1N32Q

Structure of the thermus thermophilus 30s ribosomal subunit bound to codon and near-cognate transfer rna anticodon stem-loop mismatched at the first codon position at the a site with paromomycin
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
104
structure length
104
Chain Sequence
PKKVLTGVVVSDKMQKTVTVLVERQFPHPLYGKVIKRSKKYLAHDPEEKYKLGDVVEIIESRPISKRKRFRVLRLVESGRMDLVEKYLIRRQNYQSLSKRGGKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S RIBOSOMAL RNA
publication title Selection of tRNA by the Ribosome Requires a Transition from an Open to a Closed Form
pubmed doi rcsb
molecule tags Ribosome
total genus 20
structure length 104
sequence length 104
ec nomenclature
pdb deposition date 2002-10-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Q PF00366 Ribosomal_S17 Ribosomal protein S17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 1n32Q00
1H95A 2WB1E 5GAHC 3HKZG 4LF6Q 2IX0A 5AJ3L 2PI2E 3HOXH 5GROA 3CC4A 4GLAC 5IYBH 2PI2A 1YHBA 5FJ8G 4IPHA 3ULPA 3GTLH 3KYHC 1NY4A 1GD7A 4JI1L 5JJIA 1HR0Q 4DR6Q 1SN8A 3G4SA 3CCRA 1SR3A 5LMUL 1LM0A 2YTXA 1ASZA 1XMQQ 1IL2A 3ERSX 2AWOA 4LF5Q 3BU2A 1IBMQ 4ME3A 4LF8Q 2HQLA 2Z0SA 2CWAA 4UY8C 2HT1A 2F4VQ 1YHQA 4AYBG 3PV0A 1TXYA 1K3RA 3EIVA 3GTPH 1JMCA 1HNZL 3HOUH 1UE5A 2Y0SG 2R93H 3PUWA 2Q2IA 1NMFA 1Q1BA 2K5HA 1SRUA 4JI3L 3CXCA 3TRZA 2VS1A 5M3MH 1VQIA 2QEXA 4Y7NH 1JJCB 2VUMH 1V1QA 2XTIA 1Z47A 5JEAJ 5HGQA 1EWIA 3G48A 2VQEL 4DUZQ 4HIOA 3ULJA 2B3GA 3STBC 4A3JH 1EQQA 2R92G 1I5FA 3CCJA 2ZJPA 2I5LX 4P71A 2UU9L 1QZGA 4DR4L 1KL9A 1Q86C 4KHPQ 4HJ5A 1UE7A 2RF4A 1JE5A 1Y14B 3GTKH 1PH6A 3HOXG 4B3MQ 3G6EA 5IYBG 1X3GA 2NZHA 4C3HH 2JA5G 1VQPA 4QY7A 1VS0A 4GKKQ 2AHOB 3T1HQ 3A0JA 1TWCH 1HZ9A 4OWXB 5IYDG 3L2PA 1PV4A 4NXNQ 5FLXc 3HOYG 2AMCB 4PMWA 3CCQA 1Y1VG 4K0KL 1BKBA 4JCVE 4WJ3M 1K73C 1YITA 3UDXA 4GLVB 3ER0A 4JBJA 2ASBA 3HOUG 2MFIA 1VQGA 4IPCA 4JI2Q 2OWOA 1L0WA 1GVPA 3ZJYC 4LUVA 3U50C 3J81c 4IFDI 4TQUS 4PZ8A 1N8RC 4YCVA 3HOVH 4A3JG 4A3CH 3NELA 4DV0L 5BR8L 3J81i 1BVSA 3KF6A 1VQ4A 5C4XG 3STBD 4DR3L 5C0XI 3H15A 3A74A 3DM3A 1GKHA 2I0QA 3RR5A 1I94L 4DAYB 5FLMH 1SFOH 3PF4A 4BY1G 4A3LH 3HFZB 4A3BH 5M3FH 3F2BA 1SE8A 2WB1G 2MNAA 2UXBL 5K36G 1PH1A 3S14H 2NZOA 4DV7L 2KHJA 2VZAA 2Q2UA 1IZ6A 2JE6I 1VQEA 4KLKA 4DNIA 1VQDA 3NEMA 4BBRH 3I55A 1IBKQ 1B70B 3J7ZC 3S15H 4JI4L 3L7ZC 4ALPA 1N9WA 3UDFA 1YJNA 3HOWH 4JYAL 4A3EH 1PH7A 2GVAA 2UUBQ 1K9MC 5EAYA 4X6AH 4GOPA 4A3IH 4R4QA 4DV6Q 1P16A 1LUZA 4OX9Q 3BZKA 4GKJQ 3OTOL 2B63H 4LUZA 1X3FA 3M4PA 5IP9G 4YHHL 4LUOA 3S16H 4AIMA 3T1YQ 1N33L 4B3SL 1LTLA 1T9HA 2YTYA 2ZJQA 4OO1I 1MKHA 2K75A 4PZ7A 4IFDG 1XMOL 3M9BA 3PO3H 4DV1Q 3VDYA 3NENA 1FGUA 3CMEA 4L5RC 1C9OA 5DLQE 3U58A 4X65L 3CCLA 1AE3A 4QGUA 4DUYL 3M3YH 4DKAC 4DV5Q 4LF6L 4A3LG 1RL2A 3RLOA 3RNUA 4IJHA 2JEBI 4JG2A 3U4ZA 5C3EG 4HJAA 1G6PA 4JI5Q 3FKIG 2NN6I 1XNRQ 1HR0L 2E2JH 1SROA 2WAQG 3A5ZB 1WCMH 4KI0A 3AQQA 4LF5L 2R7FA 2LSSA 1IBML 3PGZA 2R7ZH 2HHHQ 1HNXL 1VCIA 4KHZA 2AWNA 3CP0A 2F4VL 2I5MX 2JA8H 2CCZA 1NE3A 4DR5Q 3AFPA 4A3IG 4NXMQ 1VQAA 3CC2A 3TEHB 4P72A 1YIJA 3PUVA 1NJIC 1XPOA 5HY6A 1CKNB 2JQOA 1HJPA 5IWAQ 4JI8L 4A93H 4A3MG 4OO1G 1AH9A 1WI5A 1E22A 1YEZA 2OCEA 3M4OH 4DR2Q 1I3QH 2N8NA 2IT1A 1DGSA 4KHPL 4P73A 2JA7H 4GNXB 3GDEA 3UE0A 4GOPC 1EOVA 1Q1EA 3H0GH 4LFAL 1XNQQ 1K0RA 2L15A 5GAEC 2ZM6Q 4JV5Q 2OQ0A 2VQFL 4B3TL 1X65A 5IP7H 3HOZG 4YY3L 1CSPA 2EXDA 1Z9FA 1EFWA 2NN6G 2UUAQ 1UE6A 3H3VH 2BH2A 4BBSH 2JJQA 2YYZA 4NXNL 3B6YA 3E0EA 2A19A 2E2IH 3GTOH 2IHEA 3K80C 4C3IH 2R7ZG 4O0AA 1PA6A 2UXCQ 1L1OA 2LXKA 1M90C 4LF9Q 2JA8G 4DR7Q 4B3RQ 3IRBA 2YTVA 2BA1A 1KHIA 3CW2C 3KFUA 4JI2L 4YWLA 1CKMA 3S2DH 4DK3C 1VQMA 3PO2H 3G71A 2OTLA 4AQYQ 1EQRA 4A4IA 4POFA 4X66Q 3GTMH 5M5WH 3S24A 2K52A 1IYJB 2OTJA 3Q8DA 3SGIA 5E7NA 4OXPA 1Q46A 3BZCA 5IY0A 3S1MH 4LFBQ 2N49A 3JC66 2MO0A 3W1BA 4A3KH 2RCNA 5AJ3Q 3PUYA 1TWAH 1I6HH 1FVIA 5J3BA 2GVBA 5LMNW 4LFCQ 3K7AH 3PCOB 1QUQB 1VQBA 4JI1Q 4YWKA 3PIPA 1L2FA 4MZ9A 4GN3B 2DGYA 5IYCH 2HIXA 1IBKL 2R93G 2ZTCA 4BBSG 3CCMA 2UUCQ 1X9NA 2DUDA 2NVTH 4L5QA 1J6QA 2XGTA 1YHAA 4LF7Q 3CD6A 5M3MG 5C44H 4RG1A 4IOAA 3DLLA 2VUMG 3RN5A 2JA9A 1HNWQ 2R6GA 2MQHA 3I56A 3GO5A 4DV6L 2N3SA 1HNZQ 2EQSA 4GKJL 1GO3E 4IFDJ 1N34Q 2IX1A 3GTQH 1K83H 2Q2TA 1N36Q 4JBMA 3T1YL 3I4NH 3PO2G 1QZHA 3PUZA 5C0XJ 1JB7A 2VQEQ 5GQOA 1QVCA 2AKWB 4LW1A 2UU9Q 1EUJA 3HKZE 1Y1WH 1L1OC 1UWVA 5ELOA 2KCTA 4HIDA 1NTGA 4AH6A 4DV5L 4A3KG 1OXTA 4DV2Q 2D62A 1YJWA 4C2MH 3PUXA 4NPSA 1Q12A 4UPAA 1HH2P 1WYDA 4YCWA 4JI5L 3FHWA 4TVAB 1VQ6A 1E1OA 4R4CA 2ATWA 1R9TH 3JAMc 1XTDA 1J5EQ 4IJLA 4DV4L 2MO1A 1XPUA 1YI2A 2A1AA 2K50A 4JI6L 3KJPA 2IHFA 2HHHL 3KJOA 1PYBA 4DV3Q 3JAMi 1IBLQ 1VQ5A 4BY7H 4GS3A 2GN5A 4A3FH 3J7A5 3HOVG 4BXXH 1A63A 2Y0SE 4DR5L 4A3CG 1S40A 4JOIA 5M5XH 4R4TA 2JA6H 3NBHB 2ZJRA 1KD1C 3RZOH 3AEVA 5FLMG 4H02A 4QJFA 3KLWA 1JJGA 1G51A 4A3BG 5M3FG 1A8VA 1WOCA 4LWCA 5C4JH 5M5YH 4A3GH 4HIMA 1Q82C 3D0FA 5BR8Q 1N32Q 2FXQA 1PH9A 4DR3Q 4JI7Q 1VQJA 1VQLA 4DR6L 1W3SA 2KCMA 4BBRG 1Y1WG 1XMQL 1I94Q 2NVXH 4EQ5A 4XTCS 3OYYA 4X64Q 4R4OA 4LF8L 1Q7YC 3S1RH 3HOWG 2IY5B 4JV5L 4DR1Q 4LF4Q 4A3EG 1G291 4MTNA 2UXDQ 2VY3A 3E9HA 1VQHA 3UE1A 1WFQA 2E8GA 3FP9A 1IXRA 3CCSA 2CWPA 2UUAL 2Z6KA 1YNXA 4A75A 2B63G 4JI4Q 3KDFA 4JYAQ 1FJGQ 4FDBA 1A62A 4R1JA 3CPFA 5IT9c 4BY7G 4DUZL 4GN5A 3WWVA 1E24A 4HJ8A 4L5SA 2UXCL 1VQ9A 4IPGA 1U5KA 1Q81C 2HIVA 3PO3G 4R4IA 3GTGH 1MJEA 1BBUA 3KF6B 4XIGS 3AFQA 3OTOQ 1EIFA 2JA6G 2BA0A 3F2CA 2PQAA 1MIUA 1N33Q 3CPWA 1SMXA 4RMFA 2BH8A 4X66L 4B3ML 2R92H 1XMOQ 1WJJA 1LYLA 1VQFA 2B29A 5LMNQ 4JI0Q 4UP8A 1V9PA 4GKKL 2CKZB 3E9IA 3A5UA 2E2HH 2RHSB 4UP9A 4X62Q 3T1HL 2E5LQ 4LFBL 1C0AA 1WCMG 4IPDA 4X65Q 4DUYQ 2R7DA 3CCEA 4JOIC 2H5XA 1NBWA 4P75A 2JA5H 4LFCL 2EIFA 1OXXK 4GOPB 3ICEA 1Q8KA 1U0LA 4DPGA 1X56A 5IYDH 3HOYH 1KAWA 1VQ7A 2YV5A 4OWTB 2UUCL 4NB3A 1K8AC 1K8GA 1ASYA 4LF7L 1HNXQ 1Y1VH 2N78A 1E3PA 2VW9A 3CC7A 2K4KA 4A3DH 3CF5A 4A93G 1HNWL 4HJ9A 3KF8B 2OQKA 1VQCA 1N34L 4QQBX 2NVQH 2LXJA 4O2DA 2JA7G 1N36L 3H0GG 1TWFH 3RLFA 1YVCA 1GM5A 4JI8Q 3U4VA 3UDIA 2Z6KC 1QVFA 1XPRA 1KRSA 5IP7G 1CSQA 3I4MH 1CKOA 1BBWA 5C4XH 1VQOA 5LMUQ 3S2HH 1UE1A 2WP8J 4LFAQ 4BY1H 1EIYB 4DV2L 3F2DA 4IO9A 1KXLA 1OTCA 2VQFQ 4B3TQ 4JC0A 3M85A 2ALYB 3EBEA 1D7QA 2WAQE 2UUBL 4YY3Q 1HR0W 3TREA 3W5OA 3K81C 1PH5A 3M7NA 2KENA 4OX9L 2ID0A 1J5EL 3S1NH 5JJKA 3H3VI 1X6OA 2C35B 1KIXA 4JBKA 4JI3Q 3TQYA 1B7YB 1D8LA 1HZAA 3KDFB 4L5TA 2JK8A 2PNHA 4DV3L 3PSIA 1IBLL 1KQSA 2RHQB 4A3DG 1VQ8A 3AYHB 1EYGA 4DV1L 1M1KC 4APVA 2K5VA 4MNOA 5IP9H 1HZBA 4DR4Q 3J80c 4LNQA 1KRTA 1CKNA 4OONA 5JEAG 5IE8A 2PQAB 1PH8A 2K5NA 3M4QA 2A8VA 1I50H 3F8TA 3MEFA 4UP7A 1PH4A 1TWGH 3EN2A 3J80i 1PHJA 1PVOA 3I4MG 1XNRL 1N32L 3S17H 4JI7L 4PZ6A 4IOCA 4GNXA 4EX5A 2NVYH 5IYCG 2KHIA 3OW2A 1YJ9A 4X64L 4DAMA 3F1ZA 2JEAI 1A0IA 5C3EH 4AYBE 5JJLA 4DR1L 3ULLA 5C44G 1W2BA 4LF4L 3FKIH 4GLXA 1XJVA 1QVGA 4K0KQ 2UXDL 2KBNA 1L1OB 5GAGC 4NXML 2ZTDA 1OXUA 1V43A 1HZCA 3CCVA 5H1SE 3K7UC 3MXNB 1FL0A 1NMGA 3RZDH 4YWMA 5ELNA 1VQKA 2D0OA 4PG3A 4A76A 3I4NG 1PH3A 1FJGL 1MJCA 1X55A 5IWAL 2CQOA 4HJ7A 4DK6C 4DV0Q 3TS2A 4GN4B 3I7FA 2ES2A 4DR2L 1JJ2A 3PIOA 2K14A 3RN2A 2F3IA 3J81j 3PF5A 1X3EA 4POGA 4Y52H 4J15A 1XNQL 3K8AA 1AE2A 1SLJA 3S1QH 2UXBQ 4JBWA 5FJ8H 2ZM6L 3HKSA 3CMAA 2QA4A 4A3MH 3I4OA 4JI0L 5LMNL 2Q2HA 4BA1I 1C7YA 3K0XA 4DV7Q 3TS0A 3CCUA 1OXVA 3UDGA 4X62L 3CQZH 3RLNA 2E5LL 4C3JH 5C0XG 3D31A 3L0OA 1KC8C 1UEBA 3CAMA 1S3OA 4QL5A 2PMZE 3HOZH 1YBYA 1P8LA 1QUQA 5GADC 4A3FG 1PFSA 2V1CC 2F52A 4LF9L 1X54A 3GTJH 1O7IA 4BXXG 4DR7L 4B3RL 1JT8A 1OXSC 3I2ZA 4YCUA 4DV4Q 2YU9H 1RIPA 2WFWA 4JI6Q 4YHHQ 2I5HA 3LGJA 3W1GA 2VL6A 1YZ6A 2VNUD 4B3SQ 4AQYL 1VQNA 4GNXC 2QGQA 4P74A 2CFMA 4QIWE 4WJ4A 1CUKA 1TWHH 3GD7A 3KOJA 4A3GG 4BA2I 1PYSB 3BJUA 4OWWB 1S72A 1PH2A 1E7ZA 4HIKA 2ZTEA 1B8AA 2D0PA 1E1TA
chains in the Genus database with same CATH superfamily
1H95A 1K8OA 5AJ3L 1H9SB 1TS4A 3FRPB 5IYBH 2IW3A 2OF1A 2LMCB 4IPHA 3GTLH 2FHTA 3W2DA 1NR2A 5FLXL 4DR6Q 1PTOH 4EQOA 3CCRA 3JAME 1ASZA 1EYAA 4LF5Q 1IBMQ 1EY8A 4AYBG 1TXYA 1K3RA 3GTPH 1JMCA 1BUVT 1HA6A 1UE5A 3PUWA 4H0LC 4RWSC 4JI3L 4N9PA 1PTOC 2VUMH 5JEAJ 5HGQA 4DK1A 2R92G 3ULJA 2B3GA 2EJFC 3CCJA 3RMHA 2ZJPA 2I5LX 1BDOA 1CA5A 1GJXA 3GTKH 2WKDA 4B3MQ 5IYBG 2AQ2B 2JA5G 3VYRA 1FNWA 2AHOB 4QB4A 4NXNQ 4PMWA 1WVLA 2K5WA 4U673 3CCQA 1ESRA 4WJ3M 4JBJA 2Z8LA 4I65A 1VQGA 3QWNA 4JI2Q 4IURA 1SE4A 3OMCA 4N9TA 3A8IE 1IKLA 3NHHA 2A74C 2F0QA 3VR4A 4K8IA 2Q8IB 3KF6A 5C4XG 3K5LA 1GKHA 2I0QA 3K59A 5FLMH 3PF4A 1SFOH 4A3LH 5A35A 3LNNA 5M3FH 1SNMA 2WB1G 2MNAA 3DUZA 1PH1A 2NZOA 4DV7L 2VZAA 2Q2UA 4FO2A 2JE6I 4MTKA 1LV9A 3I55A 4K2KA 1EOTA 3ERQA 4ALPA 3UDFA 4JYAL 3NTIA 2GVAA 5EAYA 4I7ZC 4IUQA 4GOPA 1Q8IA 3NUCA 4A3IH 1STBA 1P16A 4OX9Q 1ICWA 4LUZA 5IP9G 4K5XA 4LUOA 4AIMA 4WFN3 2EY1A 1T9HA 2LY7A 1I50B 1TWGB 1GUGA 3KF8A 1FGUA 1ZKOA 2WKCA 4L5RC 1R9TB 2NVYB 5DLQE 5ELBA 5TSSA 4X65L 3U58A 3CCLA 2PQEA 4CJ1B 4DV5Q 4KMUC 2L5TA 4LF6L 4A3LG 2MGSA 4HJAA 3FKIG 4OIJA 2KUMA 2NN6I 1HR0L 2E2JH 3A5ZB 1XWEA 2MPMA 1JWSD 2R7FA 1ML0D 2EYLA 2JA8H 4DR5Q 4A3IG 5K5PA 3TEHB 1YNJD 4CHTB 4V190 2GA4B 1KDBA 1ILQA 3BYYB 4OELB 3C3LA 5FO9B 5IGDA 4C1NI 1WI5A 4ODGA 4HN7A 1E22A 4WRDA 2OCEA 5LHY1 3NQTA 1D1KA 2IT1A 2EYPA 4GNXB 2B2TC 3UE0A 1O7ZA 2L15A 4K6LA 1LTAD 2ZM6Q 2IJ0A 5JVH3 2OQ0A 4ZUJA 5IP7H 1KAAA 5BN4A 1JOKA 4YY3L 1CQFA 1DOMA 3K0YA 2NN6G 4CJ2C 4BBSH 2EE1A 1ZYRC 2JJQA 2YU9B 3C2PA 2ICIA 3B6YA 2E2IH 3A56A 1PZJD 3OW7A 4C3IH 3QG1A 2JA8G 3H09A 2YTVA 1GXDC 4HTHA 2BA1A 2F0PA 3N52A 3CW2C 2QILA 3TP6A 4KD4A 3TP5A 4A4IA 2BCOA 2WV6D 2OTJA 1LT6D 4OXPA 1Q46A 2B2WC 5JEAH 2N49A 3OIPA 3HRZC 1SNCA 2KOLA 2RCNA 3HOYB 1FVIA 1U9RA 5J3BA 3JAML 1QUQB 1VQBA 2PMZB 4F88A 5C4HA 5IYCH 1NNXA 2DGYA 3HOUB 2R93B 4BBSG 2UUCQ 4QF4A 1X9NA 1EIHA 2XGTA 5M3MB 1CZWA 1D5XC 3V96A 3RN5A 2JA9A 4XQQA 1O80A 2R6GA 4QIWB 3VR3A 1EY4A 1V1PB 1HNZQ 3WOEA 2N3SA 4IFDJ 4C56C 4FXKC 3SK4A 1K83H 5E4WC 4BY1B 3T1YL 1QZHA 1EYDA 3NTHA 1QVCA 1CFMA 2UU9Q 3HKZE 1L1OC 1TWCB 4HIDA 1H9SA 4X3KA 4AH6A 3PUXA 1STYA 3FHWA 1VQ6A 4R4CA 2RDFA 1R9TH 5EKIA 1E0BA 1XTDA 2MO1A 1YI2A 1QWYA 4FNFA 3KJPA 5DAUA 2HHHL 4BY7H 1PYBA 1S5DD 2L4NA 2XVSA 1SYFA 1A15A 4GS3A 4A3FH 1VQ5A 3HOVG 2XWBB 1QB5D 1S40A 3FMCA 5EKKA 2ZXOA 4R4TA 3NBHB 1SNQA 4RGOS 2KQ3A 4RKLA 3AEVA 3A7LA 4IUTA 3I72A 2B39A 3G7LA 4QJFA 4B9XA 5KNBA 1JJGA 4KJNA 4RCOA 3SDZA 3S14B 2FXQA 1DXMA 1F9QA 3P1HA 4BBRG 2NVXH 1I94Q 4EQ5A 2A6HD 4LAAA 4R4OA 2I46A 3S1RH 3HOWG 5EPLA 5C4ZA 2UXDQ 5D65A 4E6IA 2UUAL 1EWCA 2VB2X 2Z6KA 4A75A 2B63G 2QW7A 1SYCA 4J1MA 4U68A 4IUVA 5NUCA 4R1JA 4BY7G 5IT9c 1NUCA 4HJ8A 3S1QB 4IPGA 1Q81C 3PO3G 3GTGH 4H7BA 1TU2B 3OTOQ 2G9HD 4OL7A 1STAA 4ME5A 3CPWA 1JOOA 4RMFA 3G6JB 4ZCKA 4X66L 1XMOQ 1F2MA 1V9PA 2XRQD 5T1IA 1DZ1A 3NSWA 4ZRZA 3T1HL 4EVOA 4DUYQ 3CCEA 2E75C 3KBGA 1NBWA 5KEEA 4P75A 2R7ZB 4LFCL 4HR7B 3MAQA 4WJWA 1NR4A 1X56A 5IYDH 3HOYH 3ND8A 1VQ7A 2QKIC 4OWTB 2F0TA 1K8AC 3LWEA 1K8GA 4LF7L 1Y1VH 3H3VC 1G8ZD 5EJWA 4NW2A 4R8IA 2KEDA 2OQKA 1I3QB 2OT2A 3D8GA 5FO7B 4CKEA 1I4PA 2CHBD 2JA7G 1JCKB 4RCNA 1TWFH 3KBXA 4JI8Q 4QCLA 1Y8PB 1KRSA 3NBIA 1XPRA 3I4MH 1CKOA 3P75A 1F2YA 4XDXA 3TMEA 3S2HH 2RKSA 4LFAQ 4BY1H 1EIYB 4KY7A 4FF4A 4RFBA 1YNNC 4DV2L 4IO9A 2VQFQ 1D7QA 3NXWA 3K81C 5C3WA 3S2DB 1B7YB 4M1UB 1HZAA 3KDFB 4L5TA 2OEOA 2RDHA 3PO2B 1FNUA 4DV3L 2RSNA 5M9OA 2RHQB 4N8FA 1EYGA 3E6ZX 1M1KC 1A6XA 2K5VA 3J80c 1WTWA 3S1MB 1BOSA 1UEAB 4IFDH 1KLUD 4OHJA 1CA6A 3K7AB 3I4MG 1N32L 3S17H 4GNXA 3J7AV 2JEAI 3NWTA 1A0IA 4XYQA 4K0KQ 2ZT9C 1S5CD 1SSOA 1D1IA 4YIJA 2ZTDA 3VA7A 4DAPA 3CCVA 1FL0A 1NMGA 5ELNA 1HPCA 3I4NG 1PH3A 1FJGL 1QNUA 5IWAL 2CQOA 1FGBD 4DK6C 4DV0Q 4RGMA 2DJGC 1B4OA 2PO4A 3D6WA 1SYBA 5KNDA 2VXWA 1AFPA 1LLRD 2F3IA 2CQAA 3S1QH 2UXBQ 2OXPA 4JBWA 2QA4A 4C2MB 4A3EB 5LMNL 1OXVA 3UDGA 4X3UA 2CH4W 3L0OA 2BE5D 5CV9A 4ZAIA 1S3OA 3J81E 2PMZE 1A2UA 3HOZH 5C5LA 1P8LA 1QUQA 1PFSA 1DONA 4DR7L 3EVQA 4B3RL 3QB3A 2EXZA 3I2ZA 5M5XB 1B44D 3W1GA 3PIO3 4B3SQ 3D4WA 2QGQA 4NMZA 4QIWE 5C4JB 4Q5VA 1V1PA 3BJUA 4OWWB 1E7ZA 1B8AA 5L37A 5KGUA 5GAHC 3BDOA 3SR1A 5I2YA 4GLAC 3SK6A 3PQIA 1YHBA 2IX3A 1B9NA 1NY4A 5CV5A 3TN2A 3TZDA 1SN8A 5LMUL 1XMQQ 1IL2A 1DYQA 2HQLA 2Z0SA 4XT3B 3VYUA 2L55A 1G2TA 1YHQA 1EQTA 2Z4IA 2TMPA 1ET9A 2Q2IA 1NMFA 1Q1BA 1DCZA 3AB9A 2VS1A 3TRZA 2QEXA 4RAUC 4Y7NH 3ZYYX 3V2TA 4DUZQ 5J1ZA 3G48A 3GTOH 2VQEL 2R92B 5F2DA 3NBHA 3NQIA 3IAYA 2F0KA 4P71A 4DR4L 1KL9A 1BO0A 4DGZA 1AEXA 5E4XA 5K36H 1MGSA 1X3GA 4C3HH 2JA5B 1VQPA 2A6EC 1HZ9A 3L2PA 1PV4A 1ILPA 3DHQA 5IOCA 3EA6A 3QJYA 4CBVA 3GTMB 4ZUIA 4A3DB 1J8IA 3DWQA 1JWMD 1YITA 2ASBA 4IPCA 2Q8RE 3S9WA 2H1EA 1GVPA 1EY9A 2HCIA 1LACA 4TQUS 1N8RC 2AQ1B 4YCVA 4KKTA 4A3CH 3FDTA 2XSCA 1WTRA 5BR8L 2NBFA 3I8ZA 1BVSA 2SOBA 3J81i 1VQ4A 5C4XB 3STBD 3H15A 1JORA 1WD0A 5E1FA 3F2BA 5K36G 2E2DC 1LABA 5EBCA 2QDBA 1VQEA 1IBKQ 2RVLA 1PTOF 3S1NB 3J7ZC 2L0CA 3L7ZC 1YJNA 4A3EH 1KNEA 4OEMB 2JSOA 3SK5A 4DV6Q 1Z6HA 1LUZA 5AFWA 5KYLA 4YHHL 3S16H 1N33L 2G5DA 4HSVA 4OO1I 2K75A 4PZ7A 1BCPD 1E2VA 5EKLA 1Y69U 1SJED 4CGYB 3NENA 2EYMA 3FPUB 1XTCD 1C9OA 2NB0A 3MXPA 1AE3A 1FR3A 3M3YH 2JEBI 4JG2A 3U4ZA 5C3EG 4CKBA 4PV1C 5KRUA 4JI5Q 3FKIB 1PRTD 4ABNA 1SROA 2KCCA 2WAQG 3RUZA 1WCMH 3AQQA 4LF5L 2KCNA 1IBML 2HDLA 4KKSA 1VCIA 4KHZA 4DF7A 2L12A 2CCZA 4A3GB 1NCVA 2B2VA 3O13A 3HKZB 1HJPA 4OO1G 3KLSX 4DR2Q 1QG7A 1O7LA 2N8NA 3K5MA 1DGSA 4P73A 3CQZB 4GOPC 1JC7A 3D3RA 1Q1EA 3H0GH 4C3JG 2JXMB 5DM73 1H9KA 4EQPA 4B3TL 4KY5A 4DAVA 4S3SA 3J81L 1UE6A 2YYZA 4NXNL 3F2UA 2EVBA 4IUPA 1HQMC 3K80C 1BQQT 3T53B 1TWHB 4LF9Q 4V0BA 2K5DA 2B2YA 2K1BA 1TR5A 4JI2L 4YWLA 5M5YB 1PZKD 1VQMA 2OTLA 4AQYQ 3M7GA 3HOXB 2J4XA 3AMUA 3GTMH 3DXJC 1C8CA 5M5WH 1JQYD 4B08A 2K52A 5COYA 1IYJB 4I7AA 3Q8DA 1EYCA 3SGIA 4LFBQ 3BZCA 3JC66 5AJ3Q 1TWAH 5D3IB 2C5CA 1PZID 3PCOB 4GN3B 1ZEQX 1LTGD 2ZTCA 3KK7A 1AW7A 1J6QA 3CD6A 2TSSA 1PFNA 1LTBD 2VUMG 2J7ZA 4A3JB 3DWAA 3X3NA 4ZYSA 3I56A 1VMCA 4RHSA 4XT1B 2IX1A 2Q2TA 1N36Q 5JJZA 4JBMA 5G3LF 1DOLA 1JR0D 5C0XJ 1JB7A 3K5NA 1I4RA 3SEBA 4LW1A 4LMQD 1GOZA 1ET6A 2SNMA 5ELOA 2KCTA 1CHPD 1NTGA 4Q0FA 4DV5L 1OXTA 1YJWA 1C48A 1Q12A 2A68D 1HH2P 4UPAA 4TVAB 5CORA 1J5EQ 4IJLA 1GUTA 1SMYD 4M8AA 4JI6L 1AZQA 1SYDA 1EIGA 3KJOA 3JAMi 1A63A 2GN5A 3HOVB 4DR5L 2F3WA 3BVZA 2JA6H 5IGEA 2NUCA 1T5EA 2ZJRA 3RZOH 5FLMG 1IL8A 1G51A 5EGTA 5M3FG 4UAIA 4A3GH 1RDPD 1PH9A 5J39A 1HUNA 4BBRB 4KN4C 4X64Q 1V8QA 3BDLA 4LF8L 3HOWB 4LF4Q 2F0GA 2E8GA 1IXRA 3NWSA 2DNCA 3CCSA 1YNXA 2B63B 4FP5D 2XIWA 4JYAQ 2AQ3B 3CPFA 3WWVA 1QCBD 4A3MB 3PO3B 2R3ZA 1MJEA 1H9MA 1EQVA 1IW7D 2CH4A 1QJOA 1EIFA 2JA6G 2BA0A 2H4OA 2PQAA 2DNEA 1EY5A 2A69C 2BH8A 3NE5B 1FNVA 4JI0Q 1LYLA 1VQFA 2FMCA 2G9DA 4UP8A 4GKKL 1E2WA 2CKZB 2MUYA 3IL8A 3E9IA 1C0AA 4UP9A 4X65Q 3Q0AA 4RHRA 4QMGA 3TSSA 3A8JE 2F1MA 1K8MA 2EIFA 2D2CC 1UAPA 3IFDA 2J0TD 4O42A 2UUCL 1LT3D 1ASYA 3HEJA 1B3QA 4HAEA 2N78A 1E3PA 3CC7A 3J80L 5JPMC 3EROA 1NSNS 1VQCA 1OO9B 4QQBX 3NPPA 4O2DA 1A3UA 1YVCA 2Z6KC 1EY7A 2SEBD 4MN3A 5IP7G 1B2TA 5CC4A 1BBWA 1KNAA 3Q6SA 1MSHA 2K01A 2WP8J 4K8JA 4C3IG 1SXTA 2ALYB 3EBEA 3OOCA 2EYJA 2UUBL 4F7XA 4YY3Q 1HR0W 3W5OA 3CU7A 1PFBA 2ID0A 5JJKA 4K2LA 1KIXA 3TQYA 1D8LA 1STNA 2PNHA 1VQ8A 4DV1L 1EEID 2HDMA 4APVA 5CBEE 5IGGA 3OMGA 1BCPB 2VB3X 1KRTA 4O1NA 4CDCC 5JEAG 1PH8A 4A3KB 2K5NA 1I50H 3F8TA 4UP7A 1PH4A 1PVOA 1TWGH 1VMPA 2M9VA 1HXYD 1IYUA 1XNRL 1DOKA 4QUCA 4IOCA 2NVYH 5IYCG 5C0XH 1D2BA 1S5BD 3T51B 1PRTB 1PYWD 5JJLA 3H94A 3ULLA 5JVG3 2UXDL 1XJVA 1PFMA 2KBNA 5GAGC 4NXML 2A73B 5H1SE 3T56B 1WD1A 2D0OA 1S5FD 4KK7A 4A76A 3I4NB 1X55A 4MIUA 4A3BB 3C1FA 2B8GA 4GN4B 1SDFA 1U4LA 2K14A 1Y1WB 2QF7A 3PF5A 4POGA 1XNQL 3K8AA 3S15B 4A3MH 3HKSA 2V4DA 3CMAA 1AN8A 4RH6A 3CCUA 1LT4D 3BDCA 2F0FA 5I6WA 1BNZA 5C0XG 2HD3A 1A2TA 1KC8C 1UEBA 1PLFA 1MD2D 4FYDA 2B8FA 4XQNA 1YBYA 4A3FG 1BXTA 1JT8A 1OXSC 4YCUA 2YU9H 2KA7A 1RIPA 3OIQA 2I5HA 2VL6A 2VNUD 1VQNA 4GNXC 4P74A 2P5ZX 2CFMA 4WJ4A 3VA5A 4BA2I 1PYSB 1G91A 4JPBW 2SNSA 4ZQ3A 1PH2A 2Q8TA 3H3VI 2D0PA 1E1TA 3T4AC 3VYSA 3CC4A 2PI2E 3HGBA 2PI2A 3KYHC 1TS2A 1KTKA 1RD9D 4JI1L 5JJIA 4N8X1 1MI2A 3G4SA 1SR3A 4KN7C 2YTXA 2FINB 4G7ZC 1KABA 4ME3A 5EQ0A 4UY8C 2HT1A 2F4VQ 1S5ED 1GUSA 4A93B 2PYKA 3HOUH 3M4OB 2Y0SG 2R93H 2F0OA 2Z6BA 2K5HA 3MTSA 1SRUA 5M3MH 4IALA 2BDNA 1Z47A 3STBC 5ISRA 3SE0A 1I5FA 1RODA 3MFYA 4KHPQ 1Q86C 3LWUA 2FJ2A 3BVGA 2RF4A 2ZXRA 1LTID 4KV6A 2F0DA 1Y8OB 1VS0A 1SBBB 3T1HQ 1TWCH 4ZKBB 4OWXB 2DJFC 5IYDG 3HOYG 1SYGA 1L0XB 1Y1VG 1CTMA 4K0KL 2F03A 3HOUG 2E76C 2MFIA 1X3QA 2OWOA 2NVQB 4ZK9B 4QUFA 3U50C 4IFDI 4PZ8A 1I6HB 4HCSA 4DV0L 4DR3L 2DY7A 1F9RA 3DM3A 1BBXC 3WOFA 3RR5A 4DAYB 4BY1G 4A3BH 2NVTB 1SE8A 1RF2D 2UXBL 5C44B 4PQXA 4Z9CB 3S14H 4K14A 1VQDA 3NEMA 1B70B 2PW5A 2EJMA 3S15H 4JI4L 2LKVA 3EQLC 3H91A 5EPKA 3IFTA 3VR6A 1PH7A 2PPBC 4JK1C 4X6AH 4RGTA 2LFNA 4GKJQ 1X3FA 4B3SL 2ZJQA 1MSGA 1MKHA 4IFDG 3VYTA 2KHSA 3SHLA 3CMEA 4K6DA 4QGUA 2BOSA 1MHWC 2EJGC 2N88A 2WAQB 4KI0A 2RA4A 1HUMA 5CV6A 2LSSA 1PMRA 2R7ZH 1HNXL 2AWNA 3CP0A 3KUPA 1NE3A 3AFPA 2K04A 3IKJA 1VQAA 1W6KA 5DNFA 1XPOA 1CKNB 2JQOA 5IWAQ 1Z7TA 4K5WA 1KDCA 4A93H 1SNPA 5A2QL 1AH9A 1YEZA 3M4OH 1I3QH 3PMFA 3T13A 4C3JB 1EOVA 4HEDA 2WACA 2X6LA 4JV5Q 1X65A 3HOZG 4AYBB 3D4RA 1HCZA 1CSPA 3GTJB 5I4DA 2ZXPA 2D9UA 3E0EA 2A19A 3GP7A 4ZLTF 5I6YA 1IYVA 2IHEA 2AUJD 5ELDA 3OHXC 2R7ZG 4NKLA 1RHPA 1PA6A 1HA5A 2UXCQ 3GQBA 1M90C 3CKIB 4DR7Q 4B3RQ 5LL6S 3MXGA 3IRBA 1KHIA 3S2DH 3PO2H 4EGVA 5D3DA 5ELFA 3GTLB 1LTSD 4CDEC 3L9AX 3I70A 1R4QB 2DN8A 5E7NA 1PTOB 3S1MH 2F4IA 3W1BA 5IGBA 2B2VC 2JYOA 3MZ5A 1I6HH 3SVMA 5IT9E 5LMNW 3K7AH 2EY6A 1LO5D 3K58A 3PIPA 1L2FA 1CM9A 4KKUA 3K6OA 3GTPB 3I91A 1IBKL 5ELCA 3CCMA 2NVTH 1K3BC 2DUDA 4L5QA 1YHAA 5CV4A 5C44H 4RG1A 2VUMB 1SAPA 1BF4A 2F0SA 1HNWQ 2MQHA 4DV6L 3GO5A 1N34Q 3PO2G 3GTKB 2WB1B 2VQEQ 1EEFD 2K05A 2CW0D 4C3HG 2AKWB 2PCFB 1TS3A 2F0HA 1TY0A 3ND9A 2B2YC 4ZKCB 2XRSD 2SDFA 4C2MH 4NPSA 4YCWA 4JI5L 4WORA 2L11A 1YNJC 1C4QA 1E1OA 1RCVD 2WINB 1ENFA 1SE2A 3X3MA 4DV4L 3Q22A 1ICFB 1XPUA 5CMDA 1XYIA 3K5OA 2IHFA 1UUPA 1IBLQ 4HCEA 3J7A5 4BXXH 1IW7C 5LL6X 4A3CG 4JOIA 5M5XH 5CV8A 1RTNA 2F0LA 1KD1C 1SFOB 1EY6A 1BR9A 2K28A 3KLWA 5M3FB 2B2UA 1A8VA 5C4JH 4HIMA 3QIAA 5FKAC 5BR8Q 4FVMA 1O78A 4B9WA 4JI7Q 1VQJA 1VQLA 4DR6L 3FEWX 2K03A 2JN4A 4XTCS 3HP3A 4FF2A 2IY5B 4DR1Q 4A3EG 1DD2A 1LT5D 3DEPA 1WFQA 3VR2A 4A3IB 1EL0A 1V1OA 3FP9A 3E5SA 2CWPA 3MXUA 3J80E 1VF5C 5IGCA 3KDFA 2BDOA 3OWEB 4G4KA 4L5SA 1E24A 3BVMA 1U5KA 3K57A 2HIVA 4R4IA 2HQEA 1BBUA 1GUOA 1II3A 4XIGS 4DFAA 3F2CA 2FFKB 1N33Q 1SMXA 4B3ML 2R92H 2EYHA 1WJJA 2B29A 5C3XA 5JPNC 5KIXA 4G7OC 1CHQD 3QOLA 2RHSB 4X62Q 4LFBL 2E5LQ 1WCMG 2MJ8A 4IPDA 3VR5A 2ICEC 4H44C 2JA5H 2IL8A 2K33A 2QDLA 2JA8B 1I4HA 1OXXK 1TY2A 3ICEA 1Q8KA 1WTVA 1U0LA 5I9OA 4R9WA 4DPGA 3QR8A 5FOBB 1RJTA 4NB3A 1PXUA 4MHEA 3TP7A 3NTKA 2VW9A 1J9OA 2K4KA 3CF5A 4A3DH 4HJ9A 4DNTB 1EU3A 3CRLC 3Q24A 2LXJA 1N36L 3H0GG 2RQXA 3RLFA 1GM5A 1QVFA 2DY8A 5C4XH 1B9MA 3W3AA 4NDXA 1XXGA 4BBSB 3MEHA 3TZUA 3F2DA 2E2IB 1KXLA 4B3TQ 4C3IB 3M85A 1HFGA 4OIKA 1EU4A 2WAQE 4FXDA 1GHJA 3OWFA 4DK0A 1L0YB 3BG3A 2KENA 4OX9L 1J5EL 3S1NH 2RCFA 2IWHA 4JI3Q 1GUNA 5IODA 2JK8A 3PSIA 1KQSA 4A3DG 3AYHB 4IQZA 4G57A 4PMBA 1HFNA 1WTHA 2A6HC 1HZBA 3E3XA 4MNOA 5IP9H 4LNQA 1CKNA 1LTTD 2RDGA 3H6MA 3MEFA 3J80i 3EN2A 4KJOA 5D14A 5EBDA 3OW2A 5IT9L 1YJ9A 5E3FA 2MP1A 4X64L 4DAMA 3F1ZA 4EQNA 5C6AA 4AYBE 4DNRB 4LF4L 2HUGA 3FKIH 4GLXA 1L1OB 3MC0B 1SJHD 2A6ED 1OXUA 1V43A 2X6GA 1HZCA 3K7UC 3MXNB 2WIIB 1K83B 1F2ZA 2XN9C 1AZPA 4DU9A 3OSOA 2O2LD 4ILWA 2O5IC 4HMJA 3TS2A 2F0IA 3I7FA 5IIFA 1JICA 2D5DA 1EFID 3RN2A 2X69A 1X3EA 4J15A 1AE2A 1SLJA 4L8JA 5FJ8H 2ZM6L 4JI0L 3I4OA 4RA8A 4DV7Q 1C7YA 1S4ZA 5KYIA 3R3OA 3CQZH 3RLNA 2ENBA 3D31A 2F0VA 3QOJA 4HSPA 3CAMA 3C1EA 4TKOB 2KJXA 4BY7B 2NWGA 4A3FB 2V1CC 3R2TA 2F52A 1X54A 1O7IA 2NN6H 1MBYA 1H9RA 2PZTA 5I9PA 1QE6A 3I3CA 4JI6Q 1M8AA 3D4DA 1TVXA 2XNAC 1F77A 1CUKA 1HQRD 1TWHH 2O4XA 1U4MA 4A3GG 3BZDB 2PW7A 4HIKA 3URYA 2ZTEA 5M5YH 2NVXB 2Z4HA 2WB1E 2PZWA 3HKZG 4LF6Q 2IX0A 5BN5A 3N6RA 3HOXH 5GROA 3S1RB 5FJ8G 4XYOA 3ULPA 3U9OA 1ONLA 4CDFC 1GD7A 5CBAE 1HR0Q 1LM0A 3ERSX 2AWOA 2K7VA 3BU2A 1HTPA 4LF8Q 2CWAA 2RSOA 3PV0A 3EIVA 5CYUA 1HNZL 3GTGB 2Y0SB 3Q23A 1GHKA 4KHVA 3P7JA 3CXCA 2JA7B 1VQIA 3GV6A 2HCCA 1JJCB 1V1QA 2XTIA 4FF3A 4A3JH 1EWIA 4HIOA 1EQQA 2UU9L 1DM0B 1QZGA 4F8MA 2F0JA 4HJ5A 1UE7A 1JE5A 1Y14B 1PH6A 3HOXG 3V05A 1A3TA 3G6EA 2NZ1D 2NZHA 1WTPA 1QNKA 4QY7A 4GKKQ 3CRKC 3A0JA 5FLXc 5HGTA 2AMCB 1F9SA 1JE4A 1Y1VB 3QO2A 1WTOA 1BKBA 4JCVE 1K73C 3WDNA 3UDXA 1CZGA 2F0EA 3ER0A 4GLVB 4ID6A 4DA2A 4FF1A 1SYEA 5BN3A 1L0WA 3KLRA 3ZJYC 4LUVA 3J81c 1TWFB 3HOVH 4KY6A 4A3JG 1PTOD 3NELA 5FO8B 2F3VA 3I4MB 1RTOA 4UDUC 3LX0A 5C0XI 3A74A 3S2HB 2BE5C 1I94L 3HFZB 3CHBD 3HG9A 3SXHA 2AUKA 2KHJA 4KTAA 1IZ6A 4DNIA 4KLKA 1D6EC 2EY5A 4BBRH 5CGKA 1U4RA 2KEEA 3I73A 5JOBA 3GTQB 3HOWH 1N9WA 1K0SA 4P2CB 3SK8A 2UUBQ 1K9MC 2B2TA 2F0UA 4R4QA 3BZKA 3OTOL 1WTQA 2B63H 3M4PA 5A2QE 1I4QA 3T1YQ 1LTLA 2XWJB 2YTYA 1XMOL 1H9JA 3M9BA 3UI2A 3PO3H 4DV1Q 3VDYA 1UNSA 1A3VA 3S17B 3T16A 4DUYL 4DKAC 1RL2A 1TQOA 3RLOA 3RNUA 4IJHA 1G6PA 1PDQA 1XNRQ 1E2ZA 1ENCA 1BCPF 2Z1CA 4LK1C 3PGZA 2HHHQ 2F4VL 4K5VA 3HZXA 2I5MX 5HURA 2B2WA 4J6HA 1SNOA 4NXMQ 3TP8A 3CC2A 4KD3A 3MFGA 4P72A 1YIJA 3PUVA 1NJIC 5HY6A 1PRTF 3C46A 1TKWB 4JI8L 4A3MG 5KNCA 1M4VA 4RKBA 4TSSA 4KHPL 2JA7H 3DM1A 3GDEA 1B3AA 1KDAA 4LFAL 4IZ8A 1XNQQ 1K0RA 5GAEC 1NAPA 3I4LA 2VQFL 3HOZB 1EZ8A 1IKMA 2EXDA 1Z9FA 1EFWA 2UUAQ 3H3VH 2BH2A 1CT1D 2IPKD 1CQVA 1IHZA 1F9PA 4PMCA 1HHVA 2EYFA 1LTRD 1SNDA 4O0AA 1L1OA 2LXKA 4L6TB 4DN4M 3MXNA 3KFUA 3BS1A 2M2LA 1CKMA 3ONAB 4DK3C 2E2HB 1GUWA 3G71A 4CDDC 1R4PB 1EQRA 2EOTA 2CW0C 4POFA 4X66Q 3J7YW 2EPBA 3S24A 1I4GA 1Q3LA 3DMUA 2K32A 5IY0A 4C1NK 2MO0A 2E74C 4A3KH 2KECA 3PUYA 2M00A 2GVBA 2A69D 4LFCQ 1WTXA 1STGA 3TDQA 4JI1Q 4X3TA 4YWKA 2A5HA 5G3LD 2F0WA 2C9OA 4MZ9A 2HIXA 2O5JC 2KVMA 2R93G 1TIID 1BCPC 4LF7Q 1ZYRD 5M3MG 4IOAA 3FVQA 1FYCA 4Y7NB 3DLLA 3GTOB 3DEOA 2R61A 2RBMA 2EQSA 5CR3A 1GO3E 4GKJL 3GV3A 3GTQH 2I07B 3I4NH 4OGQC 3PUZA 3R8BA 1Q90A 1PRTC 5GQOA 4C3HB 4DXGA 1EUJA 1EZ6A 3AU7A 1Y1WH 1UWVA 4L63B 3PIP3 4A3KG 1QOHA 2N55A 4DV2Q 2D62A 1WYDA 4CJ0B 2ATWA 4JW0A 1STEA 1STHA 3JAMc 2A1AA 2K50A 1U4PA 3ITPA 4DV3Q 1HRJA 2Y0SE 1K28A 4TRDA 5J22A 1JB3A 5CV7A 1B1ZA 4IUUA 4H02A 1EWHA 1HTLD 4A3BG 4ULLA 3MHBA 3EJIA 1WOCA 1CI3M 4JVZA 4LWCA 5C3EB 3EFXD 2JP1A 3D0FA 1Q82C 2K6AA 1N32Q 4DR3Q 4H13C 1W3SA 2KCMA 1Y1WG 1XMQL 1RKNA 1F2LA 3OYYA 5FLXE 3RZDB 5FK9C 3J7AF 1Q7YC 3MA2B 3R93A 4JV5L 1G291 4MTNA 2VY3A 3E9HA 1VQHA 3UE1A 3KLSA 1W6JA 4LJZC 1KLGD 5ELEA 1G6ZA 4JI4Q 2PNRC 3S16B 1FJGQ 4FDBA 1A62A 1TS5A 4DUZL 4GN5A 2UXCL 1VQ9A 2NYZD 3TBIB 3KF6B 3AFQA 4F87A 1MIUA 3NK9A 3M3YB 5DEHA 1JWUD 5LMNQ 1EY0A 4CKCA 1G2SA 3A5UA 2E2HH 1AP0A 3RD4A 1WCMB 2PZUA 2LS01 2CVRA 2R7DA 4JOIC 2H5XA 3P20A 2EYOA 3FPPA 4FXGC 1B53A 1T5XD 4GOPB 3OPOA 4HMIA 2B2UC 3E0JA 4UHVA 1KAWA 1D5MC 2YV5A 1HNXQ 1ZXTA 4X3SA 1Y8NB 2EY2A 5IGFA 5T1GA 4A93G 1TT2A 1HNWL 1B50A 3KF8B 3HS0C 1FD7D 1N34L 2NVQH 1SEBD 3H0GB 2A68C 5JAVA 3U4VA 3UDIA 3R2IA 1CSQA 1ESFA 1VQOA 5LMUQ 1SMYC 3MVVA 1UE1A 2L9HA 4XXEA 4BWGB 3A55A 3U9SA 4BS9A 1OTCA 3D6CA 4JC0A 4R8NA 1X3PA 3L3OC 4XQJA 4G7HC 3TREA 3M7NA 1PH5A 1X6OA 1O7YA 2C35B 4JBKA 2QCPX 1I4XA 1IBLL 5M5WB 4PNYA 2QEJC 1JOQA 4DR4Q 5I2XA 1ENAA 4OONA 5IE8A 2PQAB 2FMMA 3M4QA 2A8VA 1TWAB 2Z9HA 1SE3A 3M4YA 1PHJA 2L1BA 4JI7L 4PZ6A 4EX5A 2KHIA 1DJRD 4J8QA 5C3EH 4DR1L 5C44G 1W2BA 4IUNA 1I6VC 1YNND 1QVGA 3A8KE 1VF7A 1VDZA 3RZDH 4YWMA 1VQKA 4NP5A 4PG3A 1MJCA 3MWYW 1CK1A 4HJ7A 3NP8A 2ES2A 4DR2L 1JJ2A 3PIOA 2EDGA 3J81j 4Y52H 4GZYC 3DWPA 5DM63 3A7AB 1D5ZC 4OO1H 2MHVA 2Q2HA 3I90A 2F0NA 2NTSA 3K0XA 4BA1I 3TS0A 2EZVA 4X62L 1XX8A 2E5LL 4C3JH 1QILA 3A54A 4IN3A 5C5MA 4QL5A 2K5QA 4DXFA 5GADC 4LF9L 4BXXG 3GTJH 4RGNA 4DV4Q 2JA6B 2F0MA 2WFWA 4YHHQ 3LGJA 3RZOB 1YZ6A 4AQYL 3GD7A 1X32A 3KOJA 5EPJA 1S72A 2E2JB 2NTTA 3BYTB 4DAYA
chains in the Genus database with same CATH topology
1H95A 2WB1E 5GAHC 3HKZG 4LF6Q 2IX0A 5AJ3L 2PI2E 3HOXH 5GROA 3CC4A 4GLAC 5IYBH 2PI2A 1YHBA 5FJ8G 4IPHA 3ULPA 3GTLH 3KYHC 1NY4A 1GD7A 4JI1L 5JJIA 1HR0Q 4DR6Q 1SN8A 3G4SA 3CCRA 1SR3A 5LMUL 1LM0A 2YTXA 1ASZA 1XMQQ 1IL2A 3ERSX 2AWOA 4LF5Q 3BU2A 1IBMQ 4ME3A 4LF8Q 2HQLA 2Z0SA 2CWAA 4UY8C 2HT1A 2F4VQ 1YHQA 4AYBG 3PV0A 1TXYA 1K3RA 3EIVA 3GTPH 1JMCA 1HNZL 3HOUH 1UE5A 2Y0SG 2R93H 3PUWA 2Q2IA 1NMFA 1Q1BA 2K5HA 1SRUA 4JI3L 3CXCA 3TRZA 2VS1A 5M3MH 1VQIA 2QEXA 4Y7NH 1JJCB 2VUMH 1V1QA 2XTIA 1Z47A 5JEAJ 5HGQA 1EWIA 3G48A 2VQEL 4DUZQ 4HIOA 3ULJA 2B3GA 3STBC 4A3JH 1EQQA 2R92G 1I5FA 3CCJA 2ZJPA 2I5LX 4P71A 2UU9L 1QZGA 4DR4L 1KL9A 1Q86C 4KHPQ 4HJ5A 1UE7A 2RF4A 1JE5A 1Y14B 3GTKH 1PH6A 3HOXG 4B3MQ 3G6EA 5IYBG 1X3GA 2NZHA 4C3HH 2JA5G 1VQPA 4QY7A 1VS0A 4GKKQ 2AHOB 3T1HQ 3A0JA 1TWCH 1HZ9A 4OWXB 5IYDG 3L2PA 1PV4A 4NXNQ 5FLXc 3HOYG 2AMCB 4PMWA 3CCQA 1Y1VG 4K0KL 1BKBA 4JCVE 4WJ3M 1K73C 1YITA 3UDXA 4GLVB 3ER0A 4JBJA 2ASBA 3HOUG 2MFIA 1VQGA 4IPCA 4JI2Q 2OWOA 1L0WA 1GVPA 3ZJYC 4LUVA 3U50C 3J81c 4IFDI 4TQUS 4PZ8A 1N8RC 4YCVA 3HOVH 4A3JG 4A3CH 3NELA 4DV0L 5BR8L 3J81i 1BVSA 3KF6A 1VQ4A 5C4XG 3STBD 4DR3L 5C0XI 3H15A 3A74A 3DM3A 1GKHA 2I0QA 3RR5A 1I94L 4DAYB 5FLMH 1SFOH 3PF4A 4BY1G 4A3LH 3HFZB 4A3BH 5M3FH 3F2BA 1SE8A 2WB1G 2MNAA 2UXBL 5K36G 1PH1A 3S14H 2NZOA 4DV7L 2KHJA 2VZAA 2Q2UA 1IZ6A 2JE6I 1VQEA 4KLKA 4DNIA 1VQDA 3NEMA 4BBRH 3I55A 1IBKQ 1B70B 3J7ZC 3S15H 4JI4L 3L7ZC 4ALPA 1N9WA 3UDFA 1YJNA 3HOWH 4JYAL 4A3EH 1PH7A 2GVAA 2UUBQ 1K9MC 5EAYA 4X6AH 4GOPA 4A3IH 4R4QA 4DV6Q 1P16A 1LUZA 4OX9Q 3BZKA 4GKJQ 3OTOL 2B63H 4LUZA 1X3FA 3M4PA 5IP9G 4YHHL 4LUOA 3S16H 4AIMA 3T1YQ 1N33L 4B3SL 1LTLA 1T9HA 2YTYA 2ZJQA 4OO1I 1MKHA 2K75A 4PZ7A 4IFDG 1XMOL 3M9BA 3PO3H 4DV1Q 3VDYA 3NENA 1FGUA 3CMEA 4L5RC 1C9OA 5DLQE 3U58A 4X65L 3CCLA 1AE3A 4QGUA 4DUYL 3M3YH 4DKAC 4DV5Q 4LF6L 4A3LG 1RL2A 3RLOA 3RNUA 4IJHA 2JEBI 4JG2A 3U4ZA 5C3EG 4HJAA 1G6PA 4JI5Q 3FKIG 2NN6I 1XNRQ 1HR0L 2E2JH 1SROA 2WAQG 3A5ZB 1WCMH 4KI0A 3AQQA 4LF5L 2R7FA 2LSSA 1IBML 3PGZA 2R7ZH 2HHHQ 1HNXL 1VCIA 4KHZA 2AWNA 3CP0A 2F4VL 2I5MX 2JA8H 2CCZA 1NE3A 4DR5Q 3AFPA 4A3IG 4NXMQ 1VQAA 3CC2A 3TEHB 4P72A 1YIJA 3PUVA 1NJIC 1XPOA 5HY6A 1CKNB 2JQOA 1HJPA 5IWAQ 4JI8L 4A93H 4A3MG 4OO1G 1AH9A 1WI5A 1E22A 1YEZA 2OCEA 3M4OH 4DR2Q 1I3QH 2N8NA 2IT1A 1DGSA 4KHPL 4P73A 2JA7H 4GNXB 3GDEA 3UE0A 4GOPC 1EOVA 1Q1EA 3H0GH 4LFAL 1XNQQ 1K0RA 2L15A 5GAEC 2ZM6Q 4JV5Q 2OQ0A 2VQFL 4B3TL 1X65A 5IP7H 3HOZG 4YY3L 1CSPA 2EXDA 1Z9FA 1EFWA 2NN6G 2UUAQ 1UE6A 3H3VH 2BH2A 4BBSH 2JJQA 2YYZA 4NXNL 3B6YA 3E0EA 2A19A 2E2IH 3GTOH 2IHEA 3K80C 4C3IH 2R7ZG 4O0AA 1PA6A 2UXCQ 1L1OA 2LXKA 1M90C 4LF9Q 2JA8G 4DR7Q 4B3RQ 3IRBA 2YTVA 2BA1A 1KHIA 3CW2C 3KFUA 4JI2L 4YWLA 1CKMA 3S2DH 4DK3C 1VQMA 3PO2H 3G71A 2OTLA 4AQYQ 1EQRA 4A4IA 4POFA 4X66Q 3GTMH 5M5WH 3S24A 2K52A 1IYJB 2OTJA 3Q8DA 3SGIA 5E7NA 4OXPA 1Q46A 3BZCA 5IY0A 3S1MH 4LFBQ 2N49A 3JC66 2MO0A 3W1BA 4A3KH 2RCNA 5AJ3Q 3PUYA 1TWAH 1I6HH 1FVIA 5J3BA 2GVBA 5LMNW 4LFCQ 3K7AH 3PCOB 1QUQB 1VQBA 4JI1Q 4YWKA 3PIPA 1L2FA 4MZ9A 4GN3B 2DGYA 5IYCH 2HIXA 1IBKL 2R93G 2ZTCA 4BBSG 3CCMA 2UUCQ 1X9NA 2DUDA 2NVTH 4L5QA 1J6QA 2XGTA 1YHAA 4LF7Q 3CD6A 5M3MG 5C44H 4RG1A 4IOAA 3DLLA 2VUMG 3RN5A 2JA9A 1HNWQ 2R6GA 2MQHA 3I56A 3GO5A 4DV6L 2N3SA 1HNZQ 2EQSA 4GKJL 1GO3E 4IFDJ 1N34Q 2IX1A 3GTQH 1K83H 2Q2TA 1N36Q 4JBMA 3T1YL 3I4NH 3PO2G 1QZHA 3PUZA 5C0XJ 1JB7A 2VQEQ 5GQOA 1QVCA 2AKWB 4LW1A 2UU9Q 1EUJA 3HKZE 1Y1WH 1L1OC 1UWVA 5ELOA 2KCTA 4HIDA 1NTGA 4AH6A 4DV5L 4A3KG 1OXTA 4DV2Q 2D62A 1YJWA 4C2MH 3PUXA 4NPSA 1Q12A 4UPAA 1HH2P 1WYDA 4YCWA 4JI5L 3FHWA 4TVAB 1VQ6A 1E1OA 4R4CA 2ATWA 1R9TH 3JAMc 1XTDA 1J5EQ 4IJLA 4DV4L 2MO1A 1XPUA 1YI2A 2A1AA 2K50A 4JI6L 3KJPA 2IHFA 2HHHL 3KJOA 1PYBA 4DV3Q 3JAMi 1IBLQ 1VQ5A 4BY7H 4GS3A 2GN5A 4A3FH 3J7A5 3HOVG 4BXXH 1A63A 2Y0SE 4DR5L 4A3CG 1S40A 4JOIA 5M5XH 4R4TA 2JA6H 3NBHB 2ZJRA 1KD1C 3RZOH 3AEVA 5FLMG 4H02A 4QJFA 3KLWA 1JJGA 1G51A 4A3BG 5M3FG 1A8VA 1WOCA 4LWCA 5C4JH 5M5YH 4A3GH 4HIMA 1Q82C 3D0FA 5BR8Q 1N32Q 2FXQA 1PH9A 4DR3Q 4JI7Q 1VQJA 1VQLA 4DR6L 1W3SA 2KCMA 4BBRG 1Y1WG 1XMQL 1I94Q 2NVXH 4EQ5A 4XTCS 3OYYA 4X64Q 4R4OA 4LF8L 1Q7YC 3S1RH 3HOWG 2IY5B 4JV5L 4DR1Q 4LF4Q 4A3EG 1G291 4MTNA 2UXDQ 2VY3A 3E9HA 1VQHA 3UE1A 1WFQA 2E8GA 3FP9A 1IXRA 3CCSA 2CWPA 2UUAL 2Z6KA 1YNXA 4A75A 2B63G 4JI4Q 3KDFA 4JYAQ 1FJGQ 4FDBA 1A62A 4R1JA 3CPFA 5IT9c 4BY7G 4DUZL 4GN5A 3WWVA 1E24A 4HJ8A 4L5SA 2UXCL 1VQ9A 4IPGA 1U5KA 1Q81C 2HIVA 3PO3G 4R4IA 3GTGH 1MJEA 1BBUA 3KF6B 4XIGS 3AFQA 3OTOQ 1EIFA 2JA6G 2BA0A 3F2CA 2PQAA 1MIUA 1N33Q 3CPWA 1SMXA 4RMFA 2BH8A 4X66L 4B3ML 2R92H 1XMOQ 1WJJA 1LYLA 1VQFA 2B29A 5LMNQ 4JI0Q 4UP8A 1V9PA 4GKKL 2CKZB 3E9IA 3A5UA 2E2HH 2RHSB 4UP9A 4X62Q 3T1HL 2E5LQ 4LFBL 1C0AA 1WCMG 4IPDA 4X65Q 4DUYQ 2R7DA 3CCEA 4JOIC 2H5XA 1NBWA 4P75A 2JA5H 4LFCL 2EIFA 1OXXK 4GOPB 3ICEA 1Q8KA 1U0LA 4DPGA 1X56A 5IYDH 3HOYH 1KAWA 1VQ7A 2YV5A 4OWTB 2UUCL 4NB3A 1K8AC 1K8GA 1ASYA 4LF7L 1HNXQ 1Y1VH 2N78A 1E3PA 2VW9A 3CC7A 2K4KA 4A3DH 3CF5A 4A93G 1HNWL 4HJ9A 3KF8B 2OQKA 1VQCA 1N34L 4QQBX 2NVQH 2LXJA 4O2DA 2JA7G 1N36L 3H0GG 1TWFH 3RLFA 1YVCA 1GM5A 4JI8Q 3U4VA 3UDIA 2Z6KC 1QVFA 1XPRA 1KRSA 5IP7G 1CSQA 3I4MH 1CKOA 1BBWA 5C4XH 1VQOA 5LMUQ 3S2HH 1UE1A 2WP8J 4LFAQ 4BY1H 1EIYB 4DV2L 3F2DA 4IO9A 1KXLA 1OTCA 2VQFQ 4B3TQ 4JC0A 3M85A 2ALYB 3EBEA 1D7QA 2WAQE 2UUBL 4YY3Q 1HR0W 3TREA 3W5OA 3K81C 1PH5A 3M7NA 2KENA 4OX9L 2ID0A 1J5EL 3S1NH 5JJKA 3H3VI 1X6OA 2C35B 1KIXA 4JBKA 4JI3Q 3TQYA 1B7YB 1D8LA 1HZAA 3KDFB 4L5TA 2JK8A 2PNHA 4DV3L 3PSIA 1IBLL 1KQSA 2RHQB 4A3DG 1VQ8A 3AYHB 1EYGA 4DV1L 1M1KC 4APVA 2K5VA 4MNOA 5IP9H 1HZBA 4DR4Q 3J80c 4LNQA 1KRTA 1CKNA 4OONA 5JEAG 5IE8A 2PQAB 1PH8A 2K5NA 3M4QA 2A8VA 1I50H 3F8TA 3MEFA 4UP7A 1PH4A 1TWGH 3EN2A 3J80i 1PHJA 1PVOA 3I4MG 1XNRL 1N32L 3S17H 4JI7L 4PZ6A 4IOCA 4GNXA 4EX5A 2NVYH 5IYCG 2KHIA 3OW2A 1YJ9A 4X64L 4DAMA 3F1ZA 2JEAI 1A0IA 5C3EH 4AYBE 5JJLA 4DR1L 3ULLA 5C44G 1W2BA 4LF4L 3FKIH 4GLXA 1XJVA 1QVGA 4K0KQ 2UXDL 2KBNA 1L1OB 5GAGC 4NXML 2ZTDA 1OXUA 1V43A 1HZCA 3CCVA 5H1SE 3K7UC 3MXNB 1FL0A 1NMGA 3RZDH 4YWMA 5ELNA 1VQKA 2D0OA 4PG3A 4A76A 3I4NG 1PH3A 1FJGL 1MJCA 1X55A 5IWAL 2CQOA 4HJ7A 4DK6C 4DV0Q 3TS2A 4GN4B 3I7FA 2ES2A 4DR2L 1JJ2A 3PIOA 2K14A 3RN2A 2F3IA 3J81j 3PF5A 1X3EA 4POGA 4Y52H 4J15A 1XNQL 3K8AA 1AE2A 1SLJA 3S1QH 2UXBQ 4JBWA 5FJ8H 2ZM6L 3HKSA 3CMAA 2QA4A 4A3MH 3I4OA 4JI0L 5LMNL 2Q2HA 4BA1I 1C7YA 3K0XA 4DV7Q 3TS0A 3CCUA 1OXVA 3UDGA 4X62L 3CQZH 3RLNA 2E5LL 4C3JH 5C0XG 3D31A 3L0OA 1KC8C 1UEBA 3CAMA 1S3OA 4QL5A 2PMZE 3HOZH 1YBYA 1P8LA 1QUQA 5GADC 4A3FG 1PFSA 2V1CC 2F52A 4LF9L 1X54A 3GTJH 1O7IA 4BXXG 4DR7L 4B3RL 1JT8A 1OXSC 3I2ZA 4YCUA 4DV4Q 2YU9H 1RIPA 2WFWA 4JI6Q 4YHHQ 2I5HA 3LGJA 3W1GA 2VL6A 1YZ6A 2VNUD 4B3SQ 4AQYL 1VQNA 4GNXC 2QGQA 4P74A 2CFMA 4QIWE 4WJ4A 1CUKA 1TWHH 3GD7A 3KOJA 4A3GG 4BA2I 1PYSB 3BJUA 4OWWB 1S72A 1PH2A 1E7ZA 4HIKA 2ZTEA 1B8AA 2D0PA 1E1TA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1H95 A;  2WB1 E;  5GAH C;  3HKZ G;  4LF6 Q;  2IX0 A;  5AJ3 L;  2PI2 E;  3HOX H;  5GRO A;  3CC4 A;  4GLA C;  5IYB H;  2PI2 A;  1YHB A;  5FJ8 G;  4IPH A;  3ULP A;  3GTL H;  3KYH C;  1NY4 A;  1GD7 A;  4JI1 L;  5JJI A;  1HR0 Q;  4DR6 Q;  1SN8 A;  3G4S A;  3CCR A;  1SR3 A;  5LMU L;  1LM0 A;  2YTX A;  1ASZ A;  1XMQ Q;  1IL2 A;  3ERS X;  2AWO A;  4LF5 Q;  3BU2 A;  1IBM Q;  4ME3 A;  4LF8 Q;  2HQL A;  2Z0S A;  2CWA A;  4UY8 C;  2HT1 A;  2F4V Q;  1YHQ A;  4AYB G;  3PV0 A;  1TXY A;  1K3R A;  3EIV A;  3GTP H;  1JMC A;  1HNZ L;  3HOU H;  1UE5 A;  2Y0S G;  2R93 H;  3PUW A;  2Q2I A;  1NMF A;  1Q1B A;  2K5H A;  1SRU A;  4JI3 L;  3CXC A;  3TRZ A;  2VS1 A;  5M3M H;  1VQI A;  2QEX A;  4Y7N H;  1JJC B;  2VUM H;  1V1Q A;  2XTI A;  1Z47 A;  5JEA J;  5HGQ A;  1EWI A;  3G48 A;  2VQE L;  4DUZ Q;  4HIO A;  3ULJ A;  2B3G A;  3STB C;  4A3J H;  1EQQ A;  2R92 G;  1I5F A;  3CCJ A;  2ZJP A;  2I5L X;  4P71 A;  2UU9 L;  1QZG A;  4DR4 L;  1KL9 A;  1Q86 C;  4KHP Q;  4HJ5 A;  1UE7 A;  2RF4 A;  1JE5 A;  1Y14 B;  3GTK H;  1PH6 A;  3HOX G;  4B3M Q;  3G6E A;  5IYB G;  1X3G A;  2NZH A;  4C3H H;  2JA5 G;  1VQP A;  4QY7 A;  1VS0 A;  4GKK Q;  2AHO B;  3T1H Q;  3A0J A;  1TWC H;  1HZ9 A;  4OWX B;  5IYD G;  3L2P A;  1PV4 A;  4NXN Q;  5FLX c;  3HOY G;  2AMC B;  4PMW A;  3CCQ A;  1Y1V G;  4K0K L;  1BKB A;  4JCV E;  4WJ3 M;  1K73 C;  1YIT A;  3UDX A;  4GLV B;  3ER0 A;  4JBJ A;  2ASB A;  3HOU G;  2MFI A;  1VQG A;  4IPC A;  4JI2 Q;  2OWO A;  1L0W A;  1GVP A;  3ZJY C;  4LUV A;  3U50 C;  3J81 c;  4IFD I;  4TQU S;  4PZ8 A;  1N8R C;  4YCV A;  3HOV H;  4A3J G;  4A3C H;  3NEL A;  4DV0 L;  5BR8 L;  3J81 i;  1BVS A;  3KF6 A;  1VQ4 A;  5C4X G;  3STB D;  4DR3 L;  5C0X I;  3H15 A;  3A74 A;  3DM3 A;  1GKH A;  2I0Q A;  3RR5 A;  1I94 L;  4DAY B;  5FLM H;  1SFO H;  3PF4 A;  4BY1 G;  4A3L H;  3HFZ B;  4A3B H;  5M3F H;  3F2B A;  1SE8 A;  2WB1 G;  2MNA A;  2UXB L;  5K36 G;  1PH1 A;  3S14 H;  2NZO A;  4DV7 L;  2KHJ A;  2VZA A;  2Q2U A;  1IZ6 A;  2JE6 I;  1VQE A;  4KLK A;  4DNI A;  1VQD A;  3NEM A;  4BBR H;  3I55 A;  1IBK Q;  1B70 B;  3J7Z C;  3S15 H;  4JI4 L;  3L7Z C;  4ALP A;  1N9W A;  3UDF A;  1YJN A;  3HOW H;  4JYA L;  4A3E H;  1PH7 A;  2GVA A;  2UUB Q;  1K9M C;  5EAY A;  4X6A H;  4GOP A;  4A3I H;  4R4Q A;  4DV6 Q;  1P16 A;  1LUZ A;  4OX9 Q;  3BZK A;  4GKJ Q;  3OTO L;  2B63 H;  4LUZ A;  1X3F A;  3M4P A;  5IP9 G;  4YHH L;  4LUO A;  3S16 H;  4AIM A;  3T1Y Q;  1N33 L;  4B3S L;  1LTL A;  1T9H A;  2YTY A;  2ZJQ A;  4OO1 I;  1MKH A;  2K75 A;  4PZ7 A;  4IFD G;  1XMO L;  3M9B A;  3PO3 H;  4DV1 Q;  3VDY A;  3NEN A;  1FGU A;  3CME A;  4L5R C;  1C9O A;  5DLQ E;  3U58 A;  4X65 L;  3CCL A;  1AE3 A;  4QGU A;  4DUY L;  3M3Y H;  4DKA C;  4DV5 Q;  4LF6 L;  4A3L G;  1RL2 A;  3RLO A;  3RNU A;  4IJH A;  2JEB I;  4JG2 A;  3U4Z A;  5C3E G;  4HJA A;  1G6P A;  4JI5 Q;  3FKI G;  2NN6 I;  1XNR Q;  1HR0 L;  2E2J H;  1SRO A;  2WAQ G;  3A5Z B;  1WCM H;  4KI0 A;  3AQQ A;  4LF5 L;  2R7F A;  2LSS A;  1IBM L;  3PGZ A;  2R7Z H;  2HHH Q;  1HNX L;  1VCI A;  4KHZ A;  2AWN A;  3CP0 A;  2F4V L;  2I5M X;  2JA8 H;  2CCZ A;  1NE3 A;  4DR5 Q;  3AFP A;  4A3I G;  4NXM Q;  1VQA A;  3CC2 A;  3TEH B;  4P72 A;  1YIJ A;  3PUV A;  1NJI C;  1XPO A;  5HY6 A;  1CKN B;  2JQO A;  1HJP A;  5IWA Q;  4JI8 L;  4A93 H;  4A3M G;  4OO1 G;  1AH9 A;  1WI5 A;  1E22 A;  1YEZ A;  2OCE A;  3M4O H;  4DR2 Q;  1I3Q H;  2N8N A;  2IT1 A;  1DGS A;  4KHP L;  4P73 A;  2JA7 H;  4GNX B;  3GDE A;  3UE0 A;  4GOP C;  1EOV A;  1Q1E A;  3H0G H;  4LFA L;  1XNQ Q;  1K0R A;  2L15 A;  5GAE C;  2ZM6 Q;  4JV5 Q;  2OQ0 A;  2VQF L;  4B3T L;  1X65 A;  5IP7 H;  3HOZ G;  4YY3 L;  1CSP A;  2EXD A;  1Z9F A;  1EFW A;  2NN6 G;  2UUA Q;  1UE6 A;  3H3V H;  2BH2 A;  4BBS H;  2JJQ A;  2YYZ A;  4NXN L;  3B6Y A;  3E0E A;  2A19 A;  2E2I H;  3GTO H;  2IHE A;  3K80 C;  4C3I H;  2R7Z G;  4O0A A;  1PA6 A;  2UXC Q;  1L1O A;  2LXK A;  1M90 C;  4LF9 Q;  2JA8 G;  4DR7 Q;  4B3R Q;  3IRB A;  2YTV A;  2BA1 A;  1KHI A;  3CW2 C;  3KFU A;  4JI2 L;  4YWL A;  1CKM A;  3S2D H;  4DK3 C;  1VQM A;  3PO2 H;  3G71 A;  2OTL A;  4AQY Q;  1EQR A;  4A4I A;  4POF A;  4X66 Q;  3GTM H;  5M5W H;  3S24 A;  2K52 A;  1IYJ B;  2OTJ A;  3Q8D A;  3SGI A;  5E7N A;  4OXP A;  1Q46 A;  3BZC A;  5IY0 A;  3S1M H;  4LFB Q;  2N49 A;  3JC6 6;  2MO0 A;  3W1B A;  4A3K H;  2RCN A;  5AJ3 Q;  3PUY A;  1TWA H;  1I6H H;  1FVI A;  5J3B A;  2GVB A;  5LMN W;  4LFC Q;  3K7A H;  3PCO B;  1QUQ B;  1VQB A;  4JI1 Q;  4YWK A;  3PIP A;  1L2F A;  4MZ9 A;  4GN3 B;  2DGY A;  5IYC H;  2HIX A;  1IBK L;  2R93 G;  2ZTC A;  4BBS G;  3CCM A;  2UUC Q;  1X9N A;  2DUD A;  2NVT H;  4L5Q A;  1J6Q A;  2XGT A;  1YHA A;  4LF7 Q;  3CD6 A;  5M3M G;  5C44 H;  4RG1 A;  4IOA A;  3DLL A;  2VUM G;  3RN5 A;  2JA9 A;  1HNW Q;  2R6G A;  2MQH A;  3I56 A;  3GO5 A;  4DV6 L;  2N3S A;  1HNZ Q;  2EQS A;  4GKJ L;  1GO3 E;  4IFD J;  1N34 Q;  2IX1 A;  3GTQ H;  1K83 H;  2Q2T A;  1N36 Q;  4JBM A;  3T1Y L;  3I4N H;  3PO2 G;  1QZH A;  3PUZ A;  5C0X J;  1JB7 A;  2VQE Q;  5GQO A;  1QVC A;  2AKW B;  4LW1 A;  2UU9 Q;  1EUJ A;  3HKZ E;  1Y1W H;  1L1O C;  1UWV A;  5ELO A;  2KCT A;  4HID A;  1NTG A;  4AH6 A;  4DV5 L;  4A3K G;  1OXT A;  4DV2 Q;  2D62 A;  1YJW A;  4C2M H;  3PUX A;  4NPS A;  1Q12 A;  4UPA A;  1HH2 P;  1WYD A;  4YCW A;  4JI5 L;  3FHW A;  4TVA B;  1VQ6 A;  1E1O A;  4R4C A;  2ATW A;  1R9T H;  3JAM c;  1XTD A;  1J5E Q;  4IJL A;  4DV4 L;  2MO1 A;  1XPU A;  1YI2 A;  2A1A A;  2K50 A;  4JI6 L;  3KJP A;  2IHF A;  2HHH L;  3KJO A;  1PYB A;  4DV3 Q;  3JAM i;  1IBL Q;  1VQ5 A;  4BY7 H;  4GS3 A;  2GN5 A;  4A3F H;  3J7A 5;  3HOV G;  4BXX H;  1A63 A;  2Y0S E;  4DR5 L;  4A3C G;  1S40 A;  4JOI A;  5M5X H;  4R4T A;  2JA6 H;  3NBH B;  2ZJR A;  1KD1 C;  3RZO H;  3AEV A;  5FLM G;  4H02 A;  4QJF A;  3KLW A;  1JJG A;  1G51 A;  4A3B G;  5M3F G;  1A8V A;  1WOC A;  4LWC A;  5C4J H;  5M5Y H;  4A3G H;  4HIM A;  1Q82 C;  3D0F A;  5BR8 Q;  1N32 Q;  2FXQ A;  1PH9 A;  4DR3 Q;  4JI7 Q;  1VQJ A;  1VQL A;  4DR6 L;  1W3S A;  2KCM A;  4BBR G;  1Y1W G;  1XMQ L;  1I94 Q;  2NVX H;  4EQ5 A;  4XTC S;  3OYY A;  4X64 Q;  4R4O A;  4LF8 L;  1Q7Y C;  3S1R H;  3HOW G;  2IY5 B;  4JV5 L;  4DR1 Q;  4LF4 Q;  4A3E G;  1G29 1;  4MTN A;  2UXD Q;  2VY3 A;  3E9H A;  1VQH A;  3UE1 A;  1WFQ A;  2E8G A;  3FP9 A;  1IXR A;  3CCS A;  2CWP A;  2UUA L;  2Z6K A;  1YNX A;  4A75 A;  2B63 G;  4JI4 Q;  3KDF A;  4JYA Q;  1FJG Q;  4FDB A;  1A62 A;  4R1J A;  3CPF A;  5IT9 c;  4BY7 G;  4DUZ L;  4GN5 A;  3WWV A;  1E24 A;  4HJ8 A;  4L5S A;  2UXC L;  1VQ9 A;  4IPG A;  1U5K A;  1Q81 C;  2HIV A;  3PO3 G;  4R4I A;  3GTG H;  1MJE A;  1BBU A;  3KF6 B;  4XIG S;  3AFQ A;  3OTO Q;  1EIF A;  2JA6 G;  2BA0 A;  3F2C A;  2PQA A;  1MIU A;  1N33 Q;  3CPW A;  1SMX A;  4RMF A;  2BH8 A;  4X66 L;  4B3M L;  2R92 H;  1XMO Q;  1WJJ A;  1LYL A;  1VQF A;  2B29 A;  5LMN Q;  4JI0 Q;  4UP8 A;  1V9P A;  4GKK L;  2CKZ B;  3E9I A;  3A5U A;  2E2H H;  2RHS B;  4UP9 A;  4X62 Q;  3T1H L;  2E5L Q;  4LFB L;  1C0A A;  1WCM G;  4IPD A;  4X65 Q;  4DUY Q;  2R7D A;  3CCE A;  4JOI C;  2H5X A;  1NBW A;  4P75 A;  2JA5 H;  4LFC L;  2EIF A;  1OXX K;  4GOP B;  3ICE A;  1Q8K A;  1U0L A;  4DPG A;  1X56 A;  5IYD H;  3HOY H;  1KAW A;  1VQ7 A;  2YV5 A;  4OWT B;  2UUC L;  4NB3 A;  1K8A C;  1K8G A;  1ASY A;  4LF7 L;  1HNX Q;  1Y1V H;  2N78 A;  1E3P A;  2VW9 A;  3CC7 A;  2K4K A;  4A3D H;  3CF5 A;  4A93 G;  1HNW L;  4HJ9 A;  3KF8 B;  2OQK A;  1VQC A;  1N34 L;  4QQB X;  2NVQ H;  2LXJ A;  4O2D A;  2JA7 G;  1N36 L;  3H0G G;  1TWF H;  3RLF A;  1YVC A;  1GM5 A;  4JI8 Q;  3U4V A;  3UDI A;  2Z6K C;  1QVF A;  1XPR A;  1KRS A;  5IP7 G;  1CSQ A;  3I4M H;  1CKO A;  1BBW A;  5C4X H;  1VQO A;  5LMU Q;  3S2H H;  1UE1 A;  2WP8 J;  4LFA Q;  4BY1 H;  1EIY B;  4DV2 L;  3F2D A;  4IO9 A;  1KXL A;  1OTC A;  2VQF Q;  4B3T Q;  4JC0 A;  3M85 A;  2ALY B;  3EBE A;  1D7Q A;  2WAQ E;  2UUB L;  4YY3 Q;  1HR0 W;  3TRE A;  3W5O A;  3K81 C;  1PH5 A;  3M7N A;  2KEN A;  4OX9 L;  2ID0 A;  1J5E L;  3S1N H;  5JJK A;  3H3V I;  1X6O A;  2C35 B;  1KIX A;  4JBK A;  4JI3 Q;  3TQY A;  1B7Y B;  1D8L A;  1HZA A;  3KDF B;  4L5T A;  2JK8 A;  2PNH A;  4DV3 L;  3PSI A;  1IBL L;  1KQS A;  2RHQ B;  4A3D G;  1VQ8 A;  3AYH B;  1EYG A;  4DV1 L;  1M1K C;  4APV A;  2K5V A;  4MNO A;  5IP9 H;  1HZB A;  4DR4 Q;  3J80 c;  4LNQ A;  1KRT A;  1CKN A;  4OON A;  5JEA G;  5IE8 A;  2PQA B;  1PH8 A;  2K5N A;  3M4Q A;  2A8V A;  1I50 H;  3F8T A;  3MEF A;  4UP7 A;  1PH4 A;  1TWG H;  3EN2 A;  3J80 i;  1PHJ A;  1PVO A;  3I4M G;  1XNR L;  1N32 L;  3S17 H;  4JI7 L;  4PZ6 A;  4IOC A;  4GNX A;  4EX5 A;  2NVY H;  5IYC G;  2KHI A;  3OW2 A;  1YJ9 A;  4X64 L;  4DAM A;  3F1Z A;  2JEA I;  1A0I A;  5C3E H;  4AYB E;  5JJL A;  4DR1 L;  3ULL A;  5C44 G;  1W2B A;  4LF4 L;  3FKI H;  4GLX A;  1XJV A;  1QVG A;  4K0K Q;  2UXD L;  2KBN A;  1L1O B;  5GAG C;  4NXM L;  2ZTD A;  1OXU A;  1V43 A;  1HZC A;  3CCV A;  5H1S E;  3K7U C;  3MXN B;  1FL0 A;  1NMG A;  3RZD H;  4YWM A;  5ELN A;  1VQK A;  2D0O A;  4PG3 A;  4A76 A;  3I4N G;  1PH3 A;  1FJG L;  1MJC A;  1X55 A;  5IWA L;  2CQO A;  4HJ7 A;  4DK6 C;  4DV0 Q;  3TS2 A;  4GN4 B;  3I7F A;  2ES2 A;  4DR2 L;  1JJ2 A;  3PIO A;  2K14 A;  3RN2 A;  2F3I A;  3J81 j;  3PF5 A;  1X3E A;  4POG A;  4Y52 H;  4J15 A;  1XNQ L;  3K8A A;  1AE2 A;  1SLJ A;  3S1Q H;  2UXB Q;  4JBW A;  5FJ8 H;  2ZM6 L;  3HKS A;  3CMA A;  2QA4 A;  4A3M H;  3I4O A;  4JI0 L;  5LMN L;  2Q2H A;  4BA1 I;  1C7Y A;  3K0X A;  4DV7 Q;  3TS0 A;  3CCU A;  1OXV A;  3UDG A;  4X62 L;  3CQZ H;  3RLN A;  2E5L L;  4C3J H;  5C0X G;  3D31 A;  3L0O A;  1KC8 C;  1UEB A;  3CAM A;  1S3O A;  4QL5 A;  2PMZ E;  3HOZ H;  1YBY A;  1P8L A;  1QUQ A;  5GAD C;  4A3F G;  1PFS A;  2V1C C;  2F52 A;  4LF9 L;  1X54 A;  3GTJ H;  1O7I A;  4BXX G;  4DR7 L;  4B3R L;  1JT8 A;  1OXS C;  3I2Z A;  4YCU A;  4DV4 Q;  2YU9 H;  1RIP A;  2WFW A;  4JI6 Q;  4YHH Q;  2I5H A;  3LGJ A;  3W1G A;  2VL6 A;  1YZ6 A;  2VNU D;  4B3S Q;  4AQY L;  1VQN A;  4GNX C;  2QGQ A;  4P74 A;  2CFM A;  4QIW E;  4WJ4 A;  1CUK A;  1TWH H;  3GD7 A;  3KOJ A;  4A3G G;  4BA2 I;  1PYS B;  3BJU A;  4OWW B;  1S72 A;  1PH2 A;  1E7Z A;  4HIK A;  2ZTE A;  1B8A A;  2D0P A;  1E1T A; 
#chains in the Genus database with same CATH topology
 1H95 A;  1K8O A;  5AJ3 L;  1H9S B;  1TS4 A;  3FRP B;  5IYB H;  2IW3 A;  2OF1 A;  2LMC B;  4IPH A;  3GTL H;  2FHT A;  3W2D A;  1NR2 A;  5FLX L;  4DR6 Q;  1PTO H;  4EQO A;  3CCR A;  3JAM E;  1ASZ A;  1EYA A;  4LF5 Q;  1IBM Q;  1EY8 A;  4AYB G;  1TXY A;  1K3R A;  3GTP H;  1JMC A;  1BUV T;  1HA6 A;  1UE5 A;  3PUW A;  4H0L C;  4RWS C;  4JI3 L;  4N9P A;  1PTO C;  2VUM H;  5JEA J;  5HGQ A;  4DK1 A;  2R92 G;  3ULJ A;  2B3G A;  2EJF C;  3CCJ A;  3RMH A;  2ZJP A;  2I5L X;  1BDO A;  1CA5 A;  1GJX A;  3GTK H;  2WKD A;  4B3M Q;  5IYB G;  2AQ2 B;  2JA5 G;  3VYR A;  1FNW A;  2AHO B;  4QB4 A;  4NXN Q;  4PMW A;  1WVL A;  2K5W A;  4U67 3;  3CCQ A;  1ESR A;  4WJ3 M;  4JBJ A;  2Z8L A;  4I65 A;  1VQG A;  3QWN A;  4JI2 Q;  4IUR A;  1SE4 A;  3OMC A;  4N9T A;  3A8I E;  1IKL A;  3NHH A;  2A74 C;  2F0Q A;  3VR4 A;  4K8I A;  2Q8I B;  3KF6 A;  5C4X G;  3K5L A;  1GKH A;  2I0Q A;  3K59 A;  5FLM H;  3PF4 A;  1SFO H;  4A3L H;  5A35 A;  3LNN A;  5M3F H;  1SNM A;  2WB1 G;  2MNA A;  3DUZ A;  1PH1 A;  2NZO A;  4DV7 L;  2VZA A;  2Q2U A;  4FO2 A;  2JE6 I;  4MTK A;  1LV9 A;  3I55 A;  4K2K A;  1EOT A;  3ERQ A;  4ALP A;  3UDF A;  4JYA L;  3NTI A;  2GVA A;  5EAY A;  4I7Z C;  4IUQ A;  4GOP A;  1Q8I A;  3NUC A;  4A3I H;  1STB A;  1P16 A;  4OX9 Q;  1ICW A;  4LUZ A;  5IP9 G;  4K5X A;  4LUO A;  4AIM A;  4WFN 3;  2EY1 A;  1T9H A;  2LY7 A;  1I50 B;  1TWG B;  1GUG A;  3KF8 A;  1FGU A;  1ZKO A;  2WKC A;  4L5R C;  1R9T B;  2NVY B;  5DLQ E;  5ELB A;  5TSS A;  4X65 L;  3U58 A;  3CCL A;  2PQE A;  4CJ1 B;  4DV5 Q;  4KMU C;  2L5T A;  4LF6 L;  4A3L G;  2MGS A;  4HJA A;  3FKI G;  4OIJ A;  2KUM A;  2NN6 I;  1HR0 L;  2E2J H;  3A5Z B;  1XWE A;  2MPM A;  1JWS D;  2R7F A;  1ML0 D;  2EYL A;  2JA8 H;  4DR5 Q;  4A3I G;  5K5P A;  3TEH B;  1YNJ D;  4CHT B;  4V19 0;  2GA4 B;  1KDB A;  1ILQ A;  3BYY B;  4OEL B;  3C3L A;  5FO9 B;  5IGD A;  4C1N I;  1WI5 A;  4ODG A;  4HN7 A;  1E22 A;  4WRD A;  2OCE A;  5LHY 1;  3NQT A;  1D1K A;  2IT1 A;  2EYP A;  4GNX B;  2B2T C;  3UE0 A;  1O7Z A;  2L15 A;  4K6L A;  1LTA D;  2ZM6 Q;  2IJ0 A;  5JVH 3;  2OQ0 A;  4ZUJ A;  5IP7 H;  1KAA A;  5BN4 A;  1JOK A;  4YY3 L;  1CQF A;  1DOM A;  3K0Y A;  2NN6 G;  4CJ2 C;  4BBS H;  2EE1 A;  1ZYR C;  2JJQ A;  2YU9 B;  3C2P A;  2ICI A;  3B6Y A;  2E2I H;  3A56 A;  1PZJ D;  3OW7 A;  4C3I H;  3QG1 A;  2JA8 G;  3H09 A;  2YTV A;  1GXD C;  4HTH A;  2BA1 A;  2F0P A;  3N52 A;  3CW2 C;  2QIL A;  3TP6 A;  4KD4 A;  3TP5 A;  4A4I A;  2BCO A;  2WV6 D;  2OTJ A;  1LT6 D;  4OXP A;  1Q46 A;  2B2W C;  5JEA H;  2N49 A;  3OIP A;  3HRZ C;  1SNC A;  2KOL A;  2RCN A;  3HOY B;  1FVI A;  1U9R A;  5J3B A;  3JAM L;  1QUQ B;  1VQB A;  2PMZ B;  4F88 A;  5C4H A;  5IYC H;  1NNX A;  2DGY A;  3HOU B;  2R93 B;  4BBS G;  2UUC Q;  4QF4 A;  1X9N A;  1EIH A;  2XGT A;  5M3M B;  1CZW A;  1D5X C;  3V96 A;  3RN5 A;  2JA9 A;  4XQQ A;  1O80 A;  2R6G A;  4QIW B;  3VR3 A;  1EY4 A;  1V1P B;  1HNZ Q;  3WOE A;  2N3S A;  4IFD J;  4C56 C;  4FXK C;  3SK4 A;  1K83 H;  5E4W C;  4BY1 B;  3T1Y L;  1QZH A;  1EYD A;  3NTH A;  1QVC A;  1CFM A;  2UU9 Q;  3HKZ E;  1L1O C;  1TWC B;  4HID A;  1H9S A;  4X3K A;  4AH6 A;  3PUX A;  1STY A;  3FHW A;  1VQ6 A;  4R4C A;  2RDF A;  1R9T H;  5EKI A;  1E0B A;  1XTD A;  2MO1 A;  1YI2 A;  1QWY A;  4FNF A;  3KJP A;  5DAU A;  2HHH L;  4BY7 H;  1PYB A;  1S5D D;  2L4N A;  2XVS A;  1SYF A;  1A15 A;  4GS3 A;  4A3F H;  1VQ5 A;  3HOV G;  2XWB B;  1QB5 D;  1S40 A;  3FMC A;  5EKK A;  2ZXO A;  4R4T A;  3NBH B;  1SNQ A;  4RGO S;  2KQ3 A;  4RKL A;  3AEV A;  3A7L A;  4IUT A;  3I72 A;  2B39 A;  3G7L A;  4QJF A;  4B9X A;  5KNB A;  1JJG A;  4KJN A;  4RCO A;  3SDZ A;  3S14 B;  2FXQ A;  1DXM A;  1F9Q A;  3P1H A;  4BBR G;  2NVX H;  1I94 Q;  4EQ5 A;  2A6H D;  4LAA A;  4R4O A;  2I46 A;  3S1R H;  3HOW G;  5EPL A;  5C4Z A;  2UXD Q;  5D65 A;  4E6I A;  2UUA L;  1EWC A;  2VB2 X;  2Z6K A;  4A75 A;  2B63 G;  2QW7 A;  1SYC A;  4J1M A;  4U68 A;  4IUV A;  5NUC A;  4R1J A;  4BY7 G;  5IT9 c;  1NUC A;  4HJ8 A;  3S1Q B;  4IPG A;  1Q81 C;  3PO3 G;  3GTG H;  4H7B A;  1TU2 B;  3OTO Q;  2G9H D;  4OL7 A;  1STA A;  4ME5 A;  3CPW A;  1JOO A;  4RMF A;  3G6J B;  4ZCK A;  4X66 L;  1XMO Q;  1F2M A;  1V9P A;  2XRQ D;  5T1I A;  1DZ1 A;  3NSW A;  4ZRZ A;  3T1H L;  4EVO A;  4DUY Q;  3CCE A;  2E75 C;  3KBG A;  1NBW A;  5KEE A;  4P75 A;  2R7Z B;  4LFC L;  4HR7 B;  3MAQ A;  4WJW A;  1NR4 A;  1X56 A;  5IYD H;  3HOY H;  3ND8 A;  1VQ7 A;  2QKI C;  4OWT B;  2F0T A;  1K8A C;  3LWE A;  1K8G A;  4LF7 L;  1Y1V H;  3H3V C;  1G8Z D;  5EJW A;  4NW2 A;  4R8I A;  2KED A;  2OQK A;  1I3Q B;  2OT2 A;  3D8G A;  5FO7 B;  4CKE A;  1I4P A;  2CHB D;  2JA7 G;  1JCK B;  4RCN A;  1TWF H;  3KBX A;  4JI8 Q;  4QCL A;  1Y8P B;  1KRS A;  3NBI A;  1XPR A;  3I4M H;  1CKO A;  3P75 A;  1F2Y A;  4XDX A;  3TME A;  3S2H H;  2RKS A;  4LFA Q;  4BY1 H;  1EIY B;  4KY7 A;  4FF4 A;  4RFB A;  1YNN C;  4DV2 L;  4IO9 A;  2VQF Q;  1D7Q A;  3NXW A;  3K81 C;  5C3W A;  3S2D B;  1B7Y B;  4M1U B;  1HZA A;  3KDF B;  4L5T A;  2OEO A;  2RDH A;  3PO2 B;  1FNU A;  4DV3 L;  2RSN A;  5M9O A;  2RHQ B;  4N8F A;  1EYG A;  3E6Z X;  1M1K C;  1A6X A;  2K5V A;  3J80 c;  1WTW A;  3S1M B;  1BOS A;  1UEA B;  4IFD H;  1KLU D;  4OHJ A;  1CA6 A;  3K7A B;  3I4M G;  1N32 L;  3S17 H;  4GNX A;  3J7A V;  2JEA I;  3NWT A;  1A0I A;  4XYQ A;  4K0K Q;  2ZT9 C;  1S5C D;  1SSO A;  1D1I A;  4YIJ A;  2ZTD A;  3VA7 A;  4DAP A;  3CCV A;  1FL0 A;  1NMG A;  5ELN A;  1HPC A;  3I4N G;  1PH3 A;  1FJG L;  1QNU A;  5IWA L;  2CQO A;  1FGB D;  4DK6 C;  4DV0 Q;  4RGM A;  2DJG C;  1B4O A;  2PO4 A;  3D6W A;  1SYB A;  5KND A;  2VXW A;  1AFP A;  1LLR D;  2F3I A;  2CQA A;  3S1Q H;  2UXB Q;  2OXP A;  4JBW A;  2QA4 A;  4C2M B;  4A3E B;  5LMN L;  1OXV A;  3UDG A;  4X3U A;  2CH4 W;  3L0O A;  2BE5 D;  5CV9 A;  4ZAI A;  1S3O A;  3J81 E;  2PMZ E;  1A2U A;  3HOZ H;  5C5L A;  1P8L A;  1QUQ A;  1PFS A;  1DON A;  4DR7 L;  3EVQ A;  4B3R L;  3QB3 A;  2EXZ A;  3I2Z A;  5M5X B;  1B44 D;  3W1G A;  3PIO 3;  4B3S Q;  3D4W A;  2QGQ A;  4NMZ A;  4QIW E;  5C4J B;  4Q5V A;  1V1P A;  3BJU A;  4OWW B;  1E7Z A;  1B8A A;  5L37 A;  5KGU A;  5GAH C;  3BDO A;  3SR1 A;  5I2Y A;  4GLA C;  3SK6 A;  3PQI A;  1YHB A;  2IX3 A;  1B9N A;  1NY4 A;  5CV5 A;  3TN2 A;  3TZD A;  1SN8 A;  5LMU L;  1XMQ Q;  1IL2 A;  1DYQ A;  2HQL A;  2Z0S A;  4XT3 B;  3VYU A;  2L55 A;  1G2T A;  1YHQ A;  1EQT A;  2Z4I A;  2TMP A;  1ET9 A;  2Q2I A;  1NMF A;  1Q1B A;  1DCZ A;  3AB9 A;  2VS1 A;  3TRZ A;  2QEX A;  4RAU C;  4Y7N H;  3ZYY X;  3V2T A;  4DUZ Q;  5J1Z A;  3G48 A;  3GTO H;  2VQE L;  2R92 B;  5F2D A;  3NBH A;  3NQI A;  3IAY A;  2F0K A;  4P71 A;  4DR4 L;  1KL9 A;  1BO0 A;  4DGZ A;  1AEX A;  5E4X A;  5K36 H;  1MGS A;  1X3G A;  4C3H H;  2JA5 B;  1VQP A;  2A6E C;  1HZ9 A;  3L2P A;  1PV4 A;  1ILP A;  3DHQ A;  5IOC A;  3EA6 A;  3QJY A;  4CBV A;  3GTM B;  4ZUI A;  4A3D B;  1J8I A;  3DWQ A;  1JWM D;  1YIT A;  2ASB A;  4IPC A;  2Q8R E;  3S9W A;  2H1E A;  1GVP A;  1EY9 A;  2HCI A;  1LAC A;  4TQU S;  1N8R C;  2AQ1 B;  4YCV A;  4KKT A;  4A3C H;  3FDT A;  2XSC A;  1WTR A;  5BR8 L;  2NBF A;  3I8Z A;  1BVS A;  2SOB A;  3J81 i;  1VQ4 A;  5C4X B;  3STB D;  3H15 A;  1JOR A;  1WD0 A;  5E1F A;  3F2B A;  5K36 G;  2E2D C;  1LAB A;  5EBC A;  2QDB A;  1VQE A;  1IBK Q;  2RVL A;  1PTO F;  3S1N B;  3J7Z C;  2L0C A;  3L7Z C;  1YJN A;  4A3E H;  1KNE A;  4OEM B;  2JSO A;  3SK5 A;  4DV6 Q;  1Z6H A;  1LUZ A;  5AFW A;  5KYL A;  4YHH L;  3S16 H;  1N33 L;  2G5D A;  4HSV A;  4OO1 I;  2K75 A;  4PZ7 A;  1BCP D;  1E2V A;  5EKL A;  1Y69 U;  1SJE D;  4CGY B;  3NEN A;  2EYM A;  3FPU B;  1XTC D;  1C9O A;  2NB0 A;  3MXP A;  1AE3 A;  1FR3 A;  3M3Y H;  2JEB I;  4JG2 A;  3U4Z A;  5C3E G;  4CKB A;  4PV1 C;  5KRU A;  4JI5 Q;  3FKI B;  1PRT D;  4ABN A;  1SRO A;  2KCC A;  2WAQ G;  3RUZ A;  1WCM H;  3AQQ A;  4LF5 L;  2KCN A;  1IBM L;  2HDL A;  4KKS A;  1VCI A;  4KHZ A;  4DF7 A;  2L12 A;  2CCZ A;  4A3G B;  1NCV A;  2B2V A;  3O13 A;  3HKZ B;  1HJP A;  4OO1 G;  3KLS X;  4DR2 Q;  1QG7 A;  1O7L A;  2N8N A;  3K5M A;  1DGS A;  4P73 A;  3CQZ B;  4GOP C;  1JC7 A;  3D3R A;  1Q1E A;  3H0G H;  4C3J G;  2JXM B;  5DM7 3;  1H9K A;  4EQP A;  4B3T L;  4KY5 A;  4DAV A;  4S3S A;  3J81 L;  1UE6 A;  2YYZ A;  4NXN L;  3F2U A;  2EVB A;  4IUP A;  1HQM C;  3K80 C;  1BQQ T;  3T53 B;  1TWH B;  4LF9 Q;  4V0B A;  2K5D A;  2B2Y A;  2K1B A;  1TR5 A;  4JI2 L;  4YWL A;  5M5Y B;  1PZK D;  1VQM A;  2OTL A;  4AQY Q;  3M7G A;  3HOX B;  2J4X A;  3AMU A;  3GTM H;  3DXJ C;  1C8C A;  5M5W H;  1JQY D;  4B08 A;  2K52 A;  5COY A;  1IYJ B;  4I7A A;  3Q8D A;  1EYC A;  3SGI A;  4LFB Q;  3BZC A;  3JC6 6;  5AJ3 Q;  1TWA H;  5D3I B;  2C5C A;  1PZI D;  3PCO B;  4GN3 B;  1ZEQ X;  1LTG D;  2ZTC A;  3KK7 A;  1AW7 A;  1J6Q A;  3CD6 A;  2TSS A;  1PFN A;  1LTB D;  2VUM G;  2J7Z A;  4A3J B;  3DWA A;  3X3N A;  4ZYS A;  3I56 A;  1VMC A;  4RHS A;  4XT1 B;  2IX1 A;  2Q2T A;  1N36 Q;  5JJZ A;  4JBM A;  5G3L F;  1DOL A;  1JR0 D;  5C0X J;  1JB7 A;  3K5N A;  1I4R A;  3SEB A;  4LW1 A;  4LMQ D;  1GOZ A;  1ET6 A;  2SNM A;  5ELO A;  2KCT A;  1CHP D;  1NTG A;  4Q0F A;  4DV5 L;  1OXT A;  1YJW A;  1C48 A;  1Q12 A;  2A68 D;  1HH2 P;  4UPA A;  4TVA B;  5COR A;  1J5E Q;  4IJL A;  1GUT A;  1SMY D;  4M8A A;  4JI6 L;  1AZQ A;  1SYD A;  1EIG A;  3KJO A;  3JAM i;  1A63 A;  2GN5 A;  3HOV B;  4DR5 L;  2F3W A;  3BVZ A;  2JA6 H;  5IGE A;  2NUC A;  1T5E A;  2ZJR A;  3RZO H;  5FLM G;  1IL8 A;  1G51 A;  5EGT A;  5M3F G;  4UAI A;  4A3G H;  1RDP D;  1PH9 A;  5J39 A;  1HUN A;  4BBR B;  4KN4 C;  4X64 Q;  1V8Q A;  3BDL A;  4LF8 L;  3HOW B;  4LF4 Q;  2F0G A;  2E8G A;  1IXR A;  3NWS A;  2DNC A;  3CCS A;  1YNX A;  2B63 B;  4FP5 D;  2XIW A;  4JYA Q;  2AQ3 B;  3CPF A;  3WWV A;  1QCB D;  4A3M B;  3PO3 B;  2R3Z A;  1MJE A;  1H9M A;  1EQV A;  1IW7 D;  2CH4 A;  1QJO A;  1EIF A;  2JA6 G;  2BA0 A;  2H4O A;  2PQA A;  2DNE A;  1EY5 A;  2A69 C;  2BH8 A;  3NE5 B;  1FNV A;  4JI0 Q;  1LYL A;  1VQF A;  2FMC A;  2G9D A;  4UP8 A;  4GKK L;  1E2W A;  2CKZ B;  2MUY A;  3IL8 A;  3E9I A;  1C0A A;  4UP9 A;  4X65 Q;  3Q0A A;  4RHR A;  4QMG A;  3TSS A;  3A8J E;  2F1M A;  1K8M A;  2EIF A;  2D2C C;  1UAP A;  3IFD A;  2J0T D;  4O42 A;  2UUC L;  1LT3 D;  1ASY A;  3HEJ A;  1B3Q A;  4HAE A;  2N78 A;  1E3P A;  3CC7 A;  3J80 L;  5JPM C;  3ERO A;  1NSN S;  1VQC A;  1OO9 B;  4QQB X;  3NPP A;  4O2D A;  1A3U A;  1YVC A;  2Z6K C;  1EY7 A;  2SEB D;  4MN3 A;  5IP7 G;  1B2T A;  5CC4 A;  1BBW A;  1KNA A;  3Q6S A;  1MSH A;  2K01 A;  2WP8 J;  4K8J A;  4C3I G;  1SXT A;  2ALY B;  3EBE A;  3OOC A;  2EYJ A;  2UUB L;  4F7X A;  4YY3 Q;  1HR0 W;  3W5O A;  3CU7 A;  1PFB A;  2ID0 A;  5JJK A;  4K2L A;  1KIX A;  3TQY A;  1D8L A;  1STN A;  2PNH A;  1VQ8 A;  4DV1 L;  1EEI D;  2HDM A;  4APV A;  5CBE E;  5IGG A;  3OMG A;  1BCP B;  2VB3 X;  1KRT A;  4O1N A;  4CDC C;  5JEA G;  1PH8 A;  4A3K B;  2K5N A;  1I50 H;  3F8T A;  4UP7 A;  1PH4 A;  1PVO A;  1TWG H;  1VMP A;  2M9V A;  1HXY D;  1IYU A;  1XNR L;  1DOK A;  4QUC A;  4IOC A;  2NVY H;  5IYC G;  5C0X H;  1D2B A;  1S5B D;  3T51 B;  1PRT B;  1PYW D;  5JJL A;  3H94 A;  3ULL A;  5JVG 3;  2UXD L;  1XJV A;  1PFM A;  2KBN A;  5GAG C;  4NXM L;  2A73 B;  5H1S E;  3T56 B;  1WD1 A;  2D0O A;  1S5F D;  4KK7 A;  4A76 A;  3I4N B;  1X55 A;  4MIU A;  4A3B B;  3C1F A;  2B8G A;  4GN4 B;  1SDF A;  1U4L A;  2K14 A;  1Y1W B;  2QF7 A;  3PF5 A;  4POG A;  1XNQ L;  3K8A A;  3S15 B;  4A3M H;  3HKS A;  2V4D A;  3CMA A;  1AN8 A;  4RH6 A;  3CCU A;  1LT4 D;  3BDC A;  2F0F A;  5I6W A;  1BNZ A;  5C0X G;  2HD3 A;  1A2T A;  1KC8 C;  1UEB A;  1PLF A;  1MD2 D;  4FYD A;  2B8F A;  4XQN A;  1YBY A;  4A3F G;  1BXT A;  1JT8 A;  1OXS C;  4YCU A;  2YU9 H;  2KA7 A;  1RIP A;  3OIQ A;  2I5H A;  2VL6 A;  2VNU D;  1VQN A;  4GNX C;  4P74 A;  2P5Z X;  2CFM A;  4WJ4 A;  3VA5 A;  4BA2 I;  1PYS B;  1G91 A;  4JPB W;  2SNS A;  4ZQ3 A;  1PH2 A;  2Q8T A;  3H3V I;  2D0P A;  1E1T A;  3T4A C;  3VYS A;  3CC4 A;  2PI2 E;  3HGB A;  2PI2 A;  3KYH C;  1TS2 A;  1KTK A;  1RD9 D;  4JI1 L;  5JJI A;  4N8X 1;  1MI2 A;  3G4S A;  1SR3 A;  4KN7 C;  2YTX A;  2FIN B;  4G7Z C;  1KAB A;  4ME3 A;  5EQ0 A;  4UY8 C;  2HT1 A;  2F4V Q;  1S5E D;  1GUS A;  4A93 B;  2PYK A;  3HOU H;  3M4O B;  2Y0S G;  2R93 H;  2F0O A;  2Z6B A;  2K5H A;  3MTS A;  1SRU A;  5M3M H;  4IAL A;  2BDN A;  1Z47 A;  3STB C;  5ISR A;  3SE0 A;  1I5F A;  1ROD A;  3MFY A;  4KHP Q;  1Q86 C;  3LWU A;  2FJ2 A;  3BVG A;  2RF4 A;  2ZXR A;  1LTI D;  4KV6 A;  2F0D A;  1Y8O B;  1VS0 A;  1SBB B;  3T1H Q;  1TWC H;  4ZKB B;  4OWX B;  2DJF C;  5IYD G;  3HOY G;  1SYG A;  1L0X B;  1Y1V G;  1CTM A;  4K0K L;  2F03 A;  3HOU G;  2E76 C;  2MFI A;  1X3Q A;  2OWO A;  2NVQ B;  4ZK9 B;  4QUF A;  3U50 C;  4IFD I;  4PZ8 A;  1I6H B;  4HCS A;  4DV0 L;  4DR3 L;  2DY7 A;  1F9R A;  3DM3 A;  1BBX C;  3WOF A;  3RR5 A;  4DAY B;  4BY1 G;  4A3B H;  2NVT B;  1SE8 A;  1RF2 D;  2UXB L;  5C44 B;  4PQX A;  4Z9C B;  3S14 H;  4K14 A;  1VQD A;  3NEM A;  1B70 B;  2PW5 A;  2EJM A;  3S15 H;  4JI4 L;  2LKV A;  3EQL C;  3H91 A;  5EPK A;  3IFT A;  3VR6 A;  1PH7 A;  2PPB C;  4JK1 C;  4X6A H;  4RGT A;  2LFN A;  4GKJ Q;  1X3F A;  4B3S L;  2ZJQ A;  1MSG A;  1MKH A;  4IFD G;  3VYT A;  2KHS A;  3SHL A;  3CME A;  4K6D A;  4QGU A;  2BOS A;  1MHW C;  2EJG C;  2N88 A;  2WAQ B;  4KI0 A;  2RA4 A;  1HUM A;  5CV6 A;  2LSS A;  1PMR A;  2R7Z H;  1HNX L;  2AWN A;  3CP0 A;  3KUP A;  1NE3 A;  3AFP A;  2K04 A;  3IKJ A;  1VQA A;  1W6K A;  5DNF A;  1XPO A;  1CKN B;  2JQO A;  5IWA Q;  1Z7T A;  4K5W A;  1KDC A;  4A93 H;  1SNP A;  5A2Q L;  1AH9 A;  1YEZ A;  3M4O H;  1I3Q H;  3PMF A;  3T13 A;  4C3J B;  1EOV A;  4HED A;  2WAC A;  2X6L A;  4JV5 Q;  1X65 A;  3HOZ G;  4AYB B;  3D4R A;  1HCZ A;  1CSP A;  3GTJ B;  5I4D A;  2ZXP A;  2D9U A;  3E0E A;  2A19 A;  3GP7 A;  4ZLT F;  5I6Y A;  1IYV A;  2IHE A;  2AUJ D;  5ELD A;  3OHX C;  2R7Z G;  4NKL A;  1RHP A;  1PA6 A;  1HA5 A;  2UXC Q;  3GQB A;  1M90 C;  3CKI B;  4DR7 Q;  4B3R Q;  5LL6 S;  3MXG A;  3IRB A;  1KHI A;  3S2D H;  3PO2 H;  4EGV A;  5D3D A;  5ELF A;  3GTL B;  1LTS D;  4CDE C;  3L9A X;  3I70 A;  1R4Q B;  2DN8 A;  5E7N A;  1PTO B;  3S1M H;  2F4I A;  3W1B A;  5IGB A;  2B2V C;  2JYO A;  3MZ5 A;  1I6H H;  3SVM A;  5IT9 E;  5LMN W;  3K7A H;  2EY6 A;  1LO5 D;  3K58 A;  3PIP A;  1L2F A;  1CM9 A;  4KKU A;  3K6O A;  3GTP B;  3I91 A;  1IBK L;  5ELC A;  3CCM A;  2NVT H;  1K3B C;  2DUD A;  4L5Q A;  1YHA A;  5CV4 A;  5C44 H;  4RG1 A;  2VUM B;  1SAP A;  1BF4 A;  2F0S A;  1HNW Q;  2MQH A;  4DV6 L;  3GO5 A;  1N34 Q;  3PO2 G;  3GTK B;  2WB1 B;  2VQE Q;  1EEF D;  2K05 A;  2CW0 D;  4C3H G;  2AKW B;  2PCF B;  1TS3 A;  2F0H A;  1TY0 A;  3ND9 A;  2B2Y C;  4ZKC B;  2XRS D;  2SDF A;  4C2M H;  4NPS A;  4YCW A;  4JI5 L;  4WOR A;  2L11 A;  1YNJ C;  1C4Q A;  1E1O A;  1RCV D;  2WIN B;  1ENF A;  1SE2 A;  3X3M A;  4DV4 L;  3Q22 A;  1ICF B;  1XPU A;  5CMD A;  1XYI A;  3K5O A;  2IHF A;  1UUP A;  1IBL Q;  4HCE A;  3J7A 5;  4BXX H;  1IW7 C;  5LL6 X;  4A3C G;  4JOI A;  5M5X H;  5CV8 A;  1RTN A;  2F0L A;  1KD1 C;  1SFO B;  1EY6 A;  1BR9 A;  2K28 A;  3KLW A;  5M3F B;  2B2U A;  1A8V A;  5C4J H;  4HIM A;  3QIA A;  5FKA C;  5BR8 Q;  4FVM A;  1O78 A;  4B9W A;  4JI7 Q;  1VQJ A;  1VQL A;  4DR6 L;  3FEW X;  2K03 A;  2JN4 A;  4XTC S;  3HP3 A;  4FF2 A;  2IY5 B;  4DR1 Q;  4A3E G;  1DD2 A;  1LT5 D;  3DEP A;  1WFQ A;  3VR2 A;  4A3I B;  1EL0 A;  1V1O A;  3FP9 A;  3E5S A;  2CWP A;  3MXU A;  3J80 E;  1VF5 C;  5IGC A;  3KDF A;  2BDO A;  3OWE B;  4G4K A;  4L5S A;  1E24 A;  3BVM A;  1U5K A;  3K57 A;  2HIV A;  4R4I A;  2HQE A;  1BBU A;  1GUO A;  1II3 A;  4XIG S;  4DFA A;  3F2C A;  2FFK B;  1N33 Q;  1SMX A;  4B3M L;  2R92 H;  2EYH A;  1WJJ A;  2B29 A;  5C3X A;  5JPN C;  5KIX A;  4G7O C;  1CHQ D;  3QOL A;  2RHS B;  4X62 Q;  4LFB L;  2E5L Q;  1WCM G;  2MJ8 A;  4IPD A;  3VR5 A;  2ICE C;  4H44 C;  2JA5 H;  2IL8 A;  2K33 A;  2QDL A;  2JA8 B;  1I4H A;  1OXX K;  1TY2 A;  3ICE A;  1Q8K A;  1WTV A;  1U0L A;  5I9O A;  4R9W A;  4DPG A;  3QR8 A;  5FOB B;  1RJT A;  4NB3 A;  1PXU A;  4MHE A;  3TP7 A;  3NTK A;  2VW9 A;  1J9O A;  2K4K A;  3CF5 A;  4A3D H;  4HJ9 A;  4DNT B;  1EU3 A;  3CRL C;  3Q24 A;  2LXJ A;  1N36 L;  3H0G G;  2RQX A;  3RLF A;  1GM5 A;  1QVF A;  2DY8 A;  5C4X H;  1B9M A;  3W3A A;  4NDX A;  1XXG A;  4BBS B;  3MEH A;  3TZU A;  3F2D A;  2E2I B;  1KXL A;  4B3T Q;  4C3I B;  3M85 A;  1HFG A;  4OIK A;  1EU4 A;  2WAQ E;  4FXD A;  1GHJ A;  3OWF A;  4DK0 A;  1L0Y B;  3BG3 A;  2KEN A;  4OX9 L;  1J5E L;  3S1N H;  2RCF A;  2IWH A;  4JI3 Q;  1GUN A;  5IOD A;  2JK8 A;  3PSI A;  1KQS A;  4A3D G;  3AYH B;  4IQZ A;  4G57 A;  4PMB A;  1HFN A;  1WTH A;  2A6H C;  1HZB A;  3E3X A;  4MNO A;  5IP9 H;  4LNQ A;  1CKN A;  1LTT D;  2RDG A;  3H6M A;  3MEF A;  3J80 i;  3EN2 A;  4KJO A;  5D14 A;  5EBD A;  3OW2 A;  5IT9 L;  1YJ9 A;  5E3F A;  2MP1 A;  4X64 L;  4DAM A;  3F1Z A;  4EQN A;  5C6A A;  4AYB E;  4DNR B;  4LF4 L;  2HUG A;  3FKI H;  4GLX A;  1L1O B;  3MC0 B;  1SJH D;  2A6E D;  1OXU A;  1V43 A;  2X6G A;  1HZC A;  3K7U C;  3MXN B;  2WII B;  1K83 B;  1F2Z A;  2XN9 C;  1AZP A;  4DU9 A;  3OSO A;  2O2L D;  4ILW A;  2O5I C;  4HMJ A;  3TS2 A;  2F0I A;  3I7F A;  5IIF A;  1JIC A;  2D5D A;  1EFI D;  3RN2 A;  2X69 A;  1X3E A;  4J15 A;  1AE2 A;  1SLJ A;  4L8J A;  5FJ8 H;  2ZM6 L;  4JI0 L;  3I4O A;  4RA8 A;  4DV7 Q;  1C7Y A;  1S4Z A;  5KYI A;  3R3O A;  3CQZ H;  3RLN A;  2ENB A;  3D31 A;  2F0V A;  3QOJ A;  4HSP A;  3CAM A;  3C1E A;  4TKO B;  2KJX A;  4BY7 B;  2NWG A;  4A3F B;  2V1C C;  3R2T A;  2F52 A;  1X54 A;  1O7I A;  2NN6 H;  1MBY A;  1H9R A;  2PZT A;  5I9P A;  1QE6 A;  3I3C A;  4JI6 Q;  1M8A A;  3D4D A;  1TVX A;  2XNA C;  1F77 A;  1CUK A;  1HQR D;  1TWH H;  2O4X A;  1U4M A;  4A3G G;  3BZD B;  2PW7 A;  4HIK A;  3URY A;  2ZTE A;  5M5Y H;  2NVX B;  2Z4H A;  2WB1 E;  2PZW A;  3HKZ G;  4LF6 Q;  2IX0 A;  5BN5 A;  3N6R A;  3HOX H;  5GRO A;  3S1R B;  5FJ8 G;  4XYO A;  3ULP A;  3U9O A;  1ONL A;  4CDF C;  1GD7 A;  5CBA E;  1HR0 Q;  1LM0 A;  3ERS X;  2AWO A;  2K7V A;  3BU2 A;  1HTP A;  4LF8 Q;  2CWA A;  2RSO A;  3PV0 A;  3EIV A;  5CYU A;  1HNZ L;  3GTG B;  2Y0S B;  3Q23 A;  1GHK A;  4KHV A;  3P7J A;  3CXC A;  2JA7 B;  1VQI A;  3GV6 A;  2HCC A;  1JJC B;  1V1Q A;  2XTI A;  4FF3 A;  4A3J H;  1EWI A;  4HIO A;  1EQQ A;  2UU9 L;  1DM0 B;  1QZG A;  4F8M A;  2F0J A;  4HJ5 A;  1UE7 A;  1JE5 A;  1Y14 B;  1PH6 A;  3HOX G;  3V05 A;  1A3T A;  3G6E A;  2NZ1 D;  2NZH A;  1WTP A;  1QNK A;  4QY7 A;  4GKK Q;  3CRK C;  3A0J A;  5FLX c;  5HGT A;  2AMC B;  1F9S A;  1JE4 A;  1Y1V B;  3QO2 A;  1WTO A;  1BKB A;  4JCV E;  1K73 C;  3WDN A;  3UDX A;  1CZG A;  2F0E A;  3ER0 A;  4GLV B;  4ID6 A;  4DA2 A;  4FF1 A;  1SYE A;  5BN3 A;  1L0W A;  3KLR A;  3ZJY C;  4LUV A;  3J81 c;  1TWF B;  3HOV H;  4KY6 A;  4A3J G;  1PTO D;  3NEL A;  5FO8 B;  2F3V A;  3I4M B;  1RTO A;  4UDU C;  3LX0 A;  5C0X I;  3A74 A;  3S2H B;  2BE5 C;  1I94 L;  3HFZ B;  3CHB D;  3HG9 A;  3SXH A;  2AUK A;  2KHJ A;  4KTA A;  1IZ6 A;  4DNI A;  4KLK A;  1D6E C;  2EY5 A;  4BBR H;  5CGK A;  1U4R A;  2KEE A;  3I73 A;  5JOB A;  3GTQ B;  3HOW H;  1N9W A;  1K0S A;  4P2C B;  3SK8 A;  2UUB Q;  1K9M C;  2B2T A;  2F0U A;  4R4Q A;  3BZK A;  3OTO L;  1WTQ A;  2B63 H;  3M4P A;  5A2Q E;  1I4Q A;  3T1Y Q;  1LTL A;  2XWJ B;  2YTY A;  1XMO L;  1H9J A;  3M9B A;  3UI2 A;  3PO3 H;  4DV1 Q;  3VDY A;  1UNS A;  1A3V A;  3S17 B;  3T16 A;  4DUY L;  4DKA C;  1RL2 A;  1TQO A;  3RLO A;  3RNU A;  4IJH A;  1G6P A;  1PDQ A;  1XNR Q;  1E2Z A;  1ENC A;  1BCP F;  2Z1C A;  4LK1 C;  3PGZ A;  2HHH Q;  2F4V L;  4K5V A;  3HZX A;  2I5M X;  5HUR A;  2B2W A;  4J6H A;  1SNO A;  4NXM Q;  3TP8 A;  3CC2 A;  4KD3 A;  3MFG A;  4P72 A;  1YIJ A;  3PUV A;  1NJI C;  5HY6 A;  1PRT F;  3C46 A;  1TKW B;  4JI8 L;  4A3M G;  5KNC A;  1M4V A;  4RKB A;  4TSS A;  4KHP L;  2JA7 H;  3DM1 A;  3GDE A;  1B3A A;  1KDA A;  4LFA L;  4IZ8 A;  1XNQ Q;  1K0R A;  5GAE C;  1NAP A;  3I4L A;  2VQF L;  3HOZ B;  1EZ8 A;  1IKM A;  2EXD A;  1Z9F A;  1EFW A;  2UUA Q;  3H3V H;  2BH2 A;  1CT1 D;  2IPK D;  1CQV A;  1IHZ A;  1F9P A;  4PMC A;  1HHV A;  2EYF A;  1LTR D;  1SND A;  4O0A A;  1L1O A;  2LXK A;  4L6T B;  4DN4 M;  3MXN A;  3KFU A;  3BS1 A;  2M2L A;  1CKM A;  3ONA B;  4DK3 C;  2E2H B;  1GUW A;  3G71 A;  4CDD C;  1R4P B;  1EQR A;  2EOT A;  2CW0 C;  4POF A;  4X66 Q;  3J7Y W;  2EPB A;  3S24 A;  1I4G A;  1Q3L A;  3DMU A;  2K32 A;  5IY0 A;  4C1N K;  2MO0 A;  2E74 C;  4A3K H;  2KEC A;  3PUY A;  2M00 A;  2GVB A;  2A69 D;  4LFC Q;  1WTX A;  1STG A;  3TDQ A;  4JI1 Q;  4X3T A;  4YWK A;  2A5H A;  5G3L D;  2F0W A;  2C9O A;  4MZ9 A;  2HIX A;  2O5J C;  2KVM A;  2R93 G;  1TII D;  1BCP C;  4LF7 Q;  1ZYR D;  5M3M G;  4IOA A;  3FVQ A;  1FYC A;  4Y7N B;  3DLL A;  3GTO B;  3DEO A;  2R61 A;  2RBM A;  2EQS A;  5CR3 A;  1GO3 E;  4GKJ L;  3GV3 A;  3GTQ H;  2I07 B;  3I4N H;  4OGQ C;  3PUZ A;  3R8B A;  1Q90 A;  1PRT C;  5GQO A;  4C3H B;  4DXG A;  1EUJ A;  1EZ6 A;  3AU7 A;  1Y1W H;  1UWV A;  4L63 B;  3PIP 3;  4A3K G;  1QOH A;  2N55 A;  4DV2 Q;  2D62 A;  1WYD A;  4CJ0 B;  2ATW A;  4JW0 A;  1STE A;  1STH A;  3JAM c;  2A1A A;  2K50 A;  1U4P A;  3ITP A;  4DV3 Q;  1HRJ A;  2Y0S E;  1K28 A;  4TRD A;  5J22 A;  1JB3 A;  5CV7 A;  1B1Z A;  4IUU A;  4H02 A;  1EWH A;  1HTL D;  4A3B G;  4ULL A;  3MHB A;  3EJI A;  1WOC A;  1CI3 M;  4JVZ A;  4LWC A;  5C3E B;  3EFX D;  2JP1 A;  3D0F A;  1Q82 C;  2K6A A;  1N32 Q;  4DR3 Q;  4H13 C;  1W3S A;  2KCM A;  1Y1W G;  1XMQ L;  1RKN A;  1F2L A;  3OYY A;  5FLX E;  3RZD B;  5FK9 C;  3J7A F;  1Q7Y C;  3MA2 B;  3R93 A;  4JV5 L;  1G29 1;  4MTN A;  2VY3 A;  3E9H A;  1VQH A;  3UE1 A;  3KLS A;  1W6J A;  4LJZ C;  1KLG D;  5ELE A;  1G6Z A;  4JI4 Q;  2PNR C;  3S16 B;  1FJG Q;  4FDB A;  1A62 A;  1TS5 A;  4DUZ L;  4GN5 A;  2UXC L;  1VQ9 A;  2NYZ D;  3TBI B;  3KF6 B;  3AFQ A;  4F87 A;  1MIU A;  3NK9 A;  3M3Y B;  5DEH A;  1JWU D;  5LMN Q;  1EY0 A;  4CKC A;  1G2S A;  3A5U A;  2E2H H;  1AP0 A;  3RD4 A;  1WCM B;  2PZU A;  2LS0 1;  2CVR A;  2R7D A;  4JOI C;  2H5X A;  3P20 A;  2EYO A;  3FPP A;  4FXG C;  1B53 A;  1T5X D;  4GOP B;  3OPO A;  4HMI A;  2B2U C;  3E0J A;  4UHV A;  1KAW A;  1D5M C;  2YV5 A;  1HNX Q;  1ZXT A;  4X3S A;  1Y8N B;  2EY2 A;  5IGF A;  5T1G A;  4A93 G;  1TT2 A;  1HNW L;  1B50 A;  3KF8 B;  3HS0 C;  1FD7 D;  1N34 L;  2NVQ H;  1SEB D;  3H0G B;  2A68 C;  5JAV A;  3U4V A;  3UDI A;  3R2I A;  1CSQ A;  1ESF A;  1VQO A;  5LMU Q;  1SMY C;  3MVV A;  1UE1 A;  2L9H A;  4XXE A;  4BWG B;  3A55 A;  3U9S A;  4BS9 A;  1OTC A;  3D6C A;  4JC0 A;  4R8N A;  1X3P A;  3L3O C;  4XQJ A;  4G7H C;  3TRE A;  3M7N A;  1PH5 A;  1X6O A;  1O7Y A;  2C35 B;  4JBK A;  2QCP X;  1I4X A;  1IBL L;  5M5W B;  4PNY A;  2QEJ C;  1JOQ A;  4DR4 Q;  5I2X A;  1ENA A;  4OON A;  5IE8 A;  2PQA B;  2FMM A;  3M4Q A;  2A8V A;  1TWA B;  2Z9H A;  1SE3 A;  3M4Y A;  1PHJ A;  2L1B A;  4JI7 L;  4PZ6 A;  4EX5 A;  2KHI A;  1DJR D;  4J8Q A;  5C3E H;  4DR1 L;  5C44 G;  1W2B A;  4IUN A;  1I6V C;  1YNN D;  1QVG A;  3A8K E;  1VF7 A;  1VDZ A;  3RZD H;  4YWM A;  1VQK A;  4NP5 A;  4PG3 A;  1MJC A;  3MWY W;  1CK1 A;  4HJ7 A;  3NP8 A;  2ES2 A;  4DR2 L;  1JJ2 A;  3PIO A;  2EDG A;  3J81 j;  4Y52 H;  4GZY C;  3DWP A;  5DM6 3;  3A7A B;  1D5Z C;  4OO1 H;  2MHV A;  2Q2H A;  3I90 A;  2F0N A;  2NTS A;  3K0X A;  4BA1 I;  3TS0 A;  2EZV A;  4X62 L;  1XX8 A;  2E5L L;  4C3J H;  1QIL A;  3A54 A;  4IN3 A;  5C5M A;  4QL5 A;  2K5Q A;  4DXF A;  5GAD C;  4LF9 L;  4BXX G;  3GTJ H;  4RGN A;  4DV4 Q;  2JA6 B;  2F0M A;  2WFW A;  4YHH Q;  3LGJ A;  3RZO B;  1YZ6 A;  4AQY L;  3GD7 A;  1X32 A;  3KOJ A;  5EPJ A;  1S72 A;  2E2J B;  2NTT A;  3BYT B;  4DAY A; 
#chains in the Genus database with same CATH homology
 1H95 A;  2WB1 E;  5GAH C;  3HKZ G;  4LF6 Q;  2IX0 A;  5AJ3 L;  2PI2 E;  3HOX H;  5GRO A;  3CC4 A;  4GLA C;  5IYB H;  2PI2 A;  1YHB A;  5FJ8 G;  4IPH A;  3ULP A;  3GTL H;  3KYH C;  1NY4 A;  1GD7 A;  4JI1 L;  5JJI A;  1HR0 Q;  4DR6 Q;  1SN8 A;  3G4S A;  3CCR A;  1SR3 A;  5LMU L;  1LM0 A;  2YTX A;  1ASZ A;  1XMQ Q;  1IL2 A;  3ERS X;  2AWO A;  4LF5 Q;  3BU2 A;  1IBM Q;  4ME3 A;  4LF8 Q;  2HQL A;  2Z0S A;  2CWA A;  4UY8 C;  2HT1 A;  2F4V Q;  1YHQ A;  4AYB G;  3PV0 A;  1TXY A;  1K3R A;  3EIV A;  3GTP H;  1JMC A;  1HNZ L;  3HOU H;  1UE5 A;  2Y0S G;  2R93 H;  3PUW A;  2Q2I A;  1NMF A;  1Q1B A;  2K5H A;  1SRU A;  4JI3 L;  3CXC A;  3TRZ A;  2VS1 A;  5M3M H;  1VQI A;  2QEX A;  4Y7N H;  1JJC B;  2VUM H;  1V1Q A;  2XTI A;  1Z47 A;  5JEA J;  5HGQ A;  1EWI A;  3G48 A;  2VQE L;  4DUZ Q;  4HIO A;  3ULJ A;  2B3G A;  3STB C;  4A3J H;  1EQQ A;  2R92 G;  1I5F A;  3CCJ A;  2ZJP A;  2I5L X;  4P71 A;  2UU9 L;  1QZG A;  4DR4 L;  1KL9 A;  1Q86 C;  4KHP Q;  4HJ5 A;  1UE7 A;  2RF4 A;  1JE5 A;  1Y14 B;  3GTK H;  1PH6 A;  3HOX G;  4B3M Q;  3G6E A;  5IYB G;  1X3G A;  2NZH A;  4C3H H;  2JA5 G;  1VQP A;  4QY7 A;  1VS0 A;  4GKK Q;  2AHO B;  3T1H Q;  3A0J A;  1TWC H;  1HZ9 A;  4OWX B;  5IYD G;  3L2P A;  1PV4 A;  4NXN Q;  5FLX c;  3HOY G;  2AMC B;  4PMW A;  3CCQ A;  1Y1V G;  4K0K L;  1BKB A;  4JCV E;  4WJ3 M;  1K73 C;  1YIT A;  3UDX A;  4GLV B;  3ER0 A;  4JBJ A;  2ASB A;  3HOU G;  2MFI A;  1VQG A;  4IPC A;  4JI2 Q;  2OWO A;  1L0W A;  1GVP A;  3ZJY C;  4LUV A;  3U50 C;  3J81 c;  4IFD I;  4TQU S;  4PZ8 A;  1N8R C;  4YCV A;  3HOV H;  4A3J G;  4A3C H;  3NEL A;  4DV0 L;  5BR8 L;  3J81 i;  1BVS A;  3KF6 A;  1VQ4 A;  5C4X G;  3STB D;  4DR3 L;  5C0X I;  3H15 A;  3A74 A;  3DM3 A;  1GKH A;  2I0Q A;  3RR5 A;  1I94 L;  4DAY B;  5FLM H;  1SFO H;  3PF4 A;  4BY1 G;  4A3L H;  3HFZ B;  4A3B H;  5M3F H;  3F2B A;  1SE8 A;  2WB1 G;  2MNA A;  2UXB L;  5K36 G;  1PH1 A;  3S14 H;  2NZO A;  4DV7 L;  2KHJ A;  2VZA A;  2Q2U A;  1IZ6 A;  2JE6 I;  1VQE A;  4KLK A;  4DNI A;  1VQD A;  3NEM A;  4BBR H;  3I55 A;  1IBK Q;  1B70 B;  3J7Z C;  3S15 H;  4JI4 L;  3L7Z C;  4ALP A;  1N9W A;  3UDF A;  1YJN A;  3HOW H;  4JYA L;  4A3E H;  1PH7 A;  2GVA A;  2UUB Q;  1K9M C;  5EAY A;  4X6A H;  4GOP A;  4A3I H;  4R4Q A;  4DV6 Q;  1P16 A;  1LUZ A;  4OX9 Q;  3BZK A;  4GKJ Q;  3OTO L;  2B63 H;  4LUZ A;  1X3F A;  3M4P A;  5IP9 G;  4YHH L;  4LUO A;  3S16 H;  4AIM A;  3T1Y Q;  1N33 L;  4B3S L;  1LTL A;  1T9H A;  2YTY A;  2ZJQ A;  4OO1 I;  1MKH A;  2K75 A;  4PZ7 A;  4IFD G;  1XMO L;  3M9B A;  3PO3 H;  4DV1 Q;  3VDY A;  3NEN A;  1FGU A;  3CME A;  4L5R C;  1C9O A;  5DLQ E;  3U58 A;  4X65 L;  3CCL A;  1AE3 A;  4QGU A;  4DUY L;  3M3Y H;  4DKA C;  4DV5 Q;  4LF6 L;  4A3L G;  1RL2 A;  3RLO A;  3RNU A;  4IJH A;  2JEB I;  4JG2 A;  3U4Z A;  5C3E G;  4HJA A;  1G6P A;  4JI5 Q;  3FKI G;  2NN6 I;  1XNR Q;  1HR0 L;  2E2J H;  1SRO A;  2WAQ G;  3A5Z B;  1WCM H;  4KI0 A;  3AQQ A;  4LF5 L;  2R7F A;  2LSS A;  1IBM L;  3PGZ A;  2R7Z H;  2HHH Q;  1HNX L;  1VCI A;  4KHZ A;  2AWN A;  3CP0 A;  2F4V L;  2I5M X;  2JA8 H;  2CCZ A;  1NE3 A;  4DR5 Q;  3AFP A;  4A3I G;  4NXM Q;  1VQA A;  3CC2 A;  3TEH B;  4P72 A;  1YIJ A;  3PUV A;  1NJI C;  1XPO A;  5HY6 A;  1CKN B;  2JQO A;  1HJP A;  5IWA Q;  4JI8 L;  4A93 H;  4A3M G;  4OO1 G;  1AH9 A;  1WI5 A;  1E22 A;  1YEZ A;  2OCE A;  3M4O H;  4DR2 Q;  1I3Q H;  2N8N A;  2IT1 A;  1DGS A;  4KHP L;  4P73 A;  2JA7 H;  4GNX B;  3GDE A;  3UE0 A;  4GOP C;  1EOV A;  1Q1E A;  3H0G H;  4LFA L;  1XNQ Q;  1K0R A;  2L15 A;  5GAE C;  2ZM6 Q;  4JV5 Q;  2OQ0 A;  2VQF L;  4B3T L;  1X65 A;  5IP7 H;  3HOZ G;  4YY3 L;  1CSP A;  2EXD A;  1Z9F A;  1EFW A;  2NN6 G;  2UUA Q;  1UE6 A;  3H3V H;  2BH2 A;  4BBS H;  2JJQ A;  2YYZ A;  4NXN L;  3B6Y A;  3E0E A;  2A19 A;  2E2I H;  3GTO H;  2IHE A;  3K80 C;  4C3I H;  2R7Z G;  4O0A A;  1PA6 A;  2UXC Q;  1L1O A;  2LXK A;  1M90 C;  4LF9 Q;  2JA8 G;  4DR7 Q;  4B3R Q;  3IRB A;  2YTV A;  2BA1 A;  1KHI A;  3CW2 C;  3KFU A;  4JI2 L;  4YWL A;  1CKM A;  3S2D H;  4DK3 C;  1VQM A;  3PO2 H;  3G71 A;  2OTL A;  4AQY Q;  1EQR A;  4A4I A;  4POF A;  4X66 Q;  3GTM H;  5M5W H;  3S24 A;  2K52 A;  1IYJ B;  2OTJ A;  3Q8D A;  3SGI A;  5E7N A;  4OXP A;  1Q46 A;  3BZC A;  5IY0 A;  3S1M H;  4LFB Q;  2N49 A;  3JC6 6;  2MO0 A;  3W1B A;  4A3K H;  2RCN A;  5AJ3 Q;  3PUY A;  1TWA H;  1I6H H;  1FVI A;  5J3B A;  2GVB A;  5LMN W;  4LFC Q;  3K7A H;  3PCO B;  1QUQ B;  1VQB A;  4JI1 Q;  4YWK A;  3PIP A;  1L2F A;  4MZ9 A;  4GN3 B;  2DGY A;  5IYC H;  2HIX A;  1IBK L;  2R93 G;  2ZTC A;  4BBS G;  3CCM A;  2UUC Q;  1X9N A;  2DUD A;  2NVT H;  4L5Q A;  1J6Q A;  2XGT A;  1YHA A;  4LF7 Q;  3CD6 A;  5M3M G;  5C44 H;  4RG1 A;  4IOA A;  3DLL A;  2VUM G;  3RN5 A;  2JA9 A;  1HNW Q;  2R6G A;  2MQH A;  3I56 A;  3GO5 A;  4DV6 L;  2N3S A;  1HNZ Q;  2EQS A;  4GKJ L;  1GO3 E;  4IFD J;  1N34 Q;  2IX1 A;  3GTQ H;  1K83 H;  2Q2T A;  1N36 Q;  4JBM A;  3T1Y L;  3I4N H;  3PO2 G;  1QZH A;  3PUZ A;  5C0X J;  1JB7 A;  2VQE Q;  5GQO A;  1QVC A;  2AKW B;  4LW1 A;  2UU9 Q;  1EUJ A;  3HKZ E;  1Y1W H;  1L1O C;  1UWV A;  5ELO A;  2KCT A;  4HID A;  1NTG A;  4AH6 A;  4DV5 L;  4A3K G;  1OXT A;  4DV2 Q;  2D62 A;  1YJW A;  4C2M H;  3PUX A;  4NPS A;  1Q12 A;  4UPA A;  1HH2 P;  1WYD A;  4YCW A;  4JI5 L;  3FHW A;  4TVA B;  1VQ6 A;  1E1O A;  4R4C A;  2ATW A;  1R9T H;  3JAM c;  1XTD A;  1J5E Q;  4IJL A;  4DV4 L;  2MO1 A;  1XPU A;  1YI2 A;  2A1A A;  2K50 A;  4JI6 L;  3KJP A;  2IHF A;  2HHH L;  3KJO A;  1PYB A;  4DV3 Q;  3JAM i;  1IBL Q;  1VQ5 A;  4BY7 H;  4GS3 A;  2GN5 A;  4A3F H;  3J7A 5;  3HOV G;  4BXX H;  1A63 A;  2Y0S E;  4DR5 L;  4A3C G;  1S40 A;  4JOI A;  5M5X H;  4R4T A;  2JA6 H;  3NBH B;  2ZJR A;  1KD1 C;  3RZO H;  3AEV A;  5FLM G;  4H02 A;  4QJF A;  3KLW A;  1JJG A;  1G51 A;  4A3B G;  5M3F G;  1A8V A;  1WOC A;  4LWC A;  5C4J H;  5M5Y H;  4A3G H;  4HIM A;  1Q82 C;  3D0F A;  5BR8 Q;  1N32 Q;  2FXQ A;  1PH9 A;  4DR3 Q;  4JI7 Q;  1VQJ A;  1VQL A;  4DR6 L;  1W3S A;  2KCM A;  4BBR G;  1Y1W G;  1XMQ L;  1I94 Q;  2NVX H;  4EQ5 A;  4XTC S;  3OYY A;  4X64 Q;  4R4O A;  4LF8 L;  1Q7Y C;  3S1R H;  3HOW G;  2IY5 B;  4JV5 L;  4DR1 Q;  4LF4 Q;  4A3E G;  1G29 1;  4MTN A;  2UXD Q;  2VY3 A;  3E9H A;  1VQH A;  3UE1 A;  1WFQ A;  2E8G A;  3FP9 A;  1IXR A;  3CCS A;  2CWP A;  2UUA L;  2Z6K A;  1YNX A;  4A75 A;  2B63 G;  4JI4 Q;  3KDF A;  4JYA Q;  1FJG Q;  4FDB A;  1A62 A;  4R1J A;  3CPF A;  5IT9 c;  4BY7 G;  4DUZ L;  4GN5 A;  3WWV A;  1E24 A;  4HJ8 A;  4L5S A;  2UXC L;  1VQ9 A;  4IPG A;  1U5K A;  1Q81 C;  2HIV A;  3PO3 G;  4R4I A;  3GTG H;  1MJE A;  1BBU A;  3KF6 B;  4XIG S;  3AFQ A;  3OTO Q;  1EIF A;  2JA6 G;  2BA0 A;  3F2C A;  2PQA A;  1MIU A;  1N33 Q;  3CPW A;  1SMX A;  4RMF A;  2BH8 A;  4X66 L;  4B3M L;  2R92 H;  1XMO Q;  1WJJ A;  1LYL A;  1VQF A;  2B29 A;  5LMN Q;  4JI0 Q;  4UP8 A;  1V9P A;  4GKK L;  2CKZ B;  3E9I A;  3A5U A;  2E2H H;  2RHS B;  4UP9 A;  4X62 Q;  3T1H L;  2E5L Q;  4LFB L;  1C0A A;  1WCM G;  4IPD A;  4X65 Q;  4DUY Q;  2R7D A;  3CCE A;  4JOI C;  2H5X A;  1NBW A;  4P75 A;  2JA5 H;  4LFC L;  2EIF A;  1OXX K;  4GOP B;  3ICE A;  1Q8K A;  1U0L A;  4DPG A;  1X56 A;  5IYD H;  3HOY H;  1KAW A;  1VQ7 A;  2YV5 A;  4OWT B;  2UUC L;  4NB3 A;  1K8A C;  1K8G A;  1ASY A;  4LF7 L;  1HNX Q;  1Y1V H;  2N78 A;  1E3P A;  2VW9 A;  3CC7 A;  2K4K A;  4A3D H;  3CF5 A;  4A93 G;  1HNW L;  4HJ9 A;  3KF8 B;  2OQK A;  1VQC A;  1N34 L;  4QQB X;  2NVQ H;  2LXJ A;  4O2D A;  2JA7 G;  1N36 L;  3H0G G;  1TWF H;  3RLF A;  1YVC A;  1GM5 A;  4JI8 Q;  3U4V A;  3UDI A;  2Z6K C;  1QVF A;  1XPR A;  1KRS A;  5IP7 G;  1CSQ A;  3I4M H;  1CKO A;  1BBW A;  5C4X H;  1VQO A;  5LMU Q;  3S2H H;  1UE1 A;  2WP8 J;  4LFA Q;  4BY1 H;  1EIY B;  4DV2 L;  3F2D A;  4IO9 A;  1KXL A;  1OTC A;  2VQF Q;  4B3T Q;  4JC0 A;  3M85 A;  2ALY B;  3EBE A;  1D7Q A;  2WAQ E;  2UUB L;  4YY3 Q;  1HR0 W;  3TRE A;  3W5O A;  3K81 C;  1PH5 A;  3M7N A;  2KEN A;  4OX9 L;  2ID0 A;  1J5E L;  3S1N H;  5JJK A;  3H3V I;  1X6O A;  2C35 B;  1KIX A;  4JBK A;  4JI3 Q;  3TQY A;  1B7Y B;  1D8L A;  1HZA A;  3KDF B;  4L5T A;  2JK8 A;  2PNH A;  4DV3 L;  3PSI A;  1IBL L;  1KQS A;  2RHQ B;  4A3D G;  1VQ8 A;  3AYH B;  1EYG A;  4DV1 L;  1M1K C;  4APV A;  2K5V A;  4MNO A;  5IP9 H;  1HZB A;  4DR4 Q;  3J80 c;  4LNQ A;  1KRT A;  1CKN A;  4OON A;  5JEA G;  5IE8 A;  2PQA B;  1PH8 A;  2K5N A;  3M4Q A;  2A8V A;  1I50 H;  3F8T A;  3MEF A;  4UP7 A;  1PH4 A;  1TWG H;  3EN2 A;  3J80 i;  1PHJ A;  1PVO A;  3I4M G;  1XNR L;  1N32 L;  3S17 H;  4JI7 L;  4PZ6 A;  4IOC A;  4GNX A;  4EX5 A;  2NVY H;  5IYC G;  2KHI A;  3OW2 A;  1YJ9 A;  4X64 L;  4DAM A;  3F1Z A;  2JEA I;  1A0I A;  5C3E H;  4AYB E;  5JJL A;  4DR1 L;  3ULL A;  5C44 G;  1W2B A;  4LF4 L;  3FKI H;  4GLX A;  1XJV A;  1QVG A;  4K0K Q;  2UXD L;  2KBN A;  1L1O B;  5GAG C;  4NXM L;  2ZTD A;  1OXU A;  1V43 A;  1HZC A;  3CCV A;  5H1S E;  3K7U C;  3MXN B;  1FL0 A;  1NMG A;  3RZD H;  4YWM A;  5ELN A;  1VQK A;  2D0O A;  4PG3 A;  4A76 A;  3I4N G;  1PH3 A;  1FJG L;  1MJC A;  1X55 A;  5IWA L;  2CQO A;  4HJ7 A;  4DK6 C;  4DV0 Q;  3TS2 A;  4GN4 B;  3I7F A;  2ES2 A;  4DR2 L;  1JJ2 A;  3PIO A;  2K14 A;  3RN2 A;  2F3I A;  3J81 j;  3PF5 A;  1X3E A;  4POG A;  4Y52 H;  4J15 A;  1XNQ L;  3K8A A;  1AE2 A;  1SLJ A;  3S1Q H;  2UXB Q;  4JBW A;  5FJ8 H;  2ZM6 L;  3HKS A;  3CMA A;  2QA4 A;  4A3M H;  3I4O A;  4JI0 L;  5LMN L;  2Q2H A;  4BA1 I;  1C7Y A;  3K0X A;  4DV7 Q;  3TS0 A;  3CCU A;  1OXV A;  3UDG A;  4X62 L;  3CQZ H;  3RLN A;  2E5L L;  4C3J H;  5C0X G;  3D31 A;  3L0O A;  1KC8 C;  1UEB A;  3CAM A;  1S3O A;  4QL5 A;  2PMZ E;  3HOZ H;  1YBY A;  1P8L A;  1QUQ A;  5GAD C;  4A3F G;  1PFS A;  2V1C C;  2F52 A;  4LF9 L;  1X54 A;  3GTJ H;  1O7I A;  4BXX G;  4DR7 L;  4B3R L;  1JT8 A;  1OXS C;  3I2Z A;  4YCU A;  4DV4 Q;  2YU9 H;  1RIP A;  2WFW A;  4JI6 Q;  4YHH Q;  2I5H A;  3LGJ A;  3W1G A;  2VL6 A;  1YZ6 A;  2VNU D;  4B3S Q;  4AQY L;  1VQN A;  4GNX C;  2QGQ A;  4P74 A;  2CFM A;  4QIW E;  4WJ4 A;  1CUK A;  1TWH H;  3GD7 A;  3KOJ A;  4A3G G;  4BA2 I;  1PYS B;  3BJU A;  4OWW B;  1S72 A;  1PH2 A;  1E7Z A;  4HIK A;  2ZTE A;  1B8A A;  2D0P A;  1E1T A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...