1N31A

Structure of a catalytically inactive mutant (k223a) of c-des with a substrate (cystine) linked to the co-factor
Total Genus 131
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
131
sequence length
386
structure length
386
Chain Sequence
TPDRHQFPGLANKTYFNFGGQGILPTVALEAITAMYGYLQENGPFSIAANQHIQQLIAQLRQALAETFNVDPNTITITDNVTTGCDIVLWGLDWHQGDEILLTDCEHPGIIAIVQAIAARFGITYRFFPVAATLNQGDAAAVLANHLGPKTRLVILSHLLWNTGQVLPLAEIMAVCRRHQGNYPVRVLVDGAQSAGSLPLDFSRLEVDYYAFTGHAWFAGPAGVGGLYIHGDCLGEINPTYVGWRSITYGAKGEPTGWAEGGKRFEVATSAYPQYAGLLAALQLHQRQGTAEERYQAICQRSEFLWRGLNQLPHVHCLATSAPQAGLVSFTVDSPLGHRAIVQKLEEQRIYLRTIADPDCIRACCHYITDEEEINHLLARLADFGP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords L-cysteine/cystine lyase C-DES
publication title Snapshots of the Cystine Lyase "C-DES" during Catalysis: Studies in Solution and in the Crystalline State
pubmed doi rcsb
source organism Synechocystis sp. pcc 6714
molecule tags Lyase
total genus 131
structure length 386
sequence length 386
chains with identical sequence B
ec nomenclature ec 4.4.1.-:
pdb deposition date 2002-10-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00266 Aminotran_5 Aminotransferase class-V
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.640.10 Alpha Beta 3-Layer(aba) Sandwich Aspartate Aminotransferase; domain 2 Type I PLP-dependent aspartate aminotransferase-like (Major domain) 1n31A02
3.90.1150.10 Alpha Beta Alpha-Beta Complex Aspartate Aminotransferase, domain 1 Aspartate Aminotransferase, domain 1 1n31A01
2E54A 2VIBA 2BI5A 1W23A 3M5UA 1WYVA 2WK7A 4RKDA 1VP4A 1BJOA 1MDZA 1IVRA 4PFNA 5EIGA 4ADCA 3BWNA 3WCNA 4JEVA 2ZY2A 1IUGA 1ZODA 1I41A 1B4XA 3HBXA 4DBCA 3G7QA 3FZ7A 3WGCA 1V72A 2VMQA 1FG7A 3QHXA 2W7KA 1X29A 4MQQA 1BQAA 1C9CA 3FFRA 2PB2A 4LNJA 5BJ3A 4H51A 3FSLA 4IY7A 3T32A 1AX4A 1JS6A 3NX3A 5FT6A 1O69A 2EGYA 2ZSMA 1S08A 3VOMA 3WKRA 3QBOA 1OHYA 2D63A 4WYEA 3DODA 3BB8A 3EIAA 4ZASA 4EFFA 2VMPA 5E3KA 4XJLA 4XAUA 1GEYA 1SZUA 4AZKA 4IXZA 3NYUA 4ZDPA 1VJOA 2D66A 4OC9A 3RQ1A 4W8IA 2DKJA 1TPLA 2AEUA 2QLRA 1LC5A 1PFFA 4A00A 2VMVA 3MADA 4WXBA 1B9IA 3WGBA 4A6TA 1CS1A 4E77A 4ZDOA 3IF2A 1RV4A 3DXVA 1G7XA 4JF1A 4F5GA 3VK2A 4Q76A 1S09A 1SVVA 2C0RA 2CJDA 4XEWA 2AY2A 4CBRA 2XH1A 4ZDLA 1BQDA 2ZYJA 3DR7A 3HLMA 1W7LA 5LHAA 3PJ0A 4KYOA 1X28A 1ARSA 2HZPA 1FC4A 4F5HA 1QIRA 2XBNA 1CQ8A 3F6TA 3WKSA 2W7JA 3DYDA 1WYUB 3ATHA 3KGXA 1IJIA 2EO5A 3HVYA 1GCKA 2JISA 2CSTA 3FKDA 5EUNA 5M4DA 4OTLA 3RCHB 3H14A 3KGWA 4IYOB 3FDDA 1S0AA 2DGKA 3ASAA 3EI5A 3BCBA 2BHXA 2BKWA 1TARA 1X0MA 1Y4IA 2AY3A 2VGWA 3G0TA 4KAMA 3F0HA 4GEBA 3NUIA 1MLZA 2AY7A 3I16A 4CBSA 3LVMA 4F4EA 3DXWA 1MDXA 3FQAA 4OMAA 1SFFA 3AENA 2CINA 2Z9UA 4MKJA 5EUDA 1Z3ZA 2YCNA 2RFVA 3ZZKA 5EAAA 4N0WA 5G2QA 1SZSA 3AEPA 1N31A 4W1XA 1M4NA 2CJGA 1AY8A 3B1CA 3H7FA 3B1EA 1SZKA 3WX9A 4Y0IA 5G09A 1I29A 3JTXA 3EZSA 1YIZA 1LKCA 2BYLA 3EI8A 2C81A 3E77A 3JZLA 1V2FA 1W7NA 5J8QA 3UE8A 2CJHA 3NNKA 4AZJA 2W7LA 3QGUA 4W1WA 3KKIA 3HQTA 2VGVA 1UU1A 1G7WA 4TN4A 3B8XA 2VLFA 3NDNA 3AEMC 2OGEA 3F9TA 2VMYA 3ACZA 1AKCA 1B5OA 2DR1A 2GMSA 2VI9A 1M0OA 1PG8A 3MBBA 1X2AA 1ZOBA 2DGMA 2W7DA 4M2JA 4WYDA 5LH9A 1WYUA 2PO3A 3JU7A 4EMYA 3CQ5A 1GDEA 4F5IA 2BIAA 1CQ6A 2O7CA 2QMAA 2GQNA 3NU8A 2AY6A 4ZM3A 5M4BA 3AEMA 1M0NA 4IYOA 4IXOA 1AJRA 2ZP7A 4K2MA 3E6GA 2Z67A 5M46A 4RITA 1MGVA 2YOBA 1Z7DA 2AY9A 3MEBA 4JEZA 1DTYA 4K2BA 4A0GA 4WLHA 3ECDA 5G0AA 2QB2A 4ZWVA 4LNLA 2W7IA 2AY1A 2YKVA 2YHKA 5FT8A 1TOEA 3RI6A 4CXRA 1V2EA 4NOGA 2V1PA 1DKAA 2W7EA 1KL2A 4TMRA 2JJEA 4R8DA 2O0RA 2GSAA 1RV3A 3ISLA 3LG0A 3QPGA 2HOZA 4E1OA 4PIWA 4WD2A 3MC6A 2R5EA 2G6WA 2YKXA 4DGTA 1YIYA 1H0CA 7AATA 4OYTA 2VMRA 4WBTA 3TQXA 1YJSA 2JJHA 3GJUA 2ZC0A 4OBVA 3BN1A 4RLGA 1JG8A 1S07A 1QJ5A 4U1TA 5BJ4A 1N8PA 3PDBB 3FZ8A 1T3IA 4RKCA 2HUIA 4UQVA 4XJPA 2W7HA 1OXOA 3EIBA 2VLHA 3OKSA 5K8BA 3E2YA 5EAVA 4AH3A 4AO4A 2YKYA 4CXQA 4FFCA 3PDXA 2NMPA 4LC3A 1OHVA 1M0QA 1TOKA 1KKPA 2OQXA 3R9AA 1ARHA 1MAQA 3LVJA 3EI9A 1J04A 3GBXA 4P7YA 5TF5A 2Q7WA 3VK4A 2FM1A 1WKHA 2EPJA 4MGRA 4L0OA 4OBUA 2CB1A 4ZM4A 2WK8A 3EI7A 3LV2A 4M2MA 5I92A 4GE4A 3FD0A 1E5EA 4GE9A 1ASFA 4F5MA 3AATA 1IAYA 2BI3A 9AATA 4M2KA 2VYCA 3GZDC 4ZWMA 2WKAA 1AMQA 1LW4A 3A2BA 3NTJA 2CTZA 2V0YA 4PVFA 4K2IA 4ADDA 4OT8A 1ELQA 3TATA 2W8TA 4UHNA 2F8JA 3R4TA 4MQPA 3BS8A 3TFTA 5E5IA 5C6UA 1EQBA 1AHYA 1IX8A 3GZDA 5D95A 3N5MA 1ELUA 2DGLA 5FT4A 1QISA 3FRKA 1ASCA 1KKJA 4XQ2A 1G4XA 3K28A 2EZ1A 5G4IA 2HORA 3BCXA 4IW7A 4ITXA 2ZY4A 1ARTA 1QJ3A 4J8LA 1BJWA 8AATA 1GBNA 4BMKA 1TATA 4F5FA 1GEXA 4R5FA 2D5YA 4EU1A 1YJZA 3ZRQA 1M0PA 4O6ZA 4UHOA 1PMOA 3L8AA 3VP6A 2X5DA 1G4VA 1O61A 3GSBA 1OATA 4OCAA 1EG5A 3WY7A 1AMRA 3PA9A 4ADEA 3MAUA 1B9HA 4W91A 4WXFA 4BA5A 3TCMA 3FFHA 2EZ2A 5E4ZA 3AOWA 2DKBA 1XEYA 3II0A 2ZY5A 1IBJA 1WYTB 1LW5A 1MAPA 3UAKA 3P6KA 1DGDA 4A6RA 1YAAA 1CQ7A 2HP1A 4J5UA 1ASDA 4MKKA 5HXXA 4JEXA 3A9ZA 1ASNA 3QN6A 1OHWA 4GE7A 3AV7A 3A9XA 4LW4A 5M49A 2ZY3A 3ZRRA 2AY5A 4P3MA 1MDOA 1RVYA 1C0NA 4R2NA 4EB7A 4WYFA 2PB0A 2HUFA 3PAAA 3PD6B 1WSTA 2VMUA 2Z9XA 1ASLA 4Q31A 2CY8A 3EI6A 3B1DA 3AOVA 1BJ4A 3CQ4A 2Z61A 2W7GA 2FNUA 2BIGA 3AEJA 3RUYA 1P3WA 5DB5A 1CZCA 3B46A 2YCTA 2VI8A 1BS0A 1C7GA 2BI9A 2W8JA 3IHJA 4R5ZA 4BQ0A 1OXPA 1AMAA 3MKJA 5EQCA 1AHXA 3FDBA 2D7ZA 2YRIA 4XJMA 2CH1A 4DQ6A 1XI9A 1DGEA 3RCHA 2EH6A 3FTBA 4E3QA 4JF0A 4AO9A 2VGTA 3FQ8A 3NRAA 4ITGA 2BYJA 1B8GA 4IXSA 4RAEA 3MC6C 2W8VA 4BA4A 4ISYA 3JWBA 1I43A 2WK9A 2VMZA 1O62A 1AY4A 3K7YA 4ADBA 3NU7A 2JJFA 3LVKA 2CH2A 1D7SA 3QI6A 3BC8A 2W7MA 5JAYA 4FL0A 4B98A 1I48A 1BW0A 3WZFA 1AHEA 1M7YA 2VMXA 3PD6A 3WLXA 1ASMA 3RBLA 4UHMA 1AKAA 2Z1ZA 2YRRA 3A9YA 4WB0B 5D5SA 2VGZA 2VMOA 5IWQA 3A8UX 4WYGA 5G4JA 5FT5A 2JG2A 1CL2A 1D7RA 1M6SA 1RVUA 4WYCA 1C7OA 3BV0A 4F5LA 2VMSA 3DC1A 2E7UA 4TV7A 2E7JA 5DJ9A 2AEVA 2R5CB 2GMUA 3DZZA 1YOOA 2GB3A 2CANA 1ASEA 3ELPA 4Y0DA 4ATQA 1EJIA 4GSAA 2AY4A 1BJNA 4XK1A 3W1HA 4ZSWA 2Z9VA 3AEOA 3E2FA 2Z1YA 2OKKA 2VMTA 3DR4A 4AOAA 4U2HA 1SPAA 1ARGA 1TOIA 1QITA 4E3RA 1O4SA 3QM2A 3BCAA 1ASAA 1CZEA 1GEWA 1TOGA 2FQ6A 3EZ1A 3JW9A 4GRXA 1TASA 4WYAA 3ZRPA 2D64A 3P1TA 3HT4A 3E2ZB 3N0LA 3OP7A 3N75A 2BI2A 4WLJA 1D7UA 2VMWA 1IAXA 1WKGA 2VGUA 3ZZJA 5EUEA 1GC0A 3GWPA 5DJ1A 1BKGA 2QA3A 5EFSA 2JJGA 2AY8A 4WB0A 2W8UA 2HUUA 5HDMA 3COGA 2DOUA 3PDBA 4ZLVA 1JS3A 4QGRA 4XJOA 1KMKA 1KL1A 4MY5A 4F5KA 3AENB 5HHYA 1ASGA 1AAWA 2QB3A 2QBTA 2R5CA 2VGSA 1LC8A 2X8UA 3CAIA 1AHFA 3PGYA 4JEWA 1LS3A 4LNMA 4LW2A 2YCPA 3CBFA 2C7TA 4JEYA 1IX6A 1IX7A 2OKJA 2Z20A 4BHDA 1DJUA 3NUBA 4N0BA 1GC4A 3CQ6A 1DJ9A 3MAFB 4JE5A 4PFFA 4A0FA 4F5JA 1V2DA 3ELEA 4MQRA 2C44A 5F9SA 5AX8A 3GZCA 3FVXA 3PPLA 2R2NA 2X5FA 4Q6RA 4WXGA 2ORDA 1TOJA 4I8AA 2D61A 2OATA 1C4KA 1UKJA 3JWAA 1ASBA 4A0HA 1FG3A 3FVSA 3E2ZA 1CL1A 3AEJC 1GC3A 2FNIA 3LWSA 3EUCA 1MLYA 1AIBA 3FVUA 3WCOA 3NYSA 1N2TA 2FN6A 3GETA 4RJ0A 3HMUA 2BWNA 1M32A 1AJSB 3AELA 2ZUKA 3D6KA 1B5PA 3FCRA 4MSOA 4Q75A 1ZC9A 4RM1A 1AIAA 2X3LA 2BI1A 1H1CA 2TPLA 2FYFA 2BWOA 2OGAA 4RIZA 2YKUA 2O1BA 3K40A 4CVQA 3DU4A 1KMJA 3I4JA 2R0TA 3VK3A 3L44A 3BWOA 3RBFA 3UWCA 4WP0A 1W7MA 1BT4A 1DFOA 3MAFA 1ARIA 2CFBA 2D7YA 3LVLB 1WYVB 2VMNA 3Q8NA 4IX8A 3E9KA 4HF8A 1WYTA 1AKBA 4UOYA 4A6UA 1BJOB 1CJ0A 1J32A 3NYTA 5EIGB 5G2PA 1E5FA 4B9BA 1ECXA 4ZSYA 3HDOA 2D65A 1DJEA 1D7VA 1PMMA 2W8WA 3LY1A 4A72A 4KXKA 3PIUA 1QGNA 1GC2A 1AMSA 1UU0A 3FQ7A 3KE3A 1SF2A 3TFUA 4ATPA 1AAMA 1LC7A 3HL2A 2HOYA 2HP2A 4Y0HA 4HVKA 4ZAHA 1UU2A 1C7NA 1AHGA 2BIEA 2HOXA 1LK9A 1W3UA 1AJSA 3USFA 2ZJGA 3W1IA 2Z9WA 1S06A 2E7IA 2JGTA 3W1JA 2W7FA 4RJYA 4A0RA 1GD9A 1ORDA 1U08A 3DRDA 3GR9A 3G8MA 3I5TA 4W5KA 4EB5A 3FZ6A 5DX5A 5F8VA 1AICA 2AATA 1YJYA 1AY5A 3ASBA 1D2FA 3VAXA 1YNUA 2VIAA 3BWNC 2BWPA 1VEFA 1JF9A 4W1VA 2ZSLA 4JE5D 4GDYA 1QZ9A
chains in the Genus database with same CATH superfamily
2E54A 2VIBA 2BI5A 1W23A 3M5UA 1WYVA 2WK7A 4RKDA 1VP4A 1BJOA 1MDZA 1IVRA 4PFNA 5EIGA 4ADCA 2QSRA 3BWNA 3WCNA 4JEVA 2ZY2A 1IUGA 1ZODA 1I41A 1B4XA 3HBXA 4DBCA 3G7QA 3FZ7A 3WGCA 1V72A 2VMQA 1FG7A 3QHXA 2W7KA 1X29A 4MQQA 1BQAA 1C9CA 3FFRA 2PB2A 4LNJA 5BJ3A 4H51A 3FSLA 4IY7A 3T32A 1AX4A 1JS6A 3NX3A 5FT6A 1O69A 2EGYA 2ZSMA 1S08A 3VOMA 3WKRA 3QBOA 1OHYA 2D63A 4WYEA 3DODA 3BB8A 3EIAA 4ZASA 4EFFA 2VMPA 5E3KA 4XJLA 4XAUA 1GEYA 1SZUA 4AZKA 4IXZA 3NYUA 4ZDPA 1VJOA 2D66A 4OC9A 3RQ1A 4W8IA 2DKJA 1TPLA 2AEUA 2QLRA 1LC5A 1PFFA 4A00A 2VMVA 3MADA 4WXBA 1B9IA 3WGBA 4A6TA 1CS1A 4E77A 4ZDOA 3IF2A 1RV4A 3DXVA 1G7XA 4JF1A 4F5GA 3VK2A 4Q76A 1S09A 1SVVA 2C0RA 2CJDA 4XEWA 2AY2A 4CBRA 2XH1A 4ZDLA 1BQDA 2ZYJA 3DR7A 3HLMA 1W7LA 5LHAA 3PJ0A 4KYOA 1X28A 1ARSA 2HZPA 1FC4A 3N4XA 4F5HA 1QIRA 2XBNA 1CQ8A 3F6TA 3WKSA 2W7JA 3DYDA 1WYUB 3ATHA 3KGXA 1IJIA 2EO5A 3HVYA 1GCKA 2JISA 2CSTA 3FKDA 5EUNA 5M4DA 4OTLA 3RCHB 3H14A 3KGWA 4IYOB 3FDDA 1S0AA 2DGKA 3ASAA 3EI5A 3BCBA 2BHXA 2BKWA 1TARA 1X0MA 1Y4IA 2AY3A 2VGWA 3G0TA 4KAMA 3F0HA 4GEBA 3NUIA 1MLZA 2AY7A 3I16A 4CBSA 3LVMA 4F4EA 3DXWA 1MDXA 3FQAA 4OMAA 1SFFA 3AENA 2CINA 2Z9UA 4MKJA 5EUDA 1Z3ZA 2YCNA 2RFVA 3ZZKA 5EAAA 4N0WA 5G2QA 1SZSA 3AEPA 1N31A 4W1XA 1M4NA 2CJGA 1AY8A 3B1CA 3H7FA 3B1EA 1SZKA 3WX9A 4Y0IA 5G09A 1I29A 3JTXA 3EZSA 1YIZA 1LKCA 2BYLA 3EI8A 2C81A 3E77A 3JZLA 1V2FA 1W7NA 5J8QA 3UE8A 2CJHA 3NNKA 4AZJA 2W7LA 3QGUA 4W1WA 3KKIA 3HQTA 2VGVA 1UU1A 1G7WA 4TN4A 3B8XA 2VLFA 3NDNA 3AEMC 2OGEA 3F9TA 2VMYA 3ACZA 1AKCA 1B5OA 2DR1A 2GMSA 2VI9A 1M0OA 1PG8A 3MBBA 1X2AA 1ZOBA 2DGMA 2W7DA 4M2JA 4WYDA 5LH9A 1KAFA 1WYUA 2PO3A 3JU7A 4EMYA 3CQ5A 1GDEA 4F5IA 2BIAA 1CQ6A 2O7CA 2QMAA 4K05A 2GQNA 3NU8A 2AY6A 4ZM3A 5M4BA 3AEMA 1M0NA 4IYOA 4IXOA 1AJRA 2ZP7A 4K2MA 3E6GA 2Z67A 5M46A 4RITA 1MGVA 2YOBA 1Z7DA 2AY9A 3MEBA 4JEZA 1DTYA 4K2BA 4A0GA 4WLHA 3ECDA 5G0AA 2QB2A 4ZWVA 4LNLA 2W7IA 2AY1A 2YKVA 2YHKA 5FT8A 1TOEA 3RI6A 4CXRA 1V2EA 4NOGA 2V1PA 1DKAA 2W7EA 1KL2A 4TMRA 2JJEA 4R8DA 2O0RA 2GSAA 1RV3A 3ISLA 3LG0A 3QPGA 2HOZA 4E1OA 4PIWA 4WD2A 3MC6A 2R5EA 2G6WA 2YKXA 4DGTA 1YIYA 1H0CA 7AATA 4OYTA 2VMRA 4WBTA 3TQXA 1YJSA 2JJHA 3GJUA 2ZC0A 4OBVA 3BN1A 4RLGA 1JG8A 1S07A 1QJ5A 4U1TA 5BJ4A 1N8PA 3PDBB 3FZ8A 1T3IA 4RKCA 2HUIA 4UQVA 4XJPA 2W7HA 1OXOA 3EIBA 2VLHA 3OKSA 5K8BA 3E2YA 5EAVA 4AH3A 4AO4A 2YKYA 4CXQA 4FFCA 3PDXA 2NMPA 4LC3A 1OHVA 1M0QA 1TOKA 1KKPA 4H63Q 2OQXA 3R9AA 1ARHA 1MAQA 3LVJA 3EI9A 1J04A 3GBXA 4P7YA 5TF5A 2Q7WA 3VK4A 2FM1A 1WKHA 2EPJA 4MGRA 4L0OA 4OBUA 2CB1A 4ZM4A 2WK8A 3EI7A 3LV2A 4M2MA 5I92A 4GE4A 3FD0A 1E5EA 4GE9A 1ASFA 4F5MA 3AATA 1IAYA 2BI3A 9AATA 4M2KA 2VYCA 3GZDC 4ZWMA 2G7JA 2WB6A 2WKAA 1AMQA 1LW4A 3A2BA 3NTJA 2CTZA 2V0YA 4PVFA 4K2IA 4ADDA 4OT8A 1ELQA 3TATA 2W8TA 4UHNA 2F8JA 3R4TA 4MQPA 3H9XA 3BS8A 3TFTA 5E5IA 5C6UA 1EQBA 1AHYA 1IX8A 3GZDA 5D95A 3N5MA 1ELUA 2DGLA 5FT4A 1QISA 3FRKA 1ASCA 1KKJA 4XQ2A 1G4XA 3K28A 2EZ1A 5G4IA 2HORA 3BCXA 4IW7A 4ITXA 2ZY4A 1ARTA 1QJ3A 4J8LA 1BJWA 8AATA 1GBNA 4BMKA 1TATA 4F5FA 1GEXA 4R5FA 2D5YA 4EU1A 1YJZA 3ZRQA 1M0PA 4O6ZA 4UHOA 1PMOA 3L8AA 3VP6A 2X5DA 1G4VA 1O61A 3GSBA 1OATA 4OCAA 1EG5A 3WY7A 1AMRA 3PA9A 4ADEA 3MAUA 1B9HA 4W91A 4WXFA 4BA5A 3TCMA 3FFHA 2EZ2A 5E4ZA 3AOWA 2DKBA 1XEYA 3II0A 3N4SA 2ZY5A 1IBJA 1WYTB 1LW5A 1MAPA 3UAKA 3P6KA 1DGDA 4A6RA 1YAAA 1CQ7A 2HP1A 4J5UA 1ASDA 4MKKA 5HXXA 4JEXA 3A9ZA 1ASNA 3QN6A 1OHWA 4GE7A 3AV7A 3A9XA 4LW4A 5M49A 2ZY3A 3ZRRA 2AY5A 4P3MA 1MDOA 1RVYA 1C0NA 4R2NA 4EB7A 4WYFA 2PB0A 2HUFA 3PAAA 3PD6B 1WSTA 2VMUA 2Z9XA 1ASLA 4Q31A 2CY8A 3EI6A 3B1DA 3AOVA 1BJ4A 3CQ4A 2Z61A 2W7GA 2FNUA 2BIGA 3AEJA 3RUYA 1P3WA 5DB5A 1CZCA 3B46A 2YCTA 2VI8A 1BS0A 1C7GA 2BI9A 2W8JA 3IHJA 4R5ZA 4BQ0A 1OXPA 1AMAA 3MKJA 5EQCA 1AHXA 3FDBA 2D7ZA 2YRIA 4XJMA 2CH1A 4DQ6A 1XI9A 1DGEA 3RCHA 2EH6A 3FTBA 4E3QA 4JF0A 4AO9A 2VGTA 3FQ8A 3NRAA 4ITGA 2BYJA 1B8GA 4IXSA 4RAEA 3MC6C 2W8VA 4BA4A 4ISYA 3JWBA 1I43A 2WK9A 2VMZA 1O62A 1AY4A 3K7YA 4ADBA 3NU7A 2JJFA 3LVKA 2CH2A 1D7SA 3QI6A 3N7NA 3BC8A 2W7MA 5JAYA 4FL0A 4B98A 1I48A 1BW0A 3WZFA 1AHEA 2FKIA 1M7YA 2VMXA 3PD6A 3WLXA 1ASMA 3RBLA 4UHMA 1AKAA 2Z1ZA 2YRRA 3A9YA 4WB0B 5D5SA 2VGZA 2VMOA 5IWQA 3A8UX 4WYGA 5G4JA 5FT5A 2JG2A 1CL2A 1D7RA 1M6SA 1RVUA 4WYCA 1C7OA 3BV0A 4F5LA 2VMSA 3DC1A 2E7UA 4TV7A 2E7JA 5DJ9A 2KFPA 2AEVA 2R5CB 2GMUA 3DZZA 1YOOA 2GB3A 2CANA 1ASEA 3ELPA 4Y0DA 4ATQA 1EJIA 4GSAA 2AY4A 1BJNA 4XK1A 3W1HA 4ZSWA 2Z9VA 3AEOA 3E2FA 2Z1YA 2OKKA 2VMTA 3DR4A 4AOAA 4U2HA 1SPAA 1ARGA 1TOIA 1QITA 4E3RA 1O4SA 3QM2A 3BCAA 1ASAA 1CZEA 1GEWA 1TOGA 2FQ6A 3EZ1A 3JW9A 4GRXA 1TASA 4WYAA 3ZRPA 2D64A 3P1TA 3HT4A 3E2ZB 3N0LA 3OP7A 3N75A 2BI2A 4WLJA 1D7UA 2VMWA 1IAXA 1WKGA 2VGUA 3ZZJA 5EUEA 1GC0A 3GWPA 5DJ1A 1BKGA 2QA3A 5EFSA 2JJGA 2AY8A 4WB0A 2W8UA 2HUUA 5HDMA 3COGA 2DOUA 3PDBA 4ZLVA 1JS3A 4QGRA 4XJOA 1KMKA 1KL1A 4MY5A 4F5KA 3AENB 5HHYA 1ASGA 1AAWA 2QB3A 2QBTA 2R5CA 2VGSA 1LC8A 2X8UA 3CAIA 1AHFA 3PGYA 4JEWA 1LS3A 4LNMA 4LW2A 2YCPA 3CBFA 2C7TA 4JEYA 1IX6A 1IX7A 2OKJA 2Z20A 4BHDA 1DJUA 3NUBA 4N0BA 1GC4A 3CQ6A 1DJ9A 3MAFB 4JE5A 4PFFA 4A0FA 4F5JA 1V2DA 2EYQA 3ELEA 4MQRA 2C44A 5F9SA 5AX8A 3GZCA 3FVXA 3PPLA 2R2NA 2X5FA 4Q6RA 4WXGA 2ORDA 1TOJA 4I8AA 2D61A 2OATA 1C4KA 1UKJA 3JWAA 1ASBA 4A0HA 1FG3A 3FVSA 3E2ZA 1CL1A 3AEJC 1GC3A 2FNIA 3LWSA 3EUCA 1MLYA 1AIBA 3FVUA 3WCOA 3NYSA 1N2TA 2FN6A 3GETA 4RJ0A 3HMUA 2BWNA 1M32A 1AJSB 3AELA 2ZUKA 3D6KA 1B5PA 3FCRA 4MSOA 4Q75A 1ZC9A 4RM1A 1AIAA 2X3LA 2BI1A 1H1CA 2TPLA 2FYFA 2BWOA 2OGAA 4RIZA 2YKUA 2O1BA 3K40A 4CVQA 3DU4A 1KMJA 3I4JA 2R0TA 3VK3A 3L44A 3BWOA 3RBFA 3UWCA 4WP0A 1W7MA 1BT4A 1DFOA 3MAFA 1ARIA 2CFBA 2D7YA 3LVLB 2A1VA 1WYVB 2VMNA 3Q8NA 4IX8A 3E9KA 4HF8A 1WYTA 1AKBA 4UOYA 4A6UA 5KTBA 1BJOB 1CJ0A 1J32A 3NYTA 5EIGB 5G2PA 1E5FA 4B9BA 1ECXA 4ZSYA 3HDOA 2D65A 1DJEA 1D7VA 1PMMA 2W8WA 3LY1A 4A72A 4KXKA 3PIUA 1QGNA 1GC2A 1AMSA 1UU0A 3FQ7A 3KE3A 1SF2A 3TFUA 4ATPA 1AAMA 1LC7A 3HL2A 2HOYA 2HP2A 4Y0HA 4HVKA 4ZAHA 1UU2A 1C7NA 1AHGA 2BIEA 2HOXA 1LK9A 1W3UA 3N4RA 1AJSA 3USFA 2ZJGA 3W1IA 2Z9WA 1S06A 2E7IA 2JGTA 3W1JA 2W7FA 4RJYA 4A0RA 1GD9A 1ORDA 1U08A 3DRDA 3GR9A 3G8MA 3I5TA 4W5KA 4EB5A 3FZ6A 5DX5A 5F8VA 1AICA 2AATA 1YJYA 1AY5A 3ASBA 1D2FA 3VAXA 1YNUA 2VIAA 3BWNC 2BWPA 1VEFA 1JF9A 4W1VA 2ZSLA 4JE5D 4GDYA 1QZ9A
chains in the Genus database with same CATH topology
2E54A 2VIBA 2BI5A 1W23A 3M5UA 1WYVA 2WK7A 4RKDA 1VP4A 1BJOA 1MDZA 1IVRA 4PFNA 5EIGA 4ADCA 2QSRA 3BWNA 3WCNA 4JEVA 2ZY2A 1IUGA 1ZODA 1I41A 1B4XA 3HBXA 4DBCA 3G7QA 3FZ7A 3WGCA 1V72A 2VMQA 1FG7A 3QHXA 2W7KA 1X29A 4MQQA 1BQAA 1C9CA 3FFRA 2PB2A 4LNJA 5BJ3A 4H51A 3FSLA 4IY7A 3T32A 1AX4A 1JS6A 3NX3A 5FT6A 1O69A 2EGYA 2ZSMA 1S08A 3VOMA 3WKRA 3QBOA 1OHYA 2D63A 4WYEA 3DODA 3BB8A 3EIAA 4ZASA 4EFFA 2VMPA 5E3KA 4XJLA 4XAUA 1GEYA 1SZUA 4AZKA 4IXZA 3NYUA 4ZDPA 1VJOA 2D66A 4OC9A 3RQ1A 4W8IA 2DKJA 1TPLA 2AEUA 2QLRA 1LC5A 1PFFA 4A00A 2VMVA 3MADA 4WXBA 1B9IA 3WGBA 4A6TA 1CS1A 4E77A 4ZDOA 3IF2A 1RV4A 3DXVA 1G7XA 4JF1A 4F5GA 3VK2A 4Q76A 1S09A 1SVVA 2C0RA 2CJDA 4XEWA 2AY2A 4CBRA 2XH1A 4ZDLA 1BQDA 2ZYJA 3DR7A 3HLMA 1W7LA 5LHAA 3PJ0A 4KYOA 1X28A 1ARSA 2HZPA 1FC4A 3N4XA 4F5HA 1QIRA 2XBNA 1CQ8A 3F6TA 3WKSA 2W7JA 3DYDA 1WYUB 3ATHA 3KGXA 1IJIA 2EO5A 3HVYA 1GCKA 2JISA 2CSTA 3FKDA 5EUNA 5M4DA 4OTLA 3RCHB 3H14A 3KGWA 4IYOB 3FDDA 1S0AA 2DGKA 3ASAA 3EI5A 3BCBA 2BHXA 2BKWA 1TARA 1X0MA 1Y4IA 2AY3A 2VGWA 3G0TA 4KAMA 3F0HA 4GEBA 3NUIA 1MLZA 2AY7A 3I16A 4CBSA 3LVMA 4F4EA 3DXWA 1MDXA 3FQAA 4OMAA 1SFFA 3AENA 2CINA 2Z9UA 4MKJA 5EUDA 1Z3ZA 2YCNA 2RFVA 3ZZKA 5EAAA 4N0WA 5G2QA 1SZSA 3AEPA 1N31A 4W1XA 1M4NA 2CJGA 1AY8A 3B1CA 3H7FA 3B1EA 1SZKA 3WX9A 4Y0IA 5G09A 1I29A 3JTXA 3EZSA 1YIZA 1LKCA 2BYLA 3EI8A 2C81A 3E77A 3JZLA 1V2FA 1W7NA 5J8QA 3UE8A 2CJHA 3NNKA 4AZJA 2W7LA 3QGUA 4W1WA 3KKIA 3HQTA 2VGVA 1UU1A 1G7WA 4TN4A 3B8XA 2VLFA 3NDNA 3AEMC 2OGEA 3F9TA 2VMYA 3ACZA 1AKCA 1B5OA 2DR1A 2GMSA 2VI9A 1M0OA 1PG8A 3MBBA 1X2AA 1ZOBA 2DGMA 2W7DA 4M2JA 4WYDA 5LH9A 1WYUA 2PO3A 3JU7A 4EMYA 3CQ5A 1GDEA 4F5IA 2BIAA 1CQ6A 2O7CA 2QMAA 4K05A 2GQNA 3NU8A 2AY6A 4ZM3A 5M4BA 3AEMA 1M0NA 4IYOA 4IXOA 1AJRA 2ZP7A 4K2MA 3E6GA 2Z67A 5M46A 4RITA 1MGVA 2YOBA 1Z7DA 2AY9A 3MEBA 4JEZA 1DTYA 4K2BA 4A0GA 4WLHA 3ECDA 5G0AA 2QB2A 4ZWVA 4LNLA 2W7IA 2AY1A 2YKVA 2YHKA 5FT8A 1TOEA 3RI6A 4CXRA 1V2EA 4NOGA 2V1PA 1DKAA 2W7EA 1KL2A 4TMRA 2JJEA 4R8DA 2O0RA 2GSAA 1RV3A 3ISLA 3LG0A 3QPGA 2HOZA 4E1OA 4PIWA 4WD2A 3MC6A 2R5EA 2G6WA 2YKXA 4DGTA 1YIYA 1H0CA 7AATA 4OYTA 2VMRA 4WBTA 3TQXA 1YJSA 2JJHA 3GJUA 2ZC0A 4OBVA 3BN1A 4RLGA 1JG8A 1S07A 1QJ5A 4U1TA 5BJ4A 1N8PA 3PDBB 3FZ8A 1T3IA 4RKCA 2HUIA 4UQVA 4XJPA 2W7HA 1OXOA 3EIBA 2VLHA 3OKSA 5K8BA 3E2YA 5EAVA 4AH3A 4AO4A 2YKYA 4CXQA 4FFCA 3PDXA 2NMPA 4LC3A 1OHVA 1M0QA 1TOKA 1KKPA 4H63Q 2OQXA 3R9AA 1ARHA 1MAQA 3LVJA 3EI9A 1J04A 3GBXA 4P7YA 5TF5A 2Q7WA 3VK4A 2FM1A 1WKHA 2EPJA 4MGRA 4L0OA 4OBUA 2CB1A 4ZM4A 2WK8A 3EI7A 3LV2A 4M2MA 5I92A 4GE4A 3FD0A 1E5EA 4GE9A 1ASFA 4F5MA 3AATA 1IAYA 2BI3A 9AATA 4M2KA 2VYCA 3GZDC 4ZWMA 2G7JA 2WB6A 2WKAA 1AMQA 1LW4A 3A2BA 3NTJA 2CTZA 2V0YA 4PVFA 4K2IA 4ADDA 4OT8A 1ELQA 3TATA 2W8TA 4UHNA 2F8JA 3R4TA 4MQPA 3H9XA 3BS8A 3TFTA 5E5IA 5C6UA 1EQBA 1AHYA 1IX8A 3GZDA 5D95A 3N5MA 1ELUA 2DGLA 5FT4A 1QISA 3FRKA 1ASCA 1KKJA 4XQ2A 1G4XA 3K28A 2EZ1A 5G4IA 2HORA 3BCXA 4IW7A 4ITXA 2ZY4A 1ARTA 1QJ3A 4J8LA 1BJWA 8AATA 1GBNA 4BMKA 1TATA 4F5FA 1GEXA 4R5FA 2D5YA 4EU1A 1YJZA 3ZRQA 1M0PA 4O6ZA 4UHOA 1PMOA 3L8AA 3VP6A 2X5DA 1G4VA 1O61A 3GSBA 1OATA 4OCAA 1EG5A 3WY7A 1AMRA 3PA9A 4ADEA 3MAUA 1B9HA 4W91A 4WXFA 4BA5A 3TCMA 3FFHA 2EZ2A 5E4ZA 3AOWA 2DKBA 1XEYA 3II0A 3N4SA 2ZY5A 1IBJA 1WYTB 1LW5A 1MAPA 3UAKA 3P6KA 1DGDA 4A6RA 1YAAA 1CQ7A 2HP1A 4J5UA 1ASDA 4MKKA 5HXXA 4JEXA 3A9ZA 1ASNA 3QN6A 1OHWA 4GE7A 3AV7A 3A9XA 4LW4A 5M49A 2ZY3A 3ZRRA 2AY5A 4P3MA 1MDOA 1RVYA 1C0NA 4R2NA 4EB7A 4WYFA 2PB0A 2HUFA 3PAAA 3PD6B 1WSTA 2VMUA 2Z9XA 1ASLA 4Q31A 2CY8A 3EI6A 3B1DA 3AOVA 1BJ4A 3CQ4A 2Z61A 2W7GA 2FNUA 2BIGA 3AEJA 3RUYA 1P3WA 5DB5A 1CZCA 3B46A 2YCTA 2VI8A 1BS0A 1C7GA 2BI9A 2W8JA 3IHJA 4R5ZA 4BQ0A 1OXPA 1AMAA 3MKJA 5EQCA 1AHXA 3FDBA 2D7ZA 2YRIA 4XJMA 2CH1A 4DQ6A 1XI9A 1DGEA 3RCHA 2EH6A 3FTBA 4E3QA 4JF0A 4AO9A 2VGTA 3FQ8A 3NRAA 4ITGA 2BYJA 1B8GA 4IXSA 4RAEA 3MC6C 2W8VA 4BA4A 4ISYA 3JWBA 1I43A 2WK9A 2VMZA 1O62A 1AY4A 3K7YA 4ADBA 3NU7A 2JJFA 3LVKA 2CH2A 1D7SA 3QI6A 3N7NA 3BC8A 2W7MA 5JAYA 4FL0A 4B98A 1I48A 1BW0A 3WZFA 1AHEA 2FKIA 1M7YA 2VMXA 3PD6A 3WLXA 1ASMA 3RBLA 4UHMA 1AKAA 2Z1ZA 2YRRA 3A9YA 4WB0B 5D5SA 2VGZA 2VMOA 5IWQA 3A8UX 4WYGA 5G4JA 5FT5A 2JG2A 1CL2A 1D7RA 1M6SA 1RVUA 4WYCA 1C7OA 3BV0A 4F5LA 2VMSA 3DC1A 2E7UA 4TV7A 2E7JA 5DJ9A 2KFPA 2AEVA 2R5CB 2GMUA 3DZZA 1YOOA 2GB3A 2CANA 1ASEA 3ELPA 4Y0DA 4ATQA 1EJIA 4GSAA 2AY4A 1BJNA 4XK1A 3W1HA 4ZSWA 2Z9VA 3AEOA 3E2FA 2Z1YA 2OKKA 2VMTA 3DR4A 4AOAA 4U2HA 1SPAA 1ARGA 1TOIA 1QITA 4E3RA 1O4SA 3QM2A 3BCAA 1ASAA 1CZEA 1GEWA 1TOGA 2FQ6A 3EZ1A 3JW9A 4GRXA 1TASA 4WYAA 3ZRPA 2D64A 3P1TA 3HT4A 3E2ZB 3N0LA 3OP7A 3N75A 2BI2A 4WLJA 1D7UA 2VMWA 1IAXA 1WKGA 2VGUA 3ZZJA 5EUEA 1GC0A 3GWPA 5DJ1A 1BKGA 2QA3A 5EFSA 2JJGA 2AY8A 4WB0A 2W8UA 2HUUA 5HDMA 3COGA 2DOUA 3PDBA 4ZLVA 1JS3A 4QGRA 4XJOA 1KMKA 1KL1A 4MY5A 4F5KA 3AENB 5HHYA 1ASGA 1AAWA 2QB3A 2QBTA 2R5CA 2VGSA 1LC8A 2X8UA 3CAIA 1AHFA 3PGYA 4JEWA 1LS3A 4LNMA 4LW2A 2YCPA 3CBFA 2C7TA 4JEYA 1IX6A 1IX7A 2OKJA 2Z20A 4BHDA 1DJUA 3NUBA 4N0BA 1GC4A 3CQ6A 1DJ9A 3MAFB 4JE5A 4PFFA 4A0FA 4F5JA 1V2DA 2EYQA 3ELEA 4MQRA 2C44A 5F9SA 5AX8A 3GZCA 3FVXA 3PPLA 2R2NA 2X5FA 4Q6RA 4WXGA 2ORDA 1TOJA 4I8AA 2D61A 2OATA 1C4KA 1UKJA 3JWAA 1ASBA 4A0HA 1FG3A 3FVSA 3E2ZA 1CL1A 3AEJC 1GC3A 2FNIA 3LWSA 3EUCA 1MLYA 1AIBA 3FVUA 3WCOA 3NYSA 1N2TA 2FN6A 3GETA 4RJ0A 3HMUA 2BWNA 1M32A 1AJSB 3AELA 2ZUKA 3D6KA 1B5PA 3FCRA 4MSOA 4Q75A 1ZC9A 4RM1A 1AIAA 2X3LA 2BI1A 1H1CA 2TPLA 2FYFA 2BWOA 2OGAA 4RIZA 2YKUA 2O1BA 3K40A 4CVQA 3DU4A 1KMJA 3I4JA 2R0TA 3VK3A 3L44A 3BWOA 3RBFA 3UWCA 4WP0A 1W7MA 1BT4A 1DFOA 3MAFA 1ARIA 2CFBA 2D7YA 3LVLB 2A1VA 1WYVB 2VMNA 3Q8NA 4IX8A 3E9KA 4HF8A 1WYTA 1AKBA 4UOYA 4A6UA 5KTBA 1BJOB 1CJ0A 1J32A 3NYTA 5EIGB 5G2PA 1E5FA 4B9BA 1ECXA 4ZSYA 3HDOA 2D65A 1DJEA 1D7VA 1PMMA 2W8WA 3LY1A 4A72A 4KXKA 3PIUA 1QGNA 1GC2A 1AMSA 1UU0A 3FQ7A 3KE3A 1SF2A 3TFUA 4ATPA 1AAMA 1LC7A 3HL2A 2HOYA 2HP2A 4Y0HA 4HVKA 4ZAHA 1UU2A 1C7NA 1AHGA 2BIEA 2HOXA 1LK9A 1W3UA 3N4RA 1AJSA 3USFA 2ZJGA 3W1IA 2Z9WA 1S06A 2E7IA 2JGTA 3W1JA 2W7FA 4RJYA 4A0RA 1GD9A 1ORDA 1U08A 3DRDA 3GR9A 3G8MA 3I5TA 4W5KA 4EB5A 3FZ6A 5DX5A 5F8VA 1AICA 2AATA 1YJYA 1AY5A 3ASBA 1D2FA 3VAXA 1YNUA 2VIAA 3BWNC 2BWPA 1VEFA 1JF9A 4W1VA 2ZSLA 4JE5D 4GDYA 1QZ9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2E54 A;  2VIB A;  2BI5 A;  1W23 A;  3M5U A;  1WYV A;  2WK7 A;  4RKD A;  1VP4 A;  1BJO A;  1MDZ A;  1IVR A;  4PFN A;  5EIG A;  4ADC A;  3BWN A;  3WCN A;  4JEV A;  2ZY2 A;  1IUG A;  1ZOD A;  1I41 A;  1B4X A;  3HBX A;  4DBC A;  3G7Q A;  3FZ7 A;  3WGC A;  1V72 A;  2VMQ A;  1FG7 A;  3QHX A;  2W7K A;  1X29 A;  4MQQ A;  1BQA A;  1C9C A;  3FFR A;  2PB2 A;  4LNJ A;  5BJ3 A;  4H51 A;  3FSL A;  4IY7 A;  3T32 A;  1AX4 A;  1JS6 A;  3NX3 A;  5FT6 A;  1O69 A;  2EGY A;  2ZSM A;  1S08 A;  3VOM A;  3WKR A;  3QBO A;  1OHY A;  2D63 A;  4WYE A;  3DOD A;  3BB8 A;  3EIA A;  4ZAS A;  4EFF A;  2VMP A;  5E3K A;  4XJL A;  4XAU A;  1GEY A;  1SZU A;  4AZK A;  4IXZ A;  3NYU A;  4ZDP A;  1VJO A;  2D66 A;  4OC9 A;  3RQ1 A;  4W8I A;  2DKJ A;  1TPL A;  2AEU A;  2QLR A;  1LC5 A;  1PFF A;  4A00 A;  2VMV A;  3MAD A;  4WXB A;  1B9I A;  3WGB A;  4A6T A;  1CS1 A;  4E77 A;  4ZDO A;  3IF2 A;  1RV4 A;  3DXV A;  1G7X A;  4JF1 A;  4F5G A;  3VK2 A;  4Q76 A;  1S09 A;  1SVV A;  2C0R A;  2CJD A;  4XEW A;  2AY2 A;  4CBR A;  2XH1 A;  4ZDL A;  1BQD A;  2ZYJ A;  3DR7 A;  3HLM A;  1W7L A;  5LHA A;  3PJ0 A;  4KYO A;  1X28 A;  1ARS A;  2HZP A;  1FC4 A;  4F5H A;  1QIR A;  2XBN A;  1CQ8 A;  3F6T A;  3WKS A;  2W7J A;  3DYD A;  1WYU B;  3ATH A;  3KGX A;  1IJI A;  2EO5 A;  3HVY A;  1GCK A;  2JIS A;  2CST A;  3FKD A;  5EUN A;  5M4D A;  4OTL A;  3RCH B;  3H14 A;  3KGW A;  4IYO B;  3FDD A;  1S0A A;  2DGK A;  3ASA A;  3EI5 A;  3BCB A;  2BHX A;  2BKW A;  1TAR A;  1X0M A;  1Y4I A;  2AY3 A;  2VGW A;  3G0T A;  4KAM A;  3F0H A;  4GEB A;  3NUI A;  1MLZ A;  2AY7 A;  3I16 A;  4CBS A;  3LVM A;  4F4E A;  3DXW A;  1MDX A;  3FQA A;  4OMA A;  1SFF A;  3AEN A;  2CIN A;  2Z9U A;  4MKJ A;  5EUD A;  1Z3Z A;  2YCN A;  2RFV A;  3ZZK A;  5EAA A;  4N0W A;  5G2Q A;  1SZS A;  3AEP A;  1N31 A;  4W1X A;  1M4N A;  2CJG A;  1AY8 A;  3B1C A;  3H7F A;  3B1E A;  1SZK A;  3WX9 A;  4Y0I A;  5G09 A;  1I29 A;  3JTX A;  3EZS A;  1YIZ A;  1LKC A;  2BYL A;  3EI8 A;  2C81 A;  3E77 A;  3JZL A;  1V2F A;  1W7N A;  5J8Q A;  3UE8 A;  2CJH A;  3NNK A;  4AZJ A;  2W7L A;  3QGU A;  4W1W A;  3KKI A;  3HQT A;  2VGV A;  1UU1 A;  1G7W A;  4TN4 A;  3B8X A;  2VLF A;  3NDN A;  3AEM C;  2OGE A;  3F9T A;  2VMY A;  3ACZ A;  1AKC A;  1B5O A;  2DR1 A;  2GMS A;  2VI9 A;  1M0O A;  1PG8 A;  3MBB A;  1X2A A;  1ZOB A;  2DGM A;  2W7D A;  4M2J A;  4WYD A;  5LH9 A;  1WYU A;  2PO3 A;  3JU7 A;  4EMY A;  3CQ5 A;  1GDE A;  4F5I A;  2BIA A;  1CQ6 A;  2O7C A;  2QMA A;  2GQN A;  3NU8 A;  2AY6 A;  4ZM3 A;  5M4B A;  3AEM A;  1M0N A;  4IYO A;  4IXO A;  1AJR A;  2ZP7 A;  4K2M A;  3E6G A;  2Z67 A;  5M46 A;  4RIT A;  1MGV A;  2YOB A;  1Z7D A;  2AY9 A;  3MEB A;  4JEZ A;  1DTY A;  4K2B A;  4A0G A;  4WLH A;  3ECD A;  5G0A A;  2QB2 A;  4ZWV A;  4LNL A;  2W7I A;  2AY1 A;  2YKV A;  2YHK A;  5FT8 A;  1TOE A;  3RI6 A;  4CXR A;  1V2E A;  4NOG A;  2V1P A;  1DKA A;  2W7E A;  1KL2 A;  4TMR A;  2JJE A;  4R8D A;  2O0R A;  2GSA A;  1RV3 A;  3ISL A;  3LG0 A;  3QPG A;  2HOZ A;  4E1O A;  4PIW A;  4WD2 A;  3MC6 A;  2R5E A;  2G6W A;  2YKX A;  4DGT A;  1YIY A;  1H0C A;  7AAT A;  4OYT A;  2VMR A;  4WBT A;  3TQX A;  1YJS A;  2JJH A;  3GJU A;  2ZC0 A;  4OBV A;  3BN1 A;  4RLG A;  1JG8 A;  1S07 A;  1QJ5 A;  4U1T A;  5BJ4 A;  1N8P A;  3PDB B;  3FZ8 A;  1T3I A;  4RKC A;  2HUI A;  4UQV A;  4XJP A;  2W7H A;  1OXO A;  3EIB A;  2VLH A;  3OKS A;  5K8B A;  3E2Y A;  5EAV A;  4AH3 A;  4AO4 A;  2YKY A;  4CXQ A;  4FFC A;  3PDX A;  2NMP A;  4LC3 A;  1OHV A;  1M0Q A;  1TOK A;  1KKP A;  2OQX A;  3R9A A;  1ARH A;  1MAQ A;  3LVJ A;  3EI9 A;  1J04 A;  3GBX A;  4P7Y A;  5TF5 A;  2Q7W A;  3VK4 A;  2FM1 A;  1WKH A;  2EPJ A;  4MGR A;  4L0O A;  4OBU A;  2CB1 A;  4ZM4 A;  2WK8 A;  3EI7 A;  3LV2 A;  4M2M A;  5I92 A;  4GE4 A;  3FD0 A;  1E5E A;  4GE9 A;  1ASF A;  4F5M A;  3AAT A;  1IAY A;  2BI3 A;  9AAT A;  4M2K A;  2VYC A;  3GZD C;  4ZWM A;  2WKA A;  1AMQ A;  1LW4 A;  3A2B A;  3NTJ A;  2CTZ A;  2V0Y A;  4PVF A;  4K2I A;  4ADD A;  4OT8 A;  1ELQ A;  3TAT A;  2W8T A;  4UHN A;  2F8J A;  3R4T A;  4MQP A;  3BS8 A;  3TFT A;  5E5I A;  5C6U A;  1EQB A;  1AHY A;  1IX8 A;  3GZD A;  5D95 A;  3N5M A;  1ELU A;  2DGL A;  5FT4 A;  1QIS A;  3FRK A;  1ASC A;  1KKJ A;  4XQ2 A;  1G4X A;  3K28 A;  2EZ1 A;  5G4I A;  2HOR A;  3BCX A;  4IW7 A;  4ITX A;  2ZY4 A;  1ART A;  1QJ3 A;  4J8L A;  1BJW A;  8AAT A;  1GBN A;  4BMK A;  1TAT A;  4F5F A;  1GEX A;  4R5F A;  2D5Y A;  4EU1 A;  1YJZ A;  3ZRQ A;  1M0P A;  4O6Z A;  4UHO A;  1PMO A;  3L8A A;  3VP6 A;  2X5D A;  1G4V A;  1O61 A;  3GSB A;  1OAT A;  4OCA A;  1EG5 A;  3WY7 A;  1AMR A;  3PA9 A;  4ADE A;  3MAU A;  1B9H A;  4W91 A;  4WXF A;  4BA5 A;  3TCM A;  3FFH A;  2EZ2 A;  5E4Z A;  3AOW A;  2DKB A;  1XEY A;  3II0 A;  2ZY5 A;  1IBJ A;  1WYT B;  1LW5 A;  1MAP A;  3UAK A;  3P6K A;  1DGD A;  4A6R A;  1YAA A;  1CQ7 A;  2HP1 A;  4J5U A;  1ASD A;  4MKK A;  5HXX A;  4JEX A;  3A9Z A;  1ASN A;  3QN6 A;  1OHW A;  4GE7 A;  3AV7 A;  3A9X A;  4LW4 A;  5M49 A;  2ZY3 A;  3ZRR A;  2AY5 A;  4P3M A;  1MDO A;  1RVY A;  1C0N A;  4R2N A;  4EB7 A;  4WYF A;  2PB0 A;  2HUF A;  3PAA A;  3PD6 B;  1WST A;  2VMU A;  2Z9X A;  1ASL A;  4Q31 A;  2CY8 A;  3EI6 A;  3B1D A;  3AOV A;  1BJ4 A;  3CQ4 A;  2Z61 A;  2W7G A;  2FNU A;  2BIG A;  3AEJ A;  3RUY A;  1P3W A;  5DB5 A;  1CZC A;  3B46 A;  2YCT A;  2VI8 A;  1BS0 A;  1C7G A;  2BI9 A;  2W8J A;  3IHJ A;  4R5Z A;  4BQ0 A;  1OXP A;  1AMA A;  3MKJ A;  5EQC A;  1AHX A;  3FDB A;  2D7Z A;  2YRI A;  4XJM A;  2CH1 A;  4DQ6 A;  1XI9 A;  1DGE A;  3RCH A;  2EH6 A;  3FTB A;  4E3Q A;  4JF0 A;  4AO9 A;  2VGT A;  3FQ8 A;  3NRA A;  4ITG A;  2BYJ A;  1B8G A;  4IXS A;  4RAE A;  3MC6 C;  2W8V A;  4BA4 A;  4ISY A;  3JWB A;  1I43 A;  2WK9 A;  2VMZ A;  1O62 A;  1AY4 A;  3K7Y A;  4ADB A;  3NU7 A;  2JJF A;  3LVK A;  2CH2 A;  1D7S A;  3QI6 A;  3BC8 A;  2W7M A;  5JAY A;  4FL0 A;  4B98 A;  1I48 A;  1BW0 A;  3WZF A;  1AHE A;  1M7Y A;  2VMX A;  3PD6 A;  3WLX A;  1ASM A;  3RBL A;  4UHM A;  1AKA A;  2Z1Z A;  2YRR A;  3A9Y A;  4WB0 B;  5D5S A;  2VGZ A;  2VMO A;  5IWQ A;  3A8U X;  4WYG A;  5G4J A;  5FT5 A;  2JG2 A;  1CL2 A;  1D7R A;  1M6S A;  1RVU A;  4WYC A;  1C7O A;  3BV0 A;  4F5L A;  2VMS A;  3DC1 A;  2E7U A;  4TV7 A;  2E7J A;  5DJ9 A;  2AEV A;  2R5C B;  2GMU A;  3DZZ A;  1YOO A;  2GB3 A;  2CAN A;  1ASE A;  3ELP A;  4Y0D A;  4ATQ A;  1EJI A;  4GSA A;  2AY4 A;  1BJN A;  4XK1 A;  3W1H A;  4ZSW A;  2Z9V A;  3AEO A;  3E2F A;  2Z1Y A;  2OKK A;  2VMT A;  3DR4 A;  4AOA A;  4U2H A;  1SPA A;  1ARG A;  1TOI A;  1QIT A;  4E3R A;  1O4S A;  3QM2 A;  3BCA A;  1ASA A;  1CZE A;  1GEW A;  1TOG A;  2FQ6 A;  3EZ1 A;  3JW9 A;  4GRX A;  1TAS A;  4WYA A;  3ZRP A;  2D64 A;  3P1T A;  3HT4 A;  3E2Z B;  3N0L A;  3OP7 A;  3N75 A;  2BI2 A;  4WLJ A;  1D7U A;  2VMW A;  1IAX A;  1WKG A;  2VGU A;  3ZZJ A;  5EUE A;  1GC0 A;  3GWP A;  5DJ1 A;  1BKG A;  2QA3 A;  5EFS A;  2JJG A;  2AY8 A;  4WB0 A;  2W8U A;  2HUU A;  5HDM A;  3COG A;  2DOU A;  3PDB A;  4ZLV A;  1JS3 A;  4QGR A;  4XJO A;  1KMK A;  1KL1 A;  4MY5 A;  4F5K A;  3AEN B;  5HHY A;  1ASG A;  1AAW A;  2QB3 A;  2QBT A;  2R5C A;  2VGS A;  1LC8 A;  2X8U A;  3CAI A;  1AHF A;  3PGY A;  4JEW A;  1LS3 A;  4LNM A;  4LW2 A;  2YCP A;  3CBF A;  2C7T A;  4JEY A;  1IX6 A;  1IX7 A;  2OKJ A;  2Z20 A;  4BHD A;  1DJU A;  3NUB A;  4N0B A;  1GC4 A;  3CQ6 A;  1DJ9 A;  3MAF B;  4JE5 A;  4PFF A;  4A0F A;  4F5J A;  1V2D A;  3ELE A;  4MQR A;  2C44 A;  5F9S A;  5AX8 A;  3GZC A;  3FVX A;  3PPL A;  2R2N A;  2X5F A;  4Q6R A;  4WXG A;  2ORD A;  1TOJ A;  4I8A A;  2D61 A;  2OAT A;  1C4K A;  1UKJ A;  3JWA A;  1ASB A;  4A0H A;  1FG3 A;  3FVS A;  3E2Z A;  1CL1 A;  3AEJ C;  1GC3 A;  2FNI A;  3LWS A;  3EUC A;  1MLY A;  1AIB A;  3FVU A;  3WCO A;  3NYS A;  1N2T A;  2FN6 A;  3GET A;  4RJ0 A;  3HMU A;  2BWN A;  1M32 A;  1AJS B;  3AEL A;  2ZUK A;  3D6K A;  1B5P A;  3FCR A;  4MSO A;  4Q75 A;  1ZC9 A;  4RM1 A;  1AIA A;  2X3L A;  2BI1 A;  1H1C A;  2TPL A;  2FYF A;  2BWO A;  2OGA A;  4RIZ A;  2YKU A;  2O1B A;  3K40 A;  4CVQ A;  3DU4 A;  1KMJ A;  3I4J A;  2R0T A;  3VK3 A;  3L44 A;  3BWO A;  3RBF A;  3UWC A;  4WP0 A;  1W7M A;  1BT4 A;  1DFO A;  3MAF A;  1ARI A;  2CFB A;  2D7Y A;  3LVL B;  1WYV B;  2VMN A;  3Q8N A;  4IX8 A;  3E9K A;  4HF8 A;  1WYT A;  1AKB A;  4UOY A;  4A6U A;  1BJO B;  1CJ0 A;  1J32 A;  3NYT A;  5EIG B;  5G2P A;  1E5F A;  4B9B A;  1ECX A;  4ZSY A;  3HDO A;  2D65 A;  1DJE A;  1D7V A;  1PMM A;  2W8W A;  3LY1 A;  4A72 A;  4KXK A;  3PIU A;  1QGN A;  1GC2 A;  1AMS A;  1UU0 A;  3FQ7 A;  3KE3 A;  1SF2 A;  3TFU A;  4ATP A;  1AAM A;  1LC7 A;  3HL2 A;  2HOY A;  2HP2 A;  4Y0H A;  4HVK A;  4ZAH A;  1UU2 A;  1C7N A;  1AHG A;  2BIE A;  2HOX A;  1LK9 A;  1W3U A;  1AJS A;  3USF A;  2ZJG A;  3W1I A;  2Z9W A;  1S06 A;  2E7I A;  2JGT A;  3W1J A;  2W7F A;  4RJY A;  4A0R A;  1GD9 A;  1ORD A;  1U08 A;  3DRD A;  3GR9 A;  3G8M A;  3I5T A;  4W5K A;  4EB5 A;  3FZ6 A;  5DX5 A;  5F8V A;  1AIC A;  2AAT A;  1YJY A;  1AY5 A;  3ASB A;  1D2F A;  3VAX A;  1YNU A;  2VIA A;  3BWN C;  2BWP A;  1VEF A;  1JF9 A;  4W1V A;  2ZSL A;  4JE5 D;  4GDY A;  1QZ9 A; 
#chains in the Genus database with same CATH topology
 2E54 A;  2VIB A;  2BI5 A;  1W23 A;  3M5U A;  1WYV A;  2WK7 A;  4RKD A;  1VP4 A;  1BJO A;  1MDZ A;  1IVR A;  4PFN A;  5EIG A;  4ADC A;  2QSR A;  3BWN A;  3WCN A;  4JEV A;  2ZY2 A;  1IUG A;  1ZOD A;  1I41 A;  1B4X A;  3HBX A;  4DBC A;  3G7Q A;  3FZ7 A;  3WGC A;  1V72 A;  2VMQ A;  1FG7 A;  3QHX A;  2W7K A;  1X29 A;  4MQQ A;  1BQA A;  1C9C A;  3FFR A;  2PB2 A;  4LNJ A;  5BJ3 A;  4H51 A;  3FSL A;  4IY7 A;  3T32 A;  1AX4 A;  1JS6 A;  3NX3 A;  5FT6 A;  1O69 A;  2EGY A;  2ZSM A;  1S08 A;  3VOM A;  3WKR A;  3QBO A;  1OHY A;  2D63 A;  4WYE A;  3DOD A;  3BB8 A;  3EIA A;  4ZAS A;  4EFF A;  2VMP A;  5E3K A;  4XJL A;  4XAU A;  1GEY A;  1SZU A;  4AZK A;  4IXZ A;  3NYU A;  4ZDP A;  1VJO A;  2D66 A;  4OC9 A;  3RQ1 A;  4W8I A;  2DKJ A;  1TPL A;  2AEU A;  2QLR A;  1LC5 A;  1PFF A;  4A00 A;  2VMV A;  3MAD A;  4WXB A;  1B9I A;  3WGB A;  4A6T A;  1CS1 A;  4E77 A;  4ZDO A;  3IF2 A;  1RV4 A;  3DXV A;  1G7X A;  4JF1 A;  4F5G A;  3VK2 A;  4Q76 A;  1S09 A;  1SVV A;  2C0R A;  2CJD A;  4XEW A;  2AY2 A;  4CBR A;  2XH1 A;  4ZDL A;  1BQD A;  2ZYJ A;  3DR7 A;  3HLM A;  1W7L A;  5LHA A;  3PJ0 A;  4KYO A;  1X28 A;  1ARS A;  2HZP A;  1FC4 A;  3N4X A;  4F5H A;  1QIR A;  2XBN A;  1CQ8 A;  3F6T A;  3WKS A;  2W7J A;  3DYD A;  1WYU B;  3ATH A;  3KGX A;  1IJI A;  2EO5 A;  3HVY A;  1GCK A;  2JIS A;  2CST A;  3FKD A;  5EUN A;  5M4D A;  4OTL A;  3RCH B;  3H14 A;  3KGW A;  4IYO B;  3FDD A;  1S0A A;  2DGK A;  3ASA A;  3EI5 A;  3BCB A;  2BHX A;  2BKW A;  1TAR A;  1X0M A;  1Y4I A;  2AY3 A;  2VGW A;  3G0T A;  4KAM A;  3F0H A;  4GEB A;  3NUI A;  1MLZ A;  2AY7 A;  3I16 A;  4CBS A;  3LVM A;  4F4E A;  3DXW A;  1MDX A;  3FQA A;  4OMA A;  1SFF A;  3AEN A;  2CIN A;  2Z9U A;  4MKJ A;  5EUD A;  1Z3Z A;  2YCN A;  2RFV A;  3ZZK A;  5EAA A;  4N0W A;  5G2Q A;  1SZS A;  3AEP A;  1N31 A;  4W1X A;  1M4N A;  2CJG A;  1AY8 A;  3B1C A;  3H7F A;  3B1E A;  1SZK A;  3WX9 A;  4Y0I A;  5G09 A;  1I29 A;  3JTX A;  3EZS A;  1YIZ A;  1LKC A;  2BYL A;  3EI8 A;  2C81 A;  3E77 A;  3JZL A;  1V2F A;  1W7N A;  5J8Q A;  3UE8 A;  2CJH A;  3NNK A;  4AZJ A;  2W7L A;  3QGU A;  4W1W A;  3KKI A;  3HQT A;  2VGV A;  1UU1 A;  1G7W A;  4TN4 A;  3B8X A;  2VLF A;  3NDN A;  3AEM C;  2OGE A;  3F9T A;  2VMY A;  3ACZ A;  1AKC A;  1B5O A;  2DR1 A;  2GMS A;  2VI9 A;  1M0O A;  1PG8 A;  3MBB A;  1X2A A;  1ZOB A;  2DGM A;  2W7D A;  4M2J A;  4WYD A;  5LH9 A;  1KAF A;  1WYU A;  2PO3 A;  3JU7 A;  4EMY A;  3CQ5 A;  1GDE A;  4F5I A;  2BIA A;  1CQ6 A;  2O7C A;  2QMA A;  4K05 A;  2GQN A;  3NU8 A;  2AY6 A;  4ZM3 A;  5M4B A;  3AEM A;  1M0N A;  4IYO A;  4IXO A;  1AJR A;  2ZP7 A;  4K2M A;  3E6G A;  2Z67 A;  5M46 A;  4RIT A;  1MGV A;  2YOB A;  1Z7D A;  2AY9 A;  3MEB A;  4JEZ A;  1DTY A;  4K2B A;  4A0G A;  4WLH A;  3ECD A;  5G0A A;  2QB2 A;  4ZWV A;  4LNL A;  2W7I A;  2AY1 A;  2YKV A;  2YHK A;  5FT8 A;  1TOE A;  3RI6 A;  4CXR A;  1V2E A;  4NOG A;  2V1P A;  1DKA A;  2W7E A;  1KL2 A;  4TMR A;  2JJE A;  4R8D A;  2O0R A;  2GSA A;  1RV3 A;  3ISL A;  3LG0 A;  3QPG A;  2HOZ A;  4E1O A;  4PIW A;  4WD2 A;  3MC6 A;  2R5E A;  2G6W A;  2YKX A;  4DGT A;  1YIY A;  1H0C A;  7AAT A;  4OYT A;  2VMR A;  4WBT A;  3TQX A;  1YJS A;  2JJH A;  3GJU A;  2ZC0 A;  4OBV A;  3BN1 A;  4RLG A;  1JG8 A;  1S07 A;  1QJ5 A;  4U1T A;  5BJ4 A;  1N8P A;  3PDB B;  3FZ8 A;  1T3I A;  4RKC A;  2HUI A;  4UQV A;  4XJP A;  2W7H A;  1OXO A;  3EIB A;  2VLH A;  3OKS A;  5K8B A;  3E2Y A;  5EAV A;  4AH3 A;  4AO4 A;  2YKY A;  4CXQ A;  4FFC A;  3PDX A;  2NMP A;  4LC3 A;  1OHV A;  1M0Q A;  1TOK A;  1KKP A;  4H63 Q;  2OQX A;  3R9A A;  1ARH A;  1MAQ A;  3LVJ A;  3EI9 A;  1J04 A;  3GBX A;  4P7Y A;  5TF5 A;  2Q7W A;  3VK4 A;  2FM1 A;  1WKH A;  2EPJ A;  4MGR A;  4L0O A;  4OBU A;  2CB1 A;  4ZM4 A;  2WK8 A;  3EI7 A;  3LV2 A;  4M2M A;  5I92 A;  4GE4 A;  3FD0 A;  1E5E A;  4GE9 A;  1ASF A;  4F5M A;  3AAT A;  1IAY A;  2BI3 A;  9AAT A;  4M2K A;  2VYC A;  3GZD C;  4ZWM A;  2G7J A;  2WB6 A;  2WKA A;  1AMQ A;  1LW4 A;  3A2B A;  3NTJ A;  2CTZ A;  2V0Y A;  4PVF A;  4K2I A;  4ADD A;  4OT8 A;  1ELQ A;  3TAT A;  2W8T A;  4UHN A;  2F8J A;  3R4T A;  4MQP A;  3H9X A;  3BS8 A;  3TFT A;  5E5I A;  5C6U A;  1EQB A;  1AHY A;  1IX8 A;  3GZD A;  5D95 A;  3N5M A;  1ELU A;  2DGL A;  5FT4 A;  1QIS A;  3FRK A;  1ASC A;  1KKJ A;  4XQ2 A;  1G4X A;  3K28 A;  2EZ1 A;  5G4I A;  2HOR A;  3BCX A;  4IW7 A;  4ITX A;  2ZY4 A;  1ART A;  1QJ3 A;  4J8L A;  1BJW A;  8AAT A;  1GBN A;  4BMK A;  1TAT A;  4F5F A;  1GEX A;  4R5F A;  2D5Y A;  4EU1 A;  1YJZ A;  3ZRQ A;  1M0P A;  4O6Z A;  4UHO A;  1PMO A;  3L8A A;  3VP6 A;  2X5D A;  1G4V A;  1O61 A;  3GSB A;  1OAT A;  4OCA A;  1EG5 A;  3WY7 A;  1AMR A;  3PA9 A;  4ADE A;  3MAU A;  1B9H A;  4W91 A;  4WXF A;  4BA5 A;  3TCM A;  3FFH A;  2EZ2 A;  5E4Z A;  3AOW A;  2DKB A;  1XEY A;  3II0 A;  3N4S A;  2ZY5 A;  1IBJ A;  1WYT B;  1LW5 A;  1MAP A;  3UAK A;  3P6K A;  1DGD A;  4A6R A;  1YAA A;  1CQ7 A;  2HP1 A;  4J5U A;  1ASD A;  4MKK A;  5HXX A;  4JEX A;  3A9Z A;  1ASN A;  3QN6 A;  1OHW A;  4GE7 A;  3AV7 A;  3A9X A;  4LW4 A;  5M49 A;  2ZY3 A;  3ZRR A;  2AY5 A;  4P3M A;  1MDO A;  1RVY A;  1C0N A;  4R2N A;  4EB7 A;  4WYF A;  2PB0 A;  2HUF A;  3PAA A;  3PD6 B;  1WST A;  2VMU A;  2Z9X A;  1ASL A;  4Q31 A;  2CY8 A;  3EI6 A;  3B1D A;  3AOV A;  1BJ4 A;  3CQ4 A;  2Z61 A;  2W7G A;  2FNU A;  2BIG A;  3AEJ A;  3RUY A;  1P3W A;  5DB5 A;  1CZC A;  3B46 A;  2YCT A;  2VI8 A;  1BS0 A;  1C7G A;  2BI9 A;  2W8J A;  3IHJ A;  4R5Z A;  4BQ0 A;  1OXP A;  1AMA A;  3MKJ A;  5EQC A;  1AHX A;  3FDB A;  2D7Z A;  2YRI A;  4XJM A;  2CH1 A;  4DQ6 A;  1XI9 A;  1DGE A;  3RCH A;  2EH6 A;  3FTB A;  4E3Q A;  4JF0 A;  4AO9 A;  2VGT A;  3FQ8 A;  3NRA A;  4ITG A;  2BYJ A;  1B8G A;  4IXS A;  4RAE A;  3MC6 C;  2W8V A;  4BA4 A;  4ISY A;  3JWB A;  1I43 A;  2WK9 A;  2VMZ A;  1O62 A;  1AY4 A;  3K7Y A;  4ADB A;  3NU7 A;  2JJF A;  3LVK A;  2CH2 A;  1D7S A;  3QI6 A;  3N7N A;  3BC8 A;  2W7M A;  5JAY A;  4FL0 A;  4B98 A;  1I48 A;  1BW0 A;  3WZF A;  1AHE A;  2FKI A;  1M7Y A;  2VMX A;  3PD6 A;  3WLX A;  1ASM A;  3RBL A;  4UHM A;  1AKA A;  2Z1Z A;  2YRR A;  3A9Y A;  4WB0 B;  5D5S A;  2VGZ A;  2VMO A;  5IWQ A;  3A8U X;  4WYG A;  5G4J A;  5FT5 A;  2JG2 A;  1CL2 A;  1D7R A;  1M6S A;  1RVU A;  4WYC A;  1C7O A;  3BV0 A;  4F5L A;  2VMS A;  3DC1 A;  2E7U A;  4TV7 A;  2E7J A;  5DJ9 A;  2KFP A;  2AEV A;  2R5C B;  2GMU A;  3DZZ A;  1YOO A;  2GB3 A;  2CAN A;  1ASE A;  3ELP A;  4Y0D A;  4ATQ A;  1EJI A;  4GSA A;  2AY4 A;  1BJN A;  4XK1 A;  3W1H A;  4ZSW A;  2Z9V A;  3AEO A;  3E2F A;  2Z1Y A;  2OKK A;  2VMT A;  3DR4 A;  4AOA A;  4U2H A;  1SPA A;  1ARG A;  1TOI A;  1QIT A;  4E3R A;  1O4S A;  3QM2 A;  3BCA A;  1ASA A;  1CZE A;  1GEW A;  1TOG A;  2FQ6 A;  3EZ1 A;  3JW9 A;  4GRX A;  1TAS A;  4WYA A;  3ZRP A;  2D64 A;  3P1T A;  3HT4 A;  3E2Z B;  3N0L A;  3OP7 A;  3N75 A;  2BI2 A;  4WLJ A;  1D7U A;  2VMW A;  1IAX A;  1WKG A;  2VGU A;  3ZZJ A;  5EUE A;  1GC0 A;  3GWP A;  5DJ1 A;  1BKG A;  2QA3 A;  5EFS A;  2JJG A;  2AY8 A;  4WB0 A;  2W8U A;  2HUU A;  5HDM A;  3COG A;  2DOU A;  3PDB A;  4ZLV A;  1JS3 A;  4QGR A;  4XJO A;  1KMK A;  1KL1 A;  4MY5 A;  4F5K A;  3AEN B;  5HHY A;  1ASG A;  1AAW A;  2QB3 A;  2QBT A;  2R5C A;  2VGS A;  1LC8 A;  2X8U A;  3CAI A;  1AHF A;  3PGY A;  4JEW A;  1LS3 A;  4LNM A;  4LW2 A;  2YCP A;  3CBF A;  2C7T A;  4JEY A;  1IX6 A;  1IX7 A;  2OKJ A;  2Z20 A;  4BHD A;  1DJU A;  3NUB A;  4N0B A;  1GC4 A;  3CQ6 A;  1DJ9 A;  3MAF B;  4JE5 A;  4PFF A;  4A0F A;  4F5J A;  1V2D A;  2EYQ A;  3ELE A;  4MQR A;  2C44 A;  5F9S A;  5AX8 A;  3GZC A;  3FVX A;  3PPL A;  2R2N A;  2X5F A;  4Q6R A;  4WXG A;  2ORD A;  1TOJ A;  4I8A A;  2D61 A;  2OAT A;  1C4K A;  1UKJ A;  3JWA A;  1ASB A;  4A0H A;  1FG3 A;  3FVS A;  3E2Z A;  1CL1 A;  3AEJ C;  1GC3 A;  2FNI A;  3LWS A;  3EUC A;  1MLY A;  1AIB A;  3FVU A;  3WCO A;  3NYS A;  1N2T A;  2FN6 A;  3GET A;  4RJ0 A;  3HMU A;  2BWN A;  1M32 A;  1AJS B;  3AEL A;  2ZUK A;  3D6K A;  1B5P A;  3FCR A;  4MSO A;  4Q75 A;  1ZC9 A;  4RM1 A;  1AIA A;  2X3L A;  2BI1 A;  1H1C A;  2TPL A;  2FYF A;  2BWO A;  2OGA A;  4RIZ A;  2YKU A;  2O1B A;  3K40 A;  4CVQ A;  3DU4 A;  1KMJ A;  3I4J A;  2R0T A;  3VK3 A;  3L44 A;  3BWO A;  3RBF A;  3UWC A;  4WP0 A;  1W7M A;  1BT4 A;  1DFO A;  3MAF A;  1ARI A;  2CFB A;  2D7Y A;  3LVL B;  2A1V A;  1WYV B;  2VMN A;  3Q8N A;  4IX8 A;  3E9K A;  4HF8 A;  1WYT A;  1AKB A;  4UOY A;  4A6U A;  5KTB A;  1BJO B;  1CJ0 A;  1J32 A;  3NYT A;  5EIG B;  5G2P A;  1E5F A;  4B9B A;  1ECX A;  4ZSY A;  3HDO A;  2D65 A;  1DJE A;  1D7V A;  1PMM A;  2W8W A;  3LY1 A;  4A72 A;  4KXK A;  3PIU A;  1QGN A;  1GC2 A;  1AMS A;  1UU0 A;  3FQ7 A;  3KE3 A;  1SF2 A;  3TFU A;  4ATP A;  1AAM A;  1LC7 A;  3HL2 A;  2HOY A;  2HP2 A;  4Y0H A;  4HVK A;  4ZAH A;  1UU2 A;  1C7N A;  1AHG A;  2BIE A;  2HOX A;  1LK9 A;  1W3U A;  3N4R A;  1AJS A;  3USF A;  2ZJG A;  3W1I A;  2Z9W A;  1S06 A;  2E7I A;  2JGT A;  3W1J A;  2W7F A;  4RJY A;  4A0R A;  1GD9 A;  1ORD A;  1U08 A;  3DRD A;  3GR9 A;  3G8M A;  3I5T A;  4W5K A;  4EB5 A;  3FZ6 A;  5DX5 A;  5F8V A;  1AIC A;  2AAT A;  1YJY A;  1AY5 A;  3ASB A;  1D2F A;  3VAX A;  1YNU A;  2VIA A;  3BWN C;  2BWP A;  1VEF A;  1JF9 A;  4W1V A;  2ZSL A;  4JE5 D;  4GDY A;  1QZ9 A; 
#chains in the Genus database with same CATH homology
 2E54 A;  2VIB A;  2BI5 A;  1W23 A;  3M5U A;  1WYV A;  2WK7 A;  4RKD A;  1VP4 A;  1BJO A;  1MDZ A;  1IVR A;  4PFN A;  5EIG A;  4ADC A;  2QSR A;  3BWN A;  3WCN A;  4JEV A;  2ZY2 A;  1IUG A;  1ZOD A;  1I41 A;  1B4X A;  3HBX A;  4DBC A;  3G7Q A;  3FZ7 A;  3WGC A;  1V72 A;  2VMQ A;  1FG7 A;  3QHX A;  2W7K A;  1X29 A;  4MQQ A;  1BQA A;  1C9C A;  3FFR A;  2PB2 A;  4LNJ A;  5BJ3 A;  4H51 A;  3FSL A;  4IY7 A;  3T32 A;  1AX4 A;  1JS6 A;  3NX3 A;  5FT6 A;  1O69 A;  2EGY A;  2ZSM A;  1S08 A;  3VOM A;  3WKR A;  3QBO A;  1OHY A;  2D63 A;  4WYE A;  3DOD A;  3BB8 A;  3EIA A;  4ZAS A;  4EFF A;  2VMP A;  5E3K A;  4XJL A;  4XAU A;  1GEY A;  1SZU A;  4AZK A;  4IXZ A;  3NYU A;  4ZDP A;  1VJO A;  2D66 A;  4OC9 A;  3RQ1 A;  4W8I A;  2DKJ A;  1TPL A;  2AEU A;  2QLR A;  1LC5 A;  1PFF A;  4A00 A;  2VMV A;  3MAD A;  4WXB A;  1B9I A;  3WGB A;  4A6T A;  1CS1 A;  4E77 A;  4ZDO A;  3IF2 A;  1RV4 A;  3DXV A;  1G7X A;  4JF1 A;  4F5G A;  3VK2 A;  4Q76 A;  1S09 A;  1SVV A;  2C0R A;  2CJD A;  4XEW A;  2AY2 A;  4CBR A;  2XH1 A;  4ZDL A;  1BQD A;  2ZYJ A;  3DR7 A;  3HLM A;  1W7L A;  5LHA A;  3PJ0 A;  4KYO A;  1X28 A;  1ARS A;  2HZP A;  1FC4 A;  3N4X A;  4F5H A;  1QIR A;  2XBN A;  1CQ8 A;  3F6T A;  3WKS A;  2W7J A;  3DYD A;  1WYU B;  3ATH A;  3KGX A;  1IJI A;  2EO5 A;  3HVY A;  1GCK A;  2JIS A;  2CST A;  3FKD A;  5EUN A;  5M4D A;  4OTL A;  3RCH B;  3H14 A;  3KGW A;  4IYO B;  3FDD A;  1S0A A;  2DGK A;  3ASA A;  3EI5 A;  3BCB A;  2BHX A;  2BKW A;  1TAR A;  1X0M A;  1Y4I A;  2AY3 A;  2VGW A;  3G0T A;  4KAM A;  3F0H A;  4GEB A;  3NUI A;  1MLZ A;  2AY7 A;  3I16 A;  4CBS A;  3LVM A;  4F4E A;  3DXW A;  1MDX A;  3FQA A;  4OMA A;  1SFF A;  3AEN A;  2CIN A;  2Z9U A;  4MKJ A;  5EUD A;  1Z3Z A;  2YCN A;  2RFV A;  3ZZK A;  5EAA A;  4N0W A;  5G2Q A;  1SZS A;  3AEP A;  1N31 A;  4W1X A;  1M4N A;  2CJG A;  1AY8 A;  3B1C A;  3H7F A;  3B1E A;  1SZK A;  3WX9 A;  4Y0I A;  5G09 A;  1I29 A;  3JTX A;  3EZS A;  1YIZ A;  1LKC A;  2BYL A;  3EI8 A;  2C81 A;  3E77 A;  3JZL A;  1V2F A;  1W7N A;  5J8Q A;  3UE8 A;  2CJH A;  3NNK A;  4AZJ A;  2W7L A;  3QGU A;  4W1W A;  3KKI A;  3HQT A;  2VGV A;  1UU1 A;  1G7W A;  4TN4 A;  3B8X A;  2VLF A;  3NDN A;  3AEM C;  2OGE A;  3F9T A;  2VMY A;  3ACZ A;  1AKC A;  1B5O A;  2DR1 A;  2GMS A;  2VI9 A;  1M0O A;  1PG8 A;  3MBB A;  1X2A A;  1ZOB A;  2DGM A;  2W7D A;  4M2J A;  4WYD A;  5LH9 A;  1WYU A;  2PO3 A;  3JU7 A;  4EMY A;  3CQ5 A;  1GDE A;  4F5I A;  2BIA A;  1CQ6 A;  2O7C A;  2QMA A;  4K05 A;  2GQN A;  3NU8 A;  2AY6 A;  4ZM3 A;  5M4B A;  3AEM A;  1M0N A;  4IYO A;  4IXO A;  1AJR A;  2ZP7 A;  4K2M A;  3E6G A;  2Z67 A;  5M46 A;  4RIT A;  1MGV A;  2YOB A;  1Z7D A;  2AY9 A;  3MEB A;  4JEZ A;  1DTY A;  4K2B A;  4A0G A;  4WLH A;  3ECD A;  5G0A A;  2QB2 A;  4ZWV A;  4LNL A;  2W7I A;  2AY1 A;  2YKV A;  2YHK A;  5FT8 A;  1TOE A;  3RI6 A;  4CXR A;  1V2E A;  4NOG A;  2V1P A;  1DKA A;  2W7E A;  1KL2 A;  4TMR A;  2JJE A;  4R8D A;  2O0R A;  2GSA A;  1RV3 A;  3ISL A;  3LG0 A;  3QPG A;  2HOZ A;  4E1O A;  4PIW A;  4WD2 A;  3MC6 A;  2R5E A;  2G6W A;  2YKX A;  4DGT A;  1YIY A;  1H0C A;  7AAT A;  4OYT A;  2VMR A;  4WBT A;  3TQX A;  1YJS A;  2JJH A;  3GJU A;  2ZC0 A;  4OBV A;  3BN1 A;  4RLG A;  1JG8 A;  1S07 A;  1QJ5 A;  4U1T A;  5BJ4 A;  1N8P A;  3PDB B;  3FZ8 A;  1T3I A;  4RKC A;  2HUI A;  4UQV A;  4XJP A;  2W7H A;  1OXO A;  3EIB A;  2VLH A;  3OKS A;  5K8B A;  3E2Y A;  5EAV A;  4AH3 A;  4AO4 A;  2YKY A;  4CXQ A;  4FFC A;  3PDX A;  2NMP A;  4LC3 A;  1OHV A;  1M0Q A;  1TOK A;  1KKP A;  4H63 Q;  2OQX A;  3R9A A;  1ARH A;  1MAQ A;  3LVJ A;  3EI9 A;  1J04 A;  3GBX A;  4P7Y A;  5TF5 A;  2Q7W A;  3VK4 A;  2FM1 A;  1WKH A;  2EPJ A;  4MGR A;  4L0O A;  4OBU A;  2CB1 A;  4ZM4 A;  2WK8 A;  3EI7 A;  3LV2 A;  4M2M A;  5I92 A;  4GE4 A;  3FD0 A;  1E5E A;  4GE9 A;  1ASF A;  4F5M A;  3AAT A;  1IAY A;  2BI3 A;  9AAT A;  4M2K A;  2VYC A;  3GZD C;  4ZWM A;  2G7J A;  2WB6 A;  2WKA A;  1AMQ A;  1LW4 A;  3A2B A;  3NTJ A;  2CTZ A;  2V0Y A;  4PVF A;  4K2I A;  4ADD A;  4OT8 A;  1ELQ A;  3TAT A;  2W8T A;  4UHN A;  2F8J A;  3R4T A;  4MQP A;  3H9X A;  3BS8 A;  3TFT A;  5E5I A;  5C6U A;  1EQB A;  1AHY A;  1IX8 A;  3GZD A;  5D95 A;  3N5M A;  1ELU A;  2DGL A;  5FT4 A;  1QIS A;  3FRK A;  1ASC A;  1KKJ A;  4XQ2 A;  1G4X A;  3K28 A;  2EZ1 A;  5G4I A;  2HOR A;  3BCX A;  4IW7 A;  4ITX A;  2ZY4 A;  1ART A;  1QJ3 A;  4J8L A;  1BJW A;  8AAT A;  1GBN A;  4BMK A;  1TAT A;  4F5F A;  1GEX A;  4R5F A;  2D5Y A;  4EU1 A;  1YJZ A;  3ZRQ A;  1M0P A;  4O6Z A;  4UHO A;  1PMO A;  3L8A A;  3VP6 A;  2X5D A;  1G4V A;  1O61 A;  3GSB A;  1OAT A;  4OCA A;  1EG5 A;  3WY7 A;  1AMR A;  3PA9 A;  4ADE A;  3MAU A;  1B9H A;  4W91 A;  4WXF A;  4BA5 A;  3TCM A;  3FFH A;  2EZ2 A;  5E4Z A;  3AOW A;  2DKB A;  1XEY A;  3II0 A;  3N4S A;  2ZY5 A;  1IBJ A;  1WYT B;  1LW5 A;  1MAP A;  3UAK A;  3P6K A;  1DGD A;  4A6R A;  1YAA A;  1CQ7 A;  2HP1 A;  4J5U A;  1ASD A;  4MKK A;  5HXX A;  4JEX A;  3A9Z A;  1ASN A;  3QN6 A;  1OHW A;  4GE7 A;  3AV7 A;  3A9X A;  4LW4 A;  5M49 A;  2ZY3 A;  3ZRR A;  2AY5 A;  4P3M A;  1MDO A;  1RVY A;  1C0N A;  4R2N A;  4EB7 A;  4WYF A;  2PB0 A;  2HUF A;  3PAA A;  3PD6 B;  1WST A;  2VMU A;  2Z9X A;  1ASL A;  4Q31 A;  2CY8 A;  3EI6 A;  3B1D A;  3AOV A;  1BJ4 A;  3CQ4 A;  2Z61 A;  2W7G A;  2FNU A;  2BIG A;  3AEJ A;  3RUY A;  1P3W A;  5DB5 A;  1CZC A;  3B46 A;  2YCT A;  2VI8 A;  1BS0 A;  1C7G A;  2BI9 A;  2W8J A;  3IHJ A;  4R5Z A;  4BQ0 A;  1OXP A;  1AMA A;  3MKJ A;  5EQC A;  1AHX A;  3FDB A;  2D7Z A;  2YRI A;  4XJM A;  2CH1 A;  4DQ6 A;  1XI9 A;  1DGE A;  3RCH A;  2EH6 A;  3FTB A;  4E3Q A;  4JF0 A;  4AO9 A;  2VGT A;  3FQ8 A;  3NRA A;  4ITG A;  2BYJ A;  1B8G A;  4IXS A;  4RAE A;  3MC6 C;  2W8V A;  4BA4 A;  4ISY A;  3JWB A;  1I43 A;  2WK9 A;  2VMZ A;  1O62 A;  1AY4 A;  3K7Y A;  4ADB A;  3NU7 A;  2JJF A;  3LVK A;  2CH2 A;  1D7S A;  3QI6 A;  3N7N A;  3BC8 A;  2W7M A;  5JAY A;  4FL0 A;  4B98 A;  1I48 A;  1BW0 A;  3WZF A;  1AHE A;  2FKI A;  1M7Y A;  2VMX A;  3PD6 A;  3WLX A;  1ASM A;  3RBL A;  4UHM A;  1AKA A;  2Z1Z A;  2YRR A;  3A9Y A;  4WB0 B;  5D5S A;  2VGZ A;  2VMO A;  5IWQ A;  3A8U X;  4WYG A;  5G4J A;  5FT5 A;  2JG2 A;  1CL2 A;  1D7R A;  1M6S A;  1RVU A;  4WYC A;  1C7O A;  3BV0 A;  4F5L A;  2VMS A;  3DC1 A;  2E7U A;  4TV7 A;  2E7J A;  5DJ9 A;  2KFP A;  2AEV A;  2R5C B;  2GMU A;  3DZZ A;  1YOO A;  2GB3 A;  2CAN A;  1ASE A;  3ELP A;  4Y0D A;  4ATQ A;  1EJI A;  4GSA A;  2AY4 A;  1BJN A;  4XK1 A;  3W1H A;  4ZSW A;  2Z9V A;  3AEO A;  3E2F A;  2Z1Y A;  2OKK A;  2VMT A;  3DR4 A;  4AOA A;  4U2H A;  1SPA A;  1ARG A;  1TOI A;  1QIT A;  4E3R A;  1O4S A;  3QM2 A;  3BCA A;  1ASA A;  1CZE A;  1GEW A;  1TOG A;  2FQ6 A;  3EZ1 A;  3JW9 A;  4GRX A;  1TAS A;  4WYA A;  3ZRP A;  2D64 A;  3P1T A;  3HT4 A;  3E2Z B;  3N0L A;  3OP7 A;  3N75 A;  2BI2 A;  4WLJ A;  1D7U A;  2VMW A;  1IAX A;  1WKG A;  2VGU A;  3ZZJ A;  5EUE A;  1GC0 A;  3GWP A;  5DJ1 A;  1BKG A;  2QA3 A;  5EFS A;  2JJG A;  2AY8 A;  4WB0 A;  2W8U A;  2HUU A;  5HDM A;  3COG A;  2DOU A;  3PDB A;  4ZLV A;  1JS3 A;  4QGR A;  4XJO A;  1KMK A;  1KL1 A;  4MY5 A;  4F5K A;  3AEN B;  5HHY A;  1ASG A;  1AAW A;  2QB3 A;  2QBT A;  2R5C A;  2VGS A;  1LC8 A;  2X8U A;  3CAI A;  1AHF A;  3PGY A;  4JEW A;  1LS3 A;  4LNM A;  4LW2 A;  2YCP A;  3CBF A;  2C7T A;  4JEY A;  1IX6 A;  1IX7 A;  2OKJ A;  2Z20 A;  4BHD A;  1DJU A;  3NUB A;  4N0B A;  1GC4 A;  3CQ6 A;  1DJ9 A;  3MAF B;  4JE5 A;  4PFF A;  4A0F A;  4F5J A;  1V2D A;  2EYQ A;  3ELE A;  4MQR A;  2C44 A;  5F9S A;  5AX8 A;  3GZC A;  3FVX A;  3PPL A;  2R2N A;  2X5F A;  4Q6R A;  4WXG A;  2ORD A;  1TOJ A;  4I8A A;  2D61 A;  2OAT A;  1C4K A;  1UKJ A;  3JWA A;  1ASB A;  4A0H A;  1FG3 A;  3FVS A;  3E2Z A;  1CL1 A;  3AEJ C;  1GC3 A;  2FNI A;  3LWS A;  3EUC A;  1MLY A;  1AIB A;  3FVU A;  3WCO A;  3NYS A;  1N2T A;  2FN6 A;  3GET A;  4RJ0 A;  3HMU A;  2BWN A;  1M32 A;  1AJS B;  3AEL A;  2ZUK A;  3D6K A;  1B5P A;  3FCR A;  4MSO A;  4Q75 A;  1ZC9 A;  4RM1 A;  1AIA A;  2X3L A;  2BI1 A;  1H1C A;  2TPL A;  2FYF A;  2BWO A;  2OGA A;  4RIZ A;  2YKU A;  2O1B A;  3K40 A;  4CVQ A;  3DU4 A;  1KMJ A;  3I4J A;  2R0T A;  3VK3 A;  3L44 A;  3BWO A;  3RBF A;  3UWC A;  4WP0 A;  1W7M A;  1BT4 A;  1DFO A;  3MAF A;  1ARI A;  2CFB A;  2D7Y A;  3LVL B;  2A1V A;  1WYV B;  2VMN A;  3Q8N A;  4IX8 A;  3E9K A;  4HF8 A;  1WYT A;  1AKB A;  4UOY A;  4A6U A;  5KTB A;  1BJO B;  1CJ0 A;  1J32 A;  3NYT A;  5EIG B;  5G2P A;  1E5F A;  4B9B A;  1ECX A;  4ZSY A;  3HDO A;  2D65 A;  1DJE A;  1D7V A;  1PMM A;  2W8W A;  3LY1 A;  4A72 A;  4KXK A;  3PIU A;  1QGN A;  1GC2 A;  1AMS A;  1UU0 A;  3FQ7 A;  3KE3 A;  1SF2 A;  3TFU A;  4ATP A;  1AAM A;  1LC7 A;  3HL2 A;  2HOY A;  2HP2 A;  4Y0H A;  4HVK A;  4ZAH A;  1UU2 A;  1C7N A;  1AHG A;  2BIE A;  2HOX A;  1LK9 A;  1W3U A;  3N4R A;  1AJS A;  3USF A;  2ZJG A;  3W1I A;  2Z9W A;  1S06 A;  2E7I A;  2JGT A;  3W1J A;  2W7F A;  4RJY A;  4A0R A;  1GD9 A;  1ORD A;  1U08 A;  3DRD A;  3GR9 A;  3G8M A;  3I5T A;  4W5K A;  4EB5 A;  3FZ6 A;  5DX5 A;  5F8V A;  1AIC A;  2AAT A;  1YJY A;  1AY5 A;  3ASB A;  1D2F A;  3VAX A;  1YNU A;  2VIA A;  3BWN C;  2BWP A;  1VEF A;  1JF9 A;  4W1V A;  2ZSL A;  4JE5 D;  4GDY A;  1QZ9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...