1N32E

Structure of the thermus thermophilus 30s ribosomal subunit bound to codon and near-cognate transfer rna anticodon stem-loop mismatched at the first codon position at the a site with paromomycin
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
150
structure length
150
Chain Sequence
b'DFEEKMILIRRTARMQAGGRRFRFGALVVVGDRQGRVGLGFGKAPEVPLAVQKAGYYARRNMVEVPLQNGTIPHEIEVEFGASKIVLKPAAPGTGVIAGAVPRAILELAGVTDILTKELGSRNPINIAYATMEALRQLRTKADVERLRKG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S RIBOSOMAL RNA
publication title Selection of tRNA by the Ribosome Requires a Transition from an Open to a Closed Form
pubmed doi rcsb
molecule tags Ribosome
total genus 35
structure length 150
sequence length 150
ec nomenclature
pdb deposition date 2002-10-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00333 Ribosomal_S5 Ribosomal protein S5, N-terminal domain
E PF03719 Ribosomal_S5_C Ribosomal protein S5, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.20 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 1n32E01
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 1n32E02
4DR7E 4DUYI 4DKKA 3ADLA 4JI1I 4DPYA 4URLA 1B63A 2LUQA 3WU6A 2UU9I 4JI3E 3QT7A 4LF6I 4UT4A 2LUPB 1IBMI 3PYGA 2UXBI 2BM1A 1QZRA 3JAMQ 3PYFA 3J7AM 1N36E 4LF4E 1EI1A 1N32E 4PRVA 4JI6E 2ZITA 5LMUI 4P52A 2L3CA 4B3RI 3C4TA 1ZBTA 3HULA 4XTJA 1N0VC 2L33A 3J7Yp 3QT6A 2LTRA 1B62A 3D4JA 2VQEE 2HFSA 4B3MI 2UXDE 1HNWE 4DR6I 1WHQA 4X8WA 3B78A 4DR3E 4DU8A 5IT9C 4X62E 3T1YE 1PVGA 1Z0VA 4LFCE 3J80Q 3VYXA 2UUCE 4LF5E 2DB2A 4FW9A 3J7AG 3OTOE 1H72C 1PIEA 3V2UC 4DR1E 2VQEI 1NHJA 5GMEA 4DV1I 4B3TI 4DV3E 2NPFA 4K0KE 4DPWA 3HTXA 5IWAE 1N0UA 1H7SA 4DR3I 1UHZA 4X62I 1N34E 1J5EI 2L2NA 4DV5I 4DR2E 4LFCI 4X66I 4M1KA 1H74A 2HKEA 2ZM6E 1XNRI 1I94I 2GS8A 5A2QQ 4DR1I 1T4LB 4P7AA 2N3GA 4YY3I 4YHHE 2EFGA 3ZZTA 1YYKA 3CWVA 1X47A 4GKJE 2UUAI 3ZM7A 3ZZUA 1UILA 4DXLA 1WUUA 4AQYI 1HNXI 4HYMA 1N33E 4X65E 2HHHE 2J7KA 1HR0I 3JAMC 1DI2A 1IBKI 2HFUA 3PYDA 4R1FA 3ADJA 3WU3A 1S4EA 1IBLI 2VQFI 3C4BA 2V2VA 3T1HI 1RREA 4NXNE 1Z59A 1XMOE 1O0WA 4DUZE 2DEJA 4DV2E 4JI0E 4DV7I 1Z0TA 4JYAE 2BM0A 4WFTA 4JI8I 2JVAA 4PRXA 2A2CA 4FWHA 4JI5I 4DR5E 4NXNI 1BKNA 5GMDA 5FLXQ 4LF7E 3J80C 4DR7I 3V5RA 1S16A 1FWLA 3WU4A 4JI3I 1D6TA 2L3JA 1Z0BA 1OJ4A 1EKZA 5L3JA 3ADGA 4KQVA 3ZKBA 2RSMA 2F4VE 3J81Q 2E5LE 4LF8E 5A2QC 1N36I 4LF4I 1ZM4A 1K47A 1N32I 4RPFA 1XMQE 4JI6I 1PKPA 5LMNE 2BV3A 4DV0E 4OX9E 4LFAE 1WHNA 2YT4A 1ZXNA 2F4VI 2UXDI 1HNWI 4B3SE 2UXCE 4KHPE 2CPNA 4GKKE 4HACA 2E5LI 4LF9E 2R42A 1KVKA 1YYWA 2MDRA 1YZ9A 1UEKA 1MX0A 3T1YI 4LFBE 1U2RA 2LRSA 2RS7A 2UUCI 4LF5I 4ED4A 4M30A 3OTOI 1RQ0A 1HNZE 4DV3I 4DR4E 4K0KI 2HK2A 5IWAI 1NZ0A 1FWKA 2WW4A 1FJGE 1ZM3A 3WU5A 1N34I 2RS6A 2V2QA 4DR2I 4JI2E 5FLXC 4I3HA 4HXZA 2ZM6I 4JI4E 1T4OA 2VF3A 1Z0CA 3LNUA 4JV5E 4FWGA 2HKJA 1DARA 2DEIA 4HACB 4YHHI 4DV6E 2UUBE 2CZ9A 4GKJI 2NUEA 4FWDA 5BR8E 1A6FA 1ZXMA 1ZM9A 4DUYE 5LL6R 3H4LA 4JG4A 2RTXA 4EMDA 1EA6A 3M6AA 4JI2I 4JI1E 4Z7YA 1N33I 4X64E 4X65I 2HHHI 3K17A 3J81C 2UU9E 1Z0GA 4LF6E 4UTGA 2L2MA 1XNQE 4DPXA 4DV6I 2UUBI 2LTSA 1IBME 2XEXA 5BR8I 3ZKDA 3P1XA 1RC7A 2UXBE 2JY9A 1XMOI 4DUZI 4X64I 4DV2I 5LMUE 4JI0I 2V2ZA 1FKAE 4JYAI 2B3TB 1MU5A 4B3RE 1XNQI 4OOGC 2DIXA 3K1JA 2L2KB 4USKA 4DR5I 4MYUA 4WUDA 1X48A 4B3ME 2AJ4A 4LF7I 4DR6E 2Q2EB 1H7UA 4DPTA 4WYQB 1VISA 3QT5A 2A2DA 2N3HA 4DPUA 2EZ6A 1ZM2A 1KKHA 1Z5AA 2X7IA 2E1RA 1FNMA 4JI7E 3LPSA 4DV1E 4B3TE 1GQEA 4LF8I 2X36A 4NXME 1J5EE 1XHKA 1XMQI 4WUBA 5LMNI 1QU6A 4PU9A 2LBSB 4DV5E 4Z7CA 4X66E 1Z5BA 3VYYA 4DV0I 2V34A 2NUGA 1XNRE 4OX9I 3LLHA 1I94E 5CFFE 4JI7I 4LFAI 4ZVIA 3F0NA 4M2ZA 3QT8A 4YY3E 4B3SI 2UXCI 4GKKI 4KHPI 1FI4A 4LF9I 2OI2A 2R3VA 2UUAE 3B82A 2NUFA 4NXMI 3GONA 4FN5A 1KTVA 2KHXA 4DV4E 2HK3A 3Q1QA 4AQYE 2NA2A 1HNXE 1KIJA 1Z0EA 1YYOA 1Z0WA 1HR0E 4MYTA 4LFBI 1H73A 1NHHA 2DMYA 4WUCA 4DU7A 1IBKE 1RR9A 1HNZI 1IBLE 1J26A 1STUA 5IT9Q 4DR4I 2VQFE 4USMA 2V8PA 4HY1A 3T1HE 1ELOA 2B7TA 1MG7A 1FJGI 3LTOA 4DV4I 1X49A 1T4NA 2B7VA 1Z5CA 2ZBKB 2LJHA 2LJPA 4JI4I 4DV7E 4JV5I 3ADIA 1NHIA 2IHR1 4JI8E 3B8HA 3ZZ0A 3PYEA 4JI5E
chains in the Genus database with same CATH superfamily
2M1SA 2JR1A 5JEAA 4R8OA 1A1LA 3P3GA 5C0XF 2YTOA 4DR7E 2YTPA 4DKKA 4DUYI 3BBGA 2JT2A 4R03A 3ADLA 2DMIA 3C6MA 4KZSA 1TF3A 4MLVA 4RHBB 1G2FC 2PO0B 4JI1I 1IMUA 4IZJD 4DPYA 1X3CA 2LUQA 1B63A 4MU0A 4URLA 3P76A 3WU6A 2UU9I 2ELYA 4JI3E 5AASA 4IS1C 3B4TA 3QT7A 4LF6I 5AE2A 3IWCA 2EMBA 1P47A 2AE8A 4BA1A 2YU8A 1AAYA 2NN6C 4UT4A 2LUPB 1SR9A 4WPYA 2EPZA 1TN9A 1BB8A 2H36X 2L6MA 1IBMI 3P3EA 3PYGA 1A1FA 2JEBB 3QG5C 2UXBI 2BM1A 4F54A 5JEAC 1QZRA 2EPCA 5EL9A 3U1YA 2ENAA 4P7DA 3PYFA 3JAMQ 4LTYA 2BR2A 3J7AM 2MC6A 2V89A 1N36E 4LF4E 2LCEA 2MDGA 3UHMA 1EI1A 3L7ZB 2EOJA 1N32E 2ADRA 5K36F 4PRVA 4JI6E 2ZITA 3THOB 5LMUI 2EMKA 4BCAA 2NN6B 1Y5YA 4P52A 2L3CA 2EMCA 2GQ0A 2WBTA 4B3RI 2A25A 3C4TA 1ZBTA 4GZNC 2JPAA 3HULA 4XTJA 1UDSA 1UBDC 2L33A 1N0VC 2ODRC 2EPOA 2JOXA 2LTRA 3J7Yp 1YUJA 2EOXA 5A6AA 1B62A 2IERA 3QT6A 4IZKA 5JEAB 2G7HA 3D4JA 2VQEE 2HFSA 2HC5A 4B3MI 2UXDE 1HNWE 4DR6I 1WHQA 2PNMA 4X8WA 3P06A 4IFDF 2EM8A 2YSOA 3B78A 2LVHA 4LCHA 4NBQA 4DR3E 4DU8A 5IT9C 4X62E 1DGCA 2CGEA 4BA1B 2YTGA 3AUZA 1E3PA 3JTZA 2LMZA 4ZYEA 3T1YE 1PVGA 4LFCE 1Z0VA 2E72A 2KONA 5T6JA 3M7ND 3J80Q 1R6LA 4F9AB 3VYXA 2GO4A 2UUCE 4LF5E 2O1TA 2DB2A 4FW9A 3J7AG 3OTOE 1H72C 1PIEA 3V2UC 4DR1E 2VQEI 1NHJA 5GMEA 4DV1I 4B3TI 2BR2B 4DV3E 3FIGA 1A1KA 2NPFA 4IFDD 4K0KE 4U3BA 4DPWA 2JE6A 3HTXA 5IWAE 1N0UA 1H7SA 4DR3I 4I8OA 1UHZA 2F8BA 4FW3A 1NEIA 2EN8A 2BA0D 1N34E 2JEBA 2O1VA 4X62I 1J5EI 1QNTA 2EMGA 4F9BB 5A6KA 4R2SA 3Q6MA 4FW4A 5F3WA 2L2NA 4DV5I 4DR2E 2BBGA 5TSEA 2HGHA 4LFCI 1IQSA 4ZYHA 4X66I 3M7NG 4M1KA 1H74A 2HKEA 2ZM6E 2PO0A 1XNRI 2O3ZA 4IZKB 1I94I 2LE2A 1A1GA 2GS8A 5A2QQ 3U1KA 2CG9A 3EPLA 1T4LB 4DR1I 2GLIA 1YPNA 4P7AA 4MU4A 2V8QB 2N3GA 4YY3I 4YHHE 2EFGA 4BC9A 3MSWA 4FW5A 4OO1E 3ZZTA 1YYKA 4F6MA 1X47A 2EMLA 4GKJE 3CWVA 2UUAI 4L5NC 4U3DA 1USVA 2BA0G 5C0XE 3GMEA 3ZM7A 3ZZUA 5JEAF 4LU9A 2B9DA 1UILA 4BC7A 4DXLA 2EQ0A 1WUUA 4AQYI 1E3HA 4ISAA 2WZOA 1HNXI 4HYMA 1N33E 4X65E 2N8XA 2HHHE 4FK5C 1L4SA 2EM7A 1TF6A 2DGCA 2J7KA 1HR0I 4X9JA 3JAMC 2O1WA 1DI2A 1OYRA 2EORA 1IBKI 2HFUA 3RMPA 1Y6ZA 3PS1A 2EOHA 2BB8A 3PYDA 4R1FA 3ADJA 3WU3A 1S4EA 1IBLI 2ENHA 4OZEA 2JE6B 1BBOA 2I9IA 2EN7A 2VF1A 5DRPA 2L92A 3H09A 2VQFI 2EP3A 3KRNA 3C4BA 2V2VA 3T1HI 1RREA 5IV8B 4NXNE 1RMDA 3M99B 2JP9A 2V87A 1Z59A 4IJDA 1YSAC 2MC5A 3IWBA 2LV2A 1XMOE 1O0WA 1NCSA 5EKWA 2EPUA 4DUZE 2M4IA 2GPIA 2R1FA 2YTIA 2DEJA 4AM3A 5K36E 3BF2A 4DV2E 5KL5A 4ZYDA 4JI0E 1JK1A 4MU3A 3F6HA 4DV7I 3PS2A 1Z0TA 4MLQA 4JYAE 2EMIA 2BM0A 4WFTA 3L00A 1GTKA 4JI8I 2JVAA 4O24A 4PRXA 4Q35B 1ZU1A 2A2CA 2V83A 4OO1D 4FWHA 4JI5I 4DR5E 2DRPA 3KZZA 4NXNI 1BKNA 5AC5A 5C0XD 5GMDA 5FLXQ 2V86A 4LF7E 3J80C 4DR7I 2EOSA 1A1HA 2IESA 2PNZA 3V5RA 4N4RB 1S16A 4IFDE 2EQ3A 1IQOA 1A1JA 5KL2A 4O5GA 4IZJA 4FW6A 2VE7C 1WXRA 4GQUA 2EM9A 1FWLA 3WU4A 4MQYA 4Q28A 4HTGA 4R2AA 4JI3I 1D6TA 2L3JA 2JEAA 2EM4A 1B69A 1Z0BA 1OJ4A 1EKZA 2PO1A 3MHHC 5L3JA 4OO1A 2EQ1A 1PJSA 2WCC3 4WXCA 2EOMA 2GO3A 2C37A 3HPZA 5C0XA 3ADGA 2ELZA 2EN1A 4KQVA 3ZKBA 4R2RA 2RSMA 2EWLA 2F4VE 3J81Q 2E5LE 1ZR9A 5A2QC 2EMFA 2EMAA 2JWOA 4LF8E 4N3OA 1N36I 2WP8B 4LF4I 4L8NA 1ZM4A 2CSHA 5K36D 1K47A 1N32I 4RPFA 1XMQE 4BHCA 4JI6I 1PKPA 5LMNE 4BBYA 2PO2B 2BV3A 4DV0E 2IOQA 2EM0A 1R6MA 2EPAA 4OX9E 1OYSA 2EOZA 1ZAAC 4LFAE 2O1UA 1WHNA 5C0XC 2PNZB 2EOYA 2YT4A 2EPLX 1ZXNA 1YH8A 2F4VI 2UXDI 1HNWI 4B3SE 2UXCE 4KHPE 2CPNA 4GKKE 4HACA 5DRRA 5FWKA 2E5LI 4LF9E 2R42A 4IZJB 1KVKA 1YYWA 2MDRA 1YZ9A 2WNRB 3DF6A 1UEKA 2F1DA 4R2DA 5JEAE 1F2IG 2YSPA 1BBGA 4MDTA 2JEAB 1MX0A 3C6KA 1EH6A 3EPJA 3T1YI 2PO1B 3EQ1A 4R2EA 2LT7A 4OO1B 4LFBE 1U2RA 1WJPA 2C37B 5C0XB 2LRSA 1WRJA 2RS7A 2UUCI 4LF5I 4ED4A 2CTDA 5KL4A 4M30A 3OTOI 1RQ0A 1HNZE 2NN6F 2YZTA 4DV3I 4IFDA 3KWRA 4DR4E 3H1CA 4K0KI 2EN3A 3THNA 4KWYA 2HK2A 5IWAI 1NZ0A 1FWKA 2WW4A 1FJGE 5ELWA 2HJJA 1UDQA 1YHCA 1T38A 1ZM3A 3KZYA 3WU5A 2RS6A 1N34I 1X6HA 2J7JA 4IS9A 2EN6A 2V2QA 4GEQB 3NZKA 3OMLA 3HJCA 3PRYA 5DNLA 1Y4UA 4DR2I 2EM3A 5FLXC 4JI2E 4I3HA 4HXZA 2ZM6I 4JI4E 1T4OA 1KYQA 4NZVA 2DSYA 2YTEA 5KL6A 1LLMC 2VF3A 1YUIA 1Z0CA 4R2CA 3LNUA 4JV5E 4FWGA 5AC4A 3MHSC 2HKJA 1DARA 2DEIA 4HACB 5KL7A 4YHHI 4LOMA 5K36B 4DV6E 2UUBE 2CZ9A 3LMLA 4R2QA 4IFDC 2CVEA 2YRHA 4GKJI 3BGHA 5A6BD 2NUEA 5BR8E 4FWDA 1PDAA 1A6FA 1ZXMA 4RH8A 2Z5CA 1ZM9A 5JEAD 4DUYE 5LL6R 2EL4A 1N3GA 4OO1F 2Z5EA 3H4LA 3EPHA 4JG4A 2KOUA 2RTXA 4EMDA 1EA6A 3M6AA 4JI2I 4JI1E 4Z7YA 1N33I 4X64E 4X65I 5DRQA 2YTQA 2HHHI 4BS9A 2WP8A 3K17A 3AV0A 3J81C 4P78A 2EPXA 2YTNA 5DNYA 2LO3A 2RQLA 2UU9E 1Z0GA 4LF6E 4UTGA 2L2MA 4QNKA 3VK6A 2EPMX 3JU0A 4F6NA 2PO2A 2EOOA 1X6FA 4IFDB 2LJUA 2MKDA 1XNQE 4DPXA 1YFHA 1UDNA 4DV6I 1Y4SA 5KL3A 2UUBI 2DLKA 4WX9A 2LTSA 1IBME 2EE8A 2K4VA 2YU5A 2C38A 2EMXA 2XEXA 5BR8I 2WBSA 4R2PA 3ZKDA 2EMZA 2RSIA 1AH5A 3P1XA 1RC7A 2UXBE 2JY9A 4FW7A 2M9AA 2VRDA 4M9VC 4WXDA 1Y60A 1XMOI 2EL5A 4DUZI 4X64I 4TUIA 2WNRA 4DV2I 5LMUE 3DJWA 4TUGA 4JI0I 2YWQA 3EPKA 2V2ZA 4MU1A 1FKAE 2EMHA 2B3TB 2C39A 2PNLA 4JYAI 3VHTB 1MU5A 2YTJA 2D9HA 2Z5BB 4B3RE 5LLQA 3GLLA 1XNQI 4OOGC 2DIXA 3K1JA 2L2KB 4USKA 5A69A 4BHBA 1X6EA 3F6GA 2Z5CB 4DR5I 4MYUA 3P3CA 4WUDA 1X48A 4J8ZA 4B3ME 2AJ4A 4DR6E 1Z1BA 1H7UA 2Q2EB 4DPTA 4LF7I 4WYQB 1P42A 4O43A 1VISA 3QT5A 3CDIA 2A2DA 3TQMA 1USUA 2EPRA 1OYPA 2MKNA 3CDJA 4J3DA 1PJTA 2N3HA 5AE1A 5IXMB 5AE3A 2VESA 1JK2A 3PS3A 4WSPA 4DPUA 2EZ6A 1ZM2A 1KKHA 2EM5A 2C38B 1Z5AA 2YTDA 2I13A 4LCGA 2BA1D 5DNXA 2X7IA 2JYAA 4OO1C 2E1RA 2FV4B 4JI7E 1FNMA 3LPSA 2NN6E 2R76A 4DV1E 4B3TE 2V85A 1GQEA 2FGGA 2EL6A 2E1MA 2K7IA 4LF8I 2EPPA 1DQ3A 2X36A 2YTFA 5K36A 4NXME 1RHYA 1UN6B 1J5EE 1XHKA 5A6JA 1XMQI 4WUBA 1MEYC 2C39B 4BMJA 5LMNI 1QU6A 3Q6NA 4PU9A 3K6QA 4BA2A 1EH8A 4DV5E 2LBSB 4Z7CA 2EM2A 2GHFA 4X66E 1Z5BA 3VYYA 4F9CB 3DD6A 4DV0I 2EPKX 2V34A 4O4KA 2NUGA 1XNRE 4OX9I 2BA1G 4ZYGA 2M7QA 3LLHA 1I94E 5CFFE 2EPNA 2EOQA 5DROA 4JI7I 4LFAI 2EJ4A 2EN2A 4ZVIA 1EH7A 4WSGA 2NABA 2Q8UA 3ECRA 4M2ZA 3F0NA 3QT8A 3IWDA 4YY3E 4B3SI 2UXCI 1ZBQA 4GKKI 4KHPI 1FI4A 4LF9I 2OI2A 2R3VA 2UUAE 3B82A 2NUFA 4NXMI 3GONA 2L8TA 4FN5A 1KTVA 1T39A 2KHXA 5K36C 2YRKA 1MGTA 2JOBA 4AIMA 4DV4E 2HK3A 3Q1QA 4AQYE 2NA2A 1HNXE 4AIDA 1KIJA 1Z0EA 1YYOA 1Z0WA 1HR0E 4MYTA 2J65A 4LFBI 2EM6A 2EMYA 1H73A 1NHHA 2DMYA 4M0VA 1GZ6A 5ADZA 4WUCA 2JXPA 4DU7A 1IBKE 2DLQA 3HQ1A 4OKGA 1G2DC 2NN6D 1RR9A 1HNZI 1IBLE 1J26A 1STUA 3GCMA 5IT9Q 4LPFA 2CT1A 2Z5BA 2EOEA 3M85D 3ZOQB 1PJQA 2PRTA 4LCFA 2RPCA 4DR4I 2FTXB 2VQFE 4USMA 2V8PA 4HY1A 2EOFA 3HXLA 2B7TA 3T1HE 1ELOA 2EMWA 2YRMA 1X5WA 1MG7A 4F2JC 4BA2B 1FJGI 3LTOA 2IOPA 4DV4I 1X49A 2ENCA 1T4NA 2B7VA 1Z5CA 1XXEA 2ZBKB 2LJHA 3UK3C 2LJPA 3BIDA 3K85A 1KJKA 1A1IA 2EOIA 4JI4I 3L7ZA 4NHRA 4DV7E 4QNJA 1UDOA 4JV5I 2NN6A 3ADIA 1NHIA 1SFEA 2IHR1 1VI7A 4JI8E 3HKMA 3M85G 3B8HA 2V88A 2EN4A 4DMIA 2WBUA 3ZZ0A 3PYEA 2YPNA 2ODRD 4JI5E 4HEIA 5A6BA 3HPSA 1HK7A
chains in the Genus database with same CATH topology
2M1SA 2JR1A 4R8OA 4DR7E 4DUYI 4DKKA 4R03A 3ADLA 4KZSA 4JI1I 4IZJD 4DPYA 4URLA 1B63A 2LUQA 3WU6A 2UU9I 4JI3E 5AASA 3QT7A 4LF6I 5AE2A 3IWCA 4UT4A 2LUPB 1SR9A 4WPYA 2H36X 2L6MA 1IBMI 3PYGA 2UXBI 2BM1A 4F54A 1QZRA 3JAMQ 4P7DA 3PYFA 4LTYA 3J7AM 2MC6A 2V89A 1N36E 4LF4E 1EI1A 1N32E 4PRVA 4JI6E 2ZITA 5LMUI 4BCAA 4P52A 2L3CA 2GQ0A 4B3RI 3C4TA 1ZBTA 3HULA 4XTJA 1N0VC 2L33A 2ODRC 3J7Yp 2JOXA 2LTRA 3QT6A 1B62A 4IZKA 2G7HA 3D4JA 2VQEE 2HFSA 4B3MI 2UXDE 1HNWE 4DR6I 1WHQA 2PNMA 4X8WA 3P06A 3B78A 4DR3E 4DU8A 5IT9C 4X62E 2CGEA 3AUZA 3JTZA 2LMZA 3T1YE 1PVGA 1Z0VA 4LFCE 2KONA 5T6JA 3J80Q 4F9AB 3VYXA 2UUCE 4LF5E 2O1TA 2DB2A 4FW9A 3J7AG 3OTOE 1H72C 1PIEA 3V2UC 4DR1E 2VQEI 1NHJA 5GMEA 4DV1I 4B3TI 4DV3E 3FIGA 2NPFA 4K0KE 4DPWA 3HTXA 5IWAE 1N0UA 1H7SA 4DR3I 4I8OA 1UHZA 2F8BA 4X62I 1N34E 2O1VA 1J5EI 4F9BB 3Q6MA 5F3WA 2L2NA 4DV5I 4DR2E 4LFCI 4X66I 4M1KA 1H74A 2HKEA 2ZM6E 1XNRI 1I94I 4IZKB 2LE2A 2GS8A 5A2QQ 2CG9A 4DR1I 1T4LB 4P7AA 2V8QB 2N3GA 4YY3I 4YHHE 2EFGA 4BC9A 3MSWA 3ZZTA 1YYKA 3CWVA 1X47A 4GKJE 2UUAI 4L5NC 1USVA 3ZM7A 3ZZUA 4LU9A 2B9DA 1UILA 4BC7A 4DXLA 1WUUA 4AQYI 1HNXI 2WZOA 4HYMA 1N33E 4X65E 2HHHE 2J7KA 1HR0I 3JAMC 2O1WA 1DI2A 1IBKI 2HFUA 3RMPA 1Y6ZA 3PYDA 4R1FA 3ADJA 3WU3A 1S4EA 1IBLI 2VF1A 2L92A 3H09A 2VQFI 3C4BA 2V2VA 3T1HI 1RREA 4NXNE 2V87A 1Z59A 2MC5A 3IWBA 1XMOE 1O0WA 4DUZE 2M4IA 2DEJA 4DV2E 4JI0E 3F6HA 4DV7I 1Z0TA 4JYAE 2BM0A 4WFTA 4JI8I 2JVAA 4PRXA 2A2CA 2V83A 4FWHA 4JI5I 4DR5E 4NXNI 1BKNA 5GMDA 5FLXQ 2V86A 4LF7E 3J80C 4DR7I 3V5RA 1S16A 4IZJA 2VE7C 1WXRA 1FWLA 3WU4A 4Q28A 4JI3I 1D6TA 2L3JA 1Z0BA 1OJ4A 1EKZA 5L3JA 3HPZA 3ADGA 4KQVA 3ZKBA 2RSMA 2EWLA 2F4VE 3J81Q 2E5LE 5A2QC 2JWOA 4LF8E 4N3OA 1N36I 4LF4I 4L8NA 1ZM4A 1K47A 1N32I 4RPFA 1XMQE 4JI6I 1PKPA 5LMNE 4BBYA 2BV3A 4DV0E 2IOQA 4OX9E 4LFAE 2O1UA 1WHNA 2YT4A 1ZXNA 2F4VI 2UXDI 1HNWI 4B3SE 2UXCE 4KHPE 2CPNA 4GKKE 4HACA 5FWKA 2E5LI 4LF9E 2R42A 4IZJB 1KVKA 1YYWA 2MDRA 1YZ9A 3DF6A 1UEKA 1MX0A 3T1YI 4LFBE 1U2RA 2LRSA 2RS7A 2UUCI 4LF5I 4ED4A 4M30A 3OTOI 1RQ0A 1HNZE 2YZTA 4DV3I 3KWRA 4DR4E 4K0KI 2HK2A 5IWAI 1NZ0A 1FWKA 2WW4A 1FJGE 1ZM3A 3WU5A 1N34I 2RS6A 2V2QA 4GEQB 3OMLA 3HJCA 3PRYA 4DR2I 1Y4UA 5FLXC 4JI2E 4I3HA 4HXZA 2ZM6I 4JI4E 1T4OA 2VF3A 2DSYA 1Z0CA 3LNUA 4JV5E 4FWGA 2HKJA 1DARA 2DEIA 4HACB 4YHHI 4DV6E 2UUBE 2CZ9A 3LMLA 4GKJI 2NUEA 4FWDA 5BR8E 1A6FA 1ZXMA 2Z5CA 1ZM9A 4DUYE 5LL6R 2Z5EA 3H4LA 4JG4A 2KOUA 2RTXA 4EMDA 1EA6A 3M6AA 4JI2I 4JI1E 4Z7YA 1N33I 4X64E 4X65I 2HHHI 4BS9A 3K17A 3AV0A 3J81C 4P78A 5DNYA 2UU9E 1Z0GA 4LF6E 4UTGA 2L2MA 3VK6A 3JU0A 1XNQE 4DPXA 4DV6I 1Y4SA 2UUBI 2LTSA 1IBME 2K4VA 2XEXA 5BR8I 3ZKDA 3P1XA 1RC7A 2UXBE 2JY9A 1XMOI 4DUZI 4X64I 4TUIA 4DV2I 5LMUE 3DJWA 4TUGA 4JI0I 2V2ZA 1FKAE 2PNLA 2B3TB 4JYAI 1MU5A 2Z5BB 4B3RE 1XNQI 4OOGC 2DIXA 3K1JA 2L2KB 4USKA 3F6GA 2Z5CB 4DR5I 4MYUA 4WUDA 1X48A 4J8ZA 4B3ME 2AJ4A 4DR6E 2Q2EB 1H7UA 4DPTA 4LF7I 4WYQB 1VISA 3QT5A 2A2DA 1USUA 2N3HA 5AE1A 5AE3A 4WSPA 4DPUA 2EZ6A 1ZM2A 1KKHA 1Z5AA 2X7IA 2E1RA 2FV4B 4JI7E 1FNMA 3LPSA 4DV1E 4B3TE 2V85A 1GQEA 2FGGA 2E1MA 4LF8I 1DQ3A 2X36A 4NXME 1J5EE 1XHKA 1XMQI 4WUBA 5LMNI 4BMJA 1QU6A 3Q6NA 4PU9A 3K6QA 2LBSB 4DV5E 4Z7CA 4X66E 1Z5BA 3VYYA 4F9CB 4DV0I 2V34A 2NUGA 1XNRE 4OX9I 2M7QA 3LLHA 1I94E 5CFFE 4JI7I 4LFAI 4ZVIA 3F0NA 4M2ZA 3QT8A 3IWDA 4YY3E 4B3SI 2UXCI 1ZBQA 4GKKI 4KHPI 1FI4A 4LF9I 2OI2A 2R3VA 2UUAE 3B82A 2NUFA 4NXMI 3GONA 2L8TA 4FN5A 1KTVA 2KHXA 2JOBA 4DV4E 2HK3A 3Q1QA 4AQYE 2NA2A 1HNXE 1KIJA 1Z0EA 1YYOA 1Z0WA 1HR0E 4MYTA 4LFBI 1H73A 1NHHA 2DMYA 4M0VA 1GZ6A 5ADZA 4WUCA 4DU7A 1IBKE 3HQ1A 1RR9A 1HNZI 1IBLE 1J26A 1STUA 5IT9Q 2Z5BA 3ZOQB 4DR4I 2FTXB 2VQFE 4USMA 2V8PA 4HY1A 3HXLA 3T1HE 2B7TA 1ELOA 1MG7A 1FJGI 3LTOA 2IOPA 4DV4I 1X49A 1T4NA 2B7VA 1Z5CA 2ZBKB 2LJHA 2LJPA 3K85A 4JI4I 4DV7E 4JV5I 3ADIA 1NHIA 2IHR1 4JI8E 3B8HA 2V88A 4DMIA 3ZZ0A 3PYEA 2ODRD 4JI5E 3HPSA 1HK7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DR7 E;  4DUY I;  4DKK A;  3ADL A;  4JI1 I;  4DPY A;  4URL A;  1B63 A;  2LUQ A;  3WU6 A;  2UU9 I;  4JI3 E;  3QT7 A;  4LF6 I;  4UT4 A;  2LUP B;  1IBM I;  3PYG A;  2UXB I;  2BM1 A;  1QZR A;  3JAM Q;  3PYF A;  3J7A M;  1N36 E;  4LF4 E;  1EI1 A;  1N32 E;  4PRV A;  4JI6 E;  2ZIT A;  5LMU I;  4P52 A;  2L3C A;  4B3R I;  3C4T A;  1ZBT A;  3HUL A;  4XTJ A;  1N0V C;  2L33 A;  3J7Y p;  3QT6 A;  2LTR A;  1B62 A;  3D4J A;  2VQE E;  2HFS A;  4B3M I;  2UXD E;  1HNW E;  4DR6 I;  1WHQ A;  4X8W A;  3B78 A;  4DR3 E;  4DU8 A;  5IT9 C;  4X62 E;  3T1Y E;  1PVG A;  1Z0V A;  4LFC E;  3J80 Q;  3VYX A;  2UUC E;  4LF5 E;  2DB2 A;  4FW9 A;  3J7A G;  3OTO E;  1H72 C;  1PIE A;  3V2U C;  4DR1 E;  2VQE I;  1NHJ A;  5GME A;  4DV1 I;  4B3T I;  4DV3 E;  2NPF A;  4K0K E;  4DPW A;  3HTX A;  5IWA E;  1N0U A;  1H7S A;  4DR3 I;  1UHZ A;  4X62 I;  1N34 E;  1J5E I;  2L2N A;  4DV5 I;  4DR2 E;  4LFC I;  4X66 I;  4M1K A;  1H74 A;  2HKE A;  2ZM6 E;  1XNR I;  1I94 I;  2GS8 A;  5A2Q Q;  4DR1 I;  1T4L B;  4P7A A;  2N3G A;  4YY3 I;  4YHH E;  2EFG A;  3ZZT A;  1YYK A;  3CWV A;  1X47 A;  4GKJ E;  2UUA I;  3ZM7 A;  3ZZU A;  1UIL A;  4DXL A;  1WUU A;  4AQY I;  1HNX I;  4HYM A;  1N33 E;  4X65 E;  2HHH E;  2J7K A;  1HR0 I;  3JAM C;  1DI2 A;  1IBK I;  2HFU A;  3PYD A;  4R1F A;  3ADJ A;  3WU3 A;  1S4E A;  1IBL I;  2VQF I;  3C4B A;  2V2V A;  3T1H I;  1RRE A;  4NXN E;  1Z59 A;  1XMO E;  1O0W A;  4DUZ E;  2DEJ A;  4DV2 E;  4JI0 E;  4DV7 I;  1Z0T A;  4JYA E;  2BM0 A;  4WFT A;  4JI8 I;  2JVA A;  4PRX A;  2A2C A;  4FWH A;  4JI5 I;  4DR5 E;  4NXN I;  1BKN A;  5GMD A;  5FLX Q;  4LF7 E;  3J80 C;  4DR7 I;  3V5R A;  1S16 A;  1FWL A;  3WU4 A;  4JI3 I;  1D6T A;  2L3J A;  1Z0B A;  1OJ4 A;  1EKZ A;  5L3J A;  3ADG A;  4KQV A;  3ZKB A;  2RSM A;  2F4V E;  3J81 Q;  2E5L E;  4LF8 E;  5A2Q C;  1N36 I;  4LF4 I;  1ZM4 A;  1K47 A;  1N32 I;  4RPF A;  1XMQ E;  4JI6 I;  1PKP A;  5LMN E;  2BV3 A;  4DV0 E;  4OX9 E;  4LFA E;  1WHN A;  2YT4 A;  1ZXN A;  2F4V I;  2UXD I;  1HNW I;  4B3S E;  2UXC E;  4KHP E;  2CPN A;  4GKK E;  4HAC A;  2E5L I;  4LF9 E;  2R42 A;  1KVK A;  1YYW A;  2MDR A;  1YZ9 A;  1UEK A;  1MX0 A;  3T1Y I;  4LFB E;  1U2R A;  2LRS A;  2RS7 A;  2UUC I;  4LF5 I;  4ED4 A;  4M30 A;  3OTO I;  1RQ0 A;  1HNZ E;  4DV3 I;  4DR4 E;  4K0K I;  2HK2 A;  5IWA I;  1NZ0 A;  1FWK A;  2WW4 A;  1FJG E;  1ZM3 A;  3WU5 A;  1N34 I;  2RS6 A;  2V2Q A;  4DR2 I;  4JI2 E;  5FLX C;  4I3H A;  4HXZ A;  2ZM6 I;  4JI4 E;  1T4O A;  2VF3 A;  1Z0C A;  3LNU A;  4JV5 E;  4FWG A;  2HKJ A;  1DAR A;  2DEI A;  4HAC B;  4YHH I;  4DV6 E;  2UUB E;  2CZ9 A;  4GKJ I;  2NUE A;  4FWD A;  5BR8 E;  1A6F A;  1ZXM A;  1ZM9 A;  4DUY E;  5LL6 R;  3H4L A;  4JG4 A;  2RTX A;  4EMD A;  1EA6 A;  3M6A A;  4JI2 I;  4JI1 E;  4Z7Y A;  1N33 I;  4X64 E;  4X65 I;  2HHH I;  3K17 A;  3J81 C;  2UU9 E;  1Z0G A;  4LF6 E;  4UTG A;  2L2M A;  1XNQ E;  4DPX A;  4DV6 I;  2UUB I;  2LTS A;  1IBM E;  2XEX A;  5BR8 I;  3ZKD A;  3P1X A;  1RC7 A;  2UXB E;  2JY9 A;  1XMO I;  4DUZ I;  4X64 I;  4DV2 I;  5LMU E;  4JI0 I;  2V2Z A;  1FKA E;  4JYA I;  2B3T B;  1MU5 A;  4B3R E;  1XNQ I;  4OOG C;  2DIX A;  3K1J A;  2L2K B;  4USK A;  4DR5 I;  4MYU A;  4WUD A;  1X48 A;  4B3M E;  2AJ4 A;  4LF7 I;  4DR6 E;  2Q2E B;  1H7U A;  4DPT A;  4WYQ B;  1VIS A;  3QT5 A;  2A2D A;  2N3H A;  4DPU A;  2EZ6 A;  1ZM2 A;  1KKH A;  1Z5A A;  2X7I A;  2E1R A;  1FNM A;  4JI7 E;  3LPS A;  4DV1 E;  4B3T E;  1GQE A;  4LF8 I;  2X36 A;  4NXM E;  1J5E E;  1XHK A;  1XMQ I;  4WUB A;  5LMN I;  1QU6 A;  4PU9 A;  2LBS B;  4DV5 E;  4Z7C A;  4X66 E;  1Z5B A;  3VYY A;  4DV0 I;  2V34 A;  2NUG A;  1XNR E;  4OX9 I;  3LLH A;  1I94 E;  5CFF E;  4JI7 I;  4LFA I;  4ZVI A;  3F0N A;  4M2Z A;  3QT8 A;  4YY3 E;  4B3S I;  2UXC I;  4GKK I;  4KHP I;  1FI4 A;  4LF9 I;  2OI2 A;  2R3V A;  2UUA E;  3B82 A;  2NUF A;  4NXM I;  3GON A;  4FN5 A;  1KTV A;  2KHX A;  4DV4 E;  2HK3 A;  3Q1Q A;  4AQY E;  2NA2 A;  1HNX E;  1KIJ A;  1Z0E A;  1YYO A;  1Z0W A;  1HR0 E;  4MYT A;  4LFB I;  1H73 A;  1NHH A;  2DMY A;  4WUC A;  4DU7 A;  1IBK E;  1RR9 A;  1HNZ I;  1IBL E;  1J26 A;  1STU A;  5IT9 Q;  4DR4 I;  2VQF E;  4USM A;  2V8P A;  4HY1 A;  3T1H E;  1ELO A;  2B7T A;  1MG7 A;  1FJG I;  3LTO A;  4DV4 I;  1X49 A;  1T4N A;  2B7V A;  1Z5C A;  2ZBK B;  2LJH A;  2LJP A;  4JI4 I;  4DV7 E;  4JV5 I;  3ADI A;  1NHI A;  2IHR 1;  4JI8 E;  3B8H A;  3ZZ0 A;  3PYE A;  4JI5 E; 
#chains in the Genus database with same CATH topology
 2M1S A;  2JR1 A;  5JEA A;  4R8O A;  1A1L A;  3P3G A;  5C0X F;  2YTO A;  4DR7 E;  2YTP A;  4DKK A;  4DUY I;  3BBG A;  2JT2 A;  4R03 A;  3ADL A;  2DMI A;  3C6M A;  4KZS A;  1TF3 A;  4MLV A;  4RHB B;  1G2F C;  2PO0 B;  4JI1 I;  1IMU A;  4IZJ D;  4DPY A;  1X3C A;  2LUQ A;  1B63 A;  4MU0 A;  4URL A;  3P76 A;  3WU6 A;  2UU9 I;  2ELY A;  4JI3 E;  5AAS A;  4IS1 C;  3B4T A;  3QT7 A;  4LF6 I;  5AE2 A;  3IWC A;  2EMB A;  1P47 A;  2AE8 A;  4BA1 A;  2YU8 A;  1AAY A;  2NN6 C;  4UT4 A;  2LUP B;  1SR9 A;  4WPY A;  2EPZ A;  1TN9 A;  1BB8 A;  2H36 X;  2L6M A;  1IBM I;  3P3E A;  3PYG A;  1A1F A;  2JEB B;  3QG5 C;  2UXB I;  2BM1 A;  4F54 A;  5JEA C;  1QZR A;  2EPC A;  5EL9 A;  3U1Y A;  2ENA A;  4P7D A;  3PYF A;  3JAM Q;  4LTY A;  2BR2 A;  3J7A M;  2MC6 A;  2V89 A;  1N36 E;  4LF4 E;  2LCE A;  2MDG A;  3UHM A;  1EI1 A;  3L7Z B;  2EOJ A;  1N32 E;  2ADR A;  5K36 F;  4PRV A;  4JI6 E;  2ZIT A;  3THO B;  5LMU I;  2EMK A;  4BCA A;  2NN6 B;  1Y5Y A;  4P52 A;  2L3C A;  2EMC A;  2GQ0 A;  2WBT A;  4B3R I;  2A25 A;  3C4T A;  1ZBT A;  4GZN C;  2JPA A;  3HUL A;  4XTJ A;  1UDS A;  1UBD C;  2L33 A;  1N0V C;  2ODR C;  2EPO A;  2JOX A;  2LTR A;  3J7Y p;  1YUJ A;  2EOX A;  5A6A A;  1B62 A;  2IER A;  3QT6 A;  4IZK A;  5JEA B;  2G7H A;  3D4J A;  2VQE E;  2HFS A;  2HC5 A;  4B3M I;  2UXD E;  1HNW E;  4DR6 I;  1WHQ A;  2PNM A;  4X8W A;  3P06 A;  4IFD F;  2EM8 A;  2YSO A;  3B78 A;  2LVH A;  4LCH A;  4NBQ A;  4DR3 E;  4DU8 A;  5IT9 C;  4X62 E;  1DGC A;  2CGE A;  4BA1 B;  2YTG A;  3AUZ A;  1E3P A;  3JTZ A;  2LMZ A;  4ZYE A;  3T1Y E;  1PVG A;  4LFC E;  1Z0V A;  2E72 A;  2KON A;  5T6J A;  3M7N D;  3J80 Q;  1R6L A;  4F9A B;  3VYX A;  2GO4 A;  2UUC E;  4LF5 E;  2O1T A;  2DB2 A;  4FW9 A;  3J7A G;  3OTO E;  1H72 C;  1PIE A;  3V2U C;  4DR1 E;  2VQE I;  1NHJ A;  5GME A;  4DV1 I;  4B3T I;  2BR2 B;  4DV3 E;  3FIG A;  1A1K A;  2NPF A;  4IFD D;  4K0K E;  4U3B A;  4DPW A;  2JE6 A;  3HTX A;  5IWA E;  1N0U A;  1H7S A;  4DR3 I;  4I8O A;  1UHZ A;  2F8B A;  4FW3 A;  1NEI A;  2EN8 A;  2BA0 D;  1N34 E;  2JEB A;  2O1V A;  4X62 I;  1J5E I;  1QNT A;  2EMG A;  4F9B B;  5A6K A;  4R2S A;  3Q6M A;  4FW4 A;  5F3W A;  2L2N A;  4DV5 I;  4DR2 E;  2BBG A;  5TSE A;  2HGH A;  4LFC I;  1IQS A;  4ZYH A;  4X66 I;  3M7N G;  4M1K A;  1H74 A;  2HKE A;  2ZM6 E;  2PO0 A;  1XNR I;  2O3Z A;  4IZK B;  1I94 I;  2LE2 A;  1A1G A;  2GS8 A;  5A2Q Q;  3U1K A;  2CG9 A;  3EPL A;  1T4L B;  4DR1 I;  2GLI A;  1YPN A;  4P7A A;  4MU4 A;  2V8Q B;  2N3G A;  4YY3 I;  4YHH E;  2EFG A;  4BC9 A;  3MSW A;  4FW5 A;  4OO1 E;  3ZZT A;  1YYK A;  4F6M A;  1X47 A;  2EML A;  4GKJ E;  3CWV A;  2UUA I;  4L5N C;  4U3D A;  1USV A;  2BA0 G;  5C0X E;  3GME A;  3ZM7 A;  3ZZU A;  5JEA F;  4LU9 A;  2B9D A;  1UIL A;  4BC7 A;  4DXL A;  2EQ0 A;  1WUU A;  4AQY I;  1E3H A;  4ISA A;  2WZO A;  1HNX I;  4HYM A;  1N33 E;  4X65 E;  2N8X A;  2HHH E;  4FK5 C;  1L4S A;  2EM7 A;  1TF6 A;  2DGC A;  2J7K A;  1HR0 I;  4X9J A;  3JAM C;  2O1W A;  1DI2 A;  1OYR A;  2EOR A;  1IBK I;  2HFU A;  3RMP A;  1Y6Z A;  3PS1 A;  2EOH A;  2BB8 A;  3PYD A;  4R1F A;  3ADJ A;  3WU3 A;  1S4E A;  1IBL I;  2ENH A;  4OZE A;  2JE6 B;  1BBO A;  2I9I A;  2EN7 A;  2VF1 A;  5DRP A;  2L92 A;  3H09 A;  2VQF I;  2EP3 A;  3KRN A;  3C4B A;  2V2V A;  3T1H I;  1RRE A;  5IV8 B;  4NXN E;  1RMD A;  3M99 B;  2JP9 A;  2V87 A;  1Z59 A;  4IJD A;  1YSA C;  2MC5 A;  3IWB A;  2LV2 A;  1XMO E;  1O0W A;  1NCS A;  5EKW A;  2EPU A;  4DUZ E;  2M4I A;  2GPI A;  2R1F A;  2YTI A;  2DEJ A;  4AM3 A;  5K36 E;  3BF2 A;  4DV2 E;  5KL5 A;  4ZYD A;  4JI0 E;  1JK1 A;  4MU3 A;  3F6H A;  4DV7 I;  3PS2 A;  1Z0T A;  4MLQ A;  4JYA E;  2EMI A;  2BM0 A;  4WFT A;  3L00 A;  1GTK A;  4JI8 I;  2JVA A;  4O24 A;  4PRX A;  4Q35 B;  1ZU1 A;  2A2C A;  2V83 A;  4OO1 D;  4FWH A;  4JI5 I;  4DR5 E;  2DRP A;  3KZZ A;  4NXN I;  1BKN A;  5AC5 A;  5C0X D;  5GMD A;  5FLX Q;  2V86 A;  4LF7 E;  3J80 C;  4DR7 I;  2EOS A;  1A1H A;  2IES A;  2PNZ A;  3V5R A;  4N4R B;  1S16 A;  4IFD E;  2EQ3 A;  1IQO A;  1A1J A;  5KL2 A;  4O5G A;  4IZJ A;  4FW6 A;  2VE7 C;  1WXR A;  4GQU A;  2EM9 A;  1FWL A;  3WU4 A;  4MQY A;  4Q28 A;  4HTG A;  4R2A A;  4JI3 I;  1D6T A;  2L3J A;  2JEA A;  2EM4 A;  1B69 A;  1Z0B A;  1OJ4 A;  1EKZ A;  2PO1 A;  3MHH C;  5L3J A;  4OO1 A;  2EQ1 A;  1PJS A;  2WCC 3;  4WXC A;  2EOM A;  2GO3 A;  2C37 A;  3HPZ A;  5C0X A;  3ADG A;  2ELZ A;  2EN1 A;  4KQV A;  3ZKB A;  4R2R A;  2RSM A;  2EWL A;  2F4V E;  3J81 Q;  2E5L E;  1ZR9 A;  5A2Q C;  2EMF A;  2EMA A;  2JWO A;  4LF8 E;  4N3O A;  1N36 I;  2WP8 B;  4LF4 I;  4L8N A;  1ZM4 A;  2CSH A;  5K36 D;  1K47 A;  1N32 I;  4RPF A;  1XMQ E;  4BHC A;  4JI6 I;  1PKP A;  5LMN E;  4BBY A;  2PO2 B;  2BV3 A;  4DV0 E;  2IOQ A;  2EM0 A;  1R6M A;  2EPA A;  4OX9 E;  1OYS A;  2EOZ A;  1ZAA C;  4LFA E;  2O1U A;  1WHN A;  5C0X C;  2PNZ B;  2EOY A;  2YT4 A;  2EPL X;  1ZXN A;  1YH8 A;  2F4V I;  2UXD I;  1HNW I;  4B3S E;  2UXC E;  4KHP E;  2CPN A;  4GKK E;  4HAC A;  5DRR A;  5FWK A;  2E5L I;  4LF9 E;  2R42 A;  4IZJ B;  1KVK A;  1YYW A;  2MDR A;  1YZ9 A;  2WNR B;  3DF6 A;  1UEK A;  2F1D A;  4R2D A;  5JEA E;  1F2I G;  2YSP A;  1BBG A;  4MDT A;  2JEA B;  1MX0 A;  3C6K A;  1EH6 A;  3EPJ A;  3T1Y I;  2PO1 B;  3EQ1 A;  4R2E A;  2LT7 A;  4OO1 B;  4LFB E;  1U2R A;  1WJP A;  2C37 B;  5C0X B;  2LRS A;  1WRJ A;  2RS7 A;  2UUC I;  4LF5 I;  4ED4 A;  2CTD A;  5KL4 A;  4M30 A;  3OTO I;  1RQ0 A;  1HNZ E;  2NN6 F;  2YZT A;  4DV3 I;  4IFD A;  3KWR A;  4DR4 E;  3H1C A;  4K0K I;  2EN3 A;  3THN A;  4KWY A;  2HK2 A;  5IWA I;  1NZ0 A;  1FWK A;  2WW4 A;  1FJG E;  5ELW A;  2HJJ A;  1UDQ A;  1YHC A;  1T38 A;  1ZM3 A;  3KZY A;  3WU5 A;  2RS6 A;  1N34 I;  1X6H A;  2J7J A;  4IS9 A;  2EN6 A;  2V2Q A;  4GEQ B;  3NZK A;  3OML A;  3HJC A;  3PRY A;  5DNL A;  1Y4U A;  4DR2 I;  2EM3 A;  5FLX C;  4JI2 E;  4I3H A;  4HXZ A;  2ZM6 I;  4JI4 E;  1T4O A;  1KYQ A;  4NZV A;  2DSY A;  2YTE A;  5KL6 A;  1LLM C;  2VF3 A;  1YUI A;  1Z0C A;  4R2C A;  3LNU A;  4JV5 E;  4FWG A;  5AC4 A;  3MHS C;  2HKJ A;  1DAR A;  2DEI A;  4HAC B;  5KL7 A;  4YHH I;  4LOM A;  5K36 B;  4DV6 E;  2UUB E;  2CZ9 A;  3LML A;  4R2Q A;  4IFD C;  2CVE A;  2YRH A;  4GKJ I;  3BGH A;  5A6B D;  2NUE A;  5BR8 E;  4FWD A;  1PDA A;  1A6F A;  1ZXM A;  4RH8 A;  2Z5C A;  1ZM9 A;  5JEA D;  4DUY E;  5LL6 R;  2EL4 A;  1N3G A;  4OO1 F;  2Z5E A;  3H4L A;  3EPH A;  4JG4 A;  2KOU A;  2RTX A;  4EMD A;  1EA6 A;  3M6A A;  4JI2 I;  4JI1 E;  4Z7Y A;  1N33 I;  4X64 E;  4X65 I;  5DRQ A;  2YTQ A;  2HHH I;  4BS9 A;  2WP8 A;  3K17 A;  3AV0 A;  3J81 C;  4P78 A;  2EPX A;  2YTN A;  5DNY A;  2LO3 A;  2RQL A;  2UU9 E;  1Z0G A;  4LF6 E;  4UTG A;  2L2M A;  4QNK A;  3VK6 A;  2EPM X;  3JU0 A;  4F6N A;  2PO2 A;  2EOO A;  1X6F A;  4IFD B;  2LJU A;  2MKD A;  1XNQ E;  4DPX A;  1YFH A;  1UDN A;  4DV6 I;  1Y4S A;  5KL3 A;  2UUB I;  2DLK A;  4WX9 A;  2LTS A;  1IBM E;  2EE8 A;  2K4V A;  2YU5 A;  2C38 A;  2EMX A;  2XEX A;  5BR8 I;  2WBS A;  4R2P A;  3ZKD A;  2EMZ A;  2RSI A;  1AH5 A;  3P1X A;  1RC7 A;  2UXB E;  2JY9 A;  4FW7 A;  2M9A A;  2VRD A;  4M9V C;  4WXD A;  1Y60 A;  1XMO I;  2EL5 A;  4DUZ I;  4X64 I;  4TUI A;  2WNR A;  4DV2 I;  5LMU E;  3DJW A;  4TUG A;  4JI0 I;  2YWQ A;  3EPK A;  2V2Z A;  4MU1 A;  1FKA E;  2EMH A;  2B3T B;  2C39 A;  2PNL A;  4JYA I;  3VHT B;  1MU5 A;  2YTJ A;  2D9H A;  2Z5B B;  4B3R E;  5LLQ A;  3GLL A;  1XNQ I;  4OOG C;  2DIX A;  3K1J A;  2L2K B;  4USK A;  5A69 A;  4BHB A;  1X6E A;  3F6G A;  2Z5C B;  4DR5 I;  4MYU A;  3P3C A;  4WUD A;  1X48 A;  4J8Z A;  4B3M E;  2AJ4 A;  4DR6 E;  1Z1B A;  1H7U A;  2Q2E B;  4DPT A;  4LF7 I;  4WYQ B;  1P42 A;  4O43 A;  1VIS A;  3QT5 A;  3CDI A;  2A2D A;  3TQM A;  1USU A;  2EPR A;  1OYP A;  2MKN A;  3CDJ A;  4J3D A;  1PJT A;  2N3H A;  5AE1 A;  5IXM B;  5AE3 A;  2VES A;  1JK2 A;  3PS3 A;  4WSP A;  4DPU A;  2EZ6 A;  1ZM2 A;  1KKH A;  2EM5 A;  2C38 B;  1Z5A A;  2YTD A;  2I13 A;  4LCG A;  2BA1 D;  5DNX A;  2X7I A;  2JYA A;  4OO1 C;  2E1R A;  2FV4 B;  4JI7 E;  1FNM A;  3LPS A;  2NN6 E;  2R76 A;  4DV1 E;  4B3T E;  2V85 A;  1GQE A;  2FGG A;  2EL6 A;  2E1M A;  2K7I A;  4LF8 I;  2EPP A;  1DQ3 A;  2X36 A;  2YTF A;  5K36 A;  4NXM E;  1RHY A;  1UN6 B;  1J5E E;  1XHK A;  5A6J A;  1XMQ I;  4WUB A;  1MEY C;  2C39 B;  4BMJ A;  5LMN I;  1QU6 A;  3Q6N A;  4PU9 A;  3K6Q A;  4BA2 A;  1EH8 A;  4DV5 E;  2LBS B;  4Z7C A;  2EM2 A;  2GHF A;  4X66 E;  1Z5B A;  3VYY A;  4F9C B;  3DD6 A;  4DV0 I;  2EPK X;  2V34 A;  4O4K A;  2NUG A;  1XNR E;  4OX9 I;  2BA1 G;  4ZYG A;  2M7Q A;  3LLH A;  1I94 E;  5CFF E;  2EPN A;  2EOQ A;  5DRO A;  4JI7 I;  4LFA I;  2EJ4 A;  2EN2 A;  4ZVI A;  1EH7 A;  4WSG A;  2NAB A;  2Q8U A;  3ECR A;  4M2Z A;  3F0N A;  3QT8 A;  3IWD A;  4YY3 E;  4B3S I;  2UXC I;  1ZBQ A;  4GKK I;  4KHP I;  1FI4 A;  4LF9 I;  2OI2 A;  2R3V A;  2UUA E;  3B82 A;  2NUF A;  4NXM I;  3GON A;  2L8T A;  4FN5 A;  1KTV A;  1T39 A;  2KHX A;  5K36 C;  2YRK A;  1MGT A;  2JOB A;  4AIM A;  4DV4 E;  2HK3 A;  3Q1Q A;  4AQY E;  2NA2 A;  1HNX E;  4AID A;  1KIJ A;  1Z0E A;  1YYO A;  1Z0W A;  1HR0 E;  4MYT A;  2J65 A;  4LFB I;  2EM6 A;  2EMY A;  1H73 A;  1NHH A;  2DMY A;  4M0V A;  1GZ6 A;  5ADZ A;  4WUC A;  2JXP A;  4DU7 A;  1IBK E;  2DLQ A;  3HQ1 A;  4OKG A;  1G2D C;  2NN6 D;  1RR9 A;  1HNZ I;  1IBL E;  1J26 A;  1STU A;  3GCM A;  5IT9 Q;  4LPF A;  2CT1 A;  2Z5B A;  2EOE A;  3M85 D;  3ZOQ B;  1PJQ A;  2PRT A;  4LCF A;  2RPC A;  4DR4 I;  2FTX B;  2VQF E;  4USM A;  2V8P A;  4HY1 A;  2EOF A;  3HXL A;  2B7T A;  3T1H E;  1ELO A;  2EMW A;  2YRM A;  1X5W A;  1MG7 A;  4F2J C;  4BA2 B;  1FJG I;  3LTO A;  2IOP A;  4DV4 I;  1X49 A;  2ENC A;  1T4N A;  2B7V A;  1Z5C A;  1XXE A;  2ZBK B;  2LJH A;  3UK3 C;  2LJP A;  3BID A;  3K85 A;  1KJK A;  1A1I A;  2EOI A;  4JI4 I;  3L7Z A;  4NHR A;  4DV7 E;  4QNJ A;  1UDO A;  4JV5 I;  2NN6 A;  3ADI A;  1NHI A;  1SFE A;  2IHR 1;  1VI7 A;  4JI8 E;  3HKM A;  3M85 G;  3B8H A;  2V88 A;  2EN4 A;  4DMI A;  2WBU A;  3ZZ0 A;  3PYE A;  2YPN A;  2ODR D;  4JI5 E;  4HEI A;  5A6B A;  3HPS A;  1HK7 A; 
#chains in the Genus database with same CATH homology
 2M1S A;  2JR1 A;  4R8O A;  4DR7 E;  4DUY I;  4DKK A;  4R03 A;  3ADL A;  4KZS A;  4JI1 I;  4IZJ D;  4DPY A;  4URL A;  1B63 A;  2LUQ A;  3WU6 A;  2UU9 I;  4JI3 E;  5AAS A;  3QT7 A;  4LF6 I;  5AE2 A;  3IWC A;  4UT4 A;  2LUP B;  1SR9 A;  4WPY A;  2H36 X;  2L6M A;  1IBM I;  3PYG A;  2UXB I;  2BM1 A;  4F54 A;  1QZR A;  3JAM Q;  4P7D A;  3PYF A;  4LTY A;  3J7A M;  2MC6 A;  2V89 A;  1N36 E;  4LF4 E;  1EI1 A;  1N32 E;  4PRV A;  4JI6 E;  2ZIT A;  5LMU I;  4BCA A;  4P52 A;  2L3C A;  2GQ0 A;  4B3R I;  3C4T A;  1ZBT A;  3HUL A;  4XTJ A;  1N0V C;  2L33 A;  2ODR C;  3J7Y p;  2JOX A;  2LTR A;  3QT6 A;  1B62 A;  4IZK A;  2G7H A;  3D4J A;  2VQE E;  2HFS A;  4B3M I;  2UXD E;  1HNW E;  4DR6 I;  1WHQ A;  2PNM A;  4X8W A;  3P06 A;  3B78 A;  4DR3 E;  4DU8 A;  5IT9 C;  4X62 E;  2CGE A;  3AUZ A;  3JTZ A;  2LMZ A;  3T1Y E;  1PVG A;  1Z0V A;  4LFC E;  2KON A;  5T6J A;  3J80 Q;  4F9A B;  3VYX A;  2UUC E;  4LF5 E;  2O1T A;  2DB2 A;  4FW9 A;  3J7A G;  3OTO E;  1H72 C;  1PIE A;  3V2U C;  4DR1 E;  2VQE I;  1NHJ A;  5GME A;  4DV1 I;  4B3T I;  4DV3 E;  3FIG A;  2NPF A;  4K0K E;  4DPW A;  3HTX A;  5IWA E;  1N0U A;  1H7S A;  4DR3 I;  4I8O A;  1UHZ A;  2F8B A;  4X62 I;  1N34 E;  2O1V A;  1J5E I;  4F9B B;  3Q6M A;  5F3W A;  2L2N A;  4DV5 I;  4DR2 E;  4LFC I;  4X66 I;  4M1K A;  1H74 A;  2HKE A;  2ZM6 E;  1XNR I;  1I94 I;  4IZK B;  2LE2 A;  2GS8 A;  5A2Q Q;  2CG9 A;  4DR1 I;  1T4L B;  4P7A A;  2V8Q B;  2N3G A;  4YY3 I;  4YHH E;  2EFG A;  4BC9 A;  3MSW A;  3ZZT A;  1YYK A;  3CWV A;  1X47 A;  4GKJ E;  2UUA I;  4L5N C;  1USV A;  3ZM7 A;  3ZZU A;  4LU9 A;  2B9D A;  1UIL A;  4BC7 A;  4DXL A;  1WUU A;  4AQY I;  1HNX I;  2WZO A;  4HYM A;  1N33 E;  4X65 E;  2HHH E;  2J7K A;  1HR0 I;  3JAM C;  2O1W A;  1DI2 A;  1IBK I;  2HFU A;  3RMP A;  1Y6Z A;  3PYD A;  4R1F A;  3ADJ A;  3WU3 A;  1S4E A;  1IBL I;  2VF1 A;  2L92 A;  3H09 A;  2VQF I;  3C4B A;  2V2V A;  3T1H I;  1RRE A;  4NXN E;  2V87 A;  1Z59 A;  2MC5 A;  3IWB A;  1XMO E;  1O0W A;  4DUZ E;  2M4I A;  2DEJ A;  4DV2 E;  4JI0 E;  3F6H A;  4DV7 I;  1Z0T A;  4JYA E;  2BM0 A;  4WFT A;  4JI8 I;  2JVA A;  4PRX A;  2A2C A;  2V83 A;  4FWH A;  4JI5 I;  4DR5 E;  4NXN I;  1BKN A;  5GMD A;  5FLX Q;  2V86 A;  4LF7 E;  3J80 C;  4DR7 I;  3V5R A;  1S16 A;  4IZJ A;  2VE7 C;  1WXR A;  1FWL A;  3WU4 A;  4Q28 A;  4JI3 I;  1D6T A;  2L3J A;  1Z0B A;  1OJ4 A;  1EKZ A;  5L3J A;  3HPZ A;  3ADG A;  4KQV A;  3ZKB A;  2RSM A;  2EWL A;  2F4V E;  3J81 Q;  2E5L E;  5A2Q C;  2JWO A;  4LF8 E;  4N3O A;  1N36 I;  4LF4 I;  4L8N A;  1ZM4 A;  1K47 A;  1N32 I;  4RPF A;  1XMQ E;  4JI6 I;  1PKP A;  5LMN E;  4BBY A;  2BV3 A;  4DV0 E;  2IOQ A;  4OX9 E;  4LFA E;  2O1U A;  1WHN A;  2YT4 A;  1ZXN A;  2F4V I;  2UXD I;  1HNW I;  4B3S E;  2UXC E;  4KHP E;  2CPN A;  4GKK E;  4HAC A;  5FWK A;  2E5L I;  4LF9 E;  2R42 A;  4IZJ B;  1KVK A;  1YYW A;  2MDR A;  1YZ9 A;  3DF6 A;  1UEK A;  1MX0 A;  3T1Y I;  4LFB E;  1U2R A;  2LRS A;  2RS7 A;  2UUC I;  4LF5 I;  4ED4 A;  4M30 A;  3OTO I;  1RQ0 A;  1HNZ E;  2YZT A;  4DV3 I;  3KWR A;  4DR4 E;  4K0K I;  2HK2 A;  5IWA I;  1NZ0 A;  1FWK A;  2WW4 A;  1FJG E;  1ZM3 A;  3WU5 A;  1N34 I;  2RS6 A;  2V2Q A;  4GEQ B;  3OML A;  3HJC A;  3PRY A;  4DR2 I;  1Y4U A;  5FLX C;  4JI2 E;  4I3H A;  4HXZ A;  2ZM6 I;  4JI4 E;  1T4O A;  2VF3 A;  2DSY A;  1Z0C A;  3LNU A;  4JV5 E;  4FWG A;  2HKJ A;  1DAR A;  2DEI A;  4HAC B;  4YHH I;  4DV6 E;  2UUB E;  2CZ9 A;  3LML A;  4GKJ I;  2NUE A;  4FWD A;  5BR8 E;  1A6F A;  1ZXM A;  2Z5C A;  1ZM9 A;  4DUY E;  5LL6 R;  2Z5E A;  3H4L A;  4JG4 A;  2KOU A;  2RTX A;  4EMD A;  1EA6 A;  3M6A A;  4JI2 I;  4JI1 E;  4Z7Y A;  1N33 I;  4X64 E;  4X65 I;  2HHH I;  4BS9 A;  3K17 A;  3AV0 A;  3J81 C;  4P78 A;  5DNY A;  2UU9 E;  1Z0G A;  4LF6 E;  4UTG A;  2L2M A;  3VK6 A;  3JU0 A;  1XNQ E;  4DPX A;  4DV6 I;  1Y4S A;  2UUB I;  2LTS A;  1IBM E;  2K4V A;  2XEX A;  5BR8 I;  3ZKD A;  3P1X A;  1RC7 A;  2UXB E;  2JY9 A;  1XMO I;  4DUZ I;  4X64 I;  4TUI A;  4DV2 I;  5LMU E;  3DJW A;  4TUG A;  4JI0 I;  2V2Z A;  1FKA E;  2PNL A;  2B3T B;  4JYA I;  1MU5 A;  2Z5B B;  4B3R E;  1XNQ I;  4OOG C;  2DIX A;  3K1J A;  2L2K B;  4USK A;  3F6G A;  2Z5C B;  4DR5 I;  4MYU A;  4WUD A;  1X48 A;  4J8Z A;  4B3M E;  2AJ4 A;  4DR6 E;  2Q2E B;  1H7U A;  4DPT A;  4LF7 I;  4WYQ B;  1VIS A;  3QT5 A;  2A2D A;  1USU A;  2N3H A;  5AE1 A;  5AE3 A;  4WSP A;  4DPU A;  2EZ6 A;  1ZM2 A;  1KKH A;  1Z5A A;  2X7I A;  2E1R A;  2FV4 B;  4JI7 E;  1FNM A;  3LPS A;  4DV1 E;  4B3T E;  2V85 A;  1GQE A;  2FGG A;  2E1M A;  4LF8 I;  1DQ3 A;  2X36 A;  4NXM E;  1J5E E;  1XHK A;  1XMQ I;  4WUB A;  5LMN I;  4BMJ A;  1QU6 A;  3Q6N A;  4PU9 A;  3K6Q A;  2LBS B;  4DV5 E;  4Z7C A;  4X66 E;  1Z5B A;  3VYY A;  4F9C B;  4DV0 I;  2V34 A;  2NUG A;  1XNR E;  4OX9 I;  2M7Q A;  3LLH A;  1I94 E;  5CFF E;  4JI7 I;  4LFA I;  4ZVI A;  3F0N A;  4M2Z A;  3QT8 A;  3IWD A;  4YY3 E;  4B3S I;  2UXC I;  1ZBQ A;  4GKK I;  4KHP I;  1FI4 A;  4LF9 I;  2OI2 A;  2R3V A;  2UUA E;  3B82 A;  2NUF A;  4NXM I;  3GON A;  2L8T A;  4FN5 A;  1KTV A;  2KHX A;  2JOB A;  4DV4 E;  2HK3 A;  3Q1Q A;  4AQY E;  2NA2 A;  1HNX E;  1KIJ A;  1Z0E A;  1YYO A;  1Z0W A;  1HR0 E;  4MYT A;  4LFB I;  1H73 A;  1NHH A;  2DMY A;  4M0V A;  1GZ6 A;  5ADZ A;  4WUC A;  4DU7 A;  1IBK E;  3HQ1 A;  1RR9 A;  1HNZ I;  1IBL E;  1J26 A;  1STU A;  5IT9 Q;  2Z5B A;  3ZOQ B;  4DR4 I;  2FTX B;  2VQF E;  4USM A;  2V8P A;  4HY1 A;  3HXL A;  3T1H E;  2B7T A;  1ELO A;  1MG7 A;  1FJG I;  3LTO A;  2IOP A;  4DV4 I;  1X49 A;  1T4N A;  2B7V A;  1Z5C A;  2ZBK B;  2LJH A;  2LJP A;  3K85 A;  4JI4 I;  4DV7 E;  4JV5 I;  3ADI A;  1NHI A;  2IHR 1;  4JI8 E;  3B8H A;  2V88 A;  4DMI A;  3ZZ0 A;  3PYE A;  2ODR D;  4JI5 E;  3HPS A;  1HK7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...