1N32O

Structure of the thermus thermophilus 30s ribosomal subunit bound to codon and near-cognate transfer rna anticodon stem-loop mismatched at the first codon position at the a site with paromomycin
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
88
structure length
88
Chain Sequence
PITKEEKQKVIQEFARFPGDTGSTEVQVALLTLRINRLSEHLKVHKKDHHSHRGLLMMVGQRRRLLRYLQREDPERYRALIEKLGIRG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Selection of tRNA by the Ribosome Requires a Transition from an Open to a Closed Form
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 16S RIBOSOMAL RNA
total genus 36
structure length 88
sequence length 88
ec nomenclature
pdb deposition date 2002-10-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
O PF00312 Ribosomal_S15 Ribosomal protein S15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.10 Mainly Alpha Orthogonal Bundle Helix Hairpins S15/NS1, RNA-binding 1n32O00
5BR8O 4DUYO 4JI7O 1XNRO 4JYAO 4JI1O 1J5EO 4B3TO 4X62O 1N32O 3J7AU 4X66O 1FKAO 1IBMO 4LFBO 2E5LO 4DV4O 4X65O 4DV7O 4LF6O 5LMUO 2AGAA 1HR0O 2HHHO 1G1XB 1XEQA 5BXZA 1NS1A 4YY3O 1D2DA 3JAMN 4DR1O 1R6TA 5A2QN 4OPHA 2VQFO 4LF8O 5H5NA 4OPAA 4YHHO 1AILA 4JI4O 4NXNO 5IT9N 3RT3C 4DV5O 4JI2O 1IBKO 5LMNO 1I94O 4JI8O 4DR5O 4LFAO 3J81N 4GKKO 1KUQA 1N36O 3O65A 3F5TA 1HNXO 2N74A 4DV2O 2VQEO 1YZBA 3M8AA 4DV6O 4X64O 1HNZO 4B3RO 1N34O 2LW7A 4DR2O 1AB3A 1FYJA 4JI0O 4DR6O 4A5UB 5LL6Y 4LF7O 3R66A 2ZM6O 4DUZO 4DV3O 2DJVA 2UXCO 1XMOO 4DV0O 1X59A 2ZKOA 4LFCO 1R1BA 4K0KO 4LF4O 2Z0AA 1N33O 1IBLO 1FJGO 4GKJO 4OX9O 3J80N 2FKXA 3T1YO 4JV5O 2UUAO 4JI3O 4LF5O 4JI6O 2UU9O 1DK1A 4DV1O 3T1HO 2JRIA 1F7YA 4DR3O 4NXMO 1HNWO 1A32A 2UUBO 4DR4O 3OTOO 2F4VO 1XNQO 2UUCO 2UXBO 4B3MO 1XMQO 4AQYO 5IWAO 5BY1A 4JI5O 5FLXN 4LF9O 3SDLA 2UXDO 4B3SO 2DOSA 4KHPO 4DR7O
chains in the Genus database with same CATH superfamily
4FVMA 3DC6A 4JZGA 3O9OA 4JI2B 2VQEB 5C8YB 2CTQA 3K0GA 3CD6V 1Q7YW 3CXHF 3ZBHA 4JYBA 4QNHB 4Z1VA 4BWAA 3JAKA 4I55A 3BABA 4W4LA 4P2ZA 1NS1A 2NN4A 1Q8IA 1R3LC 4X88A 3RW0A 2UXXA 2VQFO 4FLWA 4O2BA 1FPOA 3QO7A 2P67A 2FTKA 2QTOA 3B2EE 5B1AB 3JCZA 3AG1B 4MTOA 4DR5O 2ZXWB 2A7WA 3L71H 5EK0A 2LP7A 5LP6C 4NKGB 4LF6B 4X64O 1J95A 4B3RO 4FLTA 1NR7A 4X66B 1O9HA 2IM9A 3RYHB 4BR6A 4DR6O 2QE7G 3RYFA 4LF7O 1VARA 4DV3O 4WFGA 1DF5A 3THOA 4FZ1A 1QBZA 5EIBD 4JI5B 1GRJA 2RQ6A 5CBGA 1JMKC 4UXNA 4DR5B 2H8PC 1MABG 2QKSA 2JGUA 1F4MA 1G8MA 2AZ0A 2YEVB 1N33O 4PA6A 1HNZB 1FAFA 2PYJA 3EHBB 2E74B 5JCOA 5LXTA 1EZJA 1ZX3A 4LH7A 5EZYB 1N34B 1XMOB 3JAKB 4I55B 1P7GA 1IBMB 2HEPA 2E5LB 2Y0IA 4DV7B 2B1IA 1ZL8B 3GVMA 4LF8B 1Y66A 5BY1A 1P84F 5EC2C 4LF9O 1U97A 1YJWV 1PNMA 3W7UA 2CDYA 3CCRV 1VQOV 1SETA 2PY5A 4DV2B 3T4DA 1R3JC 5CA1A 2CTPA 3T1YB 1YJ9V 1N32O 1BT8A 1H8HG 1KU9A 2GTSA 1K92A 4MS2A 2IJIA 1W0KG 4U3JA 1G1XB 4X1YA 5KAIZ 1QCEA 1SQQH 5BZBA 2EILC 1K4DC 1R6TA 3CC4V 4EB6A 5A2QN 4WFAV 1FXKB 1EN6A 2IJKA 1Y4MA 3E83A 1UFIA 4FFKA 4PA3A 2OIEA 4D7TA 3BVOA 2YS8A 3PN1A 4FFBB 1Y76B 2H94A 1VQ7V 3K3WA 1FJGB 3ZX6A 4TUYB 5LOVB 1OCRB 2K1EA 4PELA 3OTOB 3P3PA 3G80A 4J9YB 2YICA 2ADQB 1XMQB 2GDSA 1Y74A 2OTLV 4DV0O 1X59A 3JD2A 1AJNA 3SGIA 1WAZA 3JALA 5CB4A 4GLXA 5CBFA 4J11A 4H44B 3CC7V 4IT5A 3CEIA 3OR6C 2P22C 1YITV 3U10A 1I0HA 1V54B 4KFMA 3BHPA 3JATA 5HFLA 2QA4V 4JI3O 4XDJA 4U3FH 1F23A 1TAEA 3L73H 5BMVA 3BY6A 2Q8VA 1A32A 2UXCB 1SZTA 3IC9A 4WBNA 1L1FA 1HW7A 5GTHZ 4LNUA 1QU7A 2CTRA 2Z5UA 3RGBA 1YI2V 4TQFA 3E2EA 3UQ8A 2OCCB 4PJ0Z 4QE9A 2EINC 1H8EG 3UT5A 4MTFA 5EIBC 2DN9A 3QO8A 5LP6B 3FFQA 1K73W 3SJQC 3CYOA 4UCSA 3HKBA 3OM3B 4X1IB 4K3AA 4FFBA 1P7BA 3AG4B 5JVDB 5H5NA 4WCEV 4YHHO 2YSUB 1N33B 1M5IA 3QF7A 3S3XA 1TUBA 1SC5B 4X62B 1S5HC 2NLJC 4WFEA 3FB7C 3ABMB 4DV2O 1H2SB 3LNMB 1JPXA 5J2UA 1W2BU 1AJQA 1WB8A 2CGOA 4IHJA 2HVJC 4PDRA 5DM6V 2Y4TA 4F6RB 5KHKA 1SQVH 4B3MB 3QTCA 1M4UA 5JH7A 4GKJO 4OX9O 2N05A 3J80N 2ZE7A 1HWYA 2M6YA 5EYPA 3SPHA 5KUMA 3ZHQA 1AR1B 4JYAB 1GH6A 3T1HO 2VS0A 4O4IA 1QNMA 3BA9A 1YHQV 2QWRB 4K8XA 2ZD9A 4B3MO 4MVSA 1XMQO 1LR1A 4I0XB 1N0JA 3TGUH 2ZINA 1HP8A 3A0HZ 2EZPA 3LUTB 1AI7A 1R73A 3DXRB 1SA0A 4KP4A 2AGAA 1I7FA 3AG3C 4ZIBA 4X20A 3F7YC 4O4HB 2EX3A 1YVWA 1NT2B 2QWQB 5ITZA 4JI2O 2Q4PA 2YC0A 1NQTA 5L3BA 2Q73A 2NR5A 2KQXA 1GN6A 1YZBA 3LSUA 3WG7B 3QO5A 3CCLV 2JIZG 3PJSK 3GB7C 3BEHA 1AROP 1B3QA 4JI0O 3MHSC 2F4VB 2E75B 2EIKC 2ADPA 1IDSA 3T2MA 4I7ZB 1I5YA 2HHHB 1S76D 5IYCO 1XL4A 1XNQB 3U0ZA 2PTMA 4K35A 2ITCC 5H6RA 2BTOA 4LCUC 4X64B 3OGIB 3I56V 4B3SB 1ZTEA 4JV5O 2UUAO 3AEIA 4MSWC 4JAAA 4R7CA 4RUEA 4NYKA 2CK3G 3G6EV 4DR4O 4UCVA 1XNQO 3TXQA 1M57C 4DR1B 2UUCO 4DV4B 1YTFB 1SQFA 5H9CA 2CUGA 3CX5F 1TA8A 4K0KB 3CRCA 2AW9A 2BTQA 2IJHA 4EFEA 4TOIA 3K5MA 1Z5VA 4GKJB 2KG7A 1KMIZ 1GTOA 4GKKB 1CXZB 2YIDA 2GBOA 2BSKA 3CJHA 4I50A 4JPRA 4UVAA 1FXKC 2E5LO 2WLLB 2EILB 3A0RA 3U11A 1YSCA 1HR0O 1S3JA 2M7WA 2ZE5A 4MW3A 4X9QA 1QVFU 1UPGA 2CGNA 1TGOA 2CE4A 3DTUB 3CCQV 4OPHA 4AHCA 1IURA 4DO2A 3I55V 2FYUH 2F23A 5LA6A 1EBOA 2QWNB 3RT3C 4DV5O 1ZUQA 4DRXB 5L3GA 1FFXB 2LJ2A 5FL7G 1R3KC 1VQNV 1QLEB 2C2AA 2GTAA 2VQEO 2X6BA 4PA4A 1BHBA 1BGYH 1Z2GA 1U96A 4UCRA 5IJ0B 3Q4HA 5CB4B 1FYJA 4ZBMA 3X2QB 3R66A 5KX5A 4C7UA 2DYRC 1M56B 1OCOB 1OCRC 2EJ7A 3BA8A 4TUYA 1FXVA 3MHHC 4FJCC 4HNAB 1P49A 3FB6C 3VQVA 2QM4A 4UV8A 2JEUA 3TETA 2UU9O 4PI2A 2BSKB 5FPOA 2JRIA 4IIJB 2YIBA 2Q0AA 2UUBO 4J7KA 1NBMG 3ZRXA 2ZR3A 4FLZA 2QEXV 2YIAA 1BS3A 4RAIA 5BMVB 2ILMA 1RM1B 4TV9B 2ZT9B 4NXNB 1EM1A 4UCOA 2JGDA 4JI1O 4FM1A 5K1XA 4DYLA 1D5AA 1VQ9V 4CZZA 4DR3B 5GONB 4MTXA 2IU3A 3ZIAG 1BQ0A 2E3CA 1JFFA 4PA7A 1OCZC 2KKWA 1MNGA 1L0NH 3CRMA 4U7OA 3AG4C 1M93A 3C90A 3G67A 5LMNO 2R9IA 4X1KA 2P6JA 3E22B 2R9RB 2N74A 4J41A 2UUAB 2X6AA 1COWG 2WA4A 4JI6B 2XASA 2XTAA 4D7SA 2B9ZA 1YJNV 3RYCB 4LWSA 3H01A 4LF5B 4FPPA 3UM7A 4FLYA 4YJ2A 2IU0A 3SPIA 3HKEB 5JJJB 1KP3A 3H9VA 1MG1A 1OCCC 2QM8A 2ZNJA 1GO3F 1XUQA 5DN6G 5CBHA 4BAYA 1PL0A 2W6IG 1NKDA 1SZXA 5B1BB 4MVUA 2D2CB 3T1YO 4HNAA 2AZ2A 2P06A 1EFRG 1V54C 3K9SA 2JS5A 2HJDA 3OTOO 5KX5B 3JCUZ 4PHZA 4DK0A 2HKOA 3ZN0A 1LNQA 3OW2U 2A9HA 2JK5C 2VWKA 5ITZB 3T4ZA 3ZMUA 1IX9A 3LSQA 4HAMA 1MOFA 1PNKA 3IC7A 4ZOLA 4B7EA 4LFAB 2OIGA 4GT1A 3CCUV 5LOVA 2QM7A 1SQGA 3ZMVA 5LMUO 1PL4A 4H37A 5K1PA 3UCSC 1KP2A 1H2NA 5FNVA 2XAGA 4UV9A 2ZIMA 1S0VA 4JI4O 1Q43A 1V9PA 1GM8A 2EIJB 3SYAA 1HDJA 1YCIA 4MT8A 4PDMA 5LGNA 2F93B 3ZCCA 2XUMA 4BIUA 4X8AA 2ARHA 3C3TA 1IXBA 1YEWA 1JQ0A 1SS3A 2DQ3A 1OJHA 3FX7A 2H3OA 2XHBA 3ETQA 4NTWA 4K8ZA 4IYIA 1K7DA 4JAUA 1O9GA 2RMKB 2X7RB 4G27B 3WB0A 4CS2A 4DV3B 3VQXA 3L70H 2GUZA 3CRRA 4DXWA 4R6ZA 4ABMA 1JVMA 4P30A 1PV0A 3TXSA 3KZIZ 2Y48A 2YXHA 1L0LH 1YTFD 3OE7G 4NTXA 4KL1A 4J10A 2P7TC 3CRAA 4B3SO 4MTGA 5DEDA 2VWJA 4DR7O 1CEZA 4JV5B 4DUYO 4JI7O 3T1CA 4RO2A 4W4KA 3K06A 3WU2Z 1H2KA 3QNEA 1FFTB 3JARA 4B3TO 2ZQMA 3J7AU 3VOUA 3JD3A 4CC6A 2KB1A 3OMNB 2PUSA 4WBNB 3RYIA 4LF9B 4IHJB 2PI5A 2BE3A 2YDEA 2IJJA 1WN7A 2HJFC 5CMUA 5B1AC 4LF7B 4OPAA 2ZDIA 3F7VC 3L9DA 4WF9V 1AR4A 3UKMA 1AR5A 4OX9B 4GKKO 1N32B 3TK1A 1XNRB 1F4NA 5FNVB 4CS3A 4X65B 5LA6B 3WFVA 1NZ6A 5KMGA 4TQDA 1Q5OA 1VEWA 1UJWB 1IBLB 3K03A 1HNZO 1AP5A 1NI8A 1H2LA 2MW2B 1KECA 1GN4A 3K08A 3H1JH 4YIPA 1GMGA 2P5OA 1YIJV 3OFNG 3AK1A 2EIJC 2WA3A 2ZR2A 1WLEA 3IFXA 1OZ0A 1R1BA 1N0NA 3E86A 2W6JG 3ICXA 4NR1A 1JA8A 3LNNA 1LUWA 3K5NA 1RSOA 1H2MA 4TV9A 3CE2A 2GHYA 3AG2B 2ZNIA 2F43G 4CBCA 1W59A 1NTMH 1XOUA 1Q6IA 2YXYA 4MW8A 1DK1A 5DECA 5JQGA 3ZRWB 2IH1C 3G6BA 5KHJA 5L3DA 1JR9A 2F4VO 3SYCA 1VMGA 3IAYA 3ZHVA 2W0XA 2ZDIC 4B08A 4UFZA 3BFRA 4GX1A 1BZKA 1Y67A 1I08A 3B8MA 5HFMA 4AILC 2UXDO 3TCUA 5H2FZ 4X89A 2DYSC 2DYSB 1WPBA 1ZAUA 4R8CA 3I5DA 3RYIB 1VQMV 1E1RG 4LBEC 3BPZA 3H1KH 4L8JA 4CH6A 4IYHA 3CCEV 1X4TA 1Q6UA 5B1OA 4FK5C 4JTDB 4AI8A 1XHZA 2KSDA 4YJ2B 1OCCB 1NU1H 3ZN1A 3RFRA 5L3FA 5E1AC 3AK3A 4X1YB 5J2TA 4JI8O 1WJZA 5D5QA 5EBLC 4DUYB 1VQ8V 4JI7B 3F5TA 4FIPC 4GX2A 1ROPA 2G38A 1HNWB 4LP8A 1NVPB 1BL8A 3VQYA 4NTYA 4KXRA 1MA1A 4YJ3A 1PKXA 5CA0A 4DUZO 5IWAB 2UXCO 2OCHA 3CHXA 3W7XA 4XBFA 4LFCO 4CH5A 3SYOA 2AHZA 4TT3G 3CCJV 4DR7B 2Q5ZA 2Z0AA 1IBKB 3CCSV 5IDJA 4UUJC 3ZRWA 1Y74B 2AXTZ 5JWPA 2A0LA 1K5SA 2FKXA 2NNUA 2ZE8A 3STZC 4B3TB 1JJOA 1M1KW 2XAQA 2OWOA 2EBOA 3CJHB 4H0LB 3IGAC 4J9ZB 1WNSA 4O4JA 1F7YA 1Y6XA 4H33A 2MK3A 3FYEB 1VQ4V 1VF5B 2B1GA 4MVRA 3D36A 3E89A 1TUEB 4JAVA 2Q7HA 1VF6A 2WLLA 3ABMC 3DSQA 4ZHQA 1G4YB 1DLBA 2K9PA 4G28B 4HBNA 4X62O 1IVSA 2Y69C 1GM7A 3P32A 4LFBO 3OMAB 3UT5B 3D3QA 3LDCA 3SPGA 4Q20A 1Q82W 2HLDG 4JTCB 4OXSA 5C8YA 3B77A 4J42A 3NR7A 4I50B 1H38A 3G4SV 1AILA 1E79G 3ML0A 4X1IA 2JDIG 4GZRB 4ZKIA 4LFAO 3J81N 2WAMA 3ABLB 4LFBB 4I5SA 1EN5A 4ZOLB 5LMUB 1VP7A 2EIKB 1QVGU 3K0DA 4JI1B 4DV6O 3B4SA 2OCCC 5J2TB 5JJNB 3MAQA 3APOA 2BOCC 3WG7C 2ETNA 3JAWA 4D6TH 3ABTA 4J7ZA 4JI4B 1CP9A 1Q81W 1PNLA 2ZXWC 4ZI7B 2ZE6A 2DE0X 3ABKB 1FFXA 1SKVA 4O4JB 2QWOB 5B1BC 4JI8B 4O4IB 4JYCA 3ETEA 2FMLA 3KKYA 1N36B 1XQ8A 3ABUA 1KKCA 4KHPB 3GWKC 5B1NA 4JI6O 1WP8A 4I9QA 4DR3O 1QR8A 2XAHA 3LDDA 4I4TA 2HG5C 3S3WA 3AG7A 2P4VA 2BCCH 3MD0A 2DQ0A 1RPRA 2L35A 1P4RA 2GUZB 2PYLA 3IJ4A 5TISZ 3JD1A 4CH3A 4QPJA 1SQPH 1BHAA 4U7NA 3P30A 3SPCA 5KMGB 3K58A 5LXTB 1Q90D 5KA6A 1IBMO 2P4KA 4DV4O 4DV7O 3OGCC 2GV9A 3ZEDA 5KA5A 2WLIB 1BCCH 4X1KB 4BIZA 4WFHA 2GSMB 3JAMN 2CTWA 5KAFZ 1AI6A 4MVMA 1OV9A 5AG2A 4FMTA 3D36C 1SQBH 3E35A 5GTIZ 5KUKA 1IBKO 2XAFA 1MZEA 4ZHQB 1URFA 5BR8B 4EKWA 2A3QA 1NTZH 3JAWB 3JARB 5IJ9A 1HR0B 1VIBA 2LO1A 4E4EA 2QJ1A 1BE3H 3CWBH 1Q6HA 4QIWF 2UXBB 3N2GB 2UXNA 3OMIB 2ZM6O 1R3IC 1XMOO 2YUAA 2LFSA 2OYQA 3B8NA 5C93A 4JF3A 3K57A 3ZJZA 4LH6A 2V7QG 2RJZA 1IBLO 1FJGO 2Z3YA 4ASUG 3RN4A 2CAZC 3JALB 3NXSA 3ZMTA 3APQA 5A9GA 5LP6A 2RDCA 5KHHA 2HR3A 3HKDB 4I9WA 2A06H 2ODMA 3RWRD 5B3SC 4RWUA 3ZMZA 2LW1A 5LGTA 3ASNC 4AQYO 1FS0G 2EINB 2WPDG 1TVKB 2O57A 1L8DA 1KYOF 4ZI7A 2N04A 4IL6Z 2LQTA 2B5UA 3OUSA 3HKBB 4DRXA 3ZHUA 1JOYA 1YDXA 3ZRVA 3HKCA 4RUFA 2FL4A 1MZFA 3ETGA 3JSNA 2EZOA 4UB6Z 3RYHA 3L74H 2R72A 4FLXA 3OD4A 4JZ2A 2YI9A 4MVQA 4H13B 1VQ5V 4NXNO 2YI8A 4P9PA 1B06A 5D5PA 2P90A 1BQZA 5KLVH 1WA8A 4KUMA 2JS3A 2QWPB 1N36O 3RYFB 4BW9A 4YJ3B 1KD1W 3ZMSA 1AI5A 2VRZA 2E76B 2PI4A 2OT5A 1QQCA 1K8AW 4DR2O 4A5UB 4JI3B 1XL6A 2HFEC 2QKAA 5JH7B 4GUNA 2CH7A 4R50A 2OTJV 4TWKA 1PPJH 4NVPA 1NJIW 2UUBB 2YXLA 2ZKOA 1R6NA 4OGQB 2VQFB 2LFRA 2V4DA 3VBBA 1XREA 2YIBD 1TUBB 4HZ3A 3SYPA 5LYJB 3RVYA 1CPYA 4O4LB 3H1IH 2Q9LA 5JJEB 2Q68A 3JD0A 5F2VO 3MDSA 4CS4A 5L3CA 3DC5A 3CSXA 1V55B 1Q86W 4LF5O 2R9AA 1DGSA 5IYZA 3CMAV 3W7TA 3CCVV 4B3RB 3Q4HB 1IZ3A 4NXMO 1KQSU 3FAVB 4UVCA 5GONA 1WP7A 5CA0B 4LFCB 3K5LA 3OEHG 1SQXH 3FD9A 2ZM6B 2EIMC 4F6RA 3BCCH 3FYIB 3JYCA 3HKDA 4JI5O 1KB9F 3SDLA 4N23A 1SA0B 5BR8O 1XNRO 5LGUA 4JYAO 1WPXA 4IGGA 2QR4A 5IYDO 5LMNB 1N8RW 1GKFA 1J5EO 2A79B 2DW4A 1VQLV 5IE9A 1LUVA 5EZYA 4X66O 4GX5A 3W7SA 3OTFA 1S5JA 1XEQA 2CH7B 4BIOA 3HB3B 1Y76A 3FB5C 4J80A 2IW5A 1T5EA 2QDOA 1BMFG 2W0FC 1I94O 4U3JB 3R65A 2UXDB 1J5EB 1DTOA 5B66Z 2QKCA 4Z1MG 3ABKC 1FXHA 3HPLC 1YXBA 1S5LZ 1THZA 5IYZB 1N34O 2EULA 1JCHA 2Q67A 5IYBO 1AB3A 2WLMA 2XAJA 1K9MW 2XOKG 1RM1C 4MVOA 5KHIA 1I94B 4JTAB 1GAXA 2V1DA 1MSDA 3K59A 3CXCU 4LWSB 2X0LA 1VF7A 2Y4UA 1XILA 3ASNB 2F1MA 2Q7EA 3E22A 3N2KA 4Q6GA 4DV6B 3FAVA 1ZSPA 1K34A 5B3SB 3K5OA 4I4TB 3E8GA 1K5QA 3EXAA 2KG7B 3JASB 4JI0B 4DV1O 1HNWO 4FM0A 4DR2B 1Z5WA 1ENVA 1EZVH 1D5NA 1ORQC 4PA9A 2XT9A 3HKEA 5IWAO 4DV0B 4O2BB 2ZCEA 3A0BZ 3E8HA 2HP8A 4ICGA 2DYRB 3JD4A 3CS5A 2Q0OC 1GN2A 1PP9H 4DV1B 2WLIA 3FB8C 3CRQA 3OEEG 3E8FA 3UO3A 2F95B 3D8CA 4GCZA 3CC2V 4DR4B 1FKAO 2IBZH 4DW0A 5JVDA 4LF6O 3W7WA 4FZ0A 1RPOA 1QHTA 5EBWC 1VQPV 5FPRA 5BXZA 3BAAA 2D3OW 1D2DA 4G2KA 4JGSA 1W0JG 3L72H 1OCZB 2ITDC 4EEQA 1SRYA 3M99B 2EJRA 3ZHTA 4GYCB 3BRCA 3GWOA 2HVKC 1B6QA 4LF4B 3OR7C 3CB2A 2DWDC 1SF9A 3M8AA 5H6QA 5KHGA 1B04A 2F66C 4NXMB 2LW7A 1PM9A 4DW1A 2AHYA 1AP6A 5LL6Y 4WFBV 4P9OA 1PD3A 1AI4A 2PGGA 2JJ1G 4F4LA 3AG1C 3DGEA 2JJ2G 2DJVA 3WB2A 2WLKA 4QJFB 3FKSG 4PV1B 3ASOC 4LF4O 5LHHA 2LGQA 4UCUA 3SR2C 4Z2WA 1E1QG 2JGDB 3DXRA 1ZL8A 4J7JA 4TSFG 3H1LH 5LHGA 1FD9A 1RP3B 1TVKA 3KG2A 4QGPA 4I0XA 3K04A 1XI1A 2BOBC 3SPJA 4EB6B 3KCYA 4TV8B 2PZSA 5EBMC 4YY3B 1US6A 4YXWG 3N2KB 3AK2A 2YEVA 2ATKC 3ZHSA 5IY5C 1Q3EA 3P3NA 4FLVA 3A8TA 4JYYA 5EYPB 3ETDA 2RCVA 3K79A 5JCOC 3CMEV 1IXMA 1FXKA 4IIJA 1HNXB 3HR0A 1NTKH 4X65O 3T1HB 2RNBA 4PDLA 4XDKA 3HKCB 4YY3O 2LGWA 1F51A 4FLUA 1NR1A 4HYOA 4DK1A 3OT7A 2R70A 4NB5A 3UO2A 3ZHRA 2WWWA 2WLNA 2WLHA 5LYJA 3VQWA 3AG3B 1M56C 1OCOC 2QGNA 3O65A 2JVDA 4YIOA 4O4HA 4RQEA 1HNXO 4FM2A 3STLC 3JATB 3X2QC 2XNDG 4UCTA 2Y0PA 2QSAA 3KCXA 1BSMA 4WFFA 2ZIOA 1H2GA 2JEXA 1JJ2U 2UU9B 4JASA 1JX9A 1QLEC 3E8BA 1JFFB 3LDEA 4UB8Z 2Q69A 4LR3A 3ZS8C 1XDCA 4LNUB 4TV8A 4LC1A 3SJCC 3EVKA 1WA8B 5J9PC 3OUFA 5CA3A 3QVNA 1OHHG 3N27A 1KBHA 1M90W 4RQFA 4PI0A 4PDVA 5LHIA 3SYQA 3RYCA 3M7MX 4O4LA 1N4CA 1ZLZA 4PD4F 4EFBA 4DR6B 1VQKV 2UXBO 1WB7A 5IY5B 4E2LA 5JQGB 1RSOB 4YHHB 3QG5A 5EC1C 4QE7A 1K3EA 3CP1A 3RVZA 2WSSG 1K97A 2DMXA 2BTQB 1GK9A 3ABLC 4L87A 3H1HH 4O2AA 3EFFK 1R6KA 2L6LA 2HHHO 3WB1A 3OAAG 4DR1O 2UUCB 3RBZA 5GW7A 1QR9A 3SJBC 2RN9A 4LF8O 1S77D 1GN3A 1AVMA 1EN4A 4CC5A 4DUZB 5IT9N 1K33A 1RFYA 3K9AA 1AJPA 4F6EA 3CPWU 3ASOB 4MVZA 1KUQA 1ZWIC 3F5WC 3JSLA 2Y69B 1YF2A 2IH3C 3SJAC 2X6CA 1NH2B 4GX0A 1XBLA 4XDLA 3B09A 2EIMB 4B7KA 3L75H 4BW5A 4AQYB 1MSWD 3LSSA 3TJTA 5L3EA 3B40A 1KC8W 4K0KO 3JASA 1SERA 3A2FA 3N2GA 1V55C 5E79Z 1VQ6V 1QLNA 4UVBA 1NVPD 2QTSA 1KKDA 1VF6C 1M9NA 2PF4E 3D3IA 5IJ9B 3G71V 5CN0A 1MMMA 4N21A 1GM9A 3CCMV 2Q7GA 1K4CC 5J2UB 5IJ0A 2FB5A 1G6UA 5B5EZ 3AG2C 4O2AB 1DF4A 3C3SA 4X20B 1S72V 4CH4A 5CA1B 5LBQA 3ZRSA 1SESA 1NH2D 1I5XA 2Q6AA 5FLXN 4DV5B 4QPKA 1XHXA 2DOSA 4KHPO 2DWEC 2WLJA 1M57B
chains in the Genus database with same CATH topology
5BR8O 4DUYO 4JI7O 1XNRO 4JYAO 4JI1O 1J5EO 4B3TO 4X62O 1N32O 3J7AU 4X66O 1FKAO 1IBMO 4LFBO 2E5LO 4DV4O 4X65O 4DV7O 4LF6O 5LMUO 2AGAA 1HR0O 2HHHO 1G1XB 1XEQA 5BXZA 1NS1A 4YY3O 1D2DA 3JAMN 4DR1O 1R6TA 5A2QN 4OPHA 2VQFO 4LF8O 5H5NA 4OPAA 4YHHO 1AILA 4JI4O 4NXNO 5IT9N 3RT3C 4DV5O 4JI2O 1IBKO 5LMNO 1I94O 4JI8O 4DR5O 4LFAO 3J81N 4GKKO 1KUQA 1N36O 3O65A 3F5TA 1HNXO 2N74A 4DV2O 2VQEO 1YZBA 3M8AA 4DV6O 4X64O 1HNZO 4B3RO 1N34O 2LW7A 4DR2O 1AB3A 1FYJA 4JI0O 4DR6O 4A5UB 5LL6Y 4LF7O 3R66A 2ZM6O 4DUZO 4DV3O 2DJVA 2UXCO 1XMOO 4DV0O 1X59A 2ZKOA 4LFCO 1R1BA 4K0KO 4LF4O 2Z0AA 1N33O 1IBLO 1FJGO 4GKJO 4OX9O 3J80N 2FKXA 3T1YO 4JV5O 2UUAO 4JI3O 4LF5O 4JI6O 2UU9O 1DK1A 4DV1O 3T1HO 2JRIA 1F7YA 4DR3O 4NXMO 1HNWO 1A32A 2UUBO 4DR4O 3OTOO 2F4VO 1XNQO 2UUCO 2UXBO 4B3MO 1XMQO 4AQYO 5IWAO 5BY1A 4JI5O 5FLXN 4LF9O 3SDLA 2UXDO 4B3SO 2DOSA 4KHPO 4DR7O
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5BR8 O;  4DUY O;  4JI7 O;  1XNR O;  4JYA O;  4JI1 O;  1J5E O;  4B3T O;  4X62 O;  1N32 O;  3J7A U;  4X66 O;  1FKA O;  1IBM O;  4LFB O;  2E5L O;  4DV4 O;  4X65 O;  4DV7 O;  4LF6 O;  5LMU O;  2AGA A;  1HR0 O;  2HHH O;  1G1X B;  1XEQ A;  5BXZ A;  1NS1 A;  4YY3 O;  1D2D A;  3JAM N;  4DR1 O;  1R6T A;  5A2Q N;  4OPH A;  2VQF O;  4LF8 O;  5H5N A;  4OPA A;  4YHH O;  1AIL A;  4JI4 O;  4NXN O;  5IT9 N;  3RT3 C;  4DV5 O;  4JI2 O;  1IBK O;  5LMN O;  1I94 O;  4JI8 O;  4DR5 O;  4LFA O;  3J81 N;  4GKK O;  1KUQ A;  1N36 O;  3O65 A;  3F5T A;  1HNX O;  2N74 A;  4DV2 O;  2VQE O;  1YZB A;  3M8A A;  4DV6 O;  4X64 O;  1HNZ O;  4B3R O;  1N34 O;  2LW7 A;  4DR2 O;  1AB3 A;  1FYJ A;  4JI0 O;  4DR6 O;  4A5U B;  5LL6 Y;  4LF7 O;  3R66 A;  2ZM6 O;  4DUZ O;  4DV3 O;  2DJV A;  2UXC O;  1XMO O;  4DV0 O;  1X59 A;  2ZKO A;  4LFC O;  1R1B A;  4K0K O;  4LF4 O;  2Z0A A;  1N33 O;  1IBL O;  1FJG O;  4GKJ O;  4OX9 O;  3J80 N;  2FKX A;  3T1Y O;  4JV5 O;  2UUA O;  4JI3 O;  4LF5 O;  4JI6 O;  2UU9 O;  1DK1 A;  4DV1 O;  3T1H O;  2JRI A;  1F7Y A;  4DR3 O;  4NXM O;  1HNW O;  1A32 A;  2UUB O;  4DR4 O;  3OTO O;  2F4V O;  1XNQ O;  2UUC O;  2UXB O;  4B3M O;  1XMQ O;  4AQY O;  5IWA O;  5BY1 A;  4JI5 O;  5FLX N;  4LF9 O;  3SDL A;  2UXD O;  4B3S O;  2DOS A;  4KHP O;  4DR7 O; 
#chains in the Genus database with same CATH topology
 4FVM A;  3DC6 A;  4JZG A;  3O9O A;  4JI2 B;  2VQE B;  5C8Y B;  2CTQ A;  3K0G A;  3CD6 V;  1Q7Y W;  3CXH F;  3ZBH A;  4JYB A;  4QNH B;  4Z1V A;  4BWA A;  3JAK A;  4I55 A;  3BAB A;  4W4L A;  4P2Z A;  1NS1 A;  2NN4 A;  1Q8I A;  1R3L C;  4X88 A;  3RW0 A;  2UXX A;  2VQF O;  4FLW A;  4O2B A;  1FPO A;  3QO7 A;  2P67 A;  2FTK A;  2QTO A;  3B2E E;  5B1A B;  3JCZ A;  3AG1 B;  4MTO A;  4DR5 O;  2ZXW B;  2A7W A;  3L71 H;  5EK0 A;  2LP7 A;  5LP6 C;  4NKG B;  4LF6 B;  4X64 O;  1J95 A;  4B3R O;  4FLT A;  1NR7 A;  4X66 B;  1O9H A;  2IM9 A;  3RYH B;  4BR6 A;  4DR6 O;  2QE7 G;  3RYF A;  4LF7 O;  1VAR A;  4DV3 O;  4WFG A;  1DF5 A;  3THO A;  4FZ1 A;  1QBZ A;  5EIB D;  4JI5 B;  1GRJ A;  2RQ6 A;  5CBG A;  1JMK C;  4UXN A;  4DR5 B;  2H8P C;  1MAB G;  2QKS A;  2JGU A;  1F4M A;  1G8M A;  2AZ0 A;  2YEV B;  1N33 O;  4PA6 A;  1HNZ B;  1FAF A;  2PYJ A;  3EHB B;  2E74 B;  5JCO A;  5LXT A;  1EZJ A;  1ZX3 A;  4LH7 A;  5EZY B;  1N34 B;  1XMO B;  3JAK B;  4I55 B;  1P7G A;  1IBM B;  2HEP A;  2E5L B;  2Y0I A;  4DV7 B;  2B1I A;  1ZL8 B;  3GVM A;  4LF8 B;  1Y66 A;  5BY1 A;  1P84 F;  5EC2 C;  4LF9 O;  1U97 A;  1YJW V;  1PNM A;  3W7U A;  2CDY A;  3CCR V;  1VQO V;  1SET A;  2PY5 A;  4DV2 B;  3T4D A;  1R3J C;  5CA1 A;  2CTP A;  3T1Y B;  1YJ9 V;  1N32 O;  1BT8 A;  1H8H G;  1KU9 A;  2GTS A;  1K92 A;  4MS2 A;  2IJI A;  1W0K G;  4U3J A;  1G1X B;  4X1Y A;  5KAI Z;  1QCE A;  1SQQ H;  5BZB A;  2EIL C;  1K4D C;  1R6T A;  3CC4 V;  4EB6 A;  5A2Q N;  4WFA V;  1FXK B;  1EN6 A;  2IJK A;  1Y4M A;  3E83 A;  1UFI A;  4FFK A;  4PA3 A;  2OIE A;  4D7T A;  3BVO A;  2YS8 A;  3PN1 A;  4FFB B;  1Y76 B;  2H94 A;  1VQ7 V;  3K3W A;  1FJG B;  3ZX6 A;  4TUY B;  5LOV B;  1OCR B;  2K1E A;  4PEL A;  3OTO B;  3P3P A;  3G80 A;  4J9Y B;  2YIC A;  2ADQ B;  1XMQ B;  2GDS A;  1Y74 A;  2OTL V;  4DV0 O;  1X59 A;  3JD2 A;  1AJN A;  3SGI A;  1WAZ A;  3JAL A;  5CB4 A;  4GLX A;  5CBF A;  4J11 A;  4H44 B;  3CC7 V;  4IT5 A;  3CEI A;  3OR6 C;  2P22 C;  1YIT V;  3U10 A;  1I0H A;  1V54 B;  4KFM A;  3BHP A;  3JAT A;  5HFL A;  2QA4 V;  4JI3 O;  4XDJ A;  4U3F H;  1F23 A;  1TAE A;  3L73 H;  5BMV A;  3BY6 A;  2Q8V A;  1A32 A;  2UXC B;  1SZT A;  3IC9 A;  4WBN A;  1L1F A;  1HW7 A;  5GTH Z;  4LNU A;  1QU7 A;  2CTR A;  2Z5U A;  3RGB A;  1YI2 V;  4TQF A;  3E2E A;  3UQ8 A;  2OCC B;  4PJ0 Z;  4QE9 A;  2EIN C;  1H8E G;  3UT5 A;  4MTF A;  5EIB C;  2DN9 A;  3QO8 A;  5LP6 B;  3FFQ A;  1K73 W;  3SJQ C;  3CYO A;  4UCS A;  3HKB A;  3OM3 B;  4X1I B;  4K3A A;  4FFB A;  1P7B A;  3AG4 B;  5JVD B;  5H5N A;  4WCE V;  4YHH O;  2YSU B;  1N33 B;  1M5I A;  3QF7 A;  3S3X A;  1TUB A;  1SC5 B;  4X62 B;  1S5H C;  2NLJ C;  4WFE A;  3FB7 C;  3ABM B;  4DV2 O;  1H2S B;  3LNM B;  1JPX A;  5J2U A;  1W2B U;  1AJQ A;  1WB8 A;  2CGO A;  4IHJ A;  2HVJ C;  4PDR A;  5DM6 V;  2Y4T A;  4F6R B;  5KHK A;  1SQV H;  4B3M B;  3QTC A;  1M4U A;  5JH7 A;  4GKJ O;  4OX9 O;  2N05 A;  3J80 N;  2ZE7 A;  1HWY A;  2M6Y A;  5EYP A;  3SPH A;  5KUM A;  3ZHQ A;  1AR1 B;  4JYA B;  1GH6 A;  3T1H O;  2VS0 A;  4O4I A;  1QNM A;  3BA9 A;  1YHQ V;  2QWR B;  4K8X A;  2ZD9 A;  4B3M O;  4MVS A;  1XMQ O;  1LR1 A;  4I0X B;  1N0J A;  3TGU H;  2ZIN A;  1HP8 A;  3A0H Z;  2EZP A;  3LUT B;  1AI7 A;  1R73 A;  3DXR B;  1SA0 A;  4KP4 A;  2AGA A;  1I7F A;  3AG3 C;  4ZIB A;  4X20 A;  3F7Y C;  4O4H B;  2EX3 A;  1YVW A;  1NT2 B;  2QWQ B;  5ITZ A;  4JI2 O;  2Q4P A;  2YC0 A;  1NQT A;  5L3B A;  2Q73 A;  2NR5 A;  2KQX A;  1GN6 A;  1YZB A;  3LSU A;  3WG7 B;  3QO5 A;  3CCL V;  2JIZ G;  3PJS K;  3GB7 C;  3BEH A;  1ARO P;  1B3Q A;  4JI0 O;  3MHS C;  2F4V B;  2E75 B;  2EIK C;  2ADP A;  1IDS A;  3T2M A;  4I7Z B;  1I5Y A;  2HHH B;  1S76 D;  5IYC O;  1XL4 A;  1XNQ B;  3U0Z A;  2PTM A;  4K35 A;  2ITC C;  5H6R A;  2BTO A;  4LCU C;  4X64 B;  3OGI B;  3I56 V;  4B3S B;  1ZTE A;  4JV5 O;  2UUA O;  3AEI A;  4MSW C;  4JAA A;  4R7C A;  4RUE A;  4NYK A;  2CK3 G;  3G6E V;  4DR4 O;  4UCV A;  1XNQ O;  3TXQ A;  1M57 C;  4DR1 B;  2UUC O;  4DV4 B;  1YTF B;  1SQF A;  5H9C A;  2CUG A;  3CX5 F;  1TA8 A;  4K0K B;  3CRC A;  2AW9 A;  2BTQ A;  2IJH A;  4EFE A;  4TOI A;  3K5M A;  1Z5V A;  4GKJ B;  2KG7 A;  1KMI Z;  1GTO A;  4GKK B;  1CXZ B;  2YID A;  2GBO A;  2BSK A;  3CJH A;  4I50 A;  4JPR A;  4UVA A;  1FXK C;  2E5L O;  2WLL B;  2EIL B;  3A0R A;  3U11 A;  1YSC A;  1HR0 O;  1S3J A;  2M7W A;  2ZE5 A;  4MW3 A;  4X9Q A;  1QVF U;  1UPG A;  2CGN A;  1TGO A;  2CE4 A;  3DTU B;  3CCQ V;  4OPH A;  4AHC A;  1IUR A;  4DO2 A;  3I55 V;  2FYU H;  2F23 A;  5LA6 A;  1EBO A;  2QWN B;  3RT3 C;  4DV5 O;  1ZUQ A;  4DRX B;  5L3G A;  1FFX B;  2LJ2 A;  5FL7 G;  1R3K C;  1VQN V;  1QLE B;  2C2A A;  2GTA A;  2VQE O;  2X6B A;  4PA4 A;  1BHB A;  1BGY H;  1Z2G A;  1U96 A;  4UCR A;  5IJ0 B;  3Q4H A;  5CB4 B;  1FYJ A;  4ZBM A;  3X2Q B;  3R66 A;  5KX5 A;  4C7U A;  2DYR C;  1M56 B;  1OCO B;  1OCR C;  2EJ7 A;  3BA8 A;  4TUY A;  1FXV A;  3MHH C;  4FJC C;  4HNA B;  1P49 A;  3FB6 C;  3VQV A;  2QM4 A;  4UV8 A;  2JEU A;  3TET A;  2UU9 O;  4PI2 A;  2BSK B;  5FPO A;  2JRI A;  4IIJ B;  2YIB A;  2Q0A A;  2UUB O;  4J7K A;  1NBM G;  3ZRX A;  2ZR3 A;  4FLZ A;  2QEX V;  2YIA A;  1BS3 A;  4RAI A;  5BMV B;  2ILM A;  1RM1 B;  4TV9 B;  2ZT9 B;  4NXN B;  1EM1 A;  4UCO A;  2JGD A;  4JI1 O;  4FM1 A;  5K1X A;  4DYL A;  1D5A A;  1VQ9 V;  4CZZ A;  4DR3 B;  5GON B;  4MTX A;  2IU3 A;  3ZIA G;  1BQ0 A;  2E3C A;  1JFF A;  4PA7 A;  1OCZ C;  2KKW A;  1MNG A;  1L0N H;  3CRM A;  4U7O A;  3AG4 C;  1M93 A;  3C90 A;  3G67 A;  5LMN O;  2R9I A;  4X1K A;  2P6J A;  3E22 B;  2R9R B;  2N74 A;  4J41 A;  2UUA B;  2X6A A;  1COW G;  2WA4 A;  4JI6 B;  2XAS A;  2XTA A;  4D7S A;  2B9Z A;  1YJN V;  3RYC B;  4LWS A;  3H01 A;  4LF5 B;  4FPP A;  3UM7 A;  4FLY A;  4YJ2 A;  2IU0 A;  3SPI A;  3HKE B;  5JJJ B;  1KP3 A;  3H9V A;  1MG1 A;  1OCC C;  2QM8 A;  2ZNJ A;  1GO3 F;  1XUQ A;  5DN6 G;  5CBH A;  4BAY A;  1PL0 A;  2W6I G;  1NKD A;  1SZX A;  5B1B B;  4MVU A;  2D2C B;  3T1Y O;  4HNA A;  2AZ2 A;  2P06 A;  1EFR G;  1V54 C;  3K9S A;  2JS5 A;  2HJD A;  3OTO O;  5KX5 B;  3JCU Z;  4PHZ A;  4DK0 A;  2HKO A;  3ZN0 A;  1LNQ A;  3OW2 U;  2A9H A;  2JK5 C;  2VWK A;  5ITZ B;  3T4Z A;  3ZMU A;  1IX9 A;  3LSQ A;  4HAM A;  1MOF A;  1PNK A;  3IC7 A;  4ZOL A;  4B7E A;  4LFA B;  2OIG A;  4GT1 A;  3CCU V;  5LOV A;  2QM7 A;  1SQG A;  3ZMV A;  5LMU O;  1PL4 A;  4H37 A;  5K1P A;  3UCS C;  1KP2 A;  1H2N A;  5FNV A;  2XAG A;  4UV9 A;  2ZIM A;  1S0V A;  4JI4 O;  1Q43 A;  1V9P A;  1GM8 A;  2EIJ B;  3SYA A;  1HDJ A;  1YCI A;  4MT8 A;  4PDM A;  5LGN A;  2F93 B;  3ZCC A;  2XUM A;  4BIU A;  4X8A A;  2ARH A;  3C3T A;  1IXB A;  1YEW A;  1JQ0 A;  1SS3 A;  2DQ3 A;  1OJH A;  3FX7 A;  2H3O A;  2XHB A;  3ETQ A;  4NTW A;  4K8Z A;  4IYI A;  1K7D A;  4JAU A;  1O9G A;  2RMK B;  2X7R B;  4G27 B;  3WB0 A;  4CS2 A;  4DV3 B;  3VQX A;  3L70 H;  2GUZ A;  3CRR A;  4DXW A;  4R6Z A;  4ABM A;  1JVM A;  4P30 A;  1PV0 A;  3TXS A;  3KZI Z;  2Y48 A;  2YXH A;  1L0L H;  1YTF D;  3OE7 G;  4NTX A;  4KL1 A;  4J10 A;  2P7T C;  3CRA A;  4B3S O;  4MTG A;  5DED A;  2VWJ A;  4DR7 O;  1CEZ A;  4JV5 B;  4DUY O;  4JI7 O;  3T1C A;  4RO2 A;  4W4K A;  3K06 A;  3WU2 Z;  1H2K A;  3QNE A;  1FFT B;  3JAR A;  4B3T O;  2ZQM A;  3J7A U;  3VOU A;  3JD3 A;  4CC6 A;  2KB1 A;  3OMN B;  2PUS A;  4WBN B;  3RYI A;  4LF9 B;  4IHJ B;  2PI5 A;  2BE3 A;  2YDE A;  2IJJ A;  1WN7 A;  2HJF C;  5CMU A;  5B1A C;  4LF7 B;  4OPA A;  2ZDI A;  3F7V C;  3L9D A;  4WF9 V;  1AR4 A;  3UKM A;  1AR5 A;  4OX9 B;  4GKK O;  1N32 B;  3TK1 A;  1XNR B;  1F4N A;  5FNV B;  4CS3 A;  4X65 B;  5LA6 B;  3WFV A;  1NZ6 A;  5KMG A;  4TQD A;  1Q5O A;  1VEW A;  1UJW B;  1IBL B;  3K03 A;  1HNZ O;  1AP5 A;  1NI8 A;  1H2L A;  2MW2 B;  1KEC A;  1GN4 A;  3K08 A;  3H1J H;  4YIP A;  1GMG A;  2P5O A;  1YIJ V;  3OFN G;  3AK1 A;  2EIJ C;  2WA3 A;  2ZR2 A;  1WLE A;  3IFX A;  1OZ0 A;  1R1B A;  1N0N A;  3E86 A;  2W6J G;  3ICX A;  4NR1 A;  1JA8 A;  3LNN A;  1LUW A;  3K5N A;  1RSO A;  1H2M A;  4TV9 A;  3CE2 A;  2GHY A;  3AG2 B;  2ZNI A;  2F43 G;  4CBC A;  1W59 A;  1NTM H;  1XOU A;  1Q6I A;  2YXY A;  4MW8 A;  1DK1 A;  5DEC A;  5JQG A;  3ZRW B;  2IH1 C;  3G6B A;  5KHJ A;  5L3D A;  1JR9 A;  2F4V O;  3SYC A;  1VMG A;  3IAY A;  3ZHV A;  2W0X A;  2ZDI C;  4B08 A;  4UFZ A;  3BFR A;  4GX1 A;  1BZK A;  1Y67 A;  1I08 A;  3B8M A;  5HFM A;  4AIL C;  2UXD O;  3TCU A;  5H2F Z;  4X89 A;  2DYS C;  2DYS B;  1WPB A;  1ZAU A;  4R8C A;  3I5D A;  3RYI B;  1VQM V;  1E1R G;  4LBE C;  3BPZ A;  3H1K H;  4L8J A;  4CH6 A;  4IYH A;  3CCE V;  1X4T A;  1Q6U A;  5B1O A;  4FK5 C;  4JTD B;  4AI8 A;  1XHZ A;  2KSD A;  4YJ2 B;  1OCC B;  1NU1 H;  3ZN1 A;  3RFR A;  5L3F A;  5E1A C;  3AK3 A;  4X1Y B;  5J2T A;  4JI8 O;  1WJZ A;  5D5Q A;  5EBL C;  4DUY B;  1VQ8 V;  4JI7 B;  3F5T A;  4FIP C;  4GX2 A;  1ROP A;  2G38 A;  1HNW B;  4LP8 A;  1NVP B;  1BL8 A;  3VQY A;  4NTY A;  4KXR A;  1MA1 A;  4YJ3 A;  1PKX A;  5CA0 A;  4DUZ O;  5IWA B;  2UXC O;  2OCH A;  3CHX A;  3W7X A;  4XBF A;  4LFC O;  4CH5 A;  3SYO A;  2AHZ A;  4TT3 G;  3CCJ V;  4DR7 B;  2Q5Z A;  2Z0A A;  1IBK B;  3CCS V;  5IDJ A;  4UUJ C;  3ZRW A;  1Y74 B;  2AXT Z;  5JWP A;  2A0L A;  1K5S A;  2FKX A;  2NNU A;  2ZE8 A;  3STZ C;  4B3T B;  1JJO A;  1M1K W;  2XAQ A;  2OWO A;  2EBO A;  3CJH B;  4H0L B;  3IGA C;  4J9Z B;  1WNS A;  4O4J A;  1F7Y A;  1Y6X A;  4H33 A;  2MK3 A;  3FYE B;  1VQ4 V;  1VF5 B;  2B1G A;  4MVR A;  3D36 A;  3E89 A;  1TUE B;  4JAV A;  2Q7H A;  1VF6 A;  2WLL A;  3ABM C;  3DSQ A;  4ZHQ A;  1G4Y B;  1DLB A;  2K9P A;  4G28 B;  4HBN A;  4X62 O;  1IVS A;  2Y69 C;  1GM7 A;  3P32 A;  4LFB O;  3OMA B;  3UT5 B;  3D3Q A;  3LDC A;  3SPG A;  4Q20 A;  1Q82 W;  2HLD G;  4JTC B;  4OXS A;  5C8Y A;  3B77 A;  4J42 A;  3NR7 A;  4I50 B;  1H38 A;  3G4S V;  1AIL A;  1E79 G;  3ML0 A;  4X1I A;  2JDI G;  4GZR B;  4ZKI A;  4LFA O;  3J81 N;  2WAM A;  3ABL B;  4LFB B;  4I5S A;  1EN5 A;  4ZOL B;  5LMU B;  1VP7 A;  2EIK B;  1QVG U;  3K0D A;  4JI1 B;  4DV6 O;  3B4S A;  2OCC C;  5J2T B;  5JJN B;  3MAQ A;  3APO A;  2BOC C;  3WG7 C;  2ETN A;  3JAW A;  4D6T H;  3ABT A;  4J7Z A;  4JI4 B;  1CP9 A;  1Q81 W;  1PNL A;  2ZXW C;  4ZI7 B;  2ZE6 A;  2DE0 X;  3ABK B;  1FFX A;  1SKV A;  4O4J B;  2QWO B;  5B1B C;  4JI8 B;  4O4I B;  4JYC A;  3ETE A;  2FML A;  3KKY A;  1N36 B;  1XQ8 A;  3ABU A;  1KKC A;  4KHP B;  3GWK C;  5B1N A;  4JI6 O;  1WP8 A;  4I9Q A;  4DR3 O;  1QR8 A;  2XAH A;  3LDD A;  4I4T A;  2HG5 C;  3S3W A;  3AG7 A;  2P4V A;  2BCC H;  3MD0 A;  2DQ0 A;  1RPR A;  2L35 A;  1P4R A;  2GUZ B;  2PYL A;  3IJ4 A;  5TIS Z;  3JD1 A;  4CH3 A;  4QPJ A;  1SQP H;  1BHA A;  4U7N A;  3P30 A;  3SPC A;  5KMG B;  3K58 A;  5LXT B;  1Q90 D;  5KA6 A;  1IBM O;  2P4K A;  4DV4 O;  4DV7 O;  3OGC C;  2GV9 A;  3ZED A;  5KA5 A;  2WLI B;  1BCC H;  4X1K B;  4BIZ A;  4WFH A;  2GSM B;  3JAM N;  2CTW A;  5KAF Z;  1AI6 A;  4MVM A;  1OV9 A;  5AG2 A;  4FMT A;  3D36 C;  1SQB H;  3E35 A;  5GTI Z;  5KUK A;  1IBK O;  2XAF A;  1MZE A;  4ZHQ B;  1URF A;  5BR8 B;  4EKW A;  2A3Q A;  1NTZ H;  3JAW B;  3JAR B;  5IJ9 A;  1HR0 B;  1VIB A;  2LO1 A;  4E4E A;  2QJ1 A;  1BE3 H;  3CWB H;  1Q6H A;  4QIW F;  2UXB B;  3N2G B;  2UXN A;  3OMI B;  2ZM6 O;  1R3I C;  1XMO O;  2YUA A;  2LFS A;  2OYQ A;  3B8N A;  5C93 A;  4JF3 A;  3K57 A;  3ZJZ A;  4LH6 A;  2V7Q G;  2RJZ A;  1IBL O;  1FJG O;  2Z3Y A;  4ASU G;  3RN4 A;  2CAZ C;  3JAL B;  3NXS A;  3ZMT A;  3APQ A;  5A9G A;  5LP6 A;  2RDC A;  5KHH A;  2HR3 A;  3HKD B;  4I9W A;  2A06 H;  2ODM A;  3RWR D;  5B3S C;  4RWU A;  3ZMZ A;  2LW1 A;  5LGT A;  3ASN C;  4AQY O;  1FS0 G;  2EIN B;  2WPD G;  1TVK B;  2O57 A;  1L8D A;  1KYO F;  4ZI7 A;  2N04 A;  4IL6 Z;  2LQT A;  2B5U A;  3OUS A;  3HKB B;  4DRX A;  3ZHU A;  1JOY A;  1YDX A;  3ZRV A;  3HKC A;  4RUF A;  2FL4 A;  1MZF A;  3ETG A;  3JSN A;  2EZO A;  4UB6 Z;  3RYH A;  3L74 H;  2R72 A;  4FLX A;  3OD4 A;  4JZ2 A;  2YI9 A;  4MVQ A;  4H13 B;  1VQ5 V;  4NXN O;  2YI8 A;  4P9P A;  1B06 A;  5D5P A;  2P90 A;  1BQZ A;  5KLV H;  1WA8 A;  4KUM A;  2JS3 A;  2QWP B;  1N36 O;  3RYF B;  4BW9 A;  4YJ3 B;  1KD1 W;  3ZMS A;  1AI5 A;  2VRZ A;  2E76 B;  2PI4 A;  2OT5 A;  1QQC A;  1K8A W;  4DR2 O;  4A5U B;  4JI3 B;  1XL6 A;  2HFE C;  2QKA A;  5JH7 B;  4GUN A;  2CH7 A;  4R50 A;  2OTJ V;  4TWK A;  1PPJ H;  4NVP A;  1NJI W;  2UUB B;  2YXL A;  2ZKO A;  1R6N A;  4OGQ B;  2VQF B;  2LFR A;  2V4D A;  3VBB A;  1XRE A;  2YIB D;  1TUB B;  4HZ3 A;  3SYP A;  5LYJ B;  3RVY A;  1CPY A;  4O4L B;  3H1I H;  2Q9L A;  5JJE B;  2Q68 A;  3JD0 A;  5F2V O;  3MDS A;  4CS4 A;  5L3C A;  3DC5 A;  3CSX A;  1V55 B;  1Q86 W;  4LF5 O;  2R9A A;  1DGS A;  5IYZ A;  3CMA V;  3W7T A;  3CCV V;  4B3R B;  3Q4H B;  1IZ3 A;  4NXM O;  1KQS U;  3FAV B;  4UVC A;  5GON A;  1WP7 A;  5CA0 B;  4LFC B;  3K5L A;  3OEH G;  1SQX H;  3FD9 A;  2ZM6 B;  2EIM C;  4F6R A;  3BCC H;  3FYI B;  3JYC A;  3HKD A;  4JI5 O;  1KB9 F;  3SDL A;  4N23 A;  1SA0 B;  5BR8 O;  1XNR O;  5LGU A;  4JYA O;  1WPX A;  4IGG A;  2QR4 A;  5IYD O;  5LMN B;  1N8R W;  1GKF A;  1J5E O;  2A79 B;  2DW4 A;  1VQL V;  5IE9 A;  1LUV A;  5EZY A;  4X66 O;  4GX5 A;  3W7S A;  3OTF A;  1S5J A;  1XEQ A;  2CH7 B;  4BIO A;  3HB3 B;  1Y76 A;  3FB5 C;  4J80 A;  2IW5 A;  1T5E A;  2QDO A;  1BMF G;  2W0F C;  1I94 O;  4U3J B;  3R65 A;  2UXD B;  1J5E B;  1DTO A;  5B66 Z;  2QKC A;  4Z1M G;  3ABK C;  1FXH A;  3HPL C;  1YXB A;  1S5L Z;  1THZ A;  5IYZ B;  1N34 O;  2EUL A;  1JCH A;  2Q67 A;  5IYB O;  1AB3 A;  2WLM A;  2XAJ A;  1K9M W;  2XOK G;  1RM1 C;  4MVO A;  5KHI A;  1I94 B;  4JTA B;  1GAX A;  2V1D A;  1MSD A;  3K59 A;  3CXC U;  4LWS B;  2X0L A;  1VF7 A;  2Y4U A;  1XIL A;  3ASN B;  2F1M A;  2Q7E A;  3E22 A;  3N2K A;  4Q6G A;  4DV6 B;  3FAV A;  1ZSP A;  1K34 A;  5B3S B;  3K5O A;  4I4T B;  3E8G A;  1K5Q A;  3EXA A;  2KG7 B;  3JAS B;  4JI0 B;  4DV1 O;  1HNW O;  4FM0 A;  4DR2 B;  1Z5W A;  1ENV A;  1EZV H;  1D5N A;  1ORQ C;  4PA9 A;  2XT9 A;  3HKE A;  5IWA O;  4DV0 B;  4O2B B;  2ZCE A;  3A0B Z;  3E8H A;  2HP8 A;  4ICG A;  2DYR B;  3JD4 A;  3CS5 A;  2Q0O C;  1GN2 A;  1PP9 H;  4DV1 B;  2WLI A;  3FB8 C;  3CRQ A;  3OEE G;  3E8F A;  3UO3 A;  2F95 B;  3D8C A;  4GCZ A;  3CC2 V;  4DR4 B;  1FKA O;  2IBZ H;  4DW0 A;  5JVD A;  4LF6 O;  3W7W A;  4FZ0 A;  1RPO A;  1QHT A;  5EBW C;  1VQP V;  5FPR A;  5BXZ A;  3BAA A;  2D3O W;  1D2D A;  4G2K A;  4JGS A;  1W0J G;  3L72 H;  1OCZ B;  2ITD C;  4EEQ A;  1SRY A;  3M99 B;  2EJR A;  3ZHT A;  4GYC B;  3BRC A;  3GWO A;  2HVK C;  1B6Q A;  4LF4 B;  3OR7 C;  3CB2 A;  2DWD C;  1SF9 A;  3M8A A;  5H6Q A;  5KHG A;  1B04 A;  2F66 C;  4NXM B;  2LW7 A;  1PM9 A;  4DW1 A;  2AHY A;  1AP6 A;  5LL6 Y;  4WFB V;  4P9O A;  1PD3 A;  1AI4 A;  2PGG A;  2JJ1 G;  4F4L A;  3AG1 C;  3DGE A;  2JJ2 G;  2DJV A;  3WB2 A;  2WLK A;  4QJF B;  3FKS G;  4PV1 B;  3ASO C;  4LF4 O;  5LHH A;  2LGQ A;  4UCU A;  3SR2 C;  4Z2W A;  1E1Q G;  2JGD B;  3DXR A;  1ZL8 A;  4J7J A;  4TSF G;  3H1L H;  5LHG A;  1FD9 A;  1RP3 B;  1TVK A;  3KG2 A;  4QGP A;  4I0X A;  3K04 A;  1XI1 A;  2BOB C;  3SPJ A;  4EB6 B;  3KCY A;  4TV8 B;  2PZS A;  5EBM C;  4YY3 B;  1US6 A;  4YXW G;  3N2K B;  3AK2 A;  2YEV A;  2ATK C;  3ZHS A;  5IY5 C;  1Q3E A;  3P3N A;  4FLV A;  3A8T A;  4JYY A;  5EYP B;  3ETD A;  2RCV A;  3K79 A;  5JCO C;  3CME V;  1IXM A;  1FXK A;  4IIJ A;  1HNX B;  3HR0 A;  1NTK H;  4X65 O;  3T1H B;  2RNB A;  4PDL A;  4XDK A;  3HKC B;  4YY3 O;  2LGW A;  1F51 A;  4FLU A;  1NR1 A;  4HYO A;  4DK1 A;  3OT7 A;  2R70 A;  4NB5 A;  3UO2 A;  3ZHR A;  2WWW A;  2WLN A;  2WLH A;  5LYJ A;  3VQW A;  3AG3 B;  1M56 C;  1OCO C;  2QGN A;  3O65 A;  2JVD A;  4YIO A;  4O4H A;  4RQE A;  1HNX O;  4FM2 A;  3STL C;  3JAT B;  3X2Q C;  2XND G;  4UCT A;  2Y0P A;  2QSA A;  3KCX A;  1BSM A;  4WFF A;  2ZIO A;  1H2G A;  2JEX A;  1JJ2 U;  2UU9 B;  4JAS A;  1JX9 A;  1QLE C;  3E8B A;  1JFF B;  3LDE A;  4UB8 Z;  2Q69 A;  4LR3 A;  3ZS8 C;  1XDC A;  4LNU B;  4TV8 A;  4LC1 A;  3SJC C;  3EVK A;  1WA8 B;  5J9P C;  3OUF A;  5CA3 A;  3QVN A;  1OHH G;  3N27 A;  1KBH A;  1M90 W;  4RQF A;  4PI0 A;  4PDV A;  5LHI A;  3SYQ A;  3RYC A;  3M7M X;  4O4L A;  1N4C A;  1ZLZ A;  4PD4 F;  4EFB A;  4DR6 B;  1VQK V;  2UXB O;  1WB7 A;  5IY5 B;  4E2L A;  5JQG B;  1RSO B;  4YHH B;  3QG5 A;  5EC1 C;  4QE7 A;  1K3E A;  3CP1 A;  3RVZ A;  2WSS G;  1K97 A;  2DMX A;  2BTQ B;  1GK9 A;  3ABL C;  4L87 A;  3H1H H;  4O2A A;  3EFF K;  1R6K A;  2L6L A;  2HHH O;  3WB1 A;  3OAA G;  4DR1 O;  2UUC B;  3RBZ A;  5GW7 A;  1QR9 A;  3SJB C;  2RN9 A;  4LF8 O;  1S77 D;  1GN3 A;  1AVM A;  1EN4 A;  4CC5 A;  4DUZ B;  5IT9 N;  1K33 A;  1RFY A;  3K9A A;  1AJP A;  4F6E A;  3CPW U;  3ASO B;  4MVZ A;  1KUQ A;  1ZWI C;  3F5W C;  3JSL A;  2Y69 B;  1YF2 A;  2IH3 C;  3SJA C;  2X6C A;  1NH2 B;  4GX0 A;  1XBL A;  4XDL A;  3B09 A;  2EIM B;  4B7K A;  3L75 H;  4BW5 A;  4AQY B;  1MSW D;  3LSS A;  3TJT A;  5L3E A;  3B40 A;  1KC8 W;  4K0K O;  3JAS A;  1SER A;  3A2F A;  3N2G A;  1V55 C;  5E79 Z;  1VQ6 V;  1QLN A;  4UVB A;  1NVP D;  2QTS A;  1KKD A;  1VF6 C;  1M9N A;  2PF4 E;  3D3I A;  5IJ9 B;  3G71 V;  5CN0 A;  1MMM A;  4N21 A;  1GM9 A;  3CCM V;  2Q7G A;  1K4C C;  5J2U B;  5IJ0 A;  2FB5 A;  1G6U A;  5B5E Z;  3AG2 C;  4O2A B;  1DF4 A;  3C3S A;  4X20 B;  1S72 V;  4CH4 A;  5CA1 B;  5LBQ A;  3ZRS A;  1SES A;  1NH2 D;  1I5X A;  2Q6A A;  5FLX N;  4DV5 B;  4QPK A;  1XHX A;  2DOS A;  4KHP O;  2DWE C;  2WLJ A;  1M57 B; 
#chains in the Genus database with same CATH homology
 5BR8 O;  4DUY O;  4JI7 O;  1XNR O;  4JYA O;  4JI1 O;  1J5E O;  4B3T O;  4X62 O;  1N32 O;  3J7A U;  4X66 O;  1FKA O;  1IBM O;  4LFB O;  2E5L O;  4DV4 O;  4X65 O;  4DV7 O;  4LF6 O;  5LMU O;  2AGA A;  1HR0 O;  2HHH O;  1G1X B;  1XEQ A;  5BXZ A;  1NS1 A;  4YY3 O;  1D2D A;  3JAM N;  4DR1 O;  1R6T A;  5A2Q N;  4OPH A;  2VQF O;  4LF8 O;  5H5N A;  4OPA A;  4YHH O;  1AIL A;  4JI4 O;  4NXN O;  5IT9 N;  3RT3 C;  4DV5 O;  4JI2 O;  1IBK O;  5LMN O;  1I94 O;  4JI8 O;  4DR5 O;  4LFA O;  3J81 N;  4GKK O;  1KUQ A;  1N36 O;  3O65 A;  3F5T A;  1HNX O;  2N74 A;  4DV2 O;  2VQE O;  1YZB A;  3M8A A;  4DV6 O;  4X64 O;  1HNZ O;  4B3R O;  1N34 O;  2LW7 A;  4DR2 O;  1AB3 A;  1FYJ A;  4JI0 O;  4DR6 O;  4A5U B;  5LL6 Y;  4LF7 O;  3R66 A;  2ZM6 O;  4DUZ O;  4DV3 O;  2DJV A;  2UXC O;  1XMO O;  4DV0 O;  1X59 A;  2ZKO A;  4LFC O;  1R1B A;  4K0K O;  4LF4 O;  2Z0A A;  1N33 O;  1IBL O;  1FJG O;  4GKJ O;  4OX9 O;  3J80 N;  2FKX A;  3T1Y O;  4JV5 O;  2UUA O;  4JI3 O;  4LF5 O;  4JI6 O;  2UU9 O;  1DK1 A;  4DV1 O;  3T1H O;  2JRI A;  1F7Y A;  4DR3 O;  4NXM O;  1HNW O;  1A32 A;  2UUB O;  4DR4 O;  3OTO O;  2F4V O;  1XNQ O;  2UUC O;  2UXB O;  4B3M O;  1XMQ O;  4AQY O;  5IWA O;  5BY1 A;  4JI5 O;  5FLX N;  4LF9 O;  3SDL A;  2UXD O;  4B3S O;  2DOS A;  4KHP O;  4DR7 O; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...