1N32E

Structure of the thermus thermophilus 30s ribosomal subunit bound to codon and near-cognate transfer rna anticodon stem-loop mismatched at the first codon position at the a site with paromomycin
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
150
structure length
150
Chain Sequence
DFEEKMILIRRTARMQAGGRRFRFGALVVVGDRQGRVGLGFGKAPEVPLAVQKAGYYARRNMVEVPLQNGTIPHEIEVEFGASKIVLKPAAPGTGVIAGAVPRAILELAGVTDILTKELGSRNPINIAYATMEALRQLRTKADVERLRKG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S RIBOSOMAL RNA
publication title Selection of tRNA by the Ribosome Requires a Transition from an Open to a Closed Form
pubmed doi rcsb
molecule tags Ribosome
total genus 35
structure length 150
sequence length 150
ec nomenclature
pdb deposition date 2002-10-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00333 Ribosomal_S5 Ribosomal protein S5, N-terminal domain
E PF03719 Ribosomal_S5_C Ribosomal protein S5, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.20 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 1n32E01
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 1n32E02
4DV7I 4Z7CA 4DR4I 1N33E 2J7KA 4DR1E 2WW4A 4USKA 2LRSA 1Z59A 4KHPI 4DU8A 4DPTA 1ZBTA 2EZ6A 1FI4A 1HNZE 4GKJE 4JI7E 2LJHA 1Z0VA 4AQYE 4JI8I 4JI0E 4XTJA 1VISA 2R42A 4LF9E 4X66I 2RS6A 4LF5I 5LMNI 2V2ZA 4JI1E 5LL6R 2UUCE 4DPXA 4DU7A 2GS8A 3LTOA 2RS7A 5A2QQ 4DPYA 3V2UC 3PYGA 1N32E 4B3SE 3J7AM 4DPWA 4WUCA 1N36I 2LUPB 3GONA 4YHHE 1A6FA 4JI6E 3HULA 2L33A 1N33I 4DUZI 1EA6A 4DV5E 2NUGA 3J80C 2Q2EB 3ZKDA 1S16A 5GMDA 4LFCI 2UXBI 2EFGA 4B3MI 4HYMA 5BR8I 3PYFA 1HNWI 1J5EI 2XEXA 2HFUA 4DUYI 4DV1E 1HNZI 1NHJA 2UUAE 4GKJI 2B3TB 3J81C 4LF6I 2DEJA 4JI0I 4PU9A 4GKKE 3T1HE 2X36A 4ED4A 4K0KI 1XNRI 1N0UA 5IWAI 4DR5I 4B3TI 3B82A 1EI1A 1J26A 1N32I 4B3SI 2HKEA 1UILA 4DV3E 1KKHA 3B8HA 4HXZA 4X65I 1EKZA 4DR4E 4KHPE 3WU3A 2UXDE 4HACA 2HHHI 4USMA 4JG4A 1X48A 4JI8E 1YYWA 4X66E 5A2QC 2V2QA 4LF5E 4WUBA 5LMNE 2LJPA 1B62A 1KVKA 4WUDA 1NHHA 4M2ZA 1HNXI 1FWLA 1N36E 2UU9E 4URLA 3ADJA 4RPFA 4ZVIA 4X64I 4DV0I 2R3VA 3QT5A 3M6AA 5LMUI 4DUZE 4NXNI 4LFCE 2UXBE 4B3ME 1YYKA 2UXDI 5BR8E 2HK2A 1HNWE 4DR7E 1J5EE 1H73A 4WFTA 4DUYE 2L2KB 3ZZTA 4LF6E 1IBLI 2LTRA 4UT4A 2CPNA 1PIEA 3LPSA 4K0KE 2UUBI 1XNRE 5IWAE 4DR5E 4B3TE 1IBMI 1KTVA 2LBSB 4EMDA 3ZM7A 1NHIA 4FWHA 4Z7YA 4M30A 3J7Yp 2UU9I 2RSMA 1ZM3A 1XMQI 4X65E 2HKJA 4DKKA 1XHKA 2L2NA 2DIXA 2B7TA 3HTXA 1MU5A 3D4JA 2LTSA 1ZM2A 2JVAA 1Z5AA 2VQFI 1DARA 1T4LB 2HHHE 2E5LI 1KIJA 4DR7I 3J7AG 3QT7A 3P1XA 2BM0A 4HY1A 4PRVA 1UHZA 2YT4A 2L3CA 1BKNA 1Z0GA 1H74A 4DR2I 1I94I 1ZXMA 3WU6A 4JI3I 2N3HA 3C4TA 1HNXE 1FWKA 1RQ0A 1RC7A 4DV4I 4NXME 5FLXQ 4JI4I 1ZXNA 3F0NA 4X64E 4DV0E 4I3HA 2VQEI 1O0WA 2ZITA 5LMUE 4JV5I 4FWGA 1S4EA 3H4LA 4NXNE 3ZZUA 4JI2I 4DV2I 2ZBKB 2UXCI 4LF7I 4LF8E 2RTXA 4FN5A 1RREA 1Z5CA 2A2CA 1T4OA 1Z0EA 4LFAI 1HR0E 2ZM6I 1PKPA 1ZM4A 1IBLE 3T1YI 1XMOE 2HFSA 1H7SA 4WYQB 2BM1A 3OTOI 4DR6I 4KQVA 2UUBE 4YY3I 1IBME 1B63A 4MYTA 1RR9A 1NZ0A 4R1FA 3J80Q 4NXMI 1XMQE 1ZM9A 1FJGI 1MG7A 1WHQA 1WHNA 2V34A 2X7IA 1YYOA 1K47A 3LLHA 3PYEA 4LFBI 1XNQI 1N0VC 1IBKI 2VQFE 3ZZ0A 2E5LE 4LF8I 1U2RA 1QU6A 4OX9I 1GQEA 1HR0I 4MYUA 2NPFA 1X47A 2B7VA 1XMOI 1PVGA 3K17A 2N3GA 4DR2E 1I94E 4P52A 4JI3E 5FLXC 1DI2A 2V8PA 2HK3A 3QT8A 4DV4E 1Z0CA 2OI2A 4JI4E 2KHXA 4PRXA 2LUQA 2A2DA 2VQEE 4DV6I 2F4VI 4JV5E 1WUUA 1Z5BA 4JI2E 4JYAI 4X62I 1ELOA 4LF4I 4DV2E 2UXCE 4LF7E 2IHR1 3Q1QA 1T4NA 4HACB 4X8WA 4P7AA 3B78A 4DR3I 2MDRA 4JI5I 4LFAE 1Z0WA 2ZM6E 1N34E 3T1YE 1FKAE 5IT9Q 4M1KA 3C4BA 3OTOE 4DR6E 4DR1I 4YY3E 3JAMQ 2NUEA 3CWVA 3ZKBA 3ADIA 2AJ4A 2CZ9A 4B3RE 5CFFE 4DPUA 1FJGE 4JI7I 3ADLA 4AQYI 2NA2A 3K1JA 4LF9I 5L3JA 1QZRA 4LFBE 1XNQE 1OJ4A 4JI1I 2UUCI 1IBKE 2E1RA 3VYYA 1X49A 4FWDA 4OOGC 3PYDA 1STUA 4UTGA 2V2VA 3WU5A 4OX9E 3LNUA 3VYXA 1N34I 2DMYA 2L3JA 1D6TA 4YHHI 4DV7E 1Z0BA 3ADGA 4JI6I 2DB2A 4DV5I 2DEIA 1H7UA 3V5RA 3QT6A 1H72C 2L2MA 4DXLA 5GMEA 4B3RI 1Z0TA 4FW9A 2NUFA 4DV1I 2UUAI 1MX0A 4DV6E 2F4VE 1UEKA 2VF3A 3WU4A 4GKKI 4JYAE 4X62E 1YZ9A 1FNMA 3T1HI 2JY9A 4LF4E 3J81Q 5IT9C 4DR3E 4JI5E 4DV3I 2BV3A 3JAMC
chains in the Genus database with same CATH superfamily
4IZJB 4DV7I 4Z7CA 4DR4I 1N33E 3H1CA 2J7KA 4DR1E 5T6JA 3F6HA 2WW4A 1YUIA 2EMKA 2LRSA 4USKA 2EP3A 2LV2A 4O24A 1Z59A 4BHCA 4KHPI 2MKDA 2GPIA 2EMXA 1G2DC 4DU8A 1X6FA 4DPTA 2JOBA 1ZBTA 2A25A 2JWOA 5A69A 4KZSA 2EZ6A 2EMCA 1ZAAC 1FI4A 2B9DA 1HNZE 4GKJE 2VF1A 4JI7E 2JR1A 2LJHA 4OO1E 1Z0VA 3HPSA 4J3DA 4AQYE 1OYPA 3M99B 4JI0E 4FW3A 4NBQA 4XTJA 1VISA 2R42A 4LF9E 4JI8I 4X66I 2RS6A 1OYRA 4LF5I 5LMNI 1NEIA 2V2ZA 2EPCA 4JI1E 3EPHA 5LL6R 2UUCE 4DPXA 1A1JA 1IMUA 1ZR9A 4DU7A 2GS8A 2EPAA 2R76A 5IXMB 1UDQA 2PO2B 3LTOA 1Y5YA 2RS7A 4O5GA 5A2QQ 4M0VA 4IZKA 4AIDA 3ECRA 2NN6A 1MGTA 3V2UC 4DPYA 3PYGA 1WXRA 2C38B 4WX9A 4B3SE 1N32E 3J7AM 4P52A 4TUIA 3VHTB 4DPWA 4WUCA 4F9AB 3EPJA 1UBDC 2LUPB 3GONA 2HGHA 1N36I 4YHHE 2E72A 2YPNA 3PS2A 2PNZB 3U1KA 4IFDA 1YSAC 1A6FA 2NN6F 4ZYGA 4JI6E 2WP8A 3HULA 2L33A 4DMIA 2EM5A 4IS1C 2PNMA 3LMLA 2VESA 4LCHA 4DUZI 2BA0G 1USVA 1EA6A 4DV5E 1N33I 3J80C 2H36X 2NUGA 2Q2EB 1A1GA 2Z5CB 3ZKDA 5JEAA 1S16A 5GMDA 3AV0A 4LFCI 2VRDA 2UXBI 4MU4A 2EFGA 4B3MI 2LVHA 2D9HA 5AC4A 5K36A 1OYSA 4HYMA 2V88A 3P3EA 5BR8I 3OMLA 4IFDF 3PYFA 1HNWI 1J5EI 1T38A 2XEXA 4HEIA 3L7ZA 4GQUA 1X3CA 2HFUA 3HKMA 4DV1E 4DUYI 1NHJA 2UUAE 1HNZI 4GKJI 2EOHA 5DNYA 2B3TB 2YSPA 2ODRC 3J81C 4LF6I 2IESA 5JEAF 2DEJA 2JXPA 4JI0I 4PU9A 4BA1B 1IQOA 2YRKA 2YTJA 4GKKE 3QG5C 4BC7A 2LE2A 3KZZA 3T1HE 2NN6E 2X36A 4MLVA 2R1FA 4BBYA 4ED4A 3BF2A 4K0KI 1XNRI 4MU0A 1N0UA 5IWAI 4DR5I 4B3TI 4M9VC 2HC5A 2JE6A 3M7NG 4U3BA 5KL6A 4RH8A 3B82A 2PO1A 5K36C 5C0XD 1EI1A 3TQMA 1J26A 3RMPA 3BIDA 2BA1G 2HKEA 1UILA 4B3SI 4DV3E 1T39A 4IFDE 4ISAA 1N32I 1LLMC 4O4KA 1DGCA 1KKHA 3HPZA 2Z5EA 3B8HA 4HXZA 5ELWA 4X65I 2EMBA 1Y4SA 1EKZA 4DR4E 5JEAE 5A6BA 2GHFA 2JEBB 5K36E 4KHPE 3JTZA 3WU3A 2UXDE 4BMJA 4HACA 2EOSA 2YTQA 2WNRA 2HHHI 4USMA 4JG4A 1YH8A 2EM6A 4P7DA 1X48A 5DNLA 4JI8E 1YYWA 2EWLA 4X66E 1N3GA 2L8TA 5A2QC 1YPNA 1EH8A 4F6MA 2C37B 4LPFA 2V2QA 2DMIA 4LF5E 5LMNE 3Q6MA 4WUBA 5A6KA 4N4RB 2LJPA 4OKGA 4N3OA 2EOQA 1B62A 1KVKA 2Z5BB 4WUDA 4AIMA 2CG9A 5TSEA 1NHHA 1ZBQA 2EPNA 1G2FC 4R03A 4M2ZA 1HNXI 3P06A 4BA2A 1FWLA 1P42A 1N36E 2UU9E 2ELZA 1A1LA 4URLA 3ADJA 4RPFA 2EMFA 2IERA 3DD6A 4ZVIA 4X64I 1PJQA 4DV0I 2R3VA 3QT5A 2WP8B 3M6AA 5LMUI 4DUZE 2LMZA 2EN4A 2GQ0A 4OO1C 1UDNA 4NXNI 4LTYA 4IZJD 4LFCE 2UXBE 2EPXA 2FTXB 5AE2A 4B3ME 2F8BA 2EPZA 1YYKA 5C0XA 3M85G 2UXDI 5K36B 5BR8E 1XXEA 2HK2A 1HNWE 2DLKA 4BS9A 4DR7E 1J5EE 2J7JA 1H73A 4WFTA 4DUYE 2L2KB 2EPPA 3ZZTA 4KWYA 4LF6E 2CTDA 2EN8A 3DJWA 2KOUA 1IBLI 2LTRA 4WPYA 3EPKA 2V86A 1BBOA 3PRYA 5C0XF 4UT4A 2CPNA 2ELYA 1X5WA 1AH5A 2O1WA 5EL9A 1PIEA 4WXCA 4F2JC 2AE8A 3LPSA 4K0KE 2EOEA 2UUBI 2WZOA 1XNRE 2RQLA 5IWAE 4DR5E 4B3TE 1KJKA 2JE6B 1IBMI 2EORA 5KL2A 2EQ3A 4BHBA 1KTVA 2LBSB 2JT2A 1WJPA 3K17A 4EMDA 2EMWA 1HK7A 3ZM7A 3MHHC 3MSWA 4R2RA 2YZTA 1NHIA 4FWHA 4R2PA 4MU3A 4U3DA 4Z7YA 3AUZA 4M30A 4NZVA 3J7Yp 4R2EA 2RSMA 2WCC3 1ZM3A 1XMQI 4X65E 2HKJA 4DKKA 2UU9I 5ADZA 1XHKA 4Q35B 3GLLA 2JOXA 2K7IA 2L2NA 2DIXA 2B7TA 2EOZA 3HTXA 2YTPA 5C0XE 4BC9A 1MU5A 3D4JA 2LTSA 1ZM2A 2JVAA 2K4VA 2EMYA 2YTIA 5KL4A 1Z5AA 1YFHA 2VQFI 1DARA 1T4LB 1KYQA 3BGHA 3H09A 1MEYC 2HHHE 1KIJA 2DGCA 2NN6C 2E5LI 4DR7I 2EN7A 3J7AG 3QT7A 4Q28A 3P1XA 4WSPA 2BM0A 2EMIA 2O1VA 4BCAA 2JEAA 1X6EA 2BB8A 4HY1A 2KONA 2FV4B 2PO0A 4PRVA 3NZKA 4OO1B 1UHZA 2YT4A 2V89A 2L3CA 4IZJA 1GTKA 4IFDC 4NHRA 5AASA 1BKNA 5AC5A 4R2QA 1UDSA 3THOB 1Z0GA 2GO3A 1H74A 4DR2I 1I94I 2EMLA 1F2IG 1ZXMA 3DF6A 3WU6A 2EJ4A 4FW4A 2N3HA 3C4TA 4JI3I 2BR2B 2O1UA 5JEAC 2YTNA 3L00A 1HNXE 1FWKA 3KZYA 1RQ0A 1RC7A 4DV4I 2EN3A 2V8QB 4NXME 2EOFA 1VI7A 4LOMA 5FLXQ 4JI4I 4LU9A 1ZXNA 3JU0A 4R8OA 3F0NA 4X64E 2YTGA 4DV0E 1A1IA 3GCMA 4I3HA 4LCFA 2EQ1A 3CDJA 5DROA 2VQEI 1O0WA 3FIGA 5AE3A 2ZITA 5LMUE 4JV5I 4FWGA 1S4EA 3H4LA 4NXNE 3ZZUA 4JI2I 3KRNA 1Y4UA 2EM4A 2N8XA 2ZBKB 4DV2I 2UXCI 2L92A 4LF7I 4LF8E 2RTXA 2M1SA 4F54A 4FN5A 1RREA 4QNKA 2MC5A 2EMHA 4O43A 5DRQA 1B69A 2C38A 1Z5CA 3BBGA 2V85A 3UK3C 2A2CA 1T4OA 1Z0EA 4LFAI 2YTOA 1HR0E 2ZM6I 2I13A 1PKPA 1ZM4A 1IBLE 3T1YI 3HQ1A 2WBTA 3K6QA 3K85A 4F6NA 1XMOE 2HFSA 1RMDA 1H7SA 2PNZA 4WYQB 5LLQA 2BM1A 2WBUA 3OTOI 4DR6I 4KQVA 2UUBE 4YY3I 2Z5CA 1IBME 2LT7A 4IZKB 2HJJA 2NN6B 1B63A 1DQ3A 4R2CA 3ZOQB 2C39A 2EOXA 2FGGA 2MC6A 4MYTA 2MKNA 1RR9A 3HJCA 4P78A 3EQ1A 3IWDA 1NZ0A 2YTEA 4R1FA 3J80Q 2EM9A 4NXMI 1A1FA 1XMQE 1ZM9A 1X6HA 1MG7A 1FJGI 4IFDB 3MHSC 2ODRD 2M4IA 1WHQA 4BA1A 1WHNA 2V34A 2X7IA 1YYOA 1K47A 3LLHA 3PYEA 4LFBI 1XNQI 5JEAB 2EOYA 1N0VC 1UN6B 1IBKI 2VQFE 3ZZ0A 1L4SA 2E5LE 4LF8I 1JK2A 1QU6A 2YTDA 1U2RA 2EL5A 2MDGA 2CVEA 3L7ZB 2EOMA 5K36D 2IOPA 2EPOA 5DNXA 2BA0D 4I8OA 4FK5C 2EM2A 4R2DA 4OX9I 2EE8A 2EM0A 1GQEA 5KL5A 1HR0I 4MYUA 2NPFA 2JYAA 1X47A 2B7VA 1XMOI 1TN9A 1PVGA 1NCSA 1WRJA 4WXDA 1Y6ZA 2DLQA 2N3GA 4R2AA 4DR2E 1I94E 2DRPA 1Y60A 5FLXC 2EM8A 4JI3E 2M9AA 3P76A 2JEBA 5DRRA 1DI2A 2V8PA 2CGEA 1EH6A 2HK3A 3QT8A 2PO1B 5C0XC 4DV4E 1Z0CA 2OI2A 1YUJA 3GMEA 2EOIA 5KL7A 4JI4E 2KHXA 3VK6A 4PRXA 2LUQA 4HTGA 2V83A 1E3PA 2A2DA 3U1YA 2F1DA 4QNJA 2VQEE 1BBGA 2CT1A 2EPKX 2C37A 4DV6I 2F4VI 1UDOA 4JV5E 1TF6A 1WUUA 3M7ND 1Z5BA 4LCGA 1SR9A 4WSGA 2EMAA 2G7HA 2JPAA 4JI2E 2BA1D 4X62I 1ELOA 4JYAI 2LO3A 4FW5A 1PJTA 4DV2E 5A6BD 2UXCE 3UHMA 4LF4I 2Z5BA 4LF7E 4MDTA 5EKWA 2IHR1 3Q1QA 1T4NA 4HACB 1R6LA 2WNRB 3IWCA 2ENHA 4X8WA 4P7AA 3B78A 2ENCA 1A1HA 3P3GA 4DR3I 2MDRA 2EPLX 4JI5I 4LFAE 1Z0WA 2ZM6E 1N34E 1PJSA 5DRPA 3T1YE 2I9IA 3THNA 2EMZA 4ZYDA 1FKAE 4M1KA 5IT9Q 4MLQA 3C4BA 1A1KA 2GLIA 4L5NC 2E1MA 2RPCA 1Z1BA 2EL6A 2LCEA 2YU8A 3OTOE 4DR6E 4DR1I 2VE7C 2Q8UA 4YY3E 3PS1A 4OO1D 1TF3A 3JAMQ 4F9BB 5A6JA 2NUEA 3CWVA 4R2SA 3ZKBA 2C39B 2EQ0A 4FW7A 2YTFA 3ADIA 2AJ4A 2V87A 2CZ9A 4B3RE 5CFFE 4DPUA 1ZU1A 4BA2B 2O1TA 2BBGA 4OZEA 1FJGE 1AAYA 4JI7I 2RSIA 3P3CA 3ADLA 4AQYI 2NA2A 3K1JA 4LF9I 2EM7A 1E3HA 5L3JA 5K36F 1QZRA 4IS9A 4FW6A 4LFBE 2JP9A 1XNQE 1OJ4A 3B4TA 4JI1I 4IJDA 3HXLA 2UUCI 1IBKE 5FWKA 5AE1A 3VYYA 2PRTA 1USUA 4GZNC 2E1RA 2IOQA 2PO2A 5C0XB 1YHCA 1X49A 4FWDA 4OOGC 2J65A 2YRHA 3PYDA 1STUA 5F3WA 1GZ6A 2O3ZA 2EPUA 3IWBA 4UTGA 2GO4A 1EH7A 2ENAA 2V2VA 3C6MA 3WU5A 4OX9E 4ZYEA 3LNUA 3PS3A 3VYXA 1N34I 2DMYA 2EOOA 2L3JA 2EN6A 1JK1A 3EPLA 1D6TA 2L6MA 4TUGA 1RHYA 4YHHI 4DV7E 2EN2A 3M85D 1Z0BA 3Q6NA 3ADGA 2YRMA 4ZYHA 4MQYA 4MU1A 4JI6I 2DB2A 4GEQB 2CSHA 2EOJA 4DV5I 2NABA 2DEIA 1H7UA 3V5RA 3QT6A 1H72C 2L2MA 2WBSA 1R6MA 4DXLA 2YWQA 5GMEA 4B3RI 1Z0TA 1P47A 2NN6D 2NUFA 4FW9A 5KL3A 1PDAA 2M7QA 4DV1I 2UUAI 2EPRA 4RHBB 1MX0A 2EM3A 4DV6E 2F4VE 2ADRA 2EN1A 2YU5A 5A6AA 1UEKA 4OO1A 2PNLA 3KWRA 4J8ZA 2VF3A 4L8NA 3WU4A 4GKKI 4JYAE 4IFDD 4X62E 1YZ9A 1FNMA 3T1HI 2JY9A 3F6GA 4LF4E 3J81Q 2YSOA 2EL4A 1QNTA 1IQSA 2DSYA 4F9CB 5IT9C 2BR2A 2EMGA 1BB8A 5JEAD 3C6KA 5IV8B 4DR3E 4OO1F 4AM3A 1SFEA 3CDIA 4JI5E 2LJUA 2JEAB 4DV3I 2BV3A 2PO0B 3JAMC 2EPMX 4X9JA
chains in the Genus database with same CATH topology
4IZJB 4DV7I 4Z7CA 4DR4I 1N33E 2J7KA 4DR1E 5T6JA 3F6HA 2WW4A 4USKA 2LRSA 1Z59A 4KHPI 4DU8A 4DPTA 2JOBA 1ZBTA 2JWOA 2EZ6A 4KZSA 1FI4A 2B9DA 1HNZE 4GKJE 2VF1A 4JI7E 2JR1A 2LJHA 1Z0VA 3HPSA 4AQYE 4JI8I 4JI0E 4XTJA 1VISA 2R42A 4LF9E 4X66I 2RS6A 4LF5I 5LMNI 2V2ZA 4JI1E 5LL6R 2UUCE 4DPXA 4DU7A 2GS8A 3LTOA 2RS7A 5A2QQ 4M0VA 4IZKA 4DPYA 3V2UC 3PYGA 1WXRA 1N32E 4B3SE 3J7AM 4TUIA 4DPWA 4WUCA 4F9AB 1N36I 2LUPB 3GONA 4YHHE 1A6FA 4JI6E 3HULA 2L33A 4DMIA 2PNMA 3LMLA 1N33I 4DUZI 1USVA 1EA6A 4DV5E 3J80C 2H36X 2NUGA 2Q2EB 2Z5CB 3ZKDA 1S16A 5GMDA 3AV0A 4LFCI 2UXBI 2EFGA 4B3MI 4HYMA 2V88A 5BR8I 3OMLA 3PYFA 1HNWI 1J5EI 2XEXA 2HFUA 4DUYI 4DV1E 1HNZI 1NHJA 2UUAE 4GKJI 5DNYA 2B3TB 3J81C 2ODRC 4LF6I 2DEJA 4JI0I 4PU9A 4GKKE 4BC7A 2LE2A 3T1HE 2X36A 4BBYA 4ED4A 4K0KI 1XNRI 1N0UA 5IWAI 4DR5I 4B3TI 3B82A 1EI1A 1J26A 3RMPA 1N32I 4B3SI 2HKEA 1UILA 4DV3E 1KKHA 3HPZA 2Z5EA 3B8HA 4HXZA 4X65I 1Y4SA 1EKZA 4DR4E 4KHPE 3JTZA 3WU3A 2UXDE 4BMJA 4HACA 2HHHI 4USMA 4JG4A 4P7DA 1X48A 4JI8E 1YYWA 2EWLA 4X66E 5A2QC 2L8TA 2V2QA 4LF5E 4WUBA 5LMNE 3Q6MA 2LJPA 4N3OA 1B62A 1KVKA 2Z5BB 4WUDA 2CG9A 1NHHA 1ZBQA 4R03A 4M2ZA 1HNXI 3P06A 1FWLA 1N36E 2UU9E 4URLA 3ADJA 4RPFA 4ZVIA 4X64I 4DV0I 2R3VA 3QT5A 3M6AA 5LMUI 4DUZE 2LMZA 2GQ0A 4NXNI 4LTYA 4IZJD 4LFCE 2UXBE 2FTXB 4B3ME 5AE2A 1YYKA 2F8BA 2UXDI 5BR8E 2HK2A 1HNWE 4BS9A 4DR7E 1J5EE 1H73A 4WFTA 4DUYE 2L2KB 3ZZTA 4LF6E 3DJWA 2KOUA 1IBLI 2LTRA 4WPYA 3PRYA 2V86A 4UT4A 2CPNA 2O1WA 1PIEA 3LPSA 4K0KE 2UUBI 2WZOA 1XNRE 5IWAE 4DR5E 4B3TE 1IBMI 1KTVA 2LBSB 4EMDA 1HK7A 3ZM7A 3MSWA 2YZTA 1NHIA 4FWHA 4Z7YA 3AUZA 4M30A 3J7Yp 2UU9I 2RSMA 1ZM3A 1XMQI 4X65E 2HKJA 4DKKA 5ADZA 1XHKA 2JOXA 2L2NA 2DIXA 2B7TA 3HTXA 4BC9A 1MU5A 3D4JA 2LTSA 1ZM2A 2JVAA 2K4VA 1Z5AA 2VQFI 1DARA 1T4LB 3H09A 2HHHE 2E5LI 1KIJA 4DR7I 3J7AG 3QT7A 4Q28A 3P1XA 4WSPA 2BM0A 2O1VA 4BCAA 4HY1A 2KONA 2FV4B 4PRVA 1UHZA 2YT4A 2V89A 2L3CA 4IZJA 5AASA 1BKNA 1Z0GA 1H74A 4DR2I 1I94I 1ZXMA 3DF6A 3WU6A 4JI3I 2N3HA 3C4TA 2O1UA 1HNXE 1FWKA 1RQ0A 1RC7A 4DV4I 2V8QB 4NXME 5FLXQ 4JI4I 4LU9A 1ZXNA 3JU0A 4R8OA 3F0NA 4X64E 4DV0E 4I3HA 2VQEI 1O0WA 3FIGA 5AE3A 2ZITA 5LMUE 4JV5I 4FWGA 1S4EA 3H4LA 4NXNE 3ZZUA 4JI2I 1Y4UA 4DV2I 2ZBKB 2UXCI 2L92A 4LF7I 4LF8E 2RTXA 2M1SA 4F54A 4FN5A 1RREA 2MC5A 1Z5CA 2V85A 2A2CA 1T4OA 1Z0EA 4LFAI 1HR0E 2ZM6I 1PKPA 1ZM4A 1IBLE 3T1YI 3HQ1A 3K85A 3K6QA 1XMOE 2HFSA 1H7SA 4WYQB 2BM1A 3OTOI 4DR6I 4KQVA 2UUBE 4YY3I 2Z5CA 1IBME 4IZKB 1B63A 1DQ3A 3ZOQB 2FGGA 2MC6A 4MYTA 1RR9A 3HJCA 4P78A 3IWDA 1NZ0A 4R1FA 3J80Q 4NXMI 1XMQE 1ZM9A 1FJGI 1MG7A 2ODRD 2M4IA 1WHQA 1WHNA 2V34A 2X7IA 1YYOA 1K47A 3LLHA 3PYEA 4LFBI 1XNQI 1N0VC 1IBKI 2VQFE 3ZZ0A 2E5LE 4LF8I 1U2RA 1QU6A 2IOPA 4I8OA 4OX9I 1GQEA 1HR0I 4MYUA 2NPFA 1X47A 2B7VA 1XMOI 1PVGA 1Y6ZA 3K17A 2N3GA 4DR2E 1I94E 4P52A 5FLXC 4JI3E 1DI2A 2V8PA 2CGEA 2HK3A 3QT8A 4DV4E 1Z0CA 2OI2A 4JI4E 2KHXA 3VK6A 4PRXA 2LUQA 2V83A 2A2DA 2VQEE 4DV6I 2F4VI 4JV5E 1WUUA 1Z5BA 1SR9A 4JI2E 2G7HA 4JYAI 4X62I 1ELOA 4LF4I 4DV2E 2UXCE 2Z5BA 4LF7E 2IHR1 3Q1QA 1T4NA 4HACB 3IWCA 4X8WA 4P7AA 3B78A 4DR3I 2MDRA 4JI5I 4LFAE 1Z0WA 2ZM6E 1N34E 3T1YE 1FKAE 5IT9Q 4M1KA 3C4BA 4L5NC 2E1MA 3OTOE 4DR6E 4DR1I 2VE7C 4YY3E 3JAMQ 4F9BB 2NUEA 3CWVA 3ZKBA 3ADIA 2AJ4A 2V87A 2CZ9A 4B3RE 5CFFE 4DPUA 2O1TA 1FJGE 4JI7I 3ADLA 4AQYI 2NA2A 3K1JA 4LF9I 5L3JA 1QZRA 4LFBE 1XNQE 1OJ4A 4JI1I 2UUCI 3HXLA 1IBKE 5FWKA 5AE1A 3VYYA 1USUA 2E1RA 2IOQA 1X49A 4FWDA 4OOGC 3PYDA 1STUA 5F3WA 1GZ6A 3IWBA 4UTGA 2V2VA 3WU5A 4OX9E 3LNUA 3VYXA 1N34I 2DMYA 2L3JA 1D6TA 2L6MA 4TUGA 4YHHI 4DV7E 1Z0BA 3Q6NA 3ADGA 4JI6I 2DB2A 4GEQB 4DV5I 2DEIA 1H7UA 3V5RA 3QT6A 1H72C 2L2MA 4DXLA 5GMEA 4B3RI 1Z0TA 4FW9A 2NUFA 2M7QA 4DV1I 2UUAI 1MX0A 4DV6E 2F4VE 1UEKA 2PNLA 3KWRA 4J8ZA 2VF3A 4L8NA 3WU4A 4GKKI 4JYAE 4X62E 1YZ9A 1FNMA 3T1HI 2JY9A 3F6GA 4LF4E 3J81Q 2DSYA 4F9CB 5IT9C 4DR3E 4JI5E 4DV3I 2BV3A 3JAMC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DV7 I;  4Z7C A;  4DR4 I;  1N33 E;  2J7K A;  4DR1 E;  2WW4 A;  4USK A;  2LRS A;  1Z59 A;  4KHP I;  4DU8 A;  4DPT A;  1ZBT A;  2EZ6 A;  1FI4 A;  1HNZ E;  4GKJ E;  4JI7 E;  2LJH A;  1Z0V A;  4AQY E;  4JI8 I;  4JI0 E;  4XTJ A;  1VIS A;  2R42 A;  4LF9 E;  4X66 I;  2RS6 A;  4LF5 I;  5LMN I;  2V2Z A;  4JI1 E;  5LL6 R;  2UUC E;  4DPX A;  4DU7 A;  2GS8 A;  3LTO A;  2RS7 A;  5A2Q Q;  4DPY A;  3V2U C;  3PYG A;  1N32 E;  4B3S E;  3J7A M;  4DPW A;  4WUC A;  1N36 I;  2LUP B;  3GON A;  4YHH E;  1A6F A;  4JI6 E;  3HUL A;  2L33 A;  1N33 I;  4DUZ I;  1EA6 A;  4DV5 E;  2NUG A;  3J80 C;  2Q2E B;  3ZKD A;  1S16 A;  5GMD A;  4LFC I;  2UXB I;  2EFG A;  4B3M I;  4HYM A;  5BR8 I;  3PYF A;  1HNW I;  1J5E I;  2XEX A;  2HFU A;  4DUY I;  4DV1 E;  1HNZ I;  1NHJ A;  2UUA E;  4GKJ I;  2B3T B;  3J81 C;  4LF6 I;  2DEJ A;  4JI0 I;  4PU9 A;  4GKK E;  3T1H E;  2X36 A;  4ED4 A;  4K0K I;  1XNR I;  1N0U A;  5IWA I;  4DR5 I;  4B3T I;  3B82 A;  1EI1 A;  1J26 A;  1N32 I;  4B3S I;  2HKE A;  1UIL A;  4DV3 E;  1KKH A;  3B8H A;  4HXZ A;  4X65 I;  1EKZ A;  4DR4 E;  4KHP E;  3WU3 A;  2UXD E;  4HAC A;  2HHH I;  4USM A;  4JG4 A;  1X48 A;  4JI8 E;  1YYW A;  4X66 E;  5A2Q C;  2V2Q A;  4LF5 E;  4WUB A;  5LMN E;  2LJP A;  1B62 A;  1KVK A;  4WUD A;  1NHH A;  4M2Z A;  1HNX I;  1FWL A;  1N36 E;  2UU9 E;  4URL A;  3ADJ A;  4RPF A;  4ZVI A;  4X64 I;  4DV0 I;  2R3V A;  3QT5 A;  3M6A A;  5LMU I;  4DUZ E;  4NXN I;  4LFC E;  2UXB E;  4B3M E;  1YYK A;  2UXD I;  5BR8 E;  2HK2 A;  1HNW E;  4DR7 E;  1J5E E;  1H73 A;  4WFT A;  4DUY E;  2L2K B;  3ZZT A;  4LF6 E;  1IBL I;  2LTR A;  4UT4 A;  2CPN A;  1PIE A;  3LPS A;  4K0K E;  2UUB I;  1XNR E;  5IWA E;  4DR5 E;  4B3T E;  1IBM I;  1KTV A;  2LBS B;  4EMD A;  3ZM7 A;  1NHI A;  4FWH A;  4Z7Y A;  4M30 A;  3J7Y p;  2UU9 I;  2RSM A;  1ZM3 A;  1XMQ I;  4X65 E;  2HKJ A;  4DKK A;  1XHK A;  2L2N A;  2DIX A;  2B7T A;  3HTX A;  1MU5 A;  3D4J A;  2LTS A;  1ZM2 A;  2JVA A;  1Z5A A;  2VQF I;  1DAR A;  1T4L B;  2HHH E;  2E5L I;  1KIJ A;  4DR7 I;  3J7A G;  3QT7 A;  3P1X A;  2BM0 A;  4HY1 A;  4PRV A;  1UHZ A;  2YT4 A;  2L3C A;  1BKN A;  1Z0G A;  1H74 A;  4DR2 I;  1I94 I;  1ZXM A;  3WU6 A;  4JI3 I;  2N3H A;  3C4T A;  1HNX E;  1FWK A;  1RQ0 A;  1RC7 A;  4DV4 I;  4NXM E;  5FLX Q;  4JI4 I;  1ZXN A;  3F0N A;  4X64 E;  4DV0 E;  4I3H A;  2VQE I;  1O0W A;  2ZIT A;  5LMU E;  4JV5 I;  4FWG A;  1S4E A;  3H4L A;  4NXN E;  3ZZU A;  4JI2 I;  4DV2 I;  2ZBK B;  2UXC I;  4LF7 I;  4LF8 E;  2RTX A;  4FN5 A;  1RRE A;  1Z5C A;  2A2C A;  1T4O A;  1Z0E A;  4LFA I;  1HR0 E;  2ZM6 I;  1PKP A;  1ZM4 A;  1IBL E;  3T1Y I;  1XMO E;  2HFS A;  1H7S A;  4WYQ B;  2BM1 A;  3OTO I;  4DR6 I;  4KQV A;  2UUB E;  4YY3 I;  1IBM E;  1B63 A;  4MYT A;  1RR9 A;  1NZ0 A;  4R1F A;  3J80 Q;  4NXM I;  1XMQ E;  1ZM9 A;  1FJG I;  1MG7 A;  1WHQ A;  1WHN A;  2V34 A;  2X7I A;  1YYO A;  1K47 A;  3LLH A;  3PYE A;  4LFB I;  1XNQ I;  1N0V C;  1IBK I;  2VQF E;  3ZZ0 A;  2E5L E;  4LF8 I;  1U2R A;  1QU6 A;  4OX9 I;  1GQE A;  1HR0 I;  4MYU A;  2NPF A;  1X47 A;  2B7V A;  1XMO I;  1PVG A;  3K17 A;  2N3G A;  4DR2 E;  1I94 E;  4P52 A;  4JI3 E;  5FLX C;  1DI2 A;  2V8P A;  2HK3 A;  3QT8 A;  4DV4 E;  1Z0C A;  2OI2 A;  4JI4 E;  2KHX A;  4PRX A;  2LUQ A;  2A2D A;  2VQE E;  4DV6 I;  2F4V I;  4JV5 E;  1WUU A;  1Z5B A;  4JI2 E;  4JYA I;  4X62 I;  1ELO A;  4LF4 I;  4DV2 E;  2UXC E;  4LF7 E;  2IHR 1;  3Q1Q A;  1T4N A;  4HAC B;  4X8W A;  4P7A A;  3B78 A;  4DR3 I;  2MDR A;  4JI5 I;  4LFA E;  1Z0W A;  2ZM6 E;  1N34 E;  3T1Y E;  1FKA E;  5IT9 Q;  4M1K A;  3C4B A;  3OTO E;  4DR6 E;  4DR1 I;  4YY3 E;  3JAM Q;  2NUE A;  3CWV A;  3ZKB A;  3ADI A;  2AJ4 A;  2CZ9 A;  4B3R E;  5CFF E;  4DPU A;  1FJG E;  4JI7 I;  3ADL A;  4AQY I;  2NA2 A;  3K1J A;  4LF9 I;  5L3J A;  1QZR A;  4LFB E;  1XNQ E;  1OJ4 A;  4JI1 I;  2UUC I;  1IBK E;  2E1R A;  3VYY A;  1X49 A;  4FWD A;  4OOG C;  3PYD A;  1STU A;  4UTG A;  2V2V A;  3WU5 A;  4OX9 E;  3LNU A;  3VYX A;  1N34 I;  2DMY A;  2L3J A;  1D6T A;  4YHH I;  4DV7 E;  1Z0B A;  3ADG A;  4JI6 I;  2DB2 A;  4DV5 I;  2DEI A;  1H7U A;  3V5R A;  3QT6 A;  1H72 C;  2L2M A;  4DXL A;  5GME A;  4B3R I;  1Z0T A;  4FW9 A;  2NUF A;  4DV1 I;  2UUA I;  1MX0 A;  4DV6 E;  2F4V E;  1UEK A;  2VF3 A;  3WU4 A;  4GKK I;  4JYA E;  4X62 E;  1YZ9 A;  1FNM A;  3T1H I;  2JY9 A;  4LF4 E;  3J81 Q;  5IT9 C;  4DR3 E;  4JI5 E;  4DV3 I;  2BV3 A;  3JAM C; 
#chains in the Genus database with same CATH topology
 4IZJ B;  4DV7 I;  4Z7C A;  4DR4 I;  1N33 E;  3H1C A;  2J7K A;  4DR1 E;  5T6J A;  3F6H A;  2WW4 A;  1YUI A;  2EMK A;  2LRS A;  4USK A;  2EP3 A;  2LV2 A;  4O24 A;  1Z59 A;  4BHC A;  4KHP I;  2MKD A;  2GPI A;  2EMX A;  1G2D C;  4DU8 A;  1X6F A;  4DPT A;  2JOB A;  1ZBT A;  2A25 A;  2JWO A;  5A69 A;  4KZS A;  2EZ6 A;  2EMC A;  1ZAA C;  1FI4 A;  2B9D A;  1HNZ E;  4GKJ E;  2VF1 A;  4JI7 E;  2JR1 A;  2LJH A;  4OO1 E;  1Z0V A;  3HPS A;  4J3D A;  4AQY E;  1OYP A;  3M99 B;  4JI0 E;  4FW3 A;  4NBQ A;  4XTJ A;  1VIS A;  2R42 A;  4LF9 E;  4JI8 I;  4X66 I;  2RS6 A;  1OYR A;  4LF5 I;  5LMN I;  1NEI A;  2V2Z A;  2EPC A;  4JI1 E;  3EPH A;  5LL6 R;  2UUC E;  4DPX A;  1A1J A;  1IMU A;  1ZR9 A;  4DU7 A;  2GS8 A;  2EPA A;  2R76 A;  5IXM B;  1UDQ A;  2PO2 B;  3LTO A;  1Y5Y A;  2RS7 A;  4O5G A;  5A2Q Q;  4M0V A;  4IZK A;  4AID A;  3ECR A;  2NN6 A;  1MGT A;  3V2U C;  4DPY A;  3PYG A;  1WXR A;  2C38 B;  4WX9 A;  4B3S E;  1N32 E;  3J7A M;  4P52 A;  4TUI A;  3VHT B;  4DPW A;  4WUC A;  4F9A B;  3EPJ A;  1UBD C;  2LUP B;  3GON A;  2HGH A;  1N36 I;  4YHH E;  2E72 A;  2YPN A;  3PS2 A;  2PNZ B;  3U1K A;  4IFD A;  1YSA C;  1A6F A;  2NN6 F;  4ZYG A;  4JI6 E;  2WP8 A;  3HUL A;  2L33 A;  4DMI A;  2EM5 A;  4IS1 C;  2PNM A;  3LML A;  2VES A;  4LCH A;  4DUZ I;  2BA0 G;  1USV A;  1EA6 A;  4DV5 E;  1N33 I;  3J80 C;  2H36 X;  2NUG A;  2Q2E B;  1A1G A;  2Z5C B;  3ZKD A;  5JEA A;  1S16 A;  5GMD A;  3AV0 A;  4LFC I;  2VRD A;  2UXB I;  4MU4 A;  2EFG A;  4B3M I;  2LVH A;  2D9H A;  5AC4 A;  5K36 A;  1OYS A;  4HYM A;  2V88 A;  3P3E A;  5BR8 I;  3OML A;  4IFD F;  3PYF A;  1HNW I;  1J5E I;  1T38 A;  2XEX A;  4HEI A;  3L7Z A;  4GQU A;  1X3C A;  2HFU A;  3HKM A;  4DV1 E;  4DUY I;  1NHJ A;  2UUA E;  1HNZ I;  4GKJ I;  2EOH A;  5DNY A;  2B3T B;  2YSP A;  2ODR C;  3J81 C;  4LF6 I;  2IES A;  5JEA F;  2DEJ A;  2JXP A;  4JI0 I;  4PU9 A;  4BA1 B;  1IQO A;  2YRK A;  2YTJ A;  4GKK E;  3QG5 C;  4BC7 A;  2LE2 A;  3KZZ A;  3T1H E;  2NN6 E;  2X36 A;  4MLV A;  2R1F A;  4BBY A;  4ED4 A;  3BF2 A;  4K0K I;  1XNR I;  4MU0 A;  1N0U A;  5IWA I;  4DR5 I;  4B3T I;  4M9V C;  2HC5 A;  2JE6 A;  3M7N G;  4U3B A;  5KL6 A;  4RH8 A;  3B82 A;  2PO1 A;  5K36 C;  5C0X D;  1EI1 A;  3TQM A;  1J26 A;  3RMP A;  3BID A;  2BA1 G;  2HKE A;  1UIL A;  4B3S I;  4DV3 E;  1T39 A;  4IFD E;  4ISA A;  1N32 I;  1LLM C;  4O4K A;  1DGC A;  1KKH A;  3HPZ A;  2Z5E A;  3B8H A;  4HXZ A;  5ELW A;  4X65 I;  2EMB A;  1Y4S A;  1EKZ A;  4DR4 E;  5JEA E;  5A6B A;  2GHF A;  2JEB B;  5K36 E;  4KHP E;  3JTZ A;  3WU3 A;  2UXD E;  4BMJ A;  4HAC A;  2EOS A;  2YTQ A;  2WNR A;  2HHH I;  4USM A;  4JG4 A;  1YH8 A;  2EM6 A;  4P7D A;  1X48 A;  5DNL A;  4JI8 E;  1YYW A;  2EWL A;  4X66 E;  1N3G A;  2L8T A;  5A2Q C;  1YPN A;  1EH8 A;  4F6M A;  2C37 B;  4LPF A;  2V2Q A;  2DMI A;  4LF5 E;  5LMN E;  3Q6M A;  4WUB A;  5A6K A;  4N4R B;  2LJP A;  4OKG A;  4N3O A;  2EOQ A;  1B62 A;  1KVK A;  2Z5B B;  4WUD A;  4AIM A;  2CG9 A;  5TSE A;  1NHH A;  1ZBQ A;  2EPN A;  1G2F C;  4R03 A;  4M2Z A;  1HNX I;  3P06 A;  4BA2 A;  1FWL A;  1P42 A;  1N36 E;  2UU9 E;  2ELZ A;  1A1L A;  4URL A;  3ADJ A;  4RPF A;  2EMF A;  2IER A;  3DD6 A;  4ZVI A;  4X64 I;  1PJQ A;  4DV0 I;  2R3V A;  3QT5 A;  2WP8 B;  3M6A A;  5LMU I;  4DUZ E;  2LMZ A;  2EN4 A;  2GQ0 A;  4OO1 C;  1UDN A;  4NXN I;  4LTY A;  4IZJ D;  4LFC E;  2UXB E;  2EPX A;  2FTX B;  5AE2 A;  4B3M E;  2F8B A;  2EPZ A;  1YYK A;  5C0X A;  3M85 G;  2UXD I;  5K36 B;  5BR8 E;  1XXE A;  2HK2 A;  1HNW E;  2DLK A;  4BS9 A;  4DR7 E;  1J5E E;  2J7J A;  1H73 A;  4WFT A;  4DUY E;  2L2K B;  2EPP A;  3ZZT A;  4KWY A;  4LF6 E;  2CTD A;  2EN8 A;  3DJW A;  2KOU A;  1IBL I;  2LTR A;  4WPY A;  3EPK A;  2V86 A;  1BBO A;  3PRY A;  5C0X F;  4UT4 A;  2CPN A;  2ELY A;  1X5W A;  1AH5 A;  2O1W A;  5EL9 A;  1PIE A;  4WXC A;  4F2J C;  2AE8 A;  3LPS A;  4K0K E;  2EOE A;  2UUB I;  2WZO A;  1XNR E;  2RQL A;  5IWA E;  4DR5 E;  4B3T E;  1KJK A;  2JE6 B;  1IBM I;  2EOR A;  5KL2 A;  2EQ3 A;  4BHB A;  1KTV A;  2LBS B;  2JT2 A;  1WJP A;  3K17 A;  4EMD A;  2EMW A;  1HK7 A;  3ZM7 A;  3MHH C;  3MSW A;  4R2R A;  2YZT A;  1NHI A;  4FWH A;  4R2P A;  4MU3 A;  4U3D A;  4Z7Y A;  3AUZ A;  4M30 A;  4NZV A;  3J7Y p;  4R2E A;  2RSM A;  2WCC 3;  1ZM3 A;  1XMQ I;  4X65 E;  2HKJ A;  4DKK A;  2UU9 I;  5ADZ A;  1XHK A;  4Q35 B;  3GLL A;  2JOX A;  2K7I A;  2L2N A;  2DIX A;  2B7T A;  2EOZ A;  3HTX A;  2YTP A;  5C0X E;  4BC9 A;  1MU5 A;  3D4J A;  2LTS A;  1ZM2 A;  2JVA A;  2K4V A;  2EMY A;  2YTI A;  5KL4 A;  1Z5A A;  1YFH A;  2VQF I;  1DAR A;  1T4L B;  1KYQ A;  3BGH A;  3H09 A;  1MEY C;  2HHH E;  1KIJ A;  2DGC A;  2NN6 C;  2E5L I;  4DR7 I;  2EN7 A;  3J7A G;  3QT7 A;  4Q28 A;  3P1X A;  4WSP A;  2BM0 A;  2EMI A;  2O1V A;  4BCA A;  2JEA A;  1X6E A;  2BB8 A;  4HY1 A;  2KON A;  2FV4 B;  2PO0 A;  4PRV A;  3NZK A;  4OO1 B;  1UHZ A;  2YT4 A;  2V89 A;  2L3C A;  4IZJ A;  1GTK A;  4IFD C;  4NHR A;  5AAS A;  1BKN A;  5AC5 A;  4R2Q A;  1UDS A;  3THO B;  1Z0G A;  2GO3 A;  1H74 A;  4DR2 I;  1I94 I;  2EML A;  1F2I G;  1ZXM A;  3DF6 A;  3WU6 A;  2EJ4 A;  4FW4 A;  2N3H A;  3C4T A;  4JI3 I;  2BR2 B;  2O1U A;  5JEA C;  2YTN A;  3L00 A;  1HNX E;  1FWK A;  3KZY A;  1RQ0 A;  1RC7 A;  4DV4 I;  2EN3 A;  2V8Q B;  4NXM E;  2EOF A;  1VI7 A;  4LOM A;  5FLX Q;  4JI4 I;  4LU9 A;  1ZXN A;  3JU0 A;  4R8O A;  3F0N A;  4X64 E;  2YTG A;  4DV0 E;  1A1I A;  3GCM A;  4I3H A;  4LCF A;  2EQ1 A;  3CDJ A;  5DRO A;  2VQE I;  1O0W A;  3FIG A;  5AE3 A;  2ZIT A;  5LMU E;  4JV5 I;  4FWG A;  1S4E A;  3H4L A;  4NXN E;  3ZZU A;  4JI2 I;  3KRN A;  1Y4U A;  2EM4 A;  2N8X A;  2ZBK B;  4DV2 I;  2UXC I;  2L92 A;  4LF7 I;  4LF8 E;  2RTX A;  2M1S A;  4F54 A;  4FN5 A;  1RRE A;  4QNK A;  2MC5 A;  2EMH A;  4O43 A;  5DRQ A;  1B69 A;  2C38 A;  1Z5C A;  3BBG A;  2V85 A;  3UK3 C;  2A2C A;  1T4O A;  1Z0E A;  4LFA I;  2YTO A;  1HR0 E;  2ZM6 I;  2I13 A;  1PKP A;  1ZM4 A;  1IBL E;  3T1Y I;  3HQ1 A;  2WBT A;  3K6Q A;  3K85 A;  4F6N A;  1XMO E;  2HFS A;  1RMD A;  1H7S A;  2PNZ A;  4WYQ B;  5LLQ A;  2BM1 A;  2WBU A;  3OTO I;  4DR6 I;  4KQV A;  2UUB E;  4YY3 I;  2Z5C A;  1IBM E;  2LT7 A;  4IZK B;  2HJJ A;  2NN6 B;  1B63 A;  1DQ3 A;  4R2C A;  3ZOQ B;  2C39 A;  2EOX A;  2FGG A;  2MC6 A;  4MYT A;  2MKN A;  1RR9 A;  3HJC A;  4P78 A;  3EQ1 A;  3IWD A;  1NZ0 A;  2YTE A;  4R1F A;  3J80 Q;  2EM9 A;  4NXM I;  1A1F A;  1XMQ E;  1ZM9 A;  1X6H A;  1MG7 A;  1FJG I;  4IFD B;  3MHS C;  2ODR D;  2M4I A;  1WHQ A;  4BA1 A;  1WHN A;  2V34 A;  2X7I A;  1YYO A;  1K47 A;  3LLH A;  3PYE A;  4LFB I;  1XNQ I;  5JEA B;  2EOY A;  1N0V C;  1UN6 B;  1IBK I;  2VQF E;  3ZZ0 A;  1L4S A;  2E5L E;  4LF8 I;  1JK2 A;  1QU6 A;  2YTD A;  1U2R A;  2EL5 A;  2MDG A;  2CVE A;  3L7Z B;  2EOM A;  5K36 D;  2IOP A;  2EPO A;  5DNX A;  2BA0 D;  4I8O A;  4FK5 C;  2EM2 A;  4R2D A;  4OX9 I;  2EE8 A;  2EM0 A;  1GQE A;  5KL5 A;  1HR0 I;  4MYU A;  2NPF A;  2JYA A;  1X47 A;  2B7V A;  1XMO I;  1TN9 A;  1PVG A;  1NCS A;  1WRJ A;  4WXD A;  1Y6Z A;  2DLQ A;  2N3G A;  4R2A A;  4DR2 E;  1I94 E;  2DRP A;  1Y60 A;  5FLX C;  2EM8 A;  4JI3 E;  2M9A A;  3P76 A;  2JEB A;  5DRR A;  1DI2 A;  2V8P A;  2CGE A;  1EH6 A;  2HK3 A;  3QT8 A;  2PO1 B;  5C0X C;  4DV4 E;  1Z0C A;  2OI2 A;  1YUJ A;  3GME A;  2EOI A;  5KL7 A;  4JI4 E;  2KHX A;  3VK6 A;  4PRX A;  2LUQ A;  4HTG A;  2V83 A;  1E3P A;  2A2D A;  3U1Y A;  2F1D A;  4QNJ A;  2VQE E;  1BBG A;  2CT1 A;  2EPK X;  2C37 A;  4DV6 I;  2F4V I;  1UDO A;  4JV5 E;  1TF6 A;  1WUU A;  3M7N D;  1Z5B A;  4LCG A;  1SR9 A;  4WSG A;  2EMA A;  2G7H A;  2JPA A;  4JI2 E;  2BA1 D;  4X62 I;  1ELO A;  4JYA I;  2LO3 A;  4FW5 A;  1PJT A;  4DV2 E;  5A6B D;  2UXC E;  3UHM A;  4LF4 I;  2Z5B A;  4LF7 E;  4MDT A;  5EKW A;  2IHR 1;  3Q1Q A;  1T4N A;  4HAC B;  1R6L A;  2WNR B;  3IWC A;  2ENH A;  4X8W A;  4P7A A;  3B78 A;  2ENC A;  1A1H A;  3P3G A;  4DR3 I;  2MDR A;  2EPL X;  4JI5 I;  4LFA E;  1Z0W A;  2ZM6 E;  1N34 E;  1PJS A;  5DRP A;  3T1Y E;  2I9I A;  3THN A;  2EMZ A;  4ZYD A;  1FKA E;  4M1K A;  5IT9 Q;  4MLQ A;  3C4B A;  1A1K A;  2GLI A;  4L5N C;  2E1M A;  2RPC A;  1Z1B A;  2EL6 A;  2LCE A;  2YU8 A;  3OTO E;  4DR6 E;  4DR1 I;  2VE7 C;  2Q8U A;  4YY3 E;  3PS1 A;  4OO1 D;  1TF3 A;  3JAM Q;  4F9B B;  5A6J A;  2NUE A;  3CWV A;  4R2S A;  3ZKB A;  2C39 B;  2EQ0 A;  4FW7 A;  2YTF A;  3ADI A;  2AJ4 A;  2V87 A;  2CZ9 A;  4B3R E;  5CFF E;  4DPU A;  1ZU1 A;  4BA2 B;  2O1T A;  2BBG A;  4OZE A;  1FJG E;  1AAY A;  4JI7 I;  2RSI A;  3P3C A;  3ADL A;  4AQY I;  2NA2 A;  3K1J A;  4LF9 I;  2EM7 A;  1E3H A;  5L3J A;  5K36 F;  1QZR A;  4IS9 A;  4FW6 A;  4LFB E;  2JP9 A;  1XNQ E;  1OJ4 A;  3B4T A;  4JI1 I;  4IJD A;  3HXL A;  2UUC I;  1IBK E;  5FWK A;  5AE1 A;  3VYY A;  2PRT A;  1USU A;  4GZN C;  2E1R A;  2IOQ A;  2PO2 A;  5C0X B;  1YHC A;  1X49 A;  4FWD A;  4OOG C;  2J65 A;  2YRH A;  3PYD A;  1STU A;  5F3W A;  1GZ6 A;  2O3Z A;  2EPU A;  3IWB A;  4UTG A;  2GO4 A;  1EH7 A;  2ENA A;  2V2V A;  3C6M A;  3WU5 A;  4OX9 E;  4ZYE A;  3LNU A;  3PS3 A;  3VYX A;  1N34 I;  2DMY A;  2EOO A;  2L3J A;  2EN6 A;  1JK1 A;  3EPL A;  1D6T A;  2L6M A;  4TUG A;  1RHY A;  4YHH I;  4DV7 E;  2EN2 A;  3M85 D;  1Z0B A;  3Q6N A;  3ADG A;  2YRM A;  4ZYH A;  4MQY A;  4MU1 A;  4JI6 I;  2DB2 A;  4GEQ B;  2CSH A;  2EOJ A;  4DV5 I;  2NAB A;  2DEI A;  1H7U A;  3V5R A;  3QT6 A;  1H72 C;  2L2M A;  2WBS A;  1R6M A;  4DXL A;  2YWQ A;  5GME A;  4B3R I;  1Z0T A;  1P47 A;  2NN6 D;  2NUF A;  4FW9 A;  5KL3 A;  1PDA A;  2M7Q A;  4DV1 I;  2UUA I;  2EPR A;  4RHB B;  1MX0 A;  2EM3 A;  4DV6 E;  2F4V E;  2ADR A;  2EN1 A;  2YU5 A;  5A6A A;  1UEK A;  4OO1 A;  2PNL A;  3KWR A;  4J8Z A;  2VF3 A;  4L8N A;  3WU4 A;  4GKK I;  4JYA E;  4IFD D;  4X62 E;  1YZ9 A;  1FNM A;  3T1H I;  2JY9 A;  3F6G A;  4LF4 E;  3J81 Q;  2YSO A;  2EL4 A;  1QNT A;  1IQS A;  2DSY A;  4F9C B;  5IT9 C;  2BR2 A;  2EMG A;  1BB8 A;  5JEA D;  3C6K A;  5IV8 B;  4DR3 E;  4OO1 F;  4AM3 A;  1SFE A;  3CDI A;  4JI5 E;  2LJU A;  2JEA B;  4DV3 I;  2BV3 A;  2PO0 B;  3JAM C;  2EPM X;  4X9J A; 
#chains in the Genus database with same CATH homology
 4IZJ B;  4DV7 I;  4Z7C A;  4DR4 I;  1N33 E;  2J7K A;  4DR1 E;  5T6J A;  3F6H A;  2WW4 A;  4USK A;  2LRS A;  1Z59 A;  4KHP I;  4DU8 A;  4DPT A;  2JOB A;  1ZBT A;  2JWO A;  2EZ6 A;  4KZS A;  1FI4 A;  2B9D A;  1HNZ E;  4GKJ E;  2VF1 A;  4JI7 E;  2JR1 A;  2LJH A;  1Z0V A;  3HPS A;  4AQY E;  4JI8 I;  4JI0 E;  4XTJ A;  1VIS A;  2R42 A;  4LF9 E;  4X66 I;  2RS6 A;  4LF5 I;  5LMN I;  2V2Z A;  4JI1 E;  5LL6 R;  2UUC E;  4DPX A;  4DU7 A;  2GS8 A;  3LTO A;  2RS7 A;  5A2Q Q;  4M0V A;  4IZK A;  4DPY A;  3V2U C;  3PYG A;  1WXR A;  1N32 E;  4B3S E;  3J7A M;  4TUI A;  4DPW A;  4WUC A;  4F9A B;  1N36 I;  2LUP B;  3GON A;  4YHH E;  1A6F A;  4JI6 E;  3HUL A;  2L33 A;  4DMI A;  2PNM A;  3LML A;  1N33 I;  4DUZ I;  1USV A;  1EA6 A;  4DV5 E;  3J80 C;  2H36 X;  2NUG A;  2Q2E B;  2Z5C B;  3ZKD A;  1S16 A;  5GMD A;  3AV0 A;  4LFC I;  2UXB I;  2EFG A;  4B3M I;  4HYM A;  2V88 A;  5BR8 I;  3OML A;  3PYF A;  1HNW I;  1J5E I;  2XEX A;  2HFU A;  4DUY I;  4DV1 E;  1HNZ I;  1NHJ A;  2UUA E;  4GKJ I;  5DNY A;  2B3T B;  3J81 C;  2ODR C;  4LF6 I;  2DEJ A;  4JI0 I;  4PU9 A;  4GKK E;  4BC7 A;  2LE2 A;  3T1H E;  2X36 A;  4BBY A;  4ED4 A;  4K0K I;  1XNR I;  1N0U A;  5IWA I;  4DR5 I;  4B3T I;  3B82 A;  1EI1 A;  1J26 A;  3RMP A;  1N32 I;  4B3S I;  2HKE A;  1UIL A;  4DV3 E;  1KKH A;  3HPZ A;  2Z5E A;  3B8H A;  4HXZ A;  4X65 I;  1Y4S A;  1EKZ A;  4DR4 E;  4KHP E;  3JTZ A;  3WU3 A;  2UXD E;  4BMJ A;  4HAC A;  2HHH I;  4USM A;  4JG4 A;  4P7D A;  1X48 A;  4JI8 E;  1YYW A;  2EWL A;  4X66 E;  5A2Q C;  2L8T A;  2V2Q A;  4LF5 E;  4WUB A;  5LMN E;  3Q6M A;  2LJP A;  4N3O A;  1B62 A;  1KVK A;  2Z5B B;  4WUD A;  2CG9 A;  1NHH A;  1ZBQ A;  4R03 A;  4M2Z A;  1HNX I;  3P06 A;  1FWL A;  1N36 E;  2UU9 E;  4URL A;  3ADJ A;  4RPF A;  4ZVI A;  4X64 I;  4DV0 I;  2R3V A;  3QT5 A;  3M6A A;  5LMU I;  4DUZ E;  2LMZ A;  2GQ0 A;  4NXN I;  4LTY A;  4IZJ D;  4LFC E;  2UXB E;  2FTX B;  4B3M E;  5AE2 A;  1YYK A;  2F8B A;  2UXD I;  5BR8 E;  2HK2 A;  1HNW E;  4BS9 A;  4DR7 E;  1J5E E;  1H73 A;  4WFT A;  4DUY E;  2L2K B;  3ZZT A;  4LF6 E;  3DJW A;  2KOU A;  1IBL I;  2LTR A;  4WPY A;  3PRY A;  2V86 A;  4UT4 A;  2CPN A;  2O1W A;  1PIE A;  3LPS A;  4K0K E;  2UUB I;  2WZO A;  1XNR E;  5IWA E;  4DR5 E;  4B3T E;  1IBM I;  1KTV A;  2LBS B;  4EMD A;  1HK7 A;  3ZM7 A;  3MSW A;  2YZT A;  1NHI A;  4FWH A;  4Z7Y A;  3AUZ A;  4M30 A;  3J7Y p;  2UU9 I;  2RSM A;  1ZM3 A;  1XMQ I;  4X65 E;  2HKJ A;  4DKK A;  5ADZ A;  1XHK A;  2JOX A;  2L2N A;  2DIX A;  2B7T A;  3HTX A;  4BC9 A;  1MU5 A;  3D4J A;  2LTS A;  1ZM2 A;  2JVA A;  2K4V A;  1Z5A A;  2VQF I;  1DAR A;  1T4L B;  3H09 A;  2HHH E;  2E5L I;  1KIJ A;  4DR7 I;  3J7A G;  3QT7 A;  4Q28 A;  3P1X A;  4WSP A;  2BM0 A;  2O1V A;  4BCA A;  4HY1 A;  2KON A;  2FV4 B;  4PRV A;  1UHZ A;  2YT4 A;  2V89 A;  2L3C A;  4IZJ A;  5AAS A;  1BKN A;  1Z0G A;  1H74 A;  4DR2 I;  1I94 I;  1ZXM A;  3DF6 A;  3WU6 A;  4JI3 I;  2N3H A;  3C4T A;  2O1U A;  1HNX E;  1FWK A;  1RQ0 A;  1RC7 A;  4DV4 I;  2V8Q B;  4NXM E;  5FLX Q;  4JI4 I;  4LU9 A;  1ZXN A;  3JU0 A;  4R8O A;  3F0N A;  4X64 E;  4DV0 E;  4I3H A;  2VQE I;  1O0W A;  3FIG A;  5AE3 A;  2ZIT A;  5LMU E;  4JV5 I;  4FWG A;  1S4E A;  3H4L A;  4NXN E;  3ZZU A;  4JI2 I;  1Y4U A;  4DV2 I;  2ZBK B;  2UXC I;  2L92 A;  4LF7 I;  4LF8 E;  2RTX A;  2M1S A;  4F54 A;  4FN5 A;  1RRE A;  2MC5 A;  1Z5C A;  2V85 A;  2A2C A;  1T4O A;  1Z0E A;  4LFA I;  1HR0 E;  2ZM6 I;  1PKP A;  1ZM4 A;  1IBL E;  3T1Y I;  3HQ1 A;  3K85 A;  3K6Q A;  1XMO E;  2HFS A;  1H7S A;  4WYQ B;  2BM1 A;  3OTO I;  4DR6 I;  4KQV A;  2UUB E;  4YY3 I;  2Z5C A;  1IBM E;  4IZK B;  1B63 A;  1DQ3 A;  3ZOQ B;  2FGG A;  2MC6 A;  4MYT A;  1RR9 A;  3HJC A;  4P78 A;  3IWD A;  1NZ0 A;  4R1F A;  3J80 Q;  4NXM I;  1XMQ E;  1ZM9 A;  1FJG I;  1MG7 A;  2ODR D;  2M4I A;  1WHQ A;  1WHN A;  2V34 A;  2X7I A;  1YYO A;  1K47 A;  3LLH A;  3PYE A;  4LFB I;  1XNQ I;  1N0V C;  1IBK I;  2VQF E;  3ZZ0 A;  2E5L E;  4LF8 I;  1U2R A;  1QU6 A;  2IOP A;  4I8O A;  4OX9 I;  1GQE A;  1HR0 I;  4MYU A;  2NPF A;  1X47 A;  2B7V A;  1XMO I;  1PVG A;  1Y6Z A;  3K17 A;  2N3G A;  4DR2 E;  1I94 E;  4P52 A;  5FLX C;  4JI3 E;  1DI2 A;  2V8P A;  2CGE A;  2HK3 A;  3QT8 A;  4DV4 E;  1Z0C A;  2OI2 A;  4JI4 E;  2KHX A;  3VK6 A;  4PRX A;  2LUQ A;  2V83 A;  2A2D A;  2VQE E;  4DV6 I;  2F4V I;  4JV5 E;  1WUU A;  1Z5B A;  1SR9 A;  4JI2 E;  2G7H A;  4JYA I;  4X62 I;  1ELO A;  4LF4 I;  4DV2 E;  2UXC E;  2Z5B A;  4LF7 E;  2IHR 1;  3Q1Q A;  1T4N A;  4HAC B;  3IWC A;  4X8W A;  4P7A A;  3B78 A;  4DR3 I;  2MDR A;  4JI5 I;  4LFA E;  1Z0W A;  2ZM6 E;  1N34 E;  3T1Y E;  1FKA E;  5IT9 Q;  4M1K A;  3C4B A;  4L5N C;  2E1M A;  3OTO E;  4DR6 E;  4DR1 I;  2VE7 C;  4YY3 E;  3JAM Q;  4F9B B;  2NUE A;  3CWV A;  3ZKB A;  3ADI A;  2AJ4 A;  2V87 A;  2CZ9 A;  4B3R E;  5CFF E;  4DPU A;  2O1T A;  1FJG E;  4JI7 I;  3ADL A;  4AQY I;  2NA2 A;  3K1J A;  4LF9 I;  5L3J A;  1QZR A;  4LFB E;  1XNQ E;  1OJ4 A;  4JI1 I;  2UUC I;  3HXL A;  1IBK E;  5FWK A;  5AE1 A;  3VYY A;  1USU A;  2E1R A;  2IOQ A;  1X49 A;  4FWD A;  4OOG C;  3PYD A;  1STU A;  5F3W A;  1GZ6 A;  3IWB A;  4UTG A;  2V2V A;  3WU5 A;  4OX9 E;  3LNU A;  3VYX A;  1N34 I;  2DMY A;  2L3J A;  1D6T A;  2L6M A;  4TUG A;  4YHH I;  4DV7 E;  1Z0B A;  3Q6N A;  3ADG A;  4JI6 I;  2DB2 A;  4GEQ B;  4DV5 I;  2DEI A;  1H7U A;  3V5R A;  3QT6 A;  1H72 C;  2L2M A;  4DXL A;  5GME A;  4B3R I;  1Z0T A;  4FW9 A;  2NUF A;  2M7Q A;  4DV1 I;  2UUA I;  1MX0 A;  4DV6 E;  2F4V E;  1UEK A;  2PNL A;  3KWR A;  4J8Z A;  2VF3 A;  4L8N A;  3WU4 A;  4GKK I;  4JYA E;  4X62 E;  1YZ9 A;  1FNM A;  3T1H I;  2JY9 A;  3F6G A;  4LF4 E;  3J81 Q;  2DSY A;  4F9C B;  5IT9 C;  4DR3 E;  4JI5 E;  4DV3 I;  2BV3 A;  3JAM C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...