1N32E

Structure of the thermus thermophilus 30s ribosomal subunit bound to codon and near-cognate transfer rna anticodon stem-loop mismatched at the first codon position at the a site with paromomycin
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
150
structure length
150
Chain Sequence
DFEEKMILIRRTARMQAGGRRFRFGALVVVGDRQGRVGLGFGKAPEVPLAVQKAGYYARRNMVEVPLQNGTIPHEIEVEFGASKIVLKPAAPGTGVIAGAVPRAILELAGVTDILTKELGSRNPINIAYATMEALRQLRTKADVERLRKG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S RIBOSOMAL RNA
publication title Selection of tRNA by the Ribosome Requires a Transition from an Open to a Closed Form
pubmed doi rcsb
molecule tags Ribosome
total genus 35
structure length 150
sequence length 150
ec nomenclature
pdb deposition date 2002-10-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00333 Ribosomal_S5 Ribosomal protein S5, N-terminal domain
E PF03719 Ribosomal_S5_C Ribosomal protein S5, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.20 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 1n32E01
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 1n32E02
4RPFA 1H74A 4UT4A 4LF9I 4OOGC 1N36I 4LFBI 5IT9Q 4PU9A 4DV7E 3PYDA 4DUYE 1A6FA 4GKJI 4DR6E 4NXME 3V2UC 4DR4I 1XNRI 1ZBTA 1Z0EA 4DV0E 1KKHA 4UTGA 1J5EE 1XHKA 4DV6E 4JI8I 1FI4A 1YZ9A 5IWAI 3V5RA 5LMNI 2KHXA 4HYMA 3HULA 2LUQA 3PYFA 2Q2EB 2UXBI 1DI2A 2VQFE 4DPTA 4B3RI 2A2CA 3J81C 1N33I 3VYXA 4DR1E 2DB2A 4LFCI 5LMUE 2HFUA 1Z59A 4FWHA 4HACA 4DKKA 2YT4A 1XMQE 4JI6E 4JI3E 4JYAE 1NHIA 3LPSA 4DU8A 4KHPI 2ZM6E 2BV3A 2B7VA 3C4BA 2NUFA 4JI5E 1N32E 4X65E 4DV4E 4DUZI 4M2ZA 3QT7A 2ZBKB 2RS7A 2L33A 1I94E 2UUCE 5BR8E 4DR7E 4LF8I 1PVGA 4B3TE 1HNWE 4DV2E 4K0KE 2V2ZA 2NPFA 4JI0I 1J26A 3ADLA 3B78A 2OI2A 1J5EI 1Z0BA 1XNQI 4DR3E 1IBLE 1O0WA 3D4JA 3J7Yp 2MDRA 2J7KA 3J7AG 4DV6I 4FW9A 1H73A 2L3JA 3M6AA 1Z0VA 4LFAE 1B62A 4DV1E 2F4VI 3T1HE 2BM1A 4EMDA 4P52A 5FLXQ 4HXZA 4JI2E 4DXLA 1EI1A 3QT5A 5CFFE 1Z0GA 4GKKE 1RR9A 2A2DA 1N0VC 1H72C 1ZM2A 1X47A 5LMUI 4AQYI 4WUDA 4LF7I 2VQEE 4JI6I 1FWKA 1Z0TA 3K1JA 1STUA 1S4EA 1ZM3A 4FWDA 4KQVA 2HHHE 4ZVIA 4JI4E 4JI5I 4X65I 2LTRA 1Z0CA 2IHR1 1Z5BA 2LBSB 4OX9I 3H4LA 1T4LB 2UUCI 4JV5I 1ZM9A 3B8HA 2UU9E 1IBMI 4X66E 1FJGI 4X62I 1HNWI 4DV2I 1HR0I 2UUBE 2L2KB 2BM0A 2RTXA 3PYEA 3T1YI 4YHHE 1YYKA 4Z7CA 2CPNA 1IBKE 2ZITA 4DR5I 2JY9A 4X8WA 4DR2I 2WW4A 4I3HA 4HY1A 4XTJA 3T1HI 1RC7A 1QU6A 2DIXA 1N34E 2X36A 3ADGA 4WUCA 4DV5E 3ZZUA 1KTVA 3QT8A 1D6TA 1OJ4A 1UILA 1XMOE 1EKZA 1NZ0A 1HNXE 1NHHA 4M30A 4JI7I 3WU3A 1NHJA 1KIJA 3ZZTA 4NXNE 1DARA 1S16A 4YY3I 3C4TA 1WHNA 4M1KA 4DV3I 3J81Q 4JI1E 4LF5I 1T4OA 2HKEA 4B3SE 4WYQB 1T4NA 2E5LE 2B3TB 3OTOE 4JI4I 4LF6E 4DV7I 1HNZE 2E1RA 4DUYI 1FWLA 3WU4A 2UUAE 1WUUA 4DR6I 4R1FA 4NXMI 2DMYA 4FN5A 4DV0I 4LF9E 1N36E 4LFBE 1U2RA 1K47A 4PRVA 4GKJE 2UXCE 2CZ9A 4DR4E 3JAMC 4P7AA 2V2QA 1EA6A 1ELOA 4B3ME 4MYUA 3J80C 1RQ0A 4JI8E 3ADIA 3Q1QA 2VQFI 1ZXNA 5LMNE 4USKA 2AJ4A 4DV5I 2R42A 4DR1I 4X64E 1XMOI 3JAMQ 4B3RE 1XMQI 3GONA 4JI3I 4JYAI 2GS8A 2ZM6I 1H7SA 1MU5A 3J80Q 1YYWA 2NUGA 4Z7YA 5IT9C 1X48A 4LFCE 3ZZ0A 2EFGA 2HK2A 5GMDA 4JG4A 1N32I 4DV4I 3WU6A 1X49A 3WU5A 3K17A 5A2QC 1I94I 4KHPE 5BR8I 2NA2A 1FKAE 2L3CA 2L2NA 2LTSA 4LF4E 1HNZI 4DR7I 2RSMA 4URLA 1ZXMA 2RS6A 4B3TI 4DUZE 3LLHA 4K0KI 1H7UA 2LJHA 4DR3I 1IBLI 1WHQA 1MX0A 4DPWA 2XEXA 4WFTA 1YYOA 4LF8E 2UXCI 1VISA 4ED4A 2R3VA 2X7IA 5A2QQ 4JI0E 3VYYA 4LFAI 4DV1I 1XNQE 2V2VA 4JI2I 1FNMA 3F0NA 3LNUA 2LRSA 2UXDE 4B3MI 3ADJA 2V8PA 4GKKI 4DU7A 3QT6A 2F4VE 4DPYA 3ZKDA 4X64I 1KVKA 2VF3A 4DPUA 2V34A 2NUEA 2VQEI 3HTXA 2DEIA 2HKJA 2HHHI 4AQYE 4LF7E 2LUPB 3PYGA 1ZM4A 1GQEA 1MG7A 1PIEA 2HK3A 2UU9I 4LF4I 1RREA 1B63A 4PRXA 4X66I 3ZM7A 2UUBI 4OX9E 1Z0WA 4JV5E 4YHHI 1XNRE 2B7TA 5FLXC 1IBME 2L2MA 1IBKI 1FJGE 2N3HA 4X62E 3B82A 2JVAA 1HR0E 2N3GA 2LJPA 3P1XA 1Z5CA 3T1YE 5IWAE 4DPXA 5L3JA 3LTOA 1N34I 1N0UA 2UXDI 2UXBE 5GMEA 4DR5E 2EZ6A 4DR2E 3J7AM 1HNXI 4FWGA 4WUBA 1PKPA 1N33E 2DEJA 4NXNI 4HACB 4USMA 4JI1I 1BKNA 4JI7E 4B3SI 1Z5AA 2E5LI 1UHZA 4YY3E 2HFSA 5LL6R 3OTOI 4LF6I 1UEKA 3CWVA 4DV3E 4MYTA 3ZKBA 2UUAI 4LF5E 1QZRA
chains in the Genus database with same CATH superfamily
4RPFA 2ODRC 1H74A 2Z5EA 3C6KA 2YTDA 4UT4A 4R8OA 3EPJA 1MEYC 2ENCA 2C38B 2NN6E 3M85G 4OOGC 1N36I 4LF9I 4LFBI 2NN6B 5JEAE 4Q35B 5IT9Q 4PU9A 1NCSA 4DV7E 3PYDA 5DNLA 5JEAB 1ZBQA 4DUYE 1A6FA 2JE6A 2RQLA 4GKJI 4WSGA 1A1GA 4DR6E 4NXME 3V2UC 4DR4I 1TF3A 1XNRI 3IWCA 1ZBTA 1Z0EA 4DV0E 2GO4A 1KKHA 3THOB 2NABA 4IZJA 1J5EE 4UTGA 3JTZA 1UDQA 1P47A 2M4IA 1XHKA 1X6FA 5F3WA 1OYRA 3KWRA 4DV6E 3HPZA 1SR9A 4JI8I 1FI4A 3M7ND 1A1JA 2HJJA 3BF2A 2DGCA 2PO1A 1YZ9A 1IMUA 5DNYA 4GQUA 4LCHA 5IWAI 2RSIA 4WUCA 2B9DA 3V5RA 5LMNI 2KHXA 5KL3A 4HYMA 3JU0A 3HULA 3PS2A 2LUQA 3PYFA 2Q2EB 2UXBI 2O1UA 4ZYEA 3DJWA 2KOUA 4R03A 1DGCA 1SFEA 1TF6A 1DI2A 2V83A 2VQFE 3KRNA 4DPTA 3HKMA 2Z5BA 3J81C 2GPIA 2A2CA 4B3RI 2O1VA 4RHBB 2NN6D 2PNLA 2YTJA 1YUJA 1N33I 1B69A 3VYXA 2YU8A 3F6HA 5JEAD 4DR1E 5AE2A 1OYPA 2Z5CB 2PO2A 2DB2A 3IWDA 3HPSA 4LFCI 5LMUE 2V86A 2I13A 2HFUA 1IQOA 1Z59A 4OO1E 4FWHA 4HACA 4DKKA 2YT4A 3KZZA 1XMQE 2EN6A 4JI6E 3M7NG 4JI3E 2AE8A 2EPMX 4JYAE 1NHIA 3HJCA 3LPSA 4DU8A 2ZM6E 2BV3A 4GZNC 3VHTB 2VESA 4KHPI 4LCFA 2L8TA 2B7VA 3C4BA 2NUFA 3EQ1A 2EOQA 1E3HA 2LMZA 4JI5E 1N32E 4X65E 2CG9A 4DV4E 4DUZI 4M2ZA 3QT7A 4IFDB 4P78A 1QZRA 2EOFA 2ZBKB 2RS7A 2L33A 2V85A 4KWYA 2EMBA 1I94E 4BA2A 2UUCE 2YRMA 5BR8E 3VK6A 3UK3C 1GZ6A 2EOJA 3GCMA 2C38A 3EPLA 5C0XE 2JWOA 4DR7E 4AIMA 4LF8I 2NN6A 5C0XB 1YSAC 1PVGA 1Y4SA 4B3TE 5JEAA 1HNWE 4DV2E 4HEIA 4K0KE 2V2ZA 2NPFA 2EM9A 4JI0I 2EPKX 1J26A 3ADLA 2EOZA 2OI2A 3B78A 1J5EI 1Z0BA 1XNQI 1YHCA 4I8OA 4DR3E 1IBLE 1O0WA 3D4JA 4BA1B 3J7Yp 2MDRA 4J8ZA 2J7KA 2O3ZA 2JOBA 3J7AG 4LOMA 4DV6I 4FW9A 2EQ1A 3MHHC 2I9IA 1H73A 4OO1F 1A1KA 4OO1D 5ELWA 1AAYA 2EMIA 2L3JA 3M6AA 2BR2B 1Z0VA 4LFAE 1YFHA 1B62A 4DV1E 2NN6C 1Y6ZA 3M85D 3T1HE 2EPOA 2EM2A 2BM1A 2CT1A 4P52A 4EMDA 5FLXQ 4BHBA 5JEAC 4HXZA 4JI2E 2EMLA 4F9AB 4DXLA 2IERA 1EI1A 2GO3A 2FV4B 3QT5A 3L00A 2D9HA 4BHCA 5CFFE 1Y4UA 4GKKE 1RR9A 2YTIA 1Z0GA 2A2DA 1N0VC 2DSYA 2RPCA 3KZYA 3MSWA 1H72C 2IESA 4KZSA 1UDNA 2LJUA 3BGHA 1PDAA 1ZM2A 5C0XD 2BA1D 1UBDC 1X47A 5LMUI 3MHSC 2HGHA 4AQYI 4WUDA 1G2FC 3IWBA 4LF7I 2YTEA 4M9VC 3RMPA 3AV0A 2EQ3A 2Z5CA 2VQEE 3EPHA 4JI6I 1FWKA 2EMZA 4DMIA 1Z0TA 1HK7A 3K1JA 1R6MA 1X6EA 1A1FA 1E3PA 3P76A 1STUA 4O4KA 2EP3A 1S4EA 1ZM3A 4FWDA 4KQVA 4OO1A 2C39B 2HHHE 4ZVIA 1KYQA 2YTFA 4JI4E 4JI5I 4R2CA 2EOSA 4X65I 4P7DA 2EOHA 2LTRA 2E72A 2IHR1 1Z0CA 1Z5BA 2LBSB 4OX9I 3H4LA 1T4LB 2UUCI 3K85A 4JV5I 3U1KA 3C6MA 1ZM9A 3B8HA 2UU9E 1VI7A 1IBMI 2JEBB 2YTOA 4X66E 2YTPA 1FJGI 4X62I 4OO1C 1HNWI 2BA1G 3CDIA 5DNXA 4DV2I 1HR0I 2UUBE 2L2KB 1XXEA 2BM0A 2RTXA 5A69A 3PYEA 5C0XA 3T1YI 2L6MA 4YHHE 1YYKA 5EL9A 4Z7CA 2CPNA 1IBKE 4IJDA 2EOEA 2F4VI 2ZITA 1BB8A 2LO3A 4DR5I 1DQ3A 2JY9A 4X8WA 1N3GA 4AIDA 4BS9A 2V88A 2WW4A 5AE3A 4I3HA 4LTYA 4DR2I 2JXPA 1WXRA 3P3EA 4HY1A 4XTJA 3T1HI 3F6GA 2EPCA 2WNRA 1EH8A 1QU6A 1RC7A 2LT7A 5JEAF 2DIXA 1N34E 2BA0D 2X36A 2NN6F 2BR2A 3ADGA 2LVHA 5C0XC 2FTXB 2WP8B 4DV5E 4IS9A 2CTDA 3HQ1A 4L5NC 1KTVA 1EH6A 1UDSA 3QT8A 3TQMA 2PO0B 4R2RA 1D6TA 1OJ4A 3GMEA 4NHRA 5A6AA 1BBOA 4QNKA 2V89A 3DD6A 1UILA 2VF1A 2EE8A 1XMOE 1EKZA 4F9BB 1HNXE 1NHHA 2FGGA 4M30A 4WSPA 5DRQA 4JI7I 4M0VA 1USUA 1YH8A 1PJQA 2EM3A 2J7JA 2WCC3 3WU3A 1NHJA 5IXMB 1KIJA 2IOQA 2M1SA 3ZZTA 2EOOA 2H36X 4NXNE 1DARA 1S16A 4TUGA 3C4TA 2F8BA 4LCGA 4MU0A 1WHNA 4YY3I 2JEAB 2BB8A 4M1KA 2HC5A 4DV3I 3J81Q 4JI1E 2JP9A 2PNZB 4LF5I 1T4OA 2HKEA 3ZZUA 4IFDE 2JPAA 4B3SE 4F2JC 2IOPA 4WYQB 4N3OA 4Q28A 4DV0I 1T4NA 2DLKA 2E5LE 1RMDA 4BC7A 2B3TB 3OTOE 4JI4I 4LF6E 1PJSA 2BA0G 3THNA 4FW3A 4DV7I 1X6HA 1HNZE 2E1RA 4FW5A 3K6QA 4DUYI 1FWLA 3WU4A 4MU4A 2UUAE 2LE2A 1WUUA 4U3BA 4R1FA 4DR6I 2L92A 4NXMI 1GTKA 1TN9A 2DMYA 4U3DA 4FN5A 1T38A 5A6KA 1A1LA 2GQ0A 3P3CA 4LF9E 1N36E 4LFBE 5DROA 1U2RA 2E1MA 2JE6B 2R76A 2EORA 1K47A 3HXLA 5K36E 4LU9A 4BC9A 3Q6NA 4PRVA 4GKJE 5K36B 4IZJB 2UXCE 2PNMA 2C37B 2EPUA 2CZ9A 4RH8A 1Z1BA 4DR4E 4AM3A 4WXDA 2G7HA 3JAMC 4P7AA 1Y5YA 2V2QA 2CGEA 3B4TA 2EOYA 2PO1B 2EL4A 2YRHA 5LLQA 1EA6A 2M7QA 1ELOA 4B3ME 4MYUA 1NZ0A 2YTNA 1RQ0A 4JI8E 2ELZA 3DF6A 3J80C 3ADIA 3Q1QA 2VQFI 2YRKA 4IFDD 2LCEA 1ZXNA 1ZU1A 5LMNE 2WBTA 3H1CA 2GHFA 5DRPA 4IS1C 4USKA 2AJ4A 4DV5I 4F54A 4NBQA 5FWKA 2R42A 2EMYA 4X64E 2EQ0A 4DR1I 1EH7A 5C0XF 2EN2A 1X5WA 5AE1A 1XMOI 2WP8A 3ECRA 4X9JA 2PRTA 1JK2A 1A1IA 3JAMQ 2PO0A 4B3RE 1WRJA 1XMQI 2EN3A 2WZOA 5TSEA 2MDGA 3GONA 4JI3I 4JYAI 1G2DC 3BIDA 2GS8A 2EL5A 4IZKB 1YPNA 2EOXA 2F1DA 2EMAA 2ZM6I 1H7SA 1MU5A 3J80Q 1YYWA 2EM0A 2NUGA 1F2IG 5K36D 4Z7YA 5IT9C 1X48A 4LFCE 2EMKA 3ZZ0A 3LMLA 5AC5A 5A6BA 2EFGA 2O1WA 2HK2A 5GMDA 3PS1A 4JG4A 3Q6MA 4BMJA 2J65A 4LPFA 3U1YA 4DV4I 3WU6A 2EOMA 1X49A 1PJTA 3WU5A 2PNZA 3K17A 3L7ZB 5A2QC 1I94I 4KHPE 5BR8I 3BBGA 2NA2A 1FKAE 2LV2A 2O1TA 2L3CA 4IFDA 2L2NA 2EMXA 4O43A 2LTSA 4LF4E 1HNZI 4DR7I 2K7IA 2RSMA 4URLA 1X3CA 1NEIA 4R2SA 2RS6A 4BCAA 1Y60A 1ZXMA 2EMWA 4B3TI 2EWLA 3LLHA 4DUZE 2VE7C 3AUZA 4K0KI 1H7UA 2EM4A 2BBGA 2LJHA 4DR3I 3P3GA 1IBLI 4NZVA 1WHQA 1MX0A 4DPWA 2XEXA 4WFTA 3ZOQB 1YYOA 4LF8E 2UXCI 1VISA 4ED4A 4BA1A 2R3VA 2ELYA 2X7IA 1UDOA 4MQYA 5A2QQ 4IFDC 4JI0E 2EMFA 5K36A 5ADZA 3VYYA 4LFAI 4FW4A 1XNQE 1IQSA 1MGTA 2C37A 2V2VA 4DV1I 2MC6A 2EN4A 2DLQA 4JI2I 1FNMA 1WJPA 3F0NA 3LNUA 4ISAA 2LRSA 2UXDE 4MLVA 4B3MI 3ADJA 2V8PA 3GLLA 5DRRA 4GKKI 2N8XA 4L8NA 4DU7A 3QT6A 2YPNA 2F4VE 2MKDA 5T6JA 5IV8B 5KL5A 4DPYA 1KJKA 2EM8A 1P42A 3ZKDA 4X64I 1KVKA 5K36C 5AC4A 1USVA 2VF3A 4DPUA 2DMIA 3QG5C 1JK1A 1BBGA 2YWQA 2V34A 2NUEA 4FK5C 4R2PA 3HTXA 2DRPA 2VQEI 2EMCA 2EPPA 4WX9A 4O5GA 2DEIA 2HKJA 4R2EA 2WBSA 2CSHA 2ENHA 2HHHI 4BBYA 5KL6A 4AQYE 4IZKA 2WBUA 4GEQB 3NZKA 4LF7E 2LUPB 4OO1B 3PYGA 2C39A 1ZM4A 1GQEA 4ZYHA 1MG7A 1LLMC 1PIEA 1YUIA 2KONA 2HK3A 2UU9I 4LF4I 1RREA 3L7ZA 2M9AA 1B63A 4PRXA 3UHMA 4X66I 2EMHA 4WPYA 4N4RB 2EPLX 2YU5A 4O24A 1R6LA 4R2AA 4WXCA 4F6NA 4OX9E 2JEBA 4FW7A 3ZM7A 1RHYA 4OKGA 1Z0WA 2EPAA 2UUBI 4MDTA 2ODRD 4F6MA 4JV5E 2YZTA 4YHHI 1XNRE 2B7TA 2EOIA 5FLXC 5A6BD 1IBME 2L2MA 5EKWA 1IBKI 1FJGE 2N3HA 2YTGA 4MLQA 4X62E 4FW6A 3B82A 2JVAA 1HR0E 5KL2A 2MC5A 2JT2A 2JOXA 4TUIA 2N3GA 3OMLA 3P1XA 2LJPA 2EN1A 2EJ4A 2EM6A 3T1YE 1Z5CA 5IWAE 2MKNA 3PS3A 4DPXA 4IFDF 5L3JA 3LTOA 2Q8UA 1N34I 3EPKA 2EM7A 1N0UA 2UXDI 1AH5A 2UXBE 5GMEA 2WNRB 4DR5E 1L4SA 2Z5BB 3CDJA 4MU1A 1QNTA 2EZ6A 2EPRA 2YTQA 4DR2E 1OYSA 4QNJA 5KL7A 3J7AM 1HNXI 1UN6B 2EMGA 2VRDA 3H09A 2JYAA 4FWGA 4HTGA 4WUBA 1PKPA 2PO2B 2JR1A 1N33E 2DEJA 3PRYA 2EL6A 4OZEA 4NXNI 2EN8A 1A1HA 2R1FA 2EM5A 4HACB 5K36F 4IZJD 2YSPA 3M99B 4USMA 4JI1I 1N32I 1ZR9A 4R2DA 1BKNA 1T39A 4JI7E 4F9CB 2V87A 4MU3A 4B3SI 2K4VA 4R2QA 4ZYDA 4J3DA 2CVEA 2JEAA 5AASA 1Z5AA 2ENAA 2A25A 2V8QB 2EPZA 2E5LI 1UHZA 1ZAAC 4YY3E 2EPXA 3FIGA 5LL6R 4ZYGA 2EPNA 2ADRA 2YSOA 2HFSA 3OTOI 4LF6I 1UEKA 2EN7A 5A6JA 4DV3E 3CWVA 3P06A 4MYTA 3ZKBA 2UUAI 4LF5E 2GLIA 5KL4A 4BA2B
chains in the Genus database with same CATH topology
4RPFA 2ODRC 1H74A 2Z5EA 4UT4A 4R8OA 4LF9I 4OOGC 1N36I 4LFBI 5IT9Q 4PU9A 4DV7E 3PYDA 1ZBQA 4DUYE 1A6FA 4GKJI 4DR6E 4NXME 3V2UC 4DR4I 1XNRI 3IWCA 1ZBTA 1Z0EA 4DV0E 1KKHA 4UTGA 4IZJA 1J5EE 3JTZA 2M4IA 1XHKA 5F3WA 3KWRA 4DV6E 3HPZA 1SR9A 4JI8I 1FI4A 1YZ9A 5DNYA 5IWAI 2B9DA 3V5RA 5LMNI 2KHXA 4HYMA 3JU0A 3HULA 2LUQA 3PYFA 2Q2EB 2UXBI 2O1UA 3DJWA 2KOUA 4R03A 1DI2A 2V83A 2VQFE 4DPTA 2Z5BA 3J81C 2A2CA 4B3RI 2O1VA 2PNLA 1N33I 3VYXA 3F6HA 4DR1E 5AE2A 2Z5CB 2DB2A 3IWDA 3HPSA 4LFCI 5LMUE 2V86A 2HFUA 1Z59A 4FWHA 4HACA 4DKKA 2YT4A 1XMQE 4JI6E 4JI3E 4JYAE 1NHIA 3HJCA 3LPSA 4DU8A 2ZM6E 2BV3A 4KHPI 2L8TA 2B7VA 3C4BA 2NUFA 2LMZA 4JI5E 1N32E 4X65E 2CG9A 4DV4E 4DUZI 4M2ZA 3QT7A 4P78A 2ZBKB 2RS7A 2L33A 2V85A 1I94E 2UUCE 5BR8E 3VK6A 1GZ6A 2JWOA 4DR7E 4LF8I 1PVGA 1Y4SA 4B3TE 1HNWE 4DV2E 4K0KE 2V2ZA 2NPFA 4JI0I 1J26A 3ADLA 3B78A 2OI2A 1J5EI 1Z0BA 1XNQI 4DR3E 4I8OA 1IBLE 1O0WA 3D4JA 3J7Yp 2MDRA 4J8ZA 2J7KA 2JOBA 3J7AG 4DV6I 4FW9A 1H73A 2L3JA 3M6AA 1Z0VA 4LFAE 1B62A 4DV1E 2F4VI 1Y6ZA 3T1HE 2BM1A 4EMDA 4P52A 5FLXQ 4HXZA 4JI2E 4F9AB 4DXLA 1EI1A 3QT5A 2FV4B 5CFFE 1Z0GA 1Y4UA 4GKKE 1RR9A 2A2DA 1N0VC 2DSYA 3MSWA 1H72C 4KZSA 1ZM2A 1X47A 5LMUI 4AQYI 4WUDA 3IWBA 4LF7I 3RMPA 3AV0A 2Z5CA 2VQEE 4JI6I 1FWKA 4DMIA 1Z0TA 1HK7A 3K1JA 1STUA 1S4EA 1ZM3A 4FWDA 4KQVA 2HHHE 4ZVIA 4JI4E 4JI5I 4X65I 4P7DA 2LTRA 1Z0CA 2IHR1 1Z5BA 2LBSB 4OX9I 3H4LA 1T4LB 2UUCI 3K85A 4JV5I 1ZM9A 3B8HA 2UU9E 1IBMI 4X66E 1FJGI 4X62I 1HNWI 4DV2I 1HR0I 2UUBE 2L2KB 2BM0A 2RTXA 3PYEA 3T1YI 2L6MA 4YHHE 1YYKA 4Z7CA 2CPNA 1IBKE 2ZITA 4DR5I 1DQ3A 2JY9A 4X8WA 4BS9A 2V88A 2WW4A 5AE3A 4I3HA 4LTYA 4DR2I 1WXRA 4HY1A 4XTJA 3T1HI 3F6GA 1RC7A 1QU6A 2DIXA 1N34E 2X36A 3ADGA 2FTXB 4WUCA 4DV5E 3ZZUA 3HQ1A 4L5NC 1KTVA 3QT8A 1D6TA 1OJ4A 2V89A 1UILA 2VF1A 1XMOE 1EKZA 1NZ0A 4F9BB 1HNXE 1NHHA 2FGGA 4M30A 4WSPA 4JI7I 4M0VA 1USUA 3WU3A 1NHJA 1KIJA 2IOQA 2M1SA 3ZZTA 2H36X 4NXNE 1DARA 1S16A 4TUGA 3C4TA 2F8BA 4YY3I 1WHNA 4M1KA 4DV3I 3J81Q 4JI1E 4LF5I 1T4OA 2HKEA 4B3SE 2IOPA 4WYQB 4N3OA 4Q28A 1T4NA 2E5LE 4BC7A 2B3TB 3OTOE 4JI4I 4LF6E 4DV7I 1HNZE 2E1RA 3K6QA 4DUYI 1FWLA 3WU4A 2UUAE 2LE2A 1WUUA 4DR6I 4R1FA 2L92A 4NXMI 2DMYA 4FN5A 4DV0I 2GQ0A 4LF9E 1N36E 4LFBE 1U2RA 2E1MA 1K47A 3HXLA 4LU9A 4BC9A 3Q6NA 4PRVA 4GKJE 4IZJB 2UXCE 2PNMA 2CZ9A 4DR4E 2G7HA 3JAMC 4P7AA 2V2QA 2CGEA 1EA6A 2M7QA 1ELOA 4B3ME 4MYUA 3J80C 1RQ0A 4JI8E 3DF6A 3ADIA 3Q1QA 2VQFI 1ZXNA 5LMNE 4USKA 2AJ4A 4DV5I 4F54A 5FWKA 2R42A 4DR1I 4X64E 5AE1A 1XMOI 3JAMQ 4B3RE 1XMQI 2WZOA 3GONA 4JI3I 4JYAI 2GS8A 4IZKB 2ZM6I 1H7SA 1MU5A 3J80Q 1YYWA 2NUGA 4Z7YA 5IT9C 1X48A 4LFCE 3ZZ0A 3LMLA 2EFGA 2O1WA 2HK2A 5GMDA 4JG4A 1N32I 3Q6MA 4BMJA 4DV4I 3WU6A 1X49A 3WU5A 3K17A 5A2QC 1I94I 4KHPE 5BR8I 2NA2A 1FKAE 2O1TA 2L3CA 2L2NA 2LTSA 4LF4E 1HNZI 4DR7I 2RSMA 4URLA 1ZXMA 2RS6A 4BCAA 4B3TI 2EWLA 3LLHA 4DUZE 2VE7C 3AUZA 4K0KI 1H7UA 2LJHA 4DR3I 1IBLI 1WHQA 1MX0A 4DPWA 2XEXA 4WFTA 3ZOQB 1YYOA 4LF8E 2UXCI 1VISA 4ED4A 2R3VA 2X7IA 5A2QQ 4JI0E 5ADZA 3VYYA 4LFAI 4DV1I 1XNQE 2V2VA 2MC6A 4JI2I 1FNMA 3F0NA 3LNUA 2LRSA 2UXDE 4B3MI 3ADJA 2V8PA 4GKKI 4L8NA 4DU7A 3QT6A 2F4VE 5T6JA 4DPYA 3ZKDA 4X64I 1KVKA 1USVA 2VF3A 4DPUA 2V34A 2NUEA 2VQEI 3HTXA 2DEIA 2HKJA 2HHHI 4BBYA 4AQYE 4IZKA 4GEQB 4LF7E 2LUPB 3PYGA 1ZM4A 1GQEA 1MG7A 1PIEA 2KONA 2HK3A 2UU9I 4LF4I 1RREA 1B63A 4PRXA 4X66I 4WPYA 3ZM7A 2UUBI 4OX9E 1Z0WA 2ODRD 4JV5E 2YZTA 4YHHI 1XNRE 2B7TA 5FLXC 1IBME 2L2MA 1IBKI 1FJGE 2N3HA 4X62E 3B82A 2JVAA 1HR0E 2MC5A 2JOXA 4TUIA 2N3GA 3OMLA 3P1XA 2LJPA 1Z5CA 3T1YE 5IWAE 4DPXA 5L3JA 3LTOA 1N34I 1N0UA 2UXDI 2UXBE 5GMEA 4DR5E 2Z5BB 2EZ6A 4DR2E 3J7AM 1HNXI 3H09A 4FWGA 4WUBA 1PKPA 2JR1A 1N33E 2DEJA 3PRYA 4NXNI 4HACB 4IZJD 4USMA 4JI1I 1BKNA 4JI7E 4F9CB 2V87A 4B3SI 2K4VA 5AASA 1Z5AA 2V8QB 2E5LI 1UHZA 4YY3E 3FIGA 5LL6R 2HFSA 3OTOI 4LF6I 1UEKA 3CWVA 4DV3E 3P06A 4MYTA 3ZKBA 2UUAI 4LF5E 1QZRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4RPF A;  1H74 A;  4UT4 A;  4LF9 I;  4OOG C;  1N36 I;  4LFB I;  5IT9 Q;  4PU9 A;  4DV7 E;  3PYD A;  4DUY E;  1A6F A;  4GKJ I;  4DR6 E;  4NXM E;  3V2U C;  4DR4 I;  1XNR I;  1ZBT A;  1Z0E A;  4DV0 E;  1KKH A;  4UTG A;  1J5E E;  1XHK A;  4DV6 E;  4JI8 I;  1FI4 A;  1YZ9 A;  5IWA I;  3V5R A;  5LMN I;  2KHX A;  4HYM A;  3HUL A;  2LUQ A;  3PYF A;  2Q2E B;  2UXB I;  1DI2 A;  2VQF E;  4DPT A;  4B3R I;  2A2C A;  3J81 C;  1N33 I;  3VYX A;  4DR1 E;  2DB2 A;  4LFC I;  5LMU E;  2HFU A;  1Z59 A;  4FWH A;  4HAC A;  4DKK A;  2YT4 A;  1XMQ E;  4JI6 E;  4JI3 E;  4JYA E;  1NHI A;  3LPS A;  4DU8 A;  4KHP I;  2ZM6 E;  2BV3 A;  2B7V A;  3C4B A;  2NUF A;  4JI5 E;  1N32 E;  4X65 E;  4DV4 E;  4DUZ I;  4M2Z A;  3QT7 A;  2ZBK B;  2RS7 A;  2L33 A;  1I94 E;  2UUC E;  5BR8 E;  4DR7 E;  4LF8 I;  1PVG A;  4B3T E;  1HNW E;  4DV2 E;  4K0K E;  2V2Z A;  2NPF A;  4JI0 I;  1J26 A;  3ADL A;  3B78 A;  2OI2 A;  1J5E I;  1Z0B A;  1XNQ I;  4DR3 E;  1IBL E;  1O0W A;  3D4J A;  3J7Y p;  2MDR A;  2J7K A;  3J7A G;  4DV6 I;  4FW9 A;  1H73 A;  2L3J A;  3M6A A;  1Z0V A;  4LFA E;  1B62 A;  4DV1 E;  2F4V I;  3T1H E;  2BM1 A;  4EMD A;  4P52 A;  5FLX Q;  4HXZ A;  4JI2 E;  4DXL A;  1EI1 A;  3QT5 A;  5CFF E;  1Z0G A;  4GKK E;  1RR9 A;  2A2D A;  1N0V C;  1H72 C;  1ZM2 A;  1X47 A;  5LMU I;  4AQY I;  4WUD A;  4LF7 I;  2VQE E;  4JI6 I;  1FWK A;  1Z0T A;  3K1J A;  1STU A;  1S4E A;  1ZM3 A;  4FWD A;  4KQV A;  2HHH E;  4ZVI A;  4JI4 E;  4JI5 I;  4X65 I;  2LTR A;  1Z0C A;  2IHR 1;  1Z5B A;  2LBS B;  4OX9 I;  3H4L A;  1T4L B;  2UUC I;  4JV5 I;  1ZM9 A;  3B8H A;  2UU9 E;  1IBM I;  4X66 E;  1FJG I;  4X62 I;  1HNW I;  4DV2 I;  1HR0 I;  2UUB E;  2L2K B;  2BM0 A;  2RTX A;  3PYE A;  3T1Y I;  4YHH E;  1YYK A;  4Z7C A;  2CPN A;  1IBK E;  2ZIT A;  4DR5 I;  2JY9 A;  4X8W A;  4DR2 I;  2WW4 A;  4I3H A;  4HY1 A;  4XTJ A;  3T1H I;  1RC7 A;  1QU6 A;  2DIX A;  1N34 E;  2X36 A;  3ADG A;  4WUC A;  4DV5 E;  3ZZU A;  1KTV A;  3QT8 A;  1D6T A;  1OJ4 A;  1UIL A;  1XMO E;  1EKZ A;  1NZ0 A;  1HNX E;  1NHH A;  4M30 A;  4JI7 I;  3WU3 A;  1NHJ A;  1KIJ A;  3ZZT A;  4NXN E;  1DAR A;  1S16 A;  4YY3 I;  3C4T A;  1WHN A;  4M1K A;  4DV3 I;  3J81 Q;  4JI1 E;  4LF5 I;  1T4O A;  2HKE A;  4B3S E;  4WYQ B;  1T4N A;  2E5L E;  2B3T B;  3OTO E;  4JI4 I;  4LF6 E;  4DV7 I;  1HNZ E;  2E1R A;  4DUY I;  1FWL A;  3WU4 A;  2UUA E;  1WUU A;  4DR6 I;  4R1F A;  4NXM I;  2DMY A;  4FN5 A;  4DV0 I;  4LF9 E;  1N36 E;  4LFB E;  1U2R A;  1K47 A;  4PRV A;  4GKJ E;  2UXC E;  2CZ9 A;  4DR4 E;  3JAM C;  4P7A A;  2V2Q A;  1EA6 A;  1ELO A;  4B3M E;  4MYU A;  3J80 C;  1RQ0 A;  4JI8 E;  3ADI A;  3Q1Q A;  2VQF I;  1ZXN A;  5LMN E;  4USK A;  2AJ4 A;  4DV5 I;  2R42 A;  4DR1 I;  4X64 E;  1XMO I;  3JAM Q;  4B3R E;  1XMQ I;  3GON A;  4JI3 I;  4JYA I;  2GS8 A;  2ZM6 I;  1H7S A;  1MU5 A;  3J80 Q;  1YYW A;  2NUG A;  4Z7Y A;  5IT9 C;  1X48 A;  4LFC E;  3ZZ0 A;  2EFG A;  2HK2 A;  5GMD A;  4JG4 A;  1N32 I;  4DV4 I;  3WU6 A;  1X49 A;  3WU5 A;  3K17 A;  5A2Q C;  1I94 I;  4KHP E;  5BR8 I;  2NA2 A;  1FKA E;  2L3C A;  2L2N A;  2LTS A;  4LF4 E;  1HNZ I;  4DR7 I;  2RSM A;  4URL A;  1ZXM A;  2RS6 A;  4B3T I;  4DUZ E;  3LLH A;  4K0K I;  1H7U A;  2LJH A;  4DR3 I;  1IBL I;  1WHQ A;  1MX0 A;  4DPW A;  2XEX A;  4WFT A;  1YYO A;  4LF8 E;  2UXC I;  1VIS A;  4ED4 A;  2R3V A;  2X7I A;  5A2Q Q;  4JI0 E;  3VYY A;  4LFA I;  4DV1 I;  1XNQ E;  2V2V A;  4JI2 I;  1FNM A;  3F0N A;  3LNU A;  2LRS A;  2UXD E;  4B3M I;  3ADJ A;  2V8P A;  4GKK I;  4DU7 A;  3QT6 A;  2F4V E;  4DPY A;  3ZKD A;  4X64 I;  1KVK A;  2VF3 A;  4DPU A;  2V34 A;  2NUE A;  2VQE I;  3HTX A;  2DEI A;  2HKJ A;  2HHH I;  4AQY E;  4LF7 E;  2LUP B;  3PYG A;  1ZM4 A;  1GQE A;  1MG7 A;  1PIE A;  2HK3 A;  2UU9 I;  4LF4 I;  1RRE A;  1B63 A;  4PRX A;  4X66 I;  3ZM7 A;  2UUB I;  4OX9 E;  1Z0W A;  4JV5 E;  4YHH I;  1XNR E;  2B7T A;  5FLX C;  1IBM E;  2L2M A;  1IBK I;  1FJG E;  2N3H A;  4X62 E;  3B82 A;  2JVA A;  1HR0 E;  2N3G A;  2LJP A;  3P1X A;  1Z5C A;  3T1Y E;  5IWA E;  4DPX A;  5L3J A;  3LTO A;  1N34 I;  1N0U A;  2UXD I;  2UXB E;  5GME A;  4DR5 E;  2EZ6 A;  4DR2 E;  3J7A M;  1HNX I;  4FWG A;  4WUB A;  1PKP A;  1N33 E;  2DEJ A;  4NXN I;  4HAC B;  4USM A;  4JI1 I;  1BKN A;  4JI7 E;  4B3S I;  1Z5A A;  2E5L I;  1UHZ A;  4YY3 E;  2HFS A;  5LL6 R;  3OTO I;  4LF6 I;  1UEK A;  3CWV A;  4DV3 E;  4MYT A;  3ZKB A;  2UUA I;  4LF5 E;  1QZR A; 
#chains in the Genus database with same CATH topology
 4RPF A;  2ODR C;  1H74 A;  2Z5E A;  3C6K A;  2YTD A;  4UT4 A;  4R8O A;  3EPJ A;  1MEY C;  2ENC A;  2C38 B;  2NN6 E;  3M85 G;  4OOG C;  1N36 I;  4LF9 I;  4LFB I;  2NN6 B;  5JEA E;  4Q35 B;  5IT9 Q;  4PU9 A;  1NCS A;  4DV7 E;  3PYD A;  5DNL A;  5JEA B;  1ZBQ A;  4DUY E;  1A6F A;  2JE6 A;  2RQL A;  4GKJ I;  4WSG A;  1A1G A;  4DR6 E;  4NXM E;  3V2U C;  4DR4 I;  1TF3 A;  1XNR I;  3IWC A;  1ZBT A;  1Z0E A;  4DV0 E;  2GO4 A;  1KKH A;  3THO B;  2NAB A;  4IZJ A;  1J5E E;  4UTG A;  3JTZ A;  1UDQ A;  1P47 A;  2M4I A;  1XHK A;  1X6F A;  5F3W A;  1OYR A;  3KWR A;  4DV6 E;  3HPZ A;  1SR9 A;  4JI8 I;  1FI4 A;  3M7N D;  1A1J A;  2HJJ A;  3BF2 A;  2DGC A;  2PO1 A;  1YZ9 A;  1IMU A;  5DNY A;  4GQU A;  4LCH A;  5IWA I;  2RSI A;  4WUC A;  2B9D A;  3V5R A;  5LMN I;  2KHX A;  5KL3 A;  4HYM A;  3JU0 A;  3HUL A;  3PS2 A;  2LUQ A;  3PYF A;  2Q2E B;  2UXB I;  2O1U A;  4ZYE A;  3DJW A;  2KOU A;  4R03 A;  1DGC A;  1SFE A;  1TF6 A;  1DI2 A;  2V83 A;  2VQF E;  3KRN A;  4DPT A;  3HKM A;  2Z5B A;  3J81 C;  2GPI A;  2A2C A;  4B3R I;  2O1V A;  4RHB B;  2NN6 D;  2PNL A;  2YTJ A;  1YUJ A;  1N33 I;  1B69 A;  3VYX A;  2YU8 A;  3F6H A;  5JEA D;  4DR1 E;  5AE2 A;  1OYP A;  2Z5C B;  2PO2 A;  2DB2 A;  3IWD A;  3HPS A;  4LFC I;  5LMU E;  2V86 A;  2I13 A;  2HFU A;  1IQO A;  1Z59 A;  4OO1 E;  4FWH A;  4HAC A;  4DKK A;  2YT4 A;  3KZZ A;  1XMQ E;  2EN6 A;  4JI6 E;  3M7N G;  4JI3 E;  2AE8 A;  2EPM X;  4JYA E;  1NHI A;  3HJC A;  3LPS A;  4DU8 A;  2ZM6 E;  2BV3 A;  4GZN C;  3VHT B;  2VES A;  4KHP I;  4LCF A;  2L8T A;  2B7V A;  3C4B A;  2NUF A;  3EQ1 A;  2EOQ A;  1E3H A;  2LMZ A;  4JI5 E;  1N32 E;  4X65 E;  2CG9 A;  4DV4 E;  4DUZ I;  4M2Z A;  3QT7 A;  4IFD B;  4P78 A;  1QZR A;  2EOF A;  2ZBK B;  2RS7 A;  2L33 A;  2V85 A;  4KWY A;  2EMB A;  1I94 E;  4BA2 A;  2UUC E;  2YRM A;  5BR8 E;  3VK6 A;  3UK3 C;  1GZ6 A;  2EOJ A;  3GCM A;  2C38 A;  3EPL A;  5C0X E;  2JWO A;  4DR7 E;  4AIM A;  4LF8 I;  2NN6 A;  5C0X B;  1YSA C;  1PVG A;  1Y4S A;  4B3T E;  5JEA A;  1HNW E;  4DV2 E;  4HEI A;  4K0K E;  2V2Z A;  2NPF A;  2EM9 A;  4JI0 I;  2EPK X;  1J26 A;  3ADL A;  2EOZ A;  2OI2 A;  3B78 A;  1J5E I;  1Z0B A;  1XNQ I;  1YHC A;  4I8O A;  4DR3 E;  1IBL E;  1O0W A;  3D4J A;  4BA1 B;  3J7Y p;  2MDR A;  4J8Z A;  2J7K A;  2O3Z A;  2JOB A;  3J7A G;  4LOM A;  4DV6 I;  4FW9 A;  2EQ1 A;  3MHH C;  2I9I A;  1H73 A;  4OO1 F;  1A1K A;  4OO1 D;  5ELW A;  1AAY A;  2EMI A;  2L3J A;  3M6A A;  2BR2 B;  1Z0V A;  4LFA E;  1YFH A;  1B62 A;  4DV1 E;  2NN6 C;  1Y6Z A;  3M85 D;  3T1H E;  2EPO A;  2EM2 A;  2BM1 A;  2CT1 A;  4P52 A;  4EMD A;  5FLX Q;  4BHB A;  5JEA C;  4HXZ A;  4JI2 E;  2EML A;  4F9A B;  4DXL A;  2IER A;  1EI1 A;  2GO3 A;  2FV4 B;  3QT5 A;  3L00 A;  2D9H A;  4BHC A;  5CFF E;  1Y4U A;  4GKK E;  1RR9 A;  2YTI A;  1Z0G A;  2A2D A;  1N0V C;  2DSY A;  2RPC A;  3KZY A;  3MSW A;  1H72 C;  2IES A;  4KZS A;  1UDN A;  2LJU A;  3BGH A;  1PDA A;  1ZM2 A;  5C0X D;  2BA1 D;  1UBD C;  1X47 A;  5LMU I;  3MHS C;  2HGH A;  4AQY I;  4WUD A;  1G2F C;  3IWB A;  4LF7 I;  2YTE A;  4M9V C;  3RMP A;  3AV0 A;  2EQ3 A;  2Z5C A;  2VQE E;  3EPH A;  4JI6 I;  1FWK A;  2EMZ A;  4DMI A;  1Z0T A;  1HK7 A;  3K1J A;  1R6M A;  1X6E A;  1A1F A;  1E3P A;  3P76 A;  1STU A;  4O4K A;  2EP3 A;  1S4E A;  1ZM3 A;  4FWD A;  4KQV A;  4OO1 A;  2C39 B;  2HHH E;  4ZVI A;  1KYQ A;  2YTF A;  4JI4 E;  4JI5 I;  4R2C A;  2EOS A;  4X65 I;  4P7D A;  2EOH A;  2LTR A;  2E72 A;  2IHR 1;  1Z0C A;  1Z5B A;  2LBS B;  4OX9 I;  3H4L A;  1T4L B;  2UUC I;  3K85 A;  4JV5 I;  3U1K A;  3C6M A;  1ZM9 A;  3B8H A;  2UU9 E;  1VI7 A;  1IBM I;  2JEB B;  2YTO A;  4X66 E;  2YTP A;  1FJG I;  4X62 I;  4OO1 C;  1HNW I;  2BA1 G;  3CDI A;  5DNX A;  4DV2 I;  1HR0 I;  2UUB E;  2L2K B;  1XXE A;  2BM0 A;  2RTX A;  5A69 A;  3PYE A;  5C0X A;  3T1Y I;  2L6M A;  4YHH E;  1YYK A;  5EL9 A;  4Z7C A;  2CPN A;  1IBK E;  4IJD A;  2EOE A;  2F4V I;  2ZIT A;  1BB8 A;  2LO3 A;  4DR5 I;  1DQ3 A;  2JY9 A;  4X8W A;  1N3G A;  4AID A;  4BS9 A;  2V88 A;  2WW4 A;  5AE3 A;  4I3H A;  4LTY A;  4DR2 I;  2JXP A;  1WXR A;  3P3E A;  4HY1 A;  4XTJ A;  3T1H I;  3F6G A;  2EPC A;  2WNR A;  1EH8 A;  1QU6 A;  1RC7 A;  2LT7 A;  5JEA F;  2DIX A;  1N34 E;  2BA0 D;  2X36 A;  2NN6 F;  2BR2 A;  3ADG A;  2LVH A;  5C0X C;  2FTX B;  2WP8 B;  4DV5 E;  4IS9 A;  2CTD A;  3HQ1 A;  4L5N C;  1KTV A;  1EH6 A;  1UDS A;  3QT8 A;  3TQM A;  2PO0 B;  4R2R A;  1D6T A;  1OJ4 A;  3GME A;  4NHR A;  5A6A A;  1BBO A;  4QNK A;  2V89 A;  3DD6 A;  1UIL A;  2VF1 A;  2EE8 A;  1XMO E;  1EKZ A;  4F9B B;  1HNX E;  1NHH A;  2FGG A;  4M30 A;  4WSP A;  5DRQ A;  4JI7 I;  4M0V A;  1USU A;  1YH8 A;  1PJQ A;  2EM3 A;  2J7J A;  2WCC 3;  3WU3 A;  1NHJ A;  5IXM B;  1KIJ A;  2IOQ A;  2M1S A;  3ZZT A;  2EOO A;  2H36 X;  4NXN E;  1DAR A;  1S16 A;  4TUG A;  3C4T A;  2F8B A;  4LCG A;  4MU0 A;  1WHN A;  4YY3 I;  2JEA B;  2BB8 A;  4M1K A;  2HC5 A;  4DV3 I;  3J81 Q;  4JI1 E;  2JP9 A;  2PNZ B;  4LF5 I;  1T4O A;  2HKE A;  3ZZU A;  4IFD E;  2JPA A;  4B3S E;  4F2J C;  2IOP A;  4WYQ B;  4N3O A;  4Q28 A;  4DV0 I;  1T4N A;  2DLK A;  2E5L E;  1RMD A;  4BC7 A;  2B3T B;  3OTO E;  4JI4 I;  4LF6 E;  1PJS A;  2BA0 G;  3THN A;  4FW3 A;  4DV7 I;  1X6H A;  1HNZ E;  2E1R A;  4FW5 A;  3K6Q A;  4DUY I;  1FWL A;  3WU4 A;  4MU4 A;  2UUA E;  2LE2 A;  1WUU A;  4U3B A;  4R1F A;  4DR6 I;  2L92 A;  4NXM I;  1GTK A;  1TN9 A;  2DMY A;  4U3D A;  4FN5 A;  1T38 A;  5A6K A;  1A1L A;  2GQ0 A;  3P3C A;  4LF9 E;  1N36 E;  4LFB E;  5DRO A;  1U2R A;  2E1M A;  2JE6 B;  2R76 A;  2EOR A;  1K47 A;  3HXL A;  5K36 E;  4LU9 A;  4BC9 A;  3Q6N A;  4PRV A;  4GKJ E;  5K36 B;  4IZJ B;  2UXC E;  2PNM A;  2C37 B;  2EPU A;  2CZ9 A;  4RH8 A;  1Z1B A;  4DR4 E;  4AM3 A;  4WXD A;  2G7H A;  3JAM C;  4P7A A;  1Y5Y A;  2V2Q A;  2CGE A;  3B4T A;  2EOY A;  2PO1 B;  2EL4 A;  2YRH A;  5LLQ A;  1EA6 A;  2M7Q A;  1ELO A;  4B3M E;  4MYU A;  1NZ0 A;  2YTN A;  1RQ0 A;  4JI8 E;  2ELZ A;  3DF6 A;  3J80 C;  3ADI A;  3Q1Q A;  2VQF I;  2YRK A;  4IFD D;  2LCE A;  1ZXN A;  1ZU1 A;  5LMN E;  2WBT A;  3H1C A;  2GHF A;  5DRP A;  4IS1 C;  4USK A;  2AJ4 A;  4DV5 I;  4F54 A;  4NBQ A;  5FWK A;  2R42 A;  2EMY A;  4X64 E;  2EQ0 A;  4DR1 I;  1EH7 A;  5C0X F;  2EN2 A;  1X5W A;  5AE1 A;  1XMO I;  2WP8 A;  3ECR A;  4X9J A;  2PRT A;  1JK2 A;  1A1I A;  3JAM Q;  2PO0 A;  4B3R E;  1WRJ A;  1XMQ I;  2EN3 A;  2WZO A;  5TSE A;  2MDG A;  3GON A;  4JI3 I;  4JYA I;  1G2D C;  3BID A;  2GS8 A;  2EL5 A;  4IZK B;  1YPN A;  2EOX A;  2F1D A;  2EMA A;  2ZM6 I;  1H7S A;  1MU5 A;  3J80 Q;  1YYW A;  2EM0 A;  2NUG A;  1F2I G;  5K36 D;  4Z7Y A;  5IT9 C;  1X48 A;  4LFC E;  2EMK A;  3ZZ0 A;  3LML A;  5AC5 A;  5A6B A;  2EFG A;  2O1W A;  2HK2 A;  5GMD A;  3PS1 A;  4JG4 A;  3Q6M A;  4BMJ A;  2J65 A;  4LPF A;  3U1Y A;  4DV4 I;  3WU6 A;  2EOM A;  1X49 A;  1PJT A;  3WU5 A;  2PNZ A;  3K17 A;  3L7Z B;  5A2Q C;  1I94 I;  4KHP E;  5BR8 I;  3BBG A;  2NA2 A;  1FKA E;  2LV2 A;  2O1T A;  2L3C A;  4IFD A;  2L2N A;  2EMX A;  4O43 A;  2LTS A;  4LF4 E;  1HNZ I;  4DR7 I;  2K7I A;  2RSM A;  4URL A;  1X3C A;  1NEI A;  4R2S A;  2RS6 A;  4BCA A;  1Y60 A;  1ZXM A;  2EMW A;  4B3T I;  2EWL A;  3LLH A;  4DUZ E;  2VE7 C;  3AUZ A;  4K0K I;  1H7U A;  2EM4 A;  2BBG A;  2LJH A;  4DR3 I;  3P3G A;  1IBL I;  4NZV A;  1WHQ A;  1MX0 A;  4DPW A;  2XEX A;  4WFT A;  3ZOQ B;  1YYO A;  4LF8 E;  2UXC I;  1VIS A;  4ED4 A;  4BA1 A;  2R3V A;  2ELY A;  2X7I A;  1UDO A;  4MQY A;  5A2Q Q;  4IFD C;  4JI0 E;  2EMF A;  5K36 A;  5ADZ A;  3VYY A;  4LFA I;  4FW4 A;  1XNQ E;  1IQS A;  1MGT A;  2C37 A;  2V2V A;  4DV1 I;  2MC6 A;  2EN4 A;  2DLQ A;  4JI2 I;  1FNM A;  1WJP A;  3F0N A;  3LNU A;  4ISA A;  2LRS A;  2UXD E;  4MLV A;  4B3M I;  3ADJ A;  2V8P A;  3GLL A;  5DRR A;  4GKK I;  2N8X A;  4L8N A;  4DU7 A;  3QT6 A;  2YPN A;  2F4V E;  2MKD A;  5T6J A;  5IV8 B;  5KL5 A;  4DPY A;  1KJK A;  2EM8 A;  1P42 A;  3ZKD A;  4X64 I;  1KVK A;  5K36 C;  5AC4 A;  1USV A;  2VF3 A;  4DPU A;  2DMI A;  3QG5 C;  1JK1 A;  1BBG A;  2YWQ A;  2V34 A;  2NUE A;  4FK5 C;  4R2P A;  3HTX A;  2DRP A;  2VQE I;  2EMC A;  2EPP A;  4WX9 A;  4O5G A;  2DEI A;  2HKJ A;  4R2E A;  2WBS A;  2CSH A;  2ENH A;  2HHH I;  4BBY A;  5KL6 A;  4AQY E;  4IZK A;  2WBU A;  4GEQ B;  3NZK A;  4LF7 E;  2LUP B;  4OO1 B;  3PYG A;  2C39 A;  1ZM4 A;  1GQE A;  4ZYH A;  1MG7 A;  1LLM C;  1PIE A;  1YUI A;  2KON A;  2HK3 A;  2UU9 I;  4LF4 I;  1RRE A;  3L7Z A;  2M9A A;  1B63 A;  4PRX A;  3UHM A;  4X66 I;  2EMH A;  4WPY A;  4N4R B;  2EPL X;  2YU5 A;  4O24 A;  1R6L A;  4R2A A;  4WXC A;  4F6N A;  4OX9 E;  2JEB A;  4FW7 A;  3ZM7 A;  1RHY A;  4OKG A;  1Z0W A;  2EPA A;  2UUB I;  4MDT A;  2ODR D;  4F6M A;  4JV5 E;  2YZT A;  4YHH I;  1XNR E;  2B7T A;  2EOI A;  5FLX C;  5A6B D;  1IBM E;  2L2M A;  5EKW A;  1IBK I;  1FJG E;  2N3H A;  2YTG A;  4MLQ A;  4X62 E;  4FW6 A;  3B82 A;  2JVA A;  1HR0 E;  5KL2 A;  2MC5 A;  2JT2 A;  2JOX A;  4TUI A;  2N3G A;  3OML A;  3P1X A;  2LJP A;  2EN1 A;  2EJ4 A;  2EM6 A;  3T1Y E;  1Z5C A;  5IWA E;  2MKN A;  3PS3 A;  4DPX A;  4IFD F;  5L3J A;  3LTO A;  2Q8U A;  1N34 I;  3EPK A;  2EM7 A;  1N0U A;  2UXD I;  1AH5 A;  2UXB E;  5GME A;  2WNR B;  4DR5 E;  1L4S A;  2Z5B B;  3CDJ A;  4MU1 A;  1QNT A;  2EZ6 A;  2EPR A;  2YTQ A;  4DR2 E;  1OYS A;  4QNJ A;  5KL7 A;  3J7A M;  1HNX I;  1UN6 B;  2EMG A;  2VRD A;  3H09 A;  2JYA A;  4FWG A;  4HTG A;  4WUB A;  1PKP A;  2PO2 B;  2JR1 A;  1N33 E;  2DEJ A;  3PRY A;  2EL6 A;  4OZE A;  4NXN I;  2EN8 A;  1A1H A;  2R1F A;  2EM5 A;  4HAC B;  5K36 F;  4IZJ D;  2YSP A;  3M99 B;  4USM A;  4JI1 I;  1N32 I;  1ZR9 A;  4R2D A;  1BKN A;  1T39 A;  4JI7 E;  4F9C B;  2V87 A;  4MU3 A;  4B3S I;  2K4V A;  4R2Q A;  4ZYD A;  4J3D A;  2CVE A;  2JEA A;  5AAS A;  1Z5A A;  2ENA A;  2A25 A;  2V8Q B;  2EPZ A;  2E5L I;  1UHZ A;  1ZAA C;  4YY3 E;  2EPX A;  3FIG A;  5LL6 R;  4ZYG A;  2EPN A;  2ADR A;  2YSO A;  2HFS A;  3OTO I;  4LF6 I;  1UEK A;  2EN7 A;  5A6J A;  4DV3 E;  3CWV A;  3P06 A;  4MYT A;  3ZKB A;  2UUA I;  4LF5 E;  2GLI A;  5KL4 A;  4BA2 B; 
#chains in the Genus database with same CATH homology
 4RPF A;  2ODR C;  1H74 A;  2Z5E A;  4UT4 A;  4R8O A;  4LF9 I;  4OOG C;  1N36 I;  4LFB I;  5IT9 Q;  4PU9 A;  4DV7 E;  3PYD A;  1ZBQ A;  4DUY E;  1A6F A;  4GKJ I;  4DR6 E;  4NXM E;  3V2U C;  4DR4 I;  1XNR I;  3IWC A;  1ZBT A;  1Z0E A;  4DV0 E;  1KKH A;  4UTG A;  4IZJ A;  1J5E E;  3JTZ A;  2M4I A;  1XHK A;  5F3W A;  3KWR A;  4DV6 E;  3HPZ A;  1SR9 A;  4JI8 I;  1FI4 A;  1YZ9 A;  5DNY A;  5IWA I;  2B9D A;  3V5R A;  5LMN I;  2KHX A;  4HYM A;  3JU0 A;  3HUL A;  2LUQ A;  3PYF A;  2Q2E B;  2UXB I;  2O1U A;  3DJW A;  2KOU A;  4R03 A;  1DI2 A;  2V83 A;  2VQF E;  4DPT A;  2Z5B A;  3J81 C;  2A2C A;  4B3R I;  2O1V A;  2PNL A;  1N33 I;  3VYX A;  3F6H A;  4DR1 E;  5AE2 A;  2Z5C B;  2DB2 A;  3IWD A;  3HPS A;  4LFC I;  5LMU E;  2V86 A;  2HFU A;  1Z59 A;  4FWH A;  4HAC A;  4DKK A;  2YT4 A;  1XMQ E;  4JI6 E;  4JI3 E;  4JYA E;  1NHI A;  3HJC A;  3LPS A;  4DU8 A;  2ZM6 E;  2BV3 A;  4KHP I;  2L8T A;  2B7V A;  3C4B A;  2NUF A;  2LMZ A;  4JI5 E;  1N32 E;  4X65 E;  2CG9 A;  4DV4 E;  4DUZ I;  4M2Z A;  3QT7 A;  4P78 A;  2ZBK B;  2RS7 A;  2L33 A;  2V85 A;  1I94 E;  2UUC E;  5BR8 E;  3VK6 A;  1GZ6 A;  2JWO A;  4DR7 E;  4LF8 I;  1PVG A;  1Y4S A;  4B3T E;  1HNW E;  4DV2 E;  4K0K E;  2V2Z A;  2NPF A;  4JI0 I;  1J26 A;  3ADL A;  3B78 A;  2OI2 A;  1J5E I;  1Z0B A;  1XNQ I;  4DR3 E;  4I8O A;  1IBL E;  1O0W A;  3D4J A;  3J7Y p;  2MDR A;  4J8Z A;  2J7K A;  2JOB A;  3J7A G;  4DV6 I;  4FW9 A;  1H73 A;  2L3J A;  3M6A A;  1Z0V A;  4LFA E;  1B62 A;  4DV1 E;  2F4V I;  1Y6Z A;  3T1H E;  2BM1 A;  4EMD A;  4P52 A;  5FLX Q;  4HXZ A;  4JI2 E;  4F9A B;  4DXL A;  1EI1 A;  3QT5 A;  2FV4 B;  5CFF E;  1Z0G A;  1Y4U A;  4GKK E;  1RR9 A;  2A2D A;  1N0V C;  2DSY A;  3MSW A;  1H72 C;  4KZS A;  1ZM2 A;  1X47 A;  5LMU I;  4AQY I;  4WUD A;  3IWB A;  4LF7 I;  3RMP A;  3AV0 A;  2Z5C A;  2VQE E;  4JI6 I;  1FWK A;  4DMI A;  1Z0T A;  1HK7 A;  3K1J A;  1STU A;  1S4E A;  1ZM3 A;  4FWD A;  4KQV A;  2HHH E;  4ZVI A;  4JI4 E;  4JI5 I;  4X65 I;  4P7D A;  2LTR A;  1Z0C A;  2IHR 1;  1Z5B A;  2LBS B;  4OX9 I;  3H4L A;  1T4L B;  2UUC I;  3K85 A;  4JV5 I;  1ZM9 A;  3B8H A;  2UU9 E;  1IBM I;  4X66 E;  1FJG I;  4X62 I;  1HNW I;  4DV2 I;  1HR0 I;  2UUB E;  2L2K B;  2BM0 A;  2RTX A;  3PYE A;  3T1Y I;  2L6M A;  4YHH E;  1YYK A;  4Z7C A;  2CPN A;  1IBK E;  2ZIT A;  4DR5 I;  1DQ3 A;  2JY9 A;  4X8W A;  4BS9 A;  2V88 A;  2WW4 A;  5AE3 A;  4I3H A;  4LTY A;  4DR2 I;  1WXR A;  4HY1 A;  4XTJ A;  3T1H I;  3F6G A;  1RC7 A;  1QU6 A;  2DIX A;  1N34 E;  2X36 A;  3ADG A;  2FTX B;  4WUC A;  4DV5 E;  3ZZU A;  3HQ1 A;  4L5N C;  1KTV A;  3QT8 A;  1D6T A;  1OJ4 A;  2V89 A;  1UIL A;  2VF1 A;  1XMO E;  1EKZ A;  1NZ0 A;  4F9B B;  1HNX E;  1NHH A;  2FGG A;  4M30 A;  4WSP A;  4JI7 I;  4M0V A;  1USU A;  3WU3 A;  1NHJ A;  1KIJ A;  2IOQ A;  2M1S A;  3ZZT A;  2H36 X;  4NXN E;  1DAR A;  1S16 A;  4TUG A;  3C4T A;  2F8B A;  4YY3 I;  1WHN A;  4M1K A;  4DV3 I;  3J81 Q;  4JI1 E;  4LF5 I;  1T4O A;  2HKE A;  4B3S E;  2IOP A;  4WYQ B;  4N3O A;  4Q28 A;  1T4N A;  2E5L E;  4BC7 A;  2B3T B;  3OTO E;  4JI4 I;  4LF6 E;  4DV7 I;  1HNZ E;  2E1R A;  3K6Q A;  4DUY I;  1FWL A;  3WU4 A;  2UUA E;  2LE2 A;  1WUU A;  4DR6 I;  4R1F A;  2L92 A;  4NXM I;  2DMY A;  4FN5 A;  4DV0 I;  2GQ0 A;  4LF9 E;  1N36 E;  4LFB E;  1U2R A;  2E1M A;  1K47 A;  3HXL A;  4LU9 A;  4BC9 A;  3Q6N A;  4PRV A;  4GKJ E;  4IZJ B;  2UXC E;  2PNM A;  2CZ9 A;  4DR4 E;  2G7H A;  3JAM C;  4P7A A;  2V2Q A;  2CGE A;  1EA6 A;  2M7Q A;  1ELO A;  4B3M E;  4MYU A;  3J80 C;  1RQ0 A;  4JI8 E;  3DF6 A;  3ADI A;  3Q1Q A;  2VQF I;  1ZXN A;  5LMN E;  4USK A;  2AJ4 A;  4DV5 I;  4F54 A;  5FWK A;  2R42 A;  4DR1 I;  4X64 E;  5AE1 A;  1XMO I;  3JAM Q;  4B3R E;  1XMQ I;  2WZO A;  3GON A;  4JI3 I;  4JYA I;  2GS8 A;  4IZK B;  2ZM6 I;  1H7S A;  1MU5 A;  3J80 Q;  1YYW A;  2NUG A;  4Z7Y A;  5IT9 C;  1X48 A;  4LFC E;  3ZZ0 A;  3LML A;  2EFG A;  2O1W A;  2HK2 A;  5GMD A;  4JG4 A;  1N32 I;  3Q6M A;  4BMJ A;  4DV4 I;  3WU6 A;  1X49 A;  3WU5 A;  3K17 A;  5A2Q C;  1I94 I;  4KHP E;  5BR8 I;  2NA2 A;  1FKA E;  2O1T A;  2L3C A;  2L2N A;  2LTS A;  4LF4 E;  1HNZ I;  4DR7 I;  2RSM A;  4URL A;  1ZXM A;  2RS6 A;  4BCA A;  4B3T I;  2EWL A;  3LLH A;  4DUZ E;  2VE7 C;  3AUZ A;  4K0K I;  1H7U A;  2LJH A;  4DR3 I;  1IBL I;  1WHQ A;  1MX0 A;  4DPW A;  2XEX A;  4WFT A;  3ZOQ B;  1YYO A;  4LF8 E;  2UXC I;  1VIS A;  4ED4 A;  2R3V A;  2X7I A;  5A2Q Q;  4JI0 E;  5ADZ A;  3VYY A;  4LFA I;  4DV1 I;  1XNQ E;  2V2V A;  2MC6 A;  4JI2 I;  1FNM A;  3F0N A;  3LNU A;  2LRS A;  2UXD E;  4B3M I;  3ADJ A;  2V8P A;  4GKK I;  4L8N A;  4DU7 A;  3QT6 A;  2F4V E;  5T6J A;  4DPY A;  3ZKD A;  4X64 I;  1KVK A;  1USV A;  2VF3 A;  4DPU A;  2V34 A;  2NUE A;  2VQE I;  3HTX A;  2DEI A;  2HKJ A;  2HHH I;  4BBY A;  4AQY E;  4IZK A;  4GEQ B;  4LF7 E;  2LUP B;  3PYG A;  1ZM4 A;  1GQE A;  1MG7 A;  1PIE A;  2KON A;  2HK3 A;  2UU9 I;  4LF4 I;  1RRE A;  1B63 A;  4PRX A;  4X66 I;  4WPY A;  3ZM7 A;  2UUB I;  4OX9 E;  1Z0W A;  2ODR D;  4JV5 E;  2YZT A;  4YHH I;  1XNR E;  2B7T A;  5FLX C;  1IBM E;  2L2M A;  1IBK I;  1FJG E;  2N3H A;  4X62 E;  3B82 A;  2JVA A;  1HR0 E;  2MC5 A;  2JOX A;  4TUI A;  2N3G A;  3OML A;  3P1X A;  2LJP A;  1Z5C A;  3T1Y E;  5IWA E;  4DPX A;  5L3J A;  3LTO A;  1N34 I;  1N0U A;  2UXD I;  2UXB E;  5GME A;  4DR5 E;  2Z5B B;  2EZ6 A;  4DR2 E;  3J7A M;  1HNX I;  3H09 A;  4FWG A;  4WUB A;  1PKP A;  2JR1 A;  1N33 E;  2DEJ A;  3PRY A;  4NXN I;  4HAC B;  4IZJ D;  4USM A;  4JI1 I;  1BKN A;  4JI7 E;  4F9C B;  2V87 A;  4B3S I;  2K4V A;  5AAS A;  1Z5A A;  2V8Q B;  2E5L I;  1UHZ A;  4YY3 E;  3FIG A;  5LL6 R;  2HFS A;  3OTO I;  4LF6 I;  1UEK A;  3CWV A;  4DV3 E;  3P06 A;  4MYT A;  3ZKB A;  2UUA I;  4LF5 E;  1QZR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...