1N32Q

Structure of the thermus thermophilus 30s ribosomal subunit bound to codon and near-cognate transfer rna anticodon stem-loop mismatched at the first codon position at the a site with paromomycin
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
104
structure length
104
Chain Sequence
PKKVLTGVVVSDKMQKTVTVLVERQFPHPLYGKVIKRSKKYLAHDPEEKYKLGDVVEIIESRPISKRKRFRVLRLVESGRMDLVEKYLIRRQNYQSLSKRGGKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Selection of tRNA by the Ribosome Requires a Transition from an Open to a Closed Form
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 16S RIBOSOMAL RNA
total genus 20
structure length 104
sequence length 104
ec nomenclature
pdb deposition date 2002-10-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Q PF00366 Ribosomal_S17 Ribosomal protein S17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 1n32Q00
4RMFA 1EQRA 1NY4A 1PH7A 4A3GH 3HOXG 1FGUA 2NN6I 1CKNA 4IPHA 4DAMA 1P8LA 5C4XH 1Y1WH 2EQSA 1VQMA 1UE6A 3PGZA 3TS2A 2Z6KC 3OYYA 5C3EG 4YCWA 2QGQA 1XPUA 3PO3G 3S14H 1NMFA 5AJ3Q 1E1TA 5C4JH 4HJ9A 1KD1C 3CPWA 4YHHL 1IXRA 2DGYA 2VZAA 3KLWA 4L5QA 4R4OA 2D0OA 5C44H 2K4KA 3CAMA 4A3CG 1HZAA 5FLMH 2V1CC 4JC0A 2VW9A 1L1OC 2JA6G 3RLOA 2UUCQ 1Q1EA 5C0XI 1YHBA 4HJ8A 4DR5L 3ULJA 4KLKA 2LSSA 4LF9L 4DV7Q 1Q82C 3ICEA 3HOVG 4C3IH 4P71A 2PI2A 1VQEA 4IPDA 3CXCA 4JBWA 1OXUA 1PHJA 3EIVA 2K75A 4WJ3M 1FVIA 3GTLH 2ASBA 2PNHA 4MNOA 2WB1E 1Y14B 4EQ5A 4A3KH 2HIXA 4X66L 3KF6A 4IPCA 3M4QA 4K0KL 4DAYB 4GLAC 4R1JA 1TWCH 1B7YB 3L7ZC 2I5LX 1VQ4A 2IX1A 5C0XJ 2JA8H 1G6PA 1OXTA 1IZ6A 4JBJA 3I55A 4MZ9A 1RL2A 5ELNA 4BBRG 4DKAC 3H15A 1WFQA 3K80C 2OCEA 1WI5A 4DV3L 1KXLA 3TQYA 2K50A 5LMNW 4JI6Q 2HT1A 3S16H 1VQFA 2YTYA 1Y1VG 4BY1H 4JI4L 3JAMc 1VQAA 1VS0A 4JI8L 2I0QA 1N33L 1IBKL 2E5LQ 1PYBA 2RF4A 1PH9A 1LYLA 4X6AH 1NE3A 3RZDH 2UXBL 1DGSA 2CQOA 2H5XA 2BA0A 1BKBA 1VQHA 2ES2A 1VQ9A 3RLNA 2AMCB 4DR3Q 2RHSB 3NEMA 3I56A 1EIYB 1A8VA 1PH5A 4DV6L 3E9IA 1HZBA 2OQKA 3KJOA 4OWWB 4DK6C 3EBEA 3S2DH 3E0EA 2ZTEA 4DV7L 4DV4L 3G71A 2NVTH 4TQUS 3ZJYC 5IYBG 1YJ9A 3H3VH 5LMNL 2ZTCA 5M3MH 4A3LH 4LWCA 3PF4A 2KHIA 2UXCQ 3J81j 1IL2A 4FDBA 2B63G 1U0LA 3NELA 4OONA 4A3JG 4L5RC 2OWOA 3OTOQ 1JMCA 4LF5L 3S17H 3G6EA 1Q86C 3M4OH 3KYHC 4B3RL 3G48A 4GLVB 1N34L 1BBUA 2QEXA 3GD7A 3T1YL 4JI0Q 4LNQA 1GVPA 1CSPA 3E9HA 2EXDA 3KF8B 4NXNL 1JT8A 4APVA 1HR0W 4NXNQ 4A3BH 1TWGH 5JEAJ 4DV1Q 3S1QH 2RCNA 4LF6L 4YY3Q 4OO1I 4IJHA 3T1YQ 4TVAB 2LXJA 1BBWA 3CCJA 2Y0SG 3KDFB 1E22A 1MJCA 4IPGA 2ZM6L 3PUVA 2HHHL 4DR3L 1XNQL 4GKJL 1VQKA 4JI7Q 4LF7L 5IP9G 1X3EA 1VQJA 5GROA 1XJVA 2UXDQ 2UU9L 4BBRH 2UXDL 1QUQA 2YTVA 3CF5A 4UP9A 3U50C 2UUAQ 4LF4Q 1YNXA 3FKIG 4IOAA 4C2MH 2MFIA 1N33Q 3GTPH 2GN5A 3KOJA 3PUYA 4C3JH 4NXMQ 4JI6L 5IYCG 3W1BA 5GAEC 4B3SL 5BR8Q 2D62A 4P74A 3U58A 4JI5Q 4DR7L 3UDFA 1I94L 1JJGA 1TXYA 2JA9A 2WAQG 3F2CA 2BH2A 3I4NG 4R4CA 4P72A 1Z47A 1EQQA 3M85A 1RIPA 3RR5A 4A3MH 2F4VQ 3CC4A 4JI0L 4IFDJ 1KL9A 3M3YH 5C44G 3CMEA 1VQOA 2F3IA 1YITA 1K8AC 2A19A 1IBLL 4JBKA 4P73A 5J3BA 1E7ZA 4B3MQ 4DR6L 2CWPA 4K0KQ 1NJIC 3D31A 3PUWA 1W2BA 4GOPC 3KJPA 2AKWB 3A5UA 3RZOH 1V9PA 1X3GA 2KCTA 2B63H 2AWNA 4Y52H 2VS1A 1SN8A 1YHAA 3BZCA 4YWMA 1L1OA 2YYZA 2ZM6Q 4QGUA 1QUQB 2GVAA 5HY6A 3UDXA 2VUMG 4LFAL 1FJGQ 3GTKH 2K5VA 2WFWA 1P16A 5JEAG 1KHIA 4QY7A 1HZCA 4LFAQ 4POFA 4DR1L 3VDYA 3CC2A 4DR2Q 2B29A 2F52A 4DR4Q 3ERSX 1C7YA 4UP7A 4DV2L 1YJNA 4A3FH 1YHQA 3CP0A 1WCMG 1YVCA 1XMOQ 4BBSH 3HOXH 4A3DH 4JYAL 5ELOA 3K81C 2EIFA 2Y0SE 4JI7L 4OWXB 2IHFA 4BY1G 3U4VA 5IP9H 1XTDA 2YV5A 1YZ6A 4JI5L 3HOZG 4B3TL 1TWAH 4A3FG 5M5WH 3T1HL 5IY0A 2ZJRA 1HR0Q 4NXML 1XMQQ 1EOVA 3PIOA 4KHPL 2L15A 4H02A 2JA7H 3M9BA 4LF6Q 3Q8DA 4QQBX 4DNIA 3W1GA 2C35B 1A0IA 2K5HA 3CCRA 3CCLA 1VQ8A 3D0FA 3CQZH 4JYAQ 4KI0A 2UU9Q 1B8AA 3AFPA 4DUYQ 3GO5A 3ER0A 2WAQE 5FJ8H 1KRTA 4AYBG 4HIOA 2JA7G 2ATWA 4A3KG 2IX0A 4A3MG 5GAHC 4JBMA 1V1QA 1N9WA 4JOIC 1K73C 3PO2H 4BXXH 1EYGA 4IFDI 2B3GA 4IFDG 1LUZA 3FHWA 4A76A 1EFWA 3RLFA 4X62Q 5EAYA 1J5EQ 1SR3A 5IP7G 1B70B 1X3FA 5M5YH 4DV5Q 1XNRL 1I3QH 1IYJB 1HJPA 3PSIA 3SGIA 1HNZL 3LGJA 1O7IA 2KCMA 2CFMA 2XGTA 2R92H 1KC8C 3T1HQ 1EWIA 1X9NA 1HR0L 2KHJA 4LF5Q 1M90C 3GTMH 1Q1BA 2K14A 4PZ6A 1EUJA 2JE6I 4DR5Q 3H3VI 4GKKL 1I6HH 3H0GG 3I4MG 3M7NA 1G291 1L0WA 4L5TA 4PZ8A 2UXBQ 3JAMi 5JJKA 1C9OA 1QVFA 4WJ4A 4DR4L 1QZHA 3S1MH 1AE3A 2ID0A 1K9MC 3TREA 3TS0A 4YWLA 5GAGC 4A3BG 4B3TQ 1Y1VH 5DLQE 4QJFA 4R4TA 1HH2P 4P75A 3STBC 4AQYL 1JJCB 3ULPA 1VCIA 1SROA 4LFCQ 3HOWH 3IRBA 5IT9c 4JI1Q 4JG2A 2YU9H 4DUZL 1A63A 1XMOL 4OWTB 1CKMA 1SE8A 5E7NA 4OX9Q 3K7UC 4X64L 1KRSA 4DPGA 2NVQH 4JI8Q 4DV4Q 3CC7A 4LW1A 3I2ZA 2JA5G 2JA8G 4LF9Q 1IBLQ 3TEHB 1K3RA 4AYBE 2AWOA 4GNXB 4A3GG 4X64Q 1E3PA 4IJLA 2NZHA 3NBHB 5IYBH 3GTJH 1KIXA 2R93H 3HOYG 3WWVA 3J80c 4NPSA 2KENA 4JI3L 3MXNB 2R7FA 3GDEA 2WB1G 5C3EH 2R6GA 3CCMA 3A5ZB 4GNXC 3GTQH 4A4IA 1Y1WG 3HOWG 5LMUQ 1K83H 1L2FA 1SFOH 1PH1A 1YI2A 1NMGA 1VQ7A 2IT1A 2LXKA 2MNAA 1OTCA 4YCUA 2F4VL 1VQBA 2UUBQ 1S3OA 3UDIA 1X55A 1CKOA 1LM0A 3G4SA 1J5EL 4L5SA 4LF7Q 3H0GH 1SMXA 1VQNA 5AJ3L 4JV5Q 1KAWA 1Q46A 1CKNB 1EIFA 3STBD 2NVXH 2XTIA 5K36G 2Z6KA 4EX5A 4X66Q 4DV6Q 3HOYH 1PH8A 4DV0L 1LTLA 1YBYA 1HNWQ 1XNRQ 2NN6G 1FL0A 3KDFA 1R9TH 2VUMH 4NB3A 1M1KC 1Q7YC 2UUCL 2NZOA 4GNXA 3F1ZA 1UE5A 1JE5A 1ASZA 3K0XA 3I4MH 1SRUA 4LFBQ 2E5LL 4POGA 4RG1A 2E2JH 1MIUA 3AEVA 5IYDG 4OO1G 4JI4Q 3CMAA 1XMQL 4AH6A 4ALPA 5IWAL 5IYCH 2R7ZH 2KBNA 1YIJA 1HNXQ 1WJJA 1QVCA 2AHOB 3AQQA 3I7FA 3J80i 3J7ZC 1IBMQ 1CUKA 4YY3L 1PH6A 2I5HA 4C3HH 4DK3C 1X65A 1GKHA 5IYDH 4JOIA 1NTGA 1S40A 1W3SA 4A75A 4A3EH 1E1OA 4YHHQ 3B6YA 1V43A 3CCQA 4GN5A 3PO2G 4BXXG 4YCVA 2JJQA 4UP8A 1CSQA 2PQAB 3U4ZA 1FJGL 3JC66 2RHQB 5JJIA 4XTCS 3GTGH 1UWVA 5FJ8G 4PZ7A 3HOVH 3A74A 4GOPA 1YJWA 3BU2A 4LUOA 3F2DA 1KQSA 2ZJQA 3AFQA 1MKHA 1OXSC 3S1RH 2R92G 4DV2Q 5LMNQ 2CCZA 3KF6B 4HJAA 1WCMH 4BBSG 2JK8A 1PVOA 3J7A5 4LF8Q 2N78A 1UEBA 2VQFL 3F8TA 2E2HH 5HGQA 3BJUA 1VQCA 3I4OA 5M3MG 4DUZQ 4R4IA 3HOZH 4A3IG 2JEBI 4X65L 1N8RC 4XIGS 3W5OA 4A3JH 3A0JA 3DLLA 1I50H 1H95A 4A3LG 3GTOH 2K52A 1PA6A 1IBKQ 2MQHA 2I5MX 3PO3H 1PFSA 4LUVA 5M3FG 2R7ZG 3PIPA 1Q81C 1VQDA 5C0XG 4HJ5A 4BY7H 1J6QA 3HKZE 4Y7NH 2Q2HA 2DUDA 1XPOA 1VQGA 5BR8L 4R4QA 4DR7Q 1HNWL 4HIKA 2UUAL 2CKZB 4JI2Q 1PYSB 4LF4L 2A8VA 1PH4A 1VQ6A 2OQ0A 2JA6H 1VQ5A 3PF5A 4LF8L 4PG3A 1G51A 2Q2IA 1GM5A 4GKJQ 3CW2C 3UDGA 1I94Q 4LFBL 2BA1A 4BY7G 3HOUG 2Z0SA 2GVBA 2N3SA 2FXQA 2VQEQ 2ZJPA 1L1OB 2NVYH 1S72A 3J81i 4ME3A 3HKZG 3S24A 3J81c 4HJ7A 2HHHQ 1XNQQ 1D8LA 4A93G 4DUYL 3I4NH 3CCVA 2D0PA 3FKIH 2BH8A 4DV1L 3UE1A 4KHPQ 4GN4B 5IP7H 3PV0A 3K8AA 3RNUA 1X6OA 4JV5L 1N32Q 3CD6A 2WP8J 1GO3E 2ZTDA 4YWKA 1JJ2A 1PH3A 1N34Q 1X54A 2K5NA 1MJEA 3NENA 4A3DG 4JI2L 1N32L 4GN3B 3ULLA 4JI3Q 2UUBL 1YEZA 3OTOL 1TWFH 1IBML 3L0OA 5IE8A 3CPFA 3FP9A 3PUZA 4UPAA 4DR2L 1E24A 4B3RQ 3F2BA 4J15A 2IHEA 4LUZA 1GD7A 2N8NA 1T9HA 2YTXA 4HIDA 3HKSA 1OXVA 5GQOA 2A1AA 4GOPB 3BZKA 4HIMA 2E8GA 2HQLA 4O0AA 3S1NH 4BA2I 5FLMG 2N49A 3RN5A 3DM3A 2OTLA 1N36L 4A3CH 4IO9A 2JEAI 4MTNA 2OTJA 2QA4A 1WYDA 4OXPA 4BA1I 5GADC 3HFZB 2UXCL 1AE2A 5FLXc 4GLXA 5M3FH 2MO0A 2VL6A 4LFCL 1OXXK 1TWHH 4DR1Q 4PMWA 4AQYQ 4A3EG 1I5FA 2HIVA 3L2PA 5M5XH 1N36Q 1U5KA 2VQEL 4AIMA 1PH2A 3K7AH 3PCOB 1D7QA 1HZ9A 2JQOA 2MO1A 3M4PA 4QIWE 1VQLA 4OX9L 3OW2A 5JJLA 2ALYB 1VQIA 4B3ML 4DR6Q 2PMZE 3RN2A 5H1SE 4JI1L 3EN2A 3HOUH 2R93G 2PI2E 4QL5A 4UY8C 4O2DA 4X65Q 2Q2UA 1BVSA 3S2HH 3PUXA 3S15H 1SLJA 2R7DA 4B3SQ 5C4XG 1UE1A 1ASYA 1UE7A 4JCVE 1QVGA 5IWAQ 4A93H 2VQFQ 1XPRA 3TRZA 5LMUL 1HNZQ 2VNUD 1A62A 1X56A 3MEFA 1K8GA 1Q12A 2PQAA 2VY3A 3CCSA 4KHZA 3CCEA 4DV5L 3UE0A 1PV4A 2CWAA 1VQPA 1AH9A 4GKKQ 4X62L 4DV3Q 1Q8KA 4IOCA 3CCUA 1K0RA 1Z9FA 4DV0Q 1HNXL 2E2IH 2Q2TA 3KFUA 1QZGA 1WOCA 4GS3A 1JB7A 1NBWA 2JA5H 1C0AA 2IY5B 3AYHB 4A3IH
chains in the Genus database with same CATH superfamily
1NY4A 3Q0AA 4A3GH 2NUCA 4DK1A 3HOXG 1FGUA 1ET9A 1Y1WH 2C5CA 2Z6KC 3PO3G 1I6VC 5C5LA 3D4WA 5C4JH 2FMCA 4HJ9A 1S5BD 1KD1C 3CPWA 2B2YC 4L5QA 2VZAA 3KLWA 1A2UA 4R4OA 2K4KA 1MSHA 4PQXA 3ITPA 4YIJA 4GZYC 5C0XI 1X3PA 3ULJA 1RKNA 3T53B 1JOKA 4Q0FA 2PI2A 1VQEA 4HAEA 3EIVA 4WJ3M 2EE1A 2JA6B 1C48A 3TP8A 3DEOA 3CQZB 3QIAA 4MNOA 1LV9A 2WB1E 4EQ5A 3I72A 1EU4A 1TWCH 1FD7D 4F7XA 1ENCA 3P20A 3QB3A 2F0OA 1O7LA 1E2ZA 1DOKA 2EYMA 4CDFC 1KABA 1CHPD 1RL2A 5CV4A 3T56B 2QF7A 2H4OA 2EJMA 1EYAA 2MJ8A 3TZDA 4JI6Q 3S16H 1VQFA 2YTYA 4BY1H 4JI4L 1B9NA 3FPUB 3KBGA 2K33A 2E5LQ 1PYBA 2JXMB 2RF4A 3RZDH 2UXBL 2B2VC 2EJGC 5BN5A 2H5XA 2BA0A 1BKBA 5J1ZA 3RLNA 4IUNA 1HFNA 1EIYB 2K04A 1BOSA 4P2CB 2LMCB 5TSSA 5DM73 2N88A 3E0EA 3J80E 5CBEE 1B4OA 2CVRA 1STNA 4A3LH 3F2UA 4LWCA 3PF4A 4RCOA 1IL2A 2B8FA 4OONA 4A3JG 3J7AV 2OWOA 3OTOQ 1DYQA 4B3RL 4IURA 5LL6S 3GD7A 3T1YL 3Q23A 3KF8B 1DOLA 4KJNA 4NXNQ 2XRSD 1YNND 3S1QH 4YY3Q 3T1YQ 4KY6A 1YNJD 4K8JA 2E74C 2B2UC 3CCJA 2ZM6L 3VR3A 3PUVA 1F2ZA 2HHHL 3BYTB 5D14A 1A3TA 3C3LA 2UU9L 3A55A 5EBDA 2BE5D 4UP9A 3U50C 2J4XA 1S4ZA 1XXGA 2X6GA 5EBCA 2RBMA 2L11A 5I4DA 2A68C 2GN5A 3KOJA 2K6AA 1V1PA 3E6ZX 2D62A 3U58A 2Z4IA 2JA9A 5JAVA 2WAQG 4DAPA 1EQQA 4C3JG 4K2KA 3M85A 2F1MA 3RR5A 2I07B 3CC4A 2D9UA 1PTOB 2F3IA 2GA4B 2RA4A 2QDLA 1E7ZA 2AQ1B 4CDEC 4K0KQ 1VDZA 3PUWA 3EROA 4HCEA 3KJPA 2B2YA 4OHJA 2AWNA 1CTMA 2RKSA 5CV6A 4YWMA 2YYZA 4G7ZC 1JB3A 2B2WC 2VUMG 1EZ8A 1STBA 5JEAG 1KHIA 4LFAQ 3CC2A 2G9DA 4JVZA 4DR2Q 4DR4Q 3ERSX 4UP7A 1YJNA 4V190 3T4AC 4BBSH 4H7BA 2R61A 2K5WA 1GUWA 1QILA 4BY1G 2AQ2B 3ONAB 1YZ6A 1B50A 2E2DC 4NMZA 4CHTB 3T1HL 5IY0A 1JWUD 4KHPL 2L15A 4H02A 4OGQC 3M9BA 1PZJD 2OT2A 3Q8DA 2C35B 2MHVA 4HMIA 4JYAQ 2F0VA 5JVH3 5ISRA 4DUYQ 3GO5A 4OL7A 4XQQA 1KRTA 2JA7G 4KK7A 2PCFB 3K5MA 3H91A 5JPMC 1KTKA 3PO2H 4XXEA 1EYGA 4BXXH 4IFDG 3DWPA 4X62Q 1J5EQ 4DF7A 2HQEA 3LGJA 3D3RA 4RA8A 2R92H 2CFMA 3DWQA 1KC8C 2FHTA 2E2HB 1GHKA 2KHJA 2IJ0A 1EUJA 3H3VI 1LT3D 1CQVA 1G291 3PIP3 1JQYD 1EQTA 1C9OA 2A6HD 1QVFA 1BNZA 5M5YB 1HXYD 3S1MH 1EIHA 4QJFA 2EXZA 1ZYRC 3MHBA 3IRBA 5ELEA 1SE8A 3K7UC 4FF2A 2D2CC 4QF4A 2E2IB 2JA5G 1H9MA 1K3RA 4FF3A 3NP8A 2NZHA 3NBHB 3NSWA 5IYBH 3MA2B 3J80c 1ZXTA 3Q6SA 3NTKA 2R7FA 5EKIA 3CCMA 1B2TA 3A5ZB 4GNXC 2PO4A 2PZTA 3HOWG 3K5NA 1R4QB 3VA7A 1YI2A 3GQBA 3D6CA 2LXKA 2MNAA 1B53A 1SYFA 2NTTA 4JW0A 1PRTC 2RDGA 3MAQA 4KN4C 1CKOA 3G4SA 1J5EL 1U4PA 1VQNA 3EA6A 1PFBA 3MVVA 2EYOA 3R93A 3GV6A 1CKNB 3H09A 5M3FB 2R7ZB 5K36G 1A6XA 4X66Q 1BDOA 1Y69U 1LTLA 1YBYA 1HNWQ 5IGGA 2NZOA 4GNXA 4G7HC 1UE5A 1JE5A 3J81L 2NTSA 2E2JH 1EU3A 1B9MA 4RWSC 5KNBA 1YIJA 1HNXQ 1WJJA 2AHOB 3AQQA 2PZUA 3J7ZC 4YY3L 3HZXA 4C3HH 1PRTB 1X65A 3BZDB 1NTGA 2A6HC 1W3SA 1CQFA 1SNMA 1DXMA 1V43A 3PO2G 4BXXG 2Q8RE 4YCVA 3A7LA 4UP8A 5FOBB 3JC66 2DY7A 5JJIA 1RTNA 1UWVA 4PZ7A 3HOVH 1I4QA 3QG1A 3KK7A 3AFQA 3NWSA 3RZDB 1MKHA 2R92G 2CCZA 3KF6B 2HCCA 1G2TA 5KNDA 1BF4A 1PVOA 4JK1C 1SEBD 3F8TA 2F0QA 4DUZQ 1LTGD 4R4IA 2JEBI 3C2PA 4QB4A 4XIGS 3A0JA 1RCVD 4A3LG 1WTQA 1HA5A 1IBKQ 1F77A 1G8ZD 4ZUJA 1NUCA 3SK4A 3PO3H 2EYPA 4N9TA 4LUVA 5CV5A 4RGNA 3HOZB 4HJ5A 4HMJA 1XPOA 4R4QA 1HNWL 3VYTA 4HIKA 2CKZB 4JI2Q 1PYSB 2IWHA 4B08A 3C46A 4GKJQ 5I2XA 4BY7G 3HG9A 4G57A 3MC0B 1HQRD 2ZJPA 5AFWA 3J81i 4OEMB 3HKZG 4A93B 1A3UA 5KNCA 3CCVA 3FKIH 3UE1A 1BCPF 1ESFA 3PV0A 3K8AA 1NCVA 4RKLA 4YWKA 3R8BA 1PH3A 1K83B 1MJEA 3NENA 4A3DG 2NN6H 5T1IA 1H9SB 1E2VA 1JC7A 3CPFA 3BDCA 4DR2L 3F2BA 1MHWC 2EY2A 2IHEA 2SOBA 4F87A 2KA7A 1T9HA 3NXWA 3HKSA 2CH4A 5GQOA 4GOPB 1ONLA 4O0AA 1CZGA 5FLMG 1O7ZA 1ET6A 1N36L 4A3CH 2M9VA 2XWJB 1WTPA 4X3UA 4BA1I 3IKJA 1AE2A 3LX0A 3VR5A 4GLXA 4K6LA 2MO0A 4LFCL 5M3FH 2EVBA 2R7ZH 3CHBD 2HIVA 1SNCA 1N36Q 1U5KA 2VQEL 2F0PA 2K5QA 4AYBB 3CRLC 2JQOA 4OX9L 2ALYB 4B3ML 2P5ZX 4DR6Q 1PFMA 1EY5A 4JI1L 3EN2A 3HOUH 4DGZA 4X65Q 2Q2UA 2KOLA 2SDFA 5C4XG 3NK9A 3PUXA 3S15H 1UE7A 5IWAQ 3NBIA 1XPRA 2IW3A 5LMUL 2VNUD 1ILQA 1LTAD 1A62A 1X56A 1K8GA 2XIWA 2PQAA 2VY3A 1JE4A 1QWYA 4DV5L 3UE0A 1PV4A 4R9WA 2MUYA 4NW2A 4GKKQ 1Q8KA 1G6ZA 3BDOA 1HNXL 4U68A 4CJ2C 1NBWA 3V96A 2A6ED 3VYSA 1UEAB 5IGBA 1RHPA 2NN6I 5D65A 1CKNA 4DAMA 3GTKB 3S16B 2QGQA 3OIPA 1XPUA 1E1TA 4ZCKA 4A3FB 3NE5B 4O42A 1V1PB 4I65A 1XX8A 1PMRA 5C44H 1EY6A 3CAMA 1SYDA 2JN4A 4Q5VA 1JCKB 1L1OC 2NVQB 5C4XB 1JWSD 2ENBA 1EY0A 2LSSA 1Q82C 1NR2A 3ICEA 3CXCA 4JBWA 1OXUA 1PHJA 3QOJA 1CZWA 4NP5A 3GTQB 3GTLH 4XYQA 2PNHA 1EWHA 1K28A 3DWAA 5CV7A 1EEID 2HIXA 1T5EA 1LT6D 4JPBW 4K0KL 4DAYB 4R1JA 1D5MC 1B7YB 4F88A 1VQ4A 4DAYA 1OXTA 1IZ6A 3NQTA 4JBJA 3GTOB 3TP7A 1TKWB 4DKAC 2M2LA 4XT3B 3HOXB 3PIO3 5M9OA 1WFQA 4A3IB 4J8QA 4K6DA 2CQAA 1JOOA 1F9SA 3TQYA 3C1FA 1ENFA 2I46A 5IT9E 3TP5A 1D1IA 1Y1VG 3FDTA 1VS0A 3SEBA 2F0DA 1N33L 2B63B 1RD9D 2B2VA 2CQOA 3IFTA 3VYUA 2OQKA 4OWWB 2DNCA 3D6WA 2EYFA 4DK6C 3PO2B 3D8GA 3I4LA 3G71A 3X3NA 2NVTH 3E3XA 4TQUS 2UXCQ 2KHIA 5FO7B 3J81j 1HA6A 3QJYA 4FDBA 1U0LA 2IL8A 3KLRA 4IUVA 2OF1A 1PTOH 1JMCA 1F2YA 1D5XC 2BDOA 1Q86C 3M4OH 1BBUA 4QMGA 1PXUA 4LNQA 4FXDA 5DEHA 4FYDA 4ZUIA 4A3BH 1ICFB 1KDBA 4RHSA 2RDHA 2Y0SG 3KDFB 1E22A 1F9PA 1MJCA 4TRDA 4FXKC 2RCFA 1K3BC 4LF7L 4HSVA 5IP9G 2F0GA 1LO5D 2UXDL 3CF5A 2YTVA 5BN3A 4LF4Q 1YNXA 4KHVA 4QIWB 3GTPH 2R93B 3HOVB 1RDPD 4L8JA 2PW7A 1TWFB 4DR7L 4P74A 2E76C 1S5CD 3HKZB 3FVQA 3F2CA 3I4NG 5D3IB 4P72A 1Z47A 4RGOS 5KEEA 2F4VQ 5C44G 1K8AC 2CH4W 1W2BA 3A5UA 3V05A 2A6EC 1ICWA 1G2SA 1X3GA 2FFKB 4Y52H 2VS1A 1TQOA 4KKTA 1L1OA 4KY5A 2LY7A 2ZM6Q 1TWGB 1PRTD 1QUQB 2F3WA 2GVAA 3UDXA 1EZ6A 3GTKH 4POFA 3VDYA 3NHHA 4DR1L 3S15B 1AZPA 2B29A 1C7YA 3CP0A 1KDCA 3NUCA 4A3DH 4JYAL 5ELOA 4XQNA 1SMYD 3K0YA 2OXPA 4ODGA 1XTDA 3AB9A 2JYOA 2Y0SB 4B3TL 5M5WH 3PIOA 3HOWB 2L0CA 1TS2A 3W1GA 1A0IA 5CV8A 3D0FA 3K59A 3AFPA 1KNEA 5CBAE 3ER0A 4HIOA 2M00A 4A3KG 4A3MG 3D4DA 1FNVA 1J8IA 2H1EA 1K73C 2RSNA 2EYJA 2O4XA 5T1GA 2Z1CA 1B70B 1X3FA 4DV5Q 1XNRL 3SK6A 1I3QH 1AEXA 1Z6HA 3QR8A 1HJPA 3PSIA 1KDAA 2AUKA 1HNZL 1O7IA 2KCMA 3SK8A 5EQ0A 2JSOA 1X9NA 1CFMA 4LF5Q 1JICA 4BY1B 2KJXA 2O5IC 3H0GG 4RFBA 1FYCA 3M7NA 4PZ8A 2UXBQ 5JJKA 2R3ZA 1QZHA 5FLXL 4XT1B 3TREA 1EL0A 4B3TQ 4BS9A 1Y1WB 4R4TA 2D5DA 2L5TA 3EQLC 1SROA 4JI1Q 4DUZL 1ENAA 1A63A 1STAA 4XDXA 2ZXOA 4ZKBB 3OPOA 4DPGA 2NVQH 1PTOD 4DV4Q 3CC7A 1WVLA 2JA8G 2PZWA 2K01A 3TEHB 2KECA 4AYBE 2AWOA 4GNXB 1E3PA 3GTJH 3T16A 2EYHA 3WWVA 5I9PA 3NBHA 4JI3L 1HUMA 2WB1G 3GTQH 3KBXA 2WACA 4A4IA 5LMUQ 3RUZA 1EYDA 1GUGA 1L2FA 3RMHA 1NMGA 1PH1A 3E5SA 2PW5A 1TVXA 4IN3A 1V1OA 1I6HB 1VQBA 2UUBQ 4ZYSA 5NUCA 3GTMB 3UDIA 1X55A 2RVLA 1LM0A 2JA8B 5KIXA 4LF7Q 1SMXA 1KLGD 4PMCA 5I9OA 2KHSA 1Q46A 1PZID 1RODA 2B2TC 3STBD 2XTIA 4DV6Q 5FO9B 4CJ1B 3HOYH 1PH8A 2SEBD 1XNRQ 5BN4A 4K8IA 2NBFA 3DXJC 3I4MH 1SRUA 3M4YA 4LFBQ 1EY8A 1QE6A 4RG1A 4JI4Q 4AH6A 5C6AA 2F4IA 1BBXC 2Q8IB 4ZLTF 1TWCB 1NNXA 3WOEA 4DK3C 1AFPA 5M3MB 1L0XB 1WTRA 4A3EH 1XTCD 1D1KA 4YHHQ 4GN5A 5EPJA 2JJQA 3NPPA 2EPBA 3U4ZA 2PQAB 4XTCS 5JJZA 3GTGH 5M5XB 4GOPA 3BU2A 1KQSA 3F2DA 2YU9B 3A8KE 3S1RH 1QJOA 2BOSA 3H0GB 4HJAA 5KYIA 2SNMA 2LFNA 2N78A 1UEBA 2KCNA 1VQCA 3I4OA 1TY0A 5M3MG 3BYYB 3HOZH 2AQ3B 5C4JB 1A2TA 3DLLA 1I50H 1I4GA 4LAAA 1PA6A 1R9TB 2VUMB 4ABNA 4DXFA 3A56A 3GTPB 5G3LF 1A15A 3T13A 5C0XG 5IGFA 3HKZE 4DR7Q 1VQ6A 3I70A 4XQJA 1SYBA 1I94Q 5CGKA 4LFBL 2BA1A 1EY7A 5CMDA 3HOUG 2Z0SA 2FXQA 2X6LA 4CGYB 1AP0A 2L9HA 3KLSX 4DNRB 3S24A 4HJ7A 3BG3A 1XNQQ 2EYLA 5DAUA 1LTRD 1TR5A 1MBYA 3I4NH 2D0PA 2BH8A 4EVOA 4DV1L 1WTWA 5IT9L 5JEAH 3CD6A 3TMEA 1GO3E 1JJ2A 1EYCA 4C1NI 1LLRD 4R8NA 3MXPA 1TS4A 1GXDC 2CW0D 4JI2L 4GN3B 3ULLA 4CKCA 3QO2A 3EJIA 1IBML 3L0OA 4J6HA 4G7OC 1E24A 4OELB 3GP7A 4RKBA 2AUJD 4HIDA 3BZKA 5E3FA 2N49A 3DM3A 4A3BB 2OTLA 4NDXA 5FLXc 3FEWX 3BVZA 1OXXK 1TWHH 4HSPA 4A3EG 5A2QL 4DA2A 3L2PA 1X3QA 3K7AH 2V4DA 3PCOB 1DONA 1D7QA 4QIWE 5JJLA 2MO1A 1O78A 3K6OA 4I7ZC 2Z6BA 3V2TA 2PI2E 4O2DA 5FO8B 1HHVA 1SNQA 3S2HH 4B3SQ 5ELBA 4IUUA 1GUSA 3MEFA 1IYUA 5I6YA 3CCSA 1CA6A 4A3EB 4HCSA 1AH9A 1BCPC 4X62L 2X69A 3JAML 4DV3Q 5LHY1 1IKMA 3CCUA 1K0RA 2E2IH 4OIKA 1TU2B 3K5OA 1EQVA 2K1BA 1C0AA 3AYHB 3DUZA 4A3IH 4RMFA 5DM63 4CBVA 2KEDA 1P8LA 5C4XH 4S3SA 1UE6A 3PGZA 3TS2A 3OYYA 1QNKA 2F0SA 3S14H 4FVMA 1RTOA 5AJ3Q 1LABA 4FXGC 4UAIA 2DGYA 1E2WA 2D0OA 3GTLB 1J9OA 1HCZA 4JC0A 2JA6G 4KV6A 3SK5A 2UUCQ 1Q1EA 1YHBA 4HJ8A 4DR5L 1HFGA 2K5DA 3SDZA 1ZEQX 5I2YA 4C3IH 4P71A 3S14B 4MN3A 3H6MA 4NKLA 1FVIA 4B9XA 4DXGA 2B2TA 1DD2A 1Y14B 4A3KH 1MGSA 2F0NA 4X3TA 4GLAC 3L7ZC 2I5LX 1LTTD 2IX1A 2JA8H 2CW0C 5ELNA 3E0JA 3H15A 2EZVA 2OCEA 3IFDA 1WI5A 4DV3L 1KXLA 1LTID 3I90A 4X3KA 1VQAA 2L55A 4JI8L 2I0QA 5I6WA 5C44B 1IBKL 1LYLA 1VQ9A 4DR3Q 2RHSB 3NEMA 3I56A 3E9IA 1TS5A 3KJOA 1EOTA 3K5LA 3S2DH 3K7AB 1BCPD 4DV4L 1GUNA 4C3IB 3ZJYC 5LMNL 2ZTCA 4Z9CB 5J22A 1SNOA 2FJ2A 2B63G 2A69C 4L5RC 1BCPB 4ZRZA 1QNUA 3QOLA 2R92B 4LF5L 3S17H 3G6EA 4C1NK 3KYHC 1N34L 2QEXA 4N8FA 1CSPA 3E9HA 4NXNL 1JT8A 4APVA 1KAAA 1TWGH 1HRJA 3TP6A 4EQOA 3K58A 2PNRC 2L12A 3DHQA 4TVAB 2LXJA 3OMCA 1R4PB 2IX3A 4PV1C 5IODA 3S17B 4IPGA 2VXWA 1XNQL 2PYKA 1VQJA 5GROA 1QUQA 4IOAA 2UUAQ 3FKIG 4M1UB 2MFIA 3MFYA 3MEHA 4KJOA 4C3JH 4NXMQ 2NZ1D 1YNNC 5FK9C 4JI6L 2MGSA 3W1BA 3S2DB 3MXGA 4TKOB 4B3SL 5BR8Q 4JI5Q 4IFDH 1I94L 1TXYA 3S1RB 4A3MH 3I3CA 4JI0L 3M3YH 3CMEA 1VQOA 4U673 4JBKA 5J3BA 2QILA 4B3MQ 4DR6L 2CWPA 2F0IA 4GOPC 1V9PA 2B63H 5A35A 1SN8A 1YHAA 3BZCA 5C0XH 1CA5A 3LWEA 2B2WA 2KEEA 4LFAL 1FJGQ 4QY7A 3IAYA 2F52A 4DV2L 3VR2A 1YHQA 1YVCA 2E75C 4CKEA 3I4MB 3K81C 3ERQA 3I73A 4H44C 3SE0A 3U4VA 4KMUC 5IP9H 4RH6A 1TWAH 4KD4A 4FF4A 2ZJRA 1OO9B 4NXML 1XMQQ 1EOVA 2J7ZA 5COYA 1K0SA 2JA7H 1BXTA 4DNIA 2K5HA 3CCRA 1Q90A 3EVQA 1VQ8A 4KI0A 5G3LD 1B8AA 3Q22A 2UU9Q 3OMGA 2WAQE 3MXUA 5FJ8H 4C3HG 1Y8NB 2VB3X 2MP1A 4JBMA 1V1QA 1H9KA 1N9WA 4JOIC 1JJGA 4IFDI 3RLFA 5EAYA 2QW7A 1SR3A 5IGDA 4TSSA 5IP7G 2A5HA 5M5YH 2IPKD 1TIID 4IQZA 1IYJB 1PRTF 4KY7A 2PQEA 1STGA 3SGIA 2XGTA 5ELCA 1HR0L 1SYCA 5K36H 1TT2A 4H0LC 1M90C 2F0FA 3FRPB 1Q1BA 3MXNA 4PZ6A 3GTMH 4R8IA 4DR5Q 4GKKL 1I6HH 1L0WA 4L5TA 3KLSA 4ZKCB 1BUVT 1I3QB 2KQ3A 1U9RA 2A73B 4DR4L 3MZ5A 2QDBA 2ID0A 1SE3A 3TS0A 5GAGC 1W6JA 1Y1VH 2RQXA 1HH2P 4P75A 3STBC 1E0BA 1CHQD 1NAPA 4AQYL 3UI2A 5IT9c 2A68D 3FPPA 4OWTB 1CKMA 5E7NA 4DU9A 4X64L 3P1HA 2G9HD 4LW1A 3I2ZA 1IBLQ 2EJFC 4A3GG 4X64Q 1KIXA 1U4RA 4CJ0B 1JORA 3HOYG 2OEOA 1WD1A 4B9WA 3GDEA 1SBBB 2R6GA 4MHEA 2F3VA 1Y1WG 4C56C 1K83H 4N8X1 3J81E 1D6EC 1PFNA 2IT1A 1Y8OB 1OTCA 3WDNA 1VMPA 5D3DA 5KYLA 1AN8A 1S3OA 5IGEA 5DNFA 3Q24A 2B39A 3N6RA 2L4NA 3H0GH 1JR0D 5AJ3L 3J7YW 1O80A 2KVMA 1KAWA 1EIFA 2NVXH 1DZ1A 2NWGA 2Z6KA 4EX5A 4O1NA 4DV0L 2Q8TA 2NN6G 3HEJA 3WOFA 1FL0A 3KDFA 4DAVA 1R9TH 2VUMH 4NB3A 3P75A 1Q7YC 1M1KC 2UUCL 1SXTA 1I50B 5C3WA 1ASZA 3URYA 4WRDA 1PDQA 4FP5D 4POGA 1T5XD 1MIUA 3HGBA 5IYDG 3AEVA 3HOUB 3A8JE 1BO0A 5IWAL 1VMCA 5IYCH 3I8ZA 4EQNA 3J80i 4ZQ3A 1PH6A 5ELDA 2ICEC 1GKHA 4QCLA 1L0YB 5CC4A 5IYDH 1G91A 1GHJA 4A75A 5E4WC 3G6JB 2XVSA 1S5FD 3EFXD 3TSSA 1PZKD 4IUTA 1CSQA 2RHQB 4A3JB 5FJ8G 4LMQD 4LUOA 2G5DA 2ZJQA 1FGBD 2F0KA 1LT5D 3U9SA 4DV2Q 4BBSG 3J7A5 4LF8Q 1HUNA 2E2HH 1MD2D 4CKBA 5C4HA 5HGQA 1S5ED 4A3IG 1F9QA 5E1FA 4X65L 1N8RC 3W5OA 1K8OA 4A3JH 1H95A 3GTOH 2K52A 3TBIB 5L37A 2ZT9C 2MQHA 2I5MX 3S1MB 1H9SA 1PFSA 4UHVA 3DM1A 1B3QA 3PIPA 1VQDA 4BY7H 4KKSA 1J6QA 4Y7NH 5CORA 2Q2HA 5BR8L 5EPLA 3BVMA 4LF4L 3I4NB 1Y1VB 2A8VA 1X32A 3O13A 2OQ0A 1PH4A 3J80L 3PF5A 1G51A 2A69D 3CW2C 3UDGA 1BQQT 3BVGA 1B1ZA 5FKAC 2N3SA 1L1OB 2NVYH 4A93G 3QWNA 4KHPQ 2LKVA 2C9OA 5F2DA 4JV5L 1X6OA 1LTSD 5LL6X 3S9WA 1N34Q 2K5NA 1ZKOA 2UUBL 1YEZA 2VB2X 3FP9A 3PUZA 4G4KA 4C3JB 4J15A 1IW7D 1GD7A 4K5XA 2N8NA 2TSSA 2YTXA 4RGTA 1IW7C 1OXVA 2A1AA 4DNTB 4HIMA 2HQLA 1EY4A 2BCOA 1SDFA 3S1NH 4BA2I 3BS1A 4IO9A 2JEAI 4MTNA 2OTJA 1O7YA 4OXPA 2UXCL 5GADC 2B8GA 3GTJB 4DR1Q 4PMWA 5M5XH 3C1EA 4AIMA 1PH2A 2WAQB 3M4PA 4I7AA 3OW2A 1SE4A 1VQIA 5C5MA 4H13C 2PMZE 2NVYB 5H1SE 2Z8LA 2R93G 4QL5A 4UY8C 1B3AA 5J39A 1KLUD 1NSNS 4ILWA 1C4QA 2K32A 1SLJA 2R7DA 1QVGA 2EOTA 2VQFQ 1H9RA 1ML0D 4KHZA 3CCEA 4IALA 1QG7A 2F0EA 4IOCA 4QUCA 2F0WA 2Q2TA 3KFUA 1WOCA 1JB7A 5KRUA 5JVG3 3CRKC 1AZQA 2JA7B 2IY5B 3M7GA 1EQRA 1PH7A 2FINB 2DJFC 4BBRB 4IPHA 2EQSA 5CV9A 5ELFA 1VQMA 2F0HA 2QEJC 5C3EG 4L63B 4YCWA 1TS3A 1NMFA 4YHHL 1IXRA 2WV6D 3VR4A 4A3CG 1KNAA 1IL8A 5FLXE 4LK1C 1HZAA 5FLMH 2V1CC 2VW9A 3RLOA 1U4LA 4KLKA 1Z7TA 4LF9L 4DV7Q 1FNUA 3GV3A 4UDUC 3MWYW 3HOVG 2PMZB 3OSOA 3PMFA 4IPDA 4K5WA 4HN7A 2K75A 5EGTA 3G7LA 1WTHA 5C3EB 1C8CA 2ASBA 4KN7C 4OO1H 4RCNA 1F2LA 2HUGA 4X66L 3KF6A 4IPCA 3M4QA 3D4RA 5EKKA 2ICIA 2BDNA 5C0XJ 1WTOA 1G6PA 3I55A 4MZ9A 1D5ZC 4BBRG 1EY9A 1BR9A 3K80C 1SNDA 1GJXA 2K50A 2JP1A 2WINB 1XYIA 3HP3A 5LMNW 2WIIB 2F0MA 3L9AX 2HT1A 3JAMc 1SJHD 4WFN3 2PPBC 1PH9A 4X6AH 1NE3A 1YNJC 2E2JB 1DGSA 1TY2A 5EPKA 1VQHA 2ES2A 2AMCB 1I4PA 1A8VA 1PH5A 4DV6L 1HZBA 2F03A 3EBEA 2SNSA 2ZTEA 4DV7L 4BBSB 1DOMA 4ME5A 1QB5D 5IYBG 1YJ9A 3H3VH 5M3MH 5C4ZA 4CDCC 1QCBD 4IUQA 3PO3B 1M8AA 3S1QB 3NELA 3M3YB 4Y7NB 2NVXB 3AMUA 2HDLA 3G48A 4GLVB 1F2MA 1Y8PB 2K03A 2N55A 4JI0Q 1SE2A 5HGTA 1GVPA 2WKCA 2EXDA 2NYZD 4RGMA 3R3OA 4V0BA 1HR0W 4DV1Q 5JEAJ 2RCNA 4LF6L 3S1NB 4OO1I 4IJHA 1EIGA 3SXHA 2XNAC 1TWHB 1BBWA 2EY6A 4MIUA 4HTHA 4DR3L 4GKJL 1VQKA 4X3SA 4JI7Q 1XJVA 1X3EA 2UXDQ 4BBRH 4F8MA 3I91A 4C2MH 3MTSA 1N33Q 4KTAA 2RDFA 1PTOF 4HR7B 3U9OA 1CI3M 3PUYA 3GTGB 5IYCG 1S5DD 4WJWA 5GAEC 4KKUA 3OW7A 3NWTA 3UDFA 2F0LA 2DNEA 2BH2A 4R4CA 1NR4A 1RIPA 1WTVA 1VF7A 2KCCA 4IFDJ 1KL9A 2XN9C 1W6KA 1YITA 2A19A 1IBLL 4P73A 5C3XA 5E4XA 2QCPX 1NJIC 1MI2A 3NTHA 4RAUC 3D31A 1XWEA 1SJED 1D2BA 2AKWB 2A74C 3RZOH 2KCTA 2DN8A 3X3MA 4DFAA 4QGUA 5HY6A 4EGVA 3KUPA 2K5VA 2WFWA 1P16A 3W3AA 1HZCA 4ID6A 4BY7B 1UAPA 4A3FH 1WCMG 2RSOA 1XMOQ 2XRQD 3HOXH 1GOZA 5KGUA 4JI7L 2EIFA 2Y0SE 4OWXB 2IHFA 1II3A 3ND9A 2YV5A 2L1BA 4JI5L 3HOZG 1FR3A 4A3FG 3DEPA 1HR0Q 5EKLA 3VYRA 3N52A 4LF6Q 4QQBX 3CCLA 3OIQA 3CQZH 1MSGA 1SMYC 4AYBG 1WTXA 4A3GB 1A3VA 4A3MB 2IX0A 4A3KB 2ATWA 5CYUA 1LTBD 5GAHC 2B3GA 1LUZA 3A54A 3FHWA 4A76A 1EFWA 1I4RA 1M4VA 2HCIA 2K7VA 1V8QA 1I4XA 1QOHA 4IUPA 1SYGA 1Q8IA 3T1HQ 1EWIA 4PMBA 2K14A 2JE6I 2HDMA 3I4MG 1RF2D 4A3DB 3HS0C 4XYOA 3JAMi 2K05A 4WJ4A 1PLFA 2QKIC 1STEA 1AE3A 1K9MC 1HTPA 4YWLA 4A3BG 3SVMA 5DLQE 3ULPA 4LFCQ 1JJCB 4ULLA 1VCIA 1B44D 3HOWH 3R2IA 4JG2A 2YU9H 1XMOL 4J1MA 1HTLD 4OX9Q 3CKIB 1KRSA 1FNWA 1I4HA 4JI8Q 1EFID 4IZ8A 2Z4HA 3CU7A 4LF9Q 4PNYA 1IYVA 1JOQA 2B2UA 2R93H 4IJLA 4MTKA 1IKLA 5CR3A 4NPSA 2KENA 3MXNB 3L3OC 2F0TA 4FO2A 2HD3A 1U4MA 5C3EH 2ZXPA 1LT4D 3A8IE 1JWMD 1SFOH 3J7AF 1VQ7A 1IHZA 3KF8A 3VR6A 2MPMA 4YCUA 2F4VL 2WB1B 3LNNA 5JOBA 4L5SA 2NB0A 4K2LA 1WCMB 1GUOA 3A7AB 4DN4M 3PQIA 2EY1A 4JV5Q 4C2MB 1ZYRD 4EQPA 1SFOB 1HPCA 1EEFD 1LACA 3FKIB 4L6TB 1PTOC 3F1ZA 1CK1A 3K0XA 5EJWA 3OWFA 2E5LL 3FMCA 4OO1G 3W2DA 3CMAA 1XMQL 4ALPA 4FNFA 3TN2A 2BE5C 4ZAIA 2KBNA 4HEDA 1QVCA 1STHA 3I7FA 4OIJA 1ESRA 1VF5C 4DK0A 1CUKA 4BWGB 1IBMQ 3HOYB 2I5HA 1Q3LA 1SSOA 3S2HB 3H3VC 4JOIA 1PYWD 1S40A 3DMUA 1E1OA 2K28A 3B6YA 3T51B 3CCQA 2TMPA 2LS01 5IIFA 1FJGL 2O2LD 5HURA 3A74A 4K5VA 1YJWA 1OXSC 5LMNQ 1WCMH 2XSCA 5IGCA 2JK8A 2FMMA 2VQFL 3LWUA 3BJUA 3AU7A 4M8AA 2KUMA 5M5WB 2NVTB 1SYEA 3OWEB 3SR1A 2F0JA 2ZXRA 3IL8A 1HQMC 5M3FG 2R7ZG 3K57A 1Q81C 2J0TD 4C3HB 2DUDA 1SNPA 1VQGA 2UUAL 1DJRD 2JA6H 4QUFA 1VQ5A 4LF8L 2F0UA 4PG3A 2Q2IA 3OHXC 1GM5A 2GVBA 2VQEQ 1S72A 4ME3A 1EWCA 3J81c 3BDLA 2HHHQ 1D8LA 1H9JA 3P7JA 4DUYL 5K5PA 1STYA 4GN4B 5IOCA 5IP7H 3RNUA 1N32Q 2WP8J 3RZOB 3TZUA 2ZTDA 1K8MA 1X54A 2DY8A 1N32L 2DJGC 4JI3Q 4E6IA 3OTOL 1TWFH 4N9PA 5IE8A 3OOCA 4UPAA 3H94A 4CDDC 4B3RQ 2CHBD 2XWBB 4K14A 4WORA 4LUZA 2Z9HA 2JA5B 2O5JC 2E8GA 4ZK9B 3RN5A 1CT1D 2QA4A 1WYDA 3HFZB 1WD0A 4LJZC 1RJTA 1UNSA 2VL6A 4AQYQ 1I5FA 3JAME 3ND8A 2EDGA 3ZYYX 4C3IG 1UUPA 1HZ9A 1VQLA 1DCZA 3RN2A 3HRZC 3MFGA 3RD4A 1CM9A 2EY5A 3VA5A 3NTIA 3M4OB 1BVSA 1UE1A 1AW7A 1ASYA 4JCVE 4A93H 3TRZA 1HNZQ 1SAPA 1F9RA 1Q12A 3R2TA 2CWAA 1VQPA 1ILPA 3NQIA 5A2QE 1TWAB 5JPNC 1GUTA 1Z9FA 3TDQA 4DV0Q 1QZGA 4RHRA 4GS3A 4FF1A 3SHLA 4KD3A 1DM0B 2JA5H 2WKDA
chains in the Genus database with same CATH topology
4RMFA 1EQRA 1NY4A 1PH7A 4A3GH 3HOXG 1FGUA 2NN6I 1CKNA 4IPHA 4DAMA 1P8LA 5C4XH 1Y1WH 2EQSA 1VQMA 1UE6A 3PGZA 3TS2A 2Z6KC 3OYYA 5C3EG 4YCWA 2QGQA 1XPUA 3PO3G 3S14H 1NMFA 5AJ3Q 1E1TA 5C4JH 4HJ9A 1KD1C 3CPWA 4YHHL 1IXRA 2DGYA 2VZAA 3KLWA 4L5QA 4R4OA 2D0OA 5C44H 2K4KA 3CAMA 4A3CG 1HZAA 5FLMH 2V1CC 4JC0A 2VW9A 1L1OC 2JA6G 3RLOA 2UUCQ 1Q1EA 5C0XI 1YHBA 4HJ8A 4DR5L 3ULJA 4KLKA 2LSSA 4LF9L 4DV7Q 1Q82C 3ICEA 3HOVG 4C3IH 4P71A 2PI2A 1VQEA 4IPDA 3CXCA 4JBWA 1OXUA 1PHJA 3EIVA 2K75A 4WJ3M 1FVIA 3GTLH 2ASBA 2PNHA 4MNOA 2WB1E 1Y14B 4EQ5A 4A3KH 2HIXA 4X66L 3KF6A 4IPCA 3M4QA 4K0KL 4DAYB 4GLAC 4R1JA 1TWCH 1B7YB 3L7ZC 2I5LX 1VQ4A 2IX1A 5C0XJ 2JA8H 1G6PA 1OXTA 1IZ6A 4JBJA 3I55A 4MZ9A 1RL2A 5ELNA 4BBRG 4DKAC 3H15A 1WFQA 3K80C 2OCEA 1WI5A 4DV3L 1KXLA 3TQYA 2K50A 5LMNW 4JI6Q 2HT1A 3S16H 1VQFA 2YTYA 1Y1VG 4BY1H 4JI4L 3JAMc 1VQAA 1VS0A 4JI8L 2I0QA 1N33L 1IBKL 2E5LQ 1PYBA 2RF4A 1PH9A 1LYLA 4X6AH 1NE3A 3RZDH 2UXBL 1DGSA 2CQOA 2H5XA 2BA0A 1BKBA 1VQHA 2ES2A 1VQ9A 3RLNA 2AMCB 4DR3Q 2RHSB 3NEMA 3I56A 1EIYB 1A8VA 1PH5A 4DV6L 3E9IA 1HZBA 2OQKA 3KJOA 4OWWB 4DK6C 3EBEA 3S2DH 3E0EA 2ZTEA 4DV7L 4DV4L 3G71A 2NVTH 4TQUS 3ZJYC 5IYBG 1YJ9A 3H3VH 5LMNL 2ZTCA 5M3MH 4A3LH 4LWCA 3PF4A 2KHIA 2UXCQ 3J81j 1IL2A 4FDBA 2B63G 1U0LA 3NELA 4OONA 4A3JG 4L5RC 2OWOA 3OTOQ 1JMCA 4LF5L 3S17H 3G6EA 1Q86C 3M4OH 3KYHC 4B3RL 3G48A 4GLVB 1N34L 1BBUA 2QEXA 3GD7A 3T1YL 4JI0Q 4LNQA 1GVPA 1CSPA 3E9HA 2EXDA 3KF8B 4NXNL 1JT8A 4APVA 1HR0W 4NXNQ 4A3BH 1TWGH 5JEAJ 4DV1Q 3S1QH 2RCNA 4LF6L 4YY3Q 4OO1I 4IJHA 3T1YQ 4TVAB 2LXJA 1BBWA 3CCJA 2Y0SG 3KDFB 1E22A 1MJCA 4IPGA 2ZM6L 3PUVA 2HHHL 4DR3L 1XNQL 4GKJL 1VQKA 4JI7Q 4LF7L 5IP9G 1X3EA 1VQJA 5GROA 1XJVA 2UXDQ 2UU9L 4BBRH 2UXDL 1QUQA 2YTVA 3CF5A 4UP9A 3U50C 2UUAQ 4LF4Q 1YNXA 3FKIG 4IOAA 4C2MH 2MFIA 1N33Q 3GTPH 2GN5A 3KOJA 3PUYA 4C3JH 4NXMQ 4JI6L 5IYCG 3W1BA 5GAEC 4B3SL 5BR8Q 2D62A 4P74A 3U58A 4JI5Q 4DR7L 3UDFA 1I94L 1JJGA 1TXYA 2JA9A 2WAQG 3F2CA 2BH2A 3I4NG 4R4CA 4P72A 1Z47A 1EQQA 3M85A 1RIPA 3RR5A 4A3MH 2F4VQ 3CC4A 4JI0L 4IFDJ 1KL9A 3M3YH 5C44G 3CMEA 1VQOA 2F3IA 1YITA 1K8AC 2A19A 1IBLL 4JBKA 4P73A 5J3BA 1E7ZA 4B3MQ 4DR6L 2CWPA 4K0KQ 1NJIC 3D31A 3PUWA 1W2BA 4GOPC 3KJPA 2AKWB 3A5UA 3RZOH 1V9PA 1X3GA 2KCTA 2B63H 2AWNA 4Y52H 2VS1A 1SN8A 1YHAA 3BZCA 4YWMA 1L1OA 2YYZA 2ZM6Q 4QGUA 1QUQB 2GVAA 5HY6A 3UDXA 2VUMG 4LFAL 1FJGQ 3GTKH 2K5VA 2WFWA 1P16A 5JEAG 1KHIA 4QY7A 1HZCA 4LFAQ 4POFA 4DR1L 3VDYA 3CC2A 4DR2Q 2B29A 2F52A 4DR4Q 3ERSX 1C7YA 4UP7A 4DV2L 1YJNA 4A3FH 1YHQA 3CP0A 1WCMG 1YVCA 1XMOQ 4BBSH 3HOXH 4A3DH 4JYAL 5ELOA 3K81C 2EIFA 2Y0SE 4JI7L 4OWXB 2IHFA 4BY1G 3U4VA 5IP9H 1XTDA 2YV5A 1YZ6A 4JI5L 3HOZG 4B3TL 1TWAH 4A3FG 5M5WH 3T1HL 5IY0A 2ZJRA 1HR0Q 4NXML 1XMQQ 1EOVA 3PIOA 4KHPL 2L15A 4H02A 2JA7H 3M9BA 4LF6Q 3Q8DA 4QQBX 4DNIA 3W1GA 2C35B 1A0IA 2K5HA 3CCRA 3CCLA 1VQ8A 3D0FA 3CQZH 4JYAQ 4KI0A 2UU9Q 1B8AA 3AFPA 4DUYQ 3GO5A 3ER0A 2WAQE 5FJ8H 1KRTA 4AYBG 4HIOA 2JA7G 2ATWA 4A3KG 2IX0A 4A3MG 5GAHC 4JBMA 1V1QA 1N9WA 4JOIC 1K73C 3PO2H 4BXXH 1EYGA 4IFDI 2B3GA 4IFDG 1LUZA 3FHWA 4A76A 1EFWA 3RLFA 4X62Q 5EAYA 1J5EQ 1SR3A 5IP7G 1B70B 1X3FA 5M5YH 4DV5Q 1XNRL 1I3QH 1IYJB 1HJPA 3PSIA 3SGIA 1HNZL 3LGJA 1O7IA 2KCMA 2CFMA 2XGTA 2R92H 1KC8C 3T1HQ 1EWIA 1X9NA 1HR0L 2KHJA 4LF5Q 1M90C 3GTMH 1Q1BA 2K14A 4PZ6A 1EUJA 2JE6I 4DR5Q 3H3VI 4GKKL 1I6HH 3H0GG 3I4MG 3M7NA 1G291 1L0WA 4L5TA 4PZ8A 2UXBQ 3JAMi 5JJKA 1C9OA 1QVFA 4WJ4A 4DR4L 1QZHA 3S1MH 1AE3A 2ID0A 1K9MC 3TREA 3TS0A 4YWLA 5GAGC 4A3BG 4B3TQ 1Y1VH 5DLQE 4QJFA 4R4TA 1HH2P 4P75A 3STBC 4AQYL 1JJCB 3ULPA 1VCIA 1SROA 4LFCQ 3HOWH 3IRBA 5IT9c 4JI1Q 4JG2A 2YU9H 4DUZL 1A63A 1XMOL 4OWTB 1CKMA 1SE8A 5E7NA 4OX9Q 3K7UC 4X64L 1KRSA 4DPGA 2NVQH 4JI8Q 4DV4Q 3CC7A 4LW1A 3I2ZA 2JA5G 2JA8G 4LF9Q 1IBLQ 3TEHB 1K3RA 4AYBE 2AWOA 4GNXB 4A3GG 4X64Q 1E3PA 4IJLA 2NZHA 3NBHB 5IYBH 3GTJH 1KIXA 2R93H 3HOYG 3WWVA 3J80c 4NPSA 2KENA 4JI3L 3MXNB 2R7FA 3GDEA 2WB1G 5C3EH 2R6GA 3CCMA 3A5ZB 4GNXC 3GTQH 4A4IA 1Y1WG 3HOWG 5LMUQ 1K83H 1L2FA 1SFOH 1PH1A 1YI2A 1NMGA 1VQ7A 2IT1A 2LXKA 2MNAA 1OTCA 4YCUA 2F4VL 1VQBA 2UUBQ 1S3OA 3UDIA 1X55A 1CKOA 1LM0A 3G4SA 1J5EL 4L5SA 4LF7Q 3H0GH 1SMXA 1VQNA 5AJ3L 4JV5Q 1KAWA 1Q46A 1CKNB 1EIFA 3STBD 2NVXH 2XTIA 5K36G 2Z6KA 4EX5A 4X66Q 4DV6Q 3HOYH 1PH8A 4DV0L 1LTLA 1YBYA 1HNWQ 1XNRQ 2NN6G 1FL0A 3KDFA 1R9TH 2VUMH 4NB3A 1M1KC 1Q7YC 2UUCL 2NZOA 4GNXA 3F1ZA 1UE5A 1JE5A 1ASZA 3K0XA 3I4MH 1SRUA 4LFBQ 2E5LL 4POGA 4RG1A 2E2JH 1MIUA 3AEVA 5IYDG 4OO1G 4JI4Q 3CMAA 1XMQL 4AH6A 4ALPA 5IWAL 5IYCH 2R7ZH 2KBNA 1YIJA 1HNXQ 1WJJA 1QVCA 2AHOB 3AQQA 3I7FA 3J80i 3J7ZC 1IBMQ 1CUKA 4YY3L 1PH6A 2I5HA 4C3HH 4DK3C 1X65A 1GKHA 5IYDH 4JOIA 1NTGA 1S40A 1W3SA 4A75A 4A3EH 1E1OA 4YHHQ 3B6YA 1V43A 3CCQA 4GN5A 3PO2G 4BXXG 4YCVA 2JJQA 4UP8A 1CSQA 2PQAB 3U4ZA 1FJGL 3JC66 2RHQB 5JJIA 4XTCS 3GTGH 1UWVA 5FJ8G 4PZ7A 3HOVH 3A74A 4GOPA 1YJWA 3BU2A 4LUOA 3F2DA 1KQSA 2ZJQA 3AFQA 1MKHA 1OXSC 3S1RH 2R92G 4DV2Q 5LMNQ 2CCZA 3KF6B 4HJAA 1WCMH 4BBSG 2JK8A 1PVOA 3J7A5 4LF8Q 2N78A 1UEBA 2VQFL 3F8TA 2E2HH 5HGQA 3BJUA 1VQCA 3I4OA 5M3MG 4DUZQ 4R4IA 3HOZH 4A3IG 2JEBI 4X65L 1N8RC 4XIGS 3W5OA 4A3JH 3A0JA 3DLLA 1I50H 1H95A 4A3LG 3GTOH 2K52A 1PA6A 1IBKQ 2MQHA 2I5MX 3PO3H 1PFSA 4LUVA 5M3FG 2R7ZG 3PIPA 1Q81C 1VQDA 5C0XG 4HJ5A 4BY7H 1J6QA 3HKZE 4Y7NH 2Q2HA 2DUDA 1XPOA 1VQGA 5BR8L 4R4QA 4DR7Q 1HNWL 4HIKA 2UUAL 2CKZB 4JI2Q 1PYSB 4LF4L 2A8VA 1PH4A 1VQ6A 2OQ0A 2JA6H 1VQ5A 3PF5A 4LF8L 4PG3A 1G51A 2Q2IA 1GM5A 4GKJQ 3CW2C 3UDGA 1I94Q 4LFBL 2BA1A 4BY7G 3HOUG 2Z0SA 2GVBA 2N3SA 2FXQA 2VQEQ 2ZJPA 1L1OB 2NVYH 1S72A 3J81i 4ME3A 3HKZG 3S24A 3J81c 4HJ7A 2HHHQ 1XNQQ 1D8LA 4A93G 4DUYL 3I4NH 3CCVA 2D0PA 3FKIH 2BH8A 4DV1L 3UE1A 4KHPQ 4GN4B 5IP7H 3PV0A 3K8AA 3RNUA 1X6OA 4JV5L 1N32Q 3CD6A 2WP8J 1GO3E 2ZTDA 4YWKA 1JJ2A 1PH3A 1N34Q 1X54A 2K5NA 1MJEA 3NENA 4A3DG 4JI2L 1N32L 4GN3B 3ULLA 4JI3Q 2UUBL 1YEZA 3OTOL 1TWFH 1IBML 3L0OA 5IE8A 3CPFA 3FP9A 3PUZA 4UPAA 4DR2L 1E24A 4B3RQ 3F2BA 4J15A 2IHEA 4LUZA 1GD7A 2N8NA 1T9HA 2YTXA 4HIDA 3HKSA 1OXVA 5GQOA 2A1AA 4GOPB 3BZKA 4HIMA 2E8GA 2HQLA 4O0AA 3S1NH 4BA2I 5FLMG 2N49A 3RN5A 3DM3A 2OTLA 1N36L 4A3CH 4IO9A 2JEAI 4MTNA 2OTJA 2QA4A 1WYDA 4OXPA 4BA1I 5GADC 3HFZB 2UXCL 1AE2A 5FLXc 4GLXA 5M3FH 2MO0A 2VL6A 4LFCL 1OXXK 1TWHH 4DR1Q 4PMWA 4AQYQ 4A3EG 1I5FA 2HIVA 3L2PA 5M5XH 1N36Q 1U5KA 2VQEL 4AIMA 1PH2A 3K7AH 3PCOB 1D7QA 1HZ9A 2JQOA 2MO1A 3M4PA 4QIWE 1VQLA 4OX9L 3OW2A 5JJLA 2ALYB 1VQIA 4B3ML 4DR6Q 2PMZE 3RN2A 5H1SE 4JI1L 3EN2A 3HOUH 2R93G 2PI2E 4QL5A 4UY8C 4O2DA 4X65Q 2Q2UA 1BVSA 3S2HH 3PUXA 3S15H 1SLJA 2R7DA 4B3SQ 5C4XG 1UE1A 1ASYA 1UE7A 4JCVE 1QVGA 5IWAQ 4A93H 2VQFQ 1XPRA 3TRZA 5LMUL 1HNZQ 2VNUD 1A62A 1X56A 3MEFA 1K8GA 1Q12A 2PQAA 2VY3A 3CCSA 4KHZA 3CCEA 4DV5L 3UE0A 1PV4A 2CWAA 1VQPA 1AH9A 4GKKQ 4X62L 4DV3Q 1Q8KA 4IOCA 3CCUA 1K0RA 1Z9FA 4DV0Q 1HNXL 2E2IH 2Q2TA 3KFUA 1QZGA 1WOCA 4GS3A 1JB7A 1NBWA 2JA5H 1C0AA 2IY5B 3AYHB 4A3IH
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4RMF A;  1EQR A;  1NY4 A;  1PH7 A;  4A3G H;  3HOX G;  1FGU A;  2NN6 I;  1CKN A;  4IPH A;  4DAM A;  1P8L A;  5C4X H;  1Y1W H;  2EQS A;  1VQM A;  1UE6 A;  3PGZ A;  3TS2 A;  2Z6K C;  3OYY A;  5C3E G;  4YCW A;  2QGQ A;  1XPU A;  3PO3 G;  3S14 H;  1NMF A;  5AJ3 Q;  1E1T A;  5C4J H;  4HJ9 A;  1KD1 C;  3CPW A;  4YHH L;  1IXR A;  2DGY A;  2VZA A;  3KLW A;  4L5Q A;  4R4O A;  2D0O A;  5C44 H;  2K4K A;  3CAM A;  4A3C G;  1HZA A;  5FLM H;  2V1C C;  4JC0 A;  2VW9 A;  1L1O C;  2JA6 G;  3RLO A;  2UUC Q;  1Q1E A;  5C0X I;  1YHB A;  4HJ8 A;  4DR5 L;  3ULJ A;  4KLK A;  2LSS A;  4LF9 L;  4DV7 Q;  1Q82 C;  3ICE A;  3HOV G;  4C3I H;  4P71 A;  2PI2 A;  1VQE A;  4IPD A;  3CXC A;  4JBW A;  1OXU A;  1PHJ A;  3EIV A;  2K75 A;  4WJ3 M;  1FVI A;  3GTL H;  2ASB A;  2PNH A;  4MNO A;  2WB1 E;  1Y14 B;  4EQ5 A;  4A3K H;  2HIX A;  4X66 L;  3KF6 A;  4IPC A;  3M4Q A;  4K0K L;  4DAY B;  4GLA C;  4R1J A;  1TWC H;  1B7Y B;  3L7Z C;  2I5L X;  1VQ4 A;  2IX1 A;  5C0X J;  2JA8 H;  1G6P A;  1OXT A;  1IZ6 A;  4JBJ A;  3I55 A;  4MZ9 A;  1RL2 A;  5ELN A;  4BBR G;  4DKA C;  3H15 A;  1WFQ A;  3K80 C;  2OCE A;  1WI5 A;  4DV3 L;  1KXL A;  3TQY A;  2K50 A;  5LMN W;  4JI6 Q;  2HT1 A;  3S16 H;  1VQF A;  2YTY A;  1Y1V G;  4BY1 H;  4JI4 L;  3JAM c;  1VQA A;  1VS0 A;  4JI8 L;  2I0Q A;  1N33 L;  1IBK L;  2E5L Q;  1PYB A;  2RF4 A;  1PH9 A;  1LYL A;  4X6A H;  1NE3 A;  3RZD H;  2UXB L;  1DGS A;  2CQO A;  2H5X A;  2BA0 A;  1BKB A;  1VQH A;  2ES2 A;  1VQ9 A;  3RLN A;  2AMC B;  4DR3 Q;  2RHS B;  3NEM A;  3I56 A;  1EIY B;  1A8V A;  1PH5 A;  4DV6 L;  3E9I A;  1HZB A;  2OQK A;  3KJO A;  4OWW B;  4DK6 C;  3EBE A;  3S2D H;  3E0E A;  2ZTE A;  4DV7 L;  4DV4 L;  3G71 A;  2NVT H;  4TQU S;  3ZJY C;  5IYB G;  1YJ9 A;  3H3V H;  5LMN L;  2ZTC A;  5M3M H;  4A3L H;  4LWC A;  3PF4 A;  2KHI A;  2UXC Q;  3J81 j;  1IL2 A;  4FDB A;  2B63 G;  1U0L A;  3NEL A;  4OON A;  4A3J G;  4L5R C;  2OWO A;  3OTO Q;  1JMC A;  4LF5 L;  3S17 H;  3G6E A;  1Q86 C;  3M4O H;  3KYH C;  4B3R L;  3G48 A;  4GLV B;  1N34 L;  1BBU A;  2QEX A;  3GD7 A;  3T1Y L;  4JI0 Q;  4LNQ A;  1GVP A;  1CSP A;  3E9H A;  2EXD A;  3KF8 B;  4NXN L;  1JT8 A;  4APV A;  1HR0 W;  4NXN Q;  4A3B H;  1TWG H;  5JEA J;  4DV1 Q;  3S1Q H;  2RCN A;  4LF6 L;  4YY3 Q;  4OO1 I;  4IJH A;  3T1Y Q;  4TVA B;  2LXJ A;  1BBW A;  3CCJ A;  2Y0S G;  3KDF B;  1E22 A;  1MJC A;  4IPG A;  2ZM6 L;  3PUV A;  2HHH L;  4DR3 L;  1XNQ L;  4GKJ L;  1VQK A;  4JI7 Q;  4LF7 L;  5IP9 G;  1X3E A;  1VQJ A;  5GRO A;  1XJV A;  2UXD Q;  2UU9 L;  4BBR H;  2UXD L;  1QUQ A;  2YTV A;  3CF5 A;  4UP9 A;  3U50 C;  2UUA Q;  4LF4 Q;  1YNX A;  3FKI G;  4IOA A;  4C2M H;  2MFI A;  1N33 Q;  3GTP H;  2GN5 A;  3KOJ A;  3PUY A;  4C3J H;  4NXM Q;  4JI6 L;  5IYC G;  3W1B A;  5GAE C;  4B3S L;  5BR8 Q;  2D62 A;  4P74 A;  3U58 A;  4JI5 Q;  4DR7 L;  3UDF A;  1I94 L;  1JJG A;  1TXY A;  2JA9 A;  2WAQ G;  3F2C A;  2BH2 A;  3I4N G;  4R4C A;  4P72 A;  1Z47 A;  1EQQ A;  3M85 A;  1RIP A;  3RR5 A;  4A3M H;  2F4V Q;  3CC4 A;  4JI0 L;  4IFD J;  1KL9 A;  3M3Y H;  5C44 G;  3CME A;  1VQO A;  2F3I A;  1YIT A;  1K8A C;  2A19 A;  1IBL L;  4JBK A;  4P73 A;  5J3B A;  1E7Z A;  4B3M Q;  4DR6 L;  2CWP A;  4K0K Q;  1NJI C;  3D31 A;  3PUW A;  1W2B A;  4GOP C;  3KJP A;  2AKW B;  3A5U A;  3RZO H;  1V9P A;  1X3G A;  2KCT A;  2B63 H;  2AWN A;  4Y52 H;  2VS1 A;  1SN8 A;  1YHA A;  3BZC A;  4YWM A;  1L1O A;  2YYZ A;  2ZM6 Q;  4QGU A;  1QUQ B;  2GVA A;  5HY6 A;  3UDX A;  2VUM G;  4LFA L;  1FJG Q;  3GTK H;  2K5V A;  2WFW A;  1P16 A;  5JEA G;  1KHI A;  4QY7 A;  1HZC A;  4LFA Q;  4POF A;  4DR1 L;  3VDY A;  3CC2 A;  4DR2 Q;  2B29 A;  2F52 A;  4DR4 Q;  3ERS X;  1C7Y A;  4UP7 A;  4DV2 L;  1YJN A;  4A3F H;  1YHQ A;  3CP0 A;  1WCM G;  1YVC A;  1XMO Q;  4BBS H;  3HOX H;  4A3D H;  4JYA L;  5ELO A;  3K81 C;  2EIF A;  2Y0S E;  4JI7 L;  4OWX B;  2IHF A;  4BY1 G;  3U4V A;  5IP9 H;  1XTD A;  2YV5 A;  1YZ6 A;  4JI5 L;  3HOZ G;  4B3T L;  1TWA H;  4A3F G;  5M5W H;  3T1H L;  5IY0 A;  2ZJR A;  1HR0 Q;  4NXM L;  1XMQ Q;  1EOV A;  3PIO A;  4KHP L;  2L15 A;  4H02 A;  2JA7 H;  3M9B A;  4LF6 Q;  3Q8D A;  4QQB X;  4DNI A;  3W1G A;  2C35 B;  1A0I A;  2K5H A;  3CCR A;  3CCL A;  1VQ8 A;  3D0F A;  3CQZ H;  4JYA Q;  4KI0 A;  2UU9 Q;  1B8A A;  3AFP A;  4DUY Q;  3GO5 A;  3ER0 A;  2WAQ E;  5FJ8 H;  1KRT A;  4AYB G;  4HIO A;  2JA7 G;  2ATW A;  4A3K G;  2IX0 A;  4A3M G;  5GAH C;  4JBM A;  1V1Q A;  1N9W A;  4JOI C;  1K73 C;  3PO2 H;  4BXX H;  1EYG A;  4IFD I;  2B3G A;  4IFD G;  1LUZ A;  3FHW A;  4A76 A;  1EFW A;  3RLF A;  4X62 Q;  5EAY A;  1J5E Q;  1SR3 A;  5IP7 G;  1B70 B;  1X3F A;  5M5Y H;  4DV5 Q;  1XNR L;  1I3Q H;  1IYJ B;  1HJP A;  3PSI A;  3SGI A;  1HNZ L;  3LGJ A;  1O7I A;  2KCM A;  2CFM A;  2XGT A;  2R92 H;  1KC8 C;  3T1H Q;  1EWI A;  1X9N A;  1HR0 L;  2KHJ A;  4LF5 Q;  1M90 C;  3GTM H;  1Q1B A;  2K14 A;  4PZ6 A;  1EUJ A;  2JE6 I;  4DR5 Q;  3H3V I;  4GKK L;  1I6H H;  3H0G G;  3I4M G;  3M7N A;  1G29 1;  1L0W A;  4L5T A;  4PZ8 A;  2UXB Q;  3JAM i;  5JJK A;  1C9O A;  1QVF A;  4WJ4 A;  4DR4 L;  1QZH A;  3S1M H;  1AE3 A;  2ID0 A;  1K9M C;  3TRE A;  3TS0 A;  4YWL A;  5GAG C;  4A3B G;  4B3T Q;  1Y1V H;  5DLQ E;  4QJF A;  4R4T A;  1HH2 P;  4P75 A;  3STB C;  4AQY L;  1JJC B;  3ULP A;  1VCI A;  1SRO A;  4LFC Q;  3HOW H;  3IRB A;  5IT9 c;  4JI1 Q;  4JG2 A;  2YU9 H;  4DUZ L;  1A63 A;  1XMO L;  4OWT B;  1CKM A;  1SE8 A;  5E7N A;  4OX9 Q;  3K7U C;  4X64 L;  1KRS A;  4DPG A;  2NVQ H;  4JI8 Q;  4DV4 Q;  3CC7 A;  4LW1 A;  3I2Z A;  2JA5 G;  2JA8 G;  4LF9 Q;  1IBL Q;  3TEH B;  1K3R A;  4AYB E;  2AWO A;  4GNX B;  4A3G G;  4X64 Q;  1E3P A;  4IJL A;  2NZH A;  3NBH B;  5IYB H;  3GTJ H;  1KIX A;  2R93 H;  3HOY G;  3WWV A;  3J80 c;  4NPS A;  2KEN A;  4JI3 L;  3MXN B;  2R7F A;  3GDE A;  2WB1 G;  5C3E H;  2R6G A;  3CCM A;  3A5Z B;  4GNX C;  3GTQ H;  4A4I A;  1Y1W G;  3HOW G;  5LMU Q;  1K83 H;  1L2F A;  1SFO H;  1PH1 A;  1YI2 A;  1NMG A;  1VQ7 A;  2IT1 A;  2LXK A;  2MNA A;  1OTC A;  4YCU A;  2F4V L;  1VQB A;  2UUB Q;  1S3O A;  3UDI A;  1X55 A;  1CKO A;  1LM0 A;  3G4S A;  1J5E L;  4L5S A;  4LF7 Q;  3H0G H;  1SMX A;  1VQN A;  5AJ3 L;  4JV5 Q;  1KAW A;  1Q46 A;  1CKN B;  1EIF A;  3STB D;  2NVX H;  2XTI A;  5K36 G;  2Z6K A;  4EX5 A;  4X66 Q;  4DV6 Q;  3HOY H;  1PH8 A;  4DV0 L;  1LTL A;  1YBY A;  1HNW Q;  1XNR Q;  2NN6 G;  1FL0 A;  3KDF A;  1R9T H;  2VUM H;  4NB3 A;  1M1K C;  1Q7Y C;  2UUC L;  2NZO A;  4GNX A;  3F1Z A;  1UE5 A;  1JE5 A;  1ASZ A;  3K0X A;  3I4M H;  1SRU A;  4LFB Q;  2E5L L;  4POG A;  4RG1 A;  2E2J H;  1MIU A;  3AEV A;  5IYD G;  4OO1 G;  4JI4 Q;  3CMA A;  1XMQ L;  4AH6 A;  4ALP A;  5IWA L;  5IYC H;  2R7Z H;  2KBN A;  1YIJ A;  1HNX Q;  1WJJ A;  1QVC A;  2AHO B;  3AQQ A;  3I7F A;  3J80 i;  3J7Z C;  1IBM Q;  1CUK A;  4YY3 L;  1PH6 A;  2I5H A;  4C3H H;  4DK3 C;  1X65 A;  1GKH A;  5IYD H;  4JOI A;  1NTG A;  1S40 A;  1W3S A;  4A75 A;  4A3E H;  1E1O A;  4YHH Q;  3B6Y A;  1V43 A;  3CCQ A;  4GN5 A;  3PO2 G;  4BXX G;  4YCV A;  2JJQ A;  4UP8 A;  1CSQ A;  2PQA B;  3U4Z A;  1FJG L;  3JC6 6;  2RHQ B;  5JJI A;  4XTC S;  3GTG H;  1UWV A;  5FJ8 G;  4PZ7 A;  3HOV H;  3A74 A;  4GOP A;  1YJW A;  3BU2 A;  4LUO A;  3F2D A;  1KQS A;  2ZJQ A;  3AFQ A;  1MKH A;  1OXS C;  3S1R H;  2R92 G;  4DV2 Q;  5LMN Q;  2CCZ A;  3KF6 B;  4HJA A;  1WCM H;  4BBS G;  2JK8 A;  1PVO A;  3J7A 5;  4LF8 Q;  2N78 A;  1UEB A;  2VQF L;  3F8T A;  2E2H H;  5HGQ A;  3BJU A;  1VQC A;  3I4O A;  5M3M G;  4DUZ Q;  4R4I A;  3HOZ H;  4A3I G;  2JEB I;  4X65 L;  1N8R C;  4XIG S;  3W5O A;  4A3J H;  3A0J A;  3DLL A;  1I50 H;  1H95 A;  4A3L G;  3GTO H;  2K52 A;  1PA6 A;  1IBK Q;  2MQH A;  2I5M X;  3PO3 H;  1PFS A;  4LUV A;  5M3F G;  2R7Z G;  3PIP A;  1Q81 C;  1VQD A;  5C0X G;  4HJ5 A;  4BY7 H;  1J6Q A;  3HKZ E;  4Y7N H;  2Q2H A;  2DUD A;  1XPO A;  1VQG A;  5BR8 L;  4R4Q A;  4DR7 Q;  1HNW L;  4HIK A;  2UUA L;  2CKZ B;  4JI2 Q;  1PYS B;  4LF4 L;  2A8V A;  1PH4 A;  1VQ6 A;  2OQ0 A;  2JA6 H;  1VQ5 A;  3PF5 A;  4LF8 L;  4PG3 A;  1G51 A;  2Q2I A;  1GM5 A;  4GKJ Q;  3CW2 C;  3UDG A;  1I94 Q;  4LFB L;  2BA1 A;  4BY7 G;  3HOU G;  2Z0S A;  2GVB A;  2N3S A;  2FXQ A;  2VQE Q;  2ZJP A;  1L1O B;  2NVY H;  1S72 A;  3J81 i;  4ME3 A;  3HKZ G;  3S24 A;  3J81 c;  4HJ7 A;  2HHH Q;  1XNQ Q;  1D8L A;  4A93 G;  4DUY L;  3I4N H;  3CCV A;  2D0P A;  3FKI H;  2BH8 A;  4DV1 L;  3UE1 A;  4KHP Q;  4GN4 B;  5IP7 H;  3PV0 A;  3K8A A;  3RNU A;  1X6O A;  4JV5 L;  1N32 Q;  3CD6 A;  2WP8 J;  1GO3 E;  2ZTD A;  4YWK A;  1JJ2 A;  1PH3 A;  1N34 Q;  1X54 A;  2K5N A;  1MJE A;  3NEN A;  4A3D G;  4JI2 L;  1N32 L;  4GN3 B;  3ULL A;  4JI3 Q;  2UUB L;  1YEZ A;  3OTO L;  1TWF H;  1IBM L;  3L0O A;  5IE8 A;  3CPF A;  3FP9 A;  3PUZ A;  4UPA A;  4DR2 L;  1E24 A;  4B3R Q;  3F2B A;  4J15 A;  2IHE A;  4LUZ A;  1GD7 A;  2N8N A;  1T9H A;  2YTX A;  4HID A;  3HKS A;  1OXV A;  5GQO A;  2A1A A;  4GOP B;  3BZK A;  4HIM A;  2E8G A;  2HQL A;  4O0A A;  3S1N H;  4BA2 I;  5FLM G;  2N49 A;  3RN5 A;  3DM3 A;  2OTL A;  1N36 L;  4A3C H;  4IO9 A;  2JEA I;  4MTN A;  2OTJ A;  2QA4 A;  1WYD A;  4OXP A;  4BA1 I;  5GAD C;  3HFZ B;  2UXC L;  1AE2 A;  5FLX c;  4GLX A;  5M3F H;  2MO0 A;  2VL6 A;  4LFC L;  1OXX K;  1TWH H;  4DR1 Q;  4PMW A;  4AQY Q;  4A3E G;  1I5F A;  2HIV A;  3L2P A;  5M5X H;  1N36 Q;  1U5K A;  2VQE L;  4AIM A;  1PH2 A;  3K7A H;  3PCO B;  1D7Q A;  1HZ9 A;  2JQO A;  2MO1 A;  3M4P A;  4QIW E;  1VQL A;  4OX9 L;  3OW2 A;  5JJL A;  2ALY B;  1VQI A;  4B3M L;  4DR6 Q;  2PMZ E;  3RN2 A;  5H1S E;  4JI1 L;  3EN2 A;  3HOU H;  2R93 G;  2PI2 E;  4QL5 A;  4UY8 C;  4O2D A;  4X65 Q;  2Q2U A;  1BVS A;  3S2H H;  3PUX A;  3S15 H;  1SLJ A;  2R7D A;  4B3S Q;  5C4X G;  1UE1 A;  1ASY A;  1UE7 A;  4JCV E;  1QVG A;  5IWA Q;  4A93 H;  2VQF Q;  1XPR A;  3TRZ A;  5LMU L;  1HNZ Q;  2VNU D;  1A62 A;  1X56 A;  3MEF A;  1K8G A;  1Q12 A;  2PQA A;  2VY3 A;  3CCS A;  4KHZ A;  3CCE A;  4DV5 L;  3UE0 A;  1PV4 A;  2CWA A;  1VQP A;  1AH9 A;  4GKK Q;  4X62 L;  4DV3 Q;  1Q8K A;  4IOC A;  3CCU A;  1K0R A;  1Z9F A;  4DV0 Q;  1HNX L;  2E2I H;  2Q2T A;  3KFU A;  1QZG A;  1WOC A;  4GS3 A;  1JB7 A;  1NBW A;  2JA5 H;  1C0A A;  2IY5 B;  3AYH B;  4A3I H; 
#chains in the Genus database with same CATH topology
 1NY4 A;  3Q0A A;  4A3G H;  2NUC A;  4DK1 A;  3HOX G;  1FGU A;  1ET9 A;  1Y1W H;  2C5C A;  2Z6K C;  3PO3 G;  1I6V C;  5C5L A;  3D4W A;  5C4J H;  2FMC A;  4HJ9 A;  1S5B D;  1KD1 C;  3CPW A;  2B2Y C;  4L5Q A;  2VZA A;  3KLW A;  1A2U A;  4R4O A;  2K4K A;  1MSH A;  4PQX A;  3ITP A;  4YIJ A;  4GZY C;  5C0X I;  1X3P A;  3ULJ A;  1RKN A;  3T53 B;  1JOK A;  4Q0F A;  2PI2 A;  1VQE A;  4HAE A;  3EIV A;  4WJ3 M;  2EE1 A;  2JA6 B;  1C48 A;  3TP8 A;  3DEO A;  3CQZ B;  3QIA A;  4MNO A;  1LV9 A;  2WB1 E;  4EQ5 A;  3I72 A;  1EU4 A;  1TWC H;  1FD7 D;  4F7X A;  1ENC A;  3P20 A;  3QB3 A;  2F0O A;  1O7L A;  1E2Z A;  1DOK A;  2EYM A;  4CDF C;  1KAB A;  1CHP D;  1RL2 A;  5CV4 A;  3T56 B;  2QF7 A;  2H4O A;  2EJM A;  1EYA A;  2MJ8 A;  3TZD A;  4JI6 Q;  3S16 H;  1VQF A;  2YTY A;  4BY1 H;  4JI4 L;  1B9N A;  3FPU B;  3KBG A;  2K33 A;  2E5L Q;  1PYB A;  2JXM B;  2RF4 A;  3RZD H;  2UXB L;  2B2V C;  2EJG C;  5BN5 A;  2H5X A;  2BA0 A;  1BKB A;  5J1Z A;  3RLN A;  4IUN A;  1HFN A;  1EIY B;  2K04 A;  1BOS A;  4P2C B;  2LMC B;  5TSS A;  5DM7 3;  2N88 A;  3E0E A;  3J80 E;  5CBE E;  1B4O A;  2CVR A;  1STN A;  4A3L H;  3F2U A;  4LWC A;  3PF4 A;  4RCO A;  1IL2 A;  2B8F A;  4OON A;  4A3J G;  3J7A V;  2OWO A;  3OTO Q;  1DYQ A;  4B3R L;  4IUR A;  5LL6 S;  3GD7 A;  3T1Y L;  3Q23 A;  3KF8 B;  1DOL A;  4KJN A;  4NXN Q;  2XRS D;  1YNN D;  3S1Q H;  4YY3 Q;  3T1Y Q;  4KY6 A;  1YNJ D;  4K8J A;  2E74 C;  2B2U C;  3CCJ A;  2ZM6 L;  3VR3 A;  3PUV A;  1F2Z A;  2HHH L;  3BYT B;  5D14 A;  1A3T A;  3C3L A;  2UU9 L;  3A55 A;  5EBD A;  2BE5 D;  4UP9 A;  3U50 C;  2J4X A;  1S4Z A;  1XXG A;  2X6G A;  5EBC A;  2RBM A;  2L11 A;  5I4D A;  2A68 C;  2GN5 A;  3KOJ A;  2K6A A;  1V1P A;  3E6Z X;  2D62 A;  3U58 A;  2Z4I A;  2JA9 A;  5JAV A;  2WAQ G;  4DAP A;  1EQQ A;  4C3J G;  4K2K A;  3M85 A;  2F1M A;  3RR5 A;  2I07 B;  3CC4 A;  2D9U A;  1PTO B;  2F3I A;  2GA4 B;  2RA4 A;  2QDL A;  1E7Z A;  2AQ1 B;  4CDE C;  4K0K Q;  1VDZ A;  3PUW A;  3ERO A;  4HCE A;  3KJP A;  2B2Y A;  4OHJ A;  2AWN A;  1CTM A;  2RKS A;  5CV6 A;  4YWM A;  2YYZ A;  4G7Z C;  1JB3 A;  2B2W C;  2VUM G;  1EZ8 A;  1STB A;  5JEA G;  1KHI A;  4LFA Q;  3CC2 A;  2G9D A;  4JVZ A;  4DR2 Q;  4DR4 Q;  3ERS X;  4UP7 A;  1YJN A;  4V19 0;  3T4A C;  4BBS H;  4H7B A;  2R61 A;  2K5W A;  1GUW A;  1QIL A;  4BY1 G;  2AQ2 B;  3ONA B;  1YZ6 A;  1B50 A;  2E2D C;  4NMZ A;  4CHT B;  3T1H L;  5IY0 A;  1JWU D;  4KHP L;  2L15 A;  4H02 A;  4OGQ C;  3M9B A;  1PZJ D;  2OT2 A;  3Q8D A;  2C35 B;  2MHV A;  4HMI A;  4JYA Q;  2F0V A;  5JVH 3;  5ISR A;  4DUY Q;  3GO5 A;  4OL7 A;  4XQQ A;  1KRT A;  2JA7 G;  4KK7 A;  2PCF B;  3K5M A;  3H91 A;  5JPM C;  1KTK A;  3PO2 H;  4XXE A;  1EYG A;  4BXX H;  4IFD G;  3DWP A;  4X62 Q;  1J5E Q;  4DF7 A;  2HQE A;  3LGJ A;  3D3R A;  4RA8 A;  2R92 H;  2CFM A;  3DWQ A;  1KC8 C;  2FHT A;  2E2H B;  1GHK A;  2KHJ A;  2IJ0 A;  1EUJ A;  3H3V I;  1LT3 D;  1CQV A;  1G29 1;  3PIP 3;  1JQY D;  1EQT A;  1C9O A;  2A6H D;  1QVF A;  1BNZ A;  5M5Y B;  1HXY D;  3S1M H;  1EIH A;  4QJF A;  2EXZ A;  1ZYR C;  3MHB A;  3IRB A;  5ELE A;  1SE8 A;  3K7U C;  4FF2 A;  2D2C C;  4QF4 A;  2E2I B;  2JA5 G;  1H9M A;  1K3R A;  4FF3 A;  3NP8 A;  2NZH A;  3NBH B;  3NSW A;  5IYB H;  3MA2 B;  3J80 c;  1ZXT A;  3Q6S A;  3NTK A;  2R7F A;  5EKI A;  3CCM A;  1B2T A;  3A5Z B;  4GNX C;  2PO4 A;  2PZT A;  3HOW G;  3K5N A;  1R4Q B;  3VA7 A;  1YI2 A;  3GQB A;  3D6C A;  2LXK A;  2MNA A;  1B53 A;  1SYF A;  2NTT A;  4JW0 A;  1PRT C;  2RDG A;  3MAQ A;  4KN4 C;  1CKO A;  3G4S A;  1J5E L;  1U4P A;  1VQN A;  3EA6 A;  1PFB A;  3MVV A;  2EYO A;  3R93 A;  3GV6 A;  1CKN B;  3H09 A;  5M3F B;  2R7Z B;  5K36 G;  1A6X A;  4X66 Q;  1BDO A;  1Y69 U;  1LTL A;  1YBY A;  1HNW Q;  5IGG A;  2NZO A;  4GNX A;  4G7H C;  1UE5 A;  1JE5 A;  3J81 L;  2NTS A;  2E2J H;  1EU3 A;  1B9M A;  4RWS C;  5KNB A;  1YIJ A;  1HNX Q;  1WJJ A;  2AHO B;  3AQQ A;  2PZU A;  3J7Z C;  4YY3 L;  3HZX A;  4C3H H;  1PRT B;  1X65 A;  3BZD B;  1NTG A;  2A6H C;  1W3S A;  1CQF A;  1SNM A;  1DXM A;  1V43 A;  3PO2 G;  4BXX G;  2Q8R E;  4YCV A;  3A7L A;  4UP8 A;  5FOB B;  3JC6 6;  2DY7 A;  5JJI A;  1RTN A;  1UWV A;  4PZ7 A;  3HOV H;  1I4Q A;  3QG1 A;  3KK7 A;  3AFQ A;  3NWS A;  3RZD B;  1MKH A;  2R92 G;  2CCZ A;  3KF6 B;  2HCC A;  1G2T A;  5KND A;  1BF4 A;  1PVO A;  4JK1 C;  1SEB D;  3F8T A;  2F0Q A;  4DUZ Q;  1LTG D;  4R4I A;  2JEB I;  3C2P A;  4QB4 A;  4XIG S;  3A0J A;  1RCV D;  4A3L G;  1WTQ A;  1HA5 A;  1IBK Q;  1F77 A;  1G8Z D;  4ZUJ A;  1NUC A;  3SK4 A;  3PO3 H;  2EYP A;  4N9T A;  4LUV A;  5CV5 A;  4RGN A;  3HOZ B;  4HJ5 A;  4HMJ A;  1XPO A;  4R4Q A;  1HNW L;  3VYT A;  4HIK A;  2CKZ B;  4JI2 Q;  1PYS B;  2IWH A;  4B08 A;  3C46 A;  4GKJ Q;  5I2X A;  4BY7 G;  3HG9 A;  4G57 A;  3MC0 B;  1HQR D;  2ZJP A;  5AFW A;  3J81 i;  4OEM B;  3HKZ G;  4A93 B;  1A3U A;  5KNC A;  3CCV A;  3FKI H;  3UE1 A;  1BCP F;  1ESF A;  3PV0 A;  3K8A A;  1NCV A;  4RKL A;  4YWK A;  3R8B A;  1PH3 A;  1K83 B;  1MJE A;  3NEN A;  4A3D G;  2NN6 H;  5T1I A;  1H9S B;  1E2V A;  1JC7 A;  3CPF A;  3BDC A;  4DR2 L;  3F2B A;  1MHW C;  2EY2 A;  2IHE A;  2SOB A;  4F87 A;  2KA7 A;  1T9H A;  3NXW A;  3HKS A;  2CH4 A;  5GQO A;  4GOP B;  1ONL A;  4O0A A;  1CZG A;  5FLM G;  1O7Z A;  1ET6 A;  1N36 L;  4A3C H;  2M9V A;  2XWJ B;  1WTP A;  4X3U A;  4BA1 I;  3IKJ A;  1AE2 A;  3LX0 A;  3VR5 A;  4GLX A;  4K6L A;  2MO0 A;  4LFC L;  5M3F H;  2EVB A;  2R7Z H;  3CHB D;  2HIV A;  1SNC A;  1N36 Q;  1U5K A;  2VQE L;  2F0P A;  2K5Q A;  4AYB B;  3CRL C;  2JQO A;  4OX9 L;  2ALY B;  4B3M L;  2P5Z X;  4DR6 Q;  1PFM A;  1EY5 A;  4JI1 L;  3EN2 A;  3HOU H;  4DGZ A;  4X65 Q;  2Q2U A;  2KOL A;  2SDF A;  5C4X G;  3NK9 A;  3PUX A;  3S15 H;  1UE7 A;  5IWA Q;  3NBI A;  1XPR A;  2IW3 A;  5LMU L;  2VNU D;  1ILQ A;  1LTA D;  1A62 A;  1X56 A;  1K8G A;  2XIW A;  2PQA A;  2VY3 A;  1JE4 A;  1QWY A;  4DV5 L;  3UE0 A;  1PV4 A;  4R9W A;  2MUY A;  4NW2 A;  4GKK Q;  1Q8K A;  1G6Z A;  3BDO A;  1HNX L;  4U68 A;  4CJ2 C;  1NBW A;  3V96 A;  2A6E D;  3VYS A;  1UEA B;  5IGB A;  1RHP A;  2NN6 I;  5D65 A;  1CKN A;  4DAM A;  3GTK B;  3S16 B;  2QGQ A;  3OIP A;  1XPU A;  1E1T A;  4ZCK A;  4A3F B;  3NE5 B;  4O42 A;  1V1P B;  4I65 A;  1XX8 A;  1PMR A;  5C44 H;  1EY6 A;  3CAM A;  1SYD A;  2JN4 A;  4Q5V A;  1JCK B;  1L1O C;  2NVQ B;  5C4X B;  1JWS D;  2ENB A;  1EY0 A;  2LSS A;  1Q82 C;  1NR2 A;  3ICE A;  3CXC A;  4JBW A;  1OXU A;  1PHJ A;  3QOJ A;  1CZW A;  4NP5 A;  3GTQ B;  3GTL H;  4XYQ A;  2PNH A;  1EWH A;  1K28 A;  3DWA A;  5CV7 A;  1EEI D;  2HIX A;  1T5E A;  1LT6 D;  4JPB W;  4K0K L;  4DAY B;  4R1J A;  1D5M C;  1B7Y B;  4F88 A;  1VQ4 A;  4DAY A;  1OXT A;  1IZ6 A;  3NQT A;  4JBJ A;  3GTO B;  3TP7 A;  1TKW B;  4DKA C;  2M2L A;  4XT3 B;  3HOX B;  3PIO 3;  5M9O A;  1WFQ A;  4A3I B;  4J8Q A;  4K6D A;  2CQA A;  1JOO A;  1F9S A;  3TQY A;  3C1F A;  1ENF A;  2I46 A;  5IT9 E;  3TP5 A;  1D1I A;  1Y1V G;  3FDT A;  1VS0 A;  3SEB A;  2F0D A;  1N33 L;  2B63 B;  1RD9 D;  2B2V A;  2CQO A;  3IFT A;  3VYU A;  2OQK A;  4OWW B;  2DNC A;  3D6W A;  2EYF A;  4DK6 C;  3PO2 B;  3D8G A;  3I4L A;  3G71 A;  3X3N A;  2NVT H;  3E3X A;  4TQU S;  2UXC Q;  2KHI A;  5FO7 B;  3J81 j;  1HA6 A;  3QJY A;  4FDB A;  1U0L A;  2IL8 A;  3KLR A;  4IUV A;  2OF1 A;  1PTO H;  1JMC A;  1F2Y A;  1D5X C;  2BDO A;  1Q86 C;  3M4O H;  1BBU A;  4QMG A;  1PXU A;  4LNQ A;  4FXD A;  5DEH A;  4FYD A;  4ZUI A;  4A3B H;  1ICF B;  1KDB A;  4RHS A;  2RDH A;  2Y0S G;  3KDF B;  1E22 A;  1F9P A;  1MJC A;  4TRD A;  4FXK C;  2RCF A;  1K3B C;  4LF7 L;  4HSV A;  5IP9 G;  2F0G A;  1LO5 D;  2UXD L;  3CF5 A;  2YTV A;  5BN3 A;  4LF4 Q;  1YNX A;  4KHV A;  4QIW B;  3GTP H;  2R93 B;  3HOV B;  1RDP D;  4L8J A;  2PW7 A;  1TWF B;  4DR7 L;  4P74 A;  2E76 C;  1S5C D;  3HKZ B;  3FVQ A;  3F2C A;  3I4N G;  5D3I B;  4P72 A;  1Z47 A;  4RGO S;  5KEE A;  2F4V Q;  5C44 G;  1K8A C;  2CH4 W;  1W2B A;  3A5U A;  3V05 A;  2A6E C;  1ICW A;  1G2S A;  1X3G A;  2FFK B;  4Y52 H;  2VS1 A;  1TQO A;  4KKT A;  1L1O A;  4KY5 A;  2LY7 A;  2ZM6 Q;  1TWG B;  1PRT D;  1QUQ B;  2F3W A;  2GVA A;  3UDX A;  1EZ6 A;  3GTK H;  4POF A;  3VDY A;  3NHH A;  4DR1 L;  3S15 B;  1AZP A;  2B29 A;  1C7Y A;  3CP0 A;  1KDC A;  3NUC A;  4A3D H;  4JYA L;  5ELO A;  4XQN A;  1SMY D;  3K0Y A;  2OXP A;  4ODG A;  1XTD A;  3AB9 A;  2JYO A;  2Y0S B;  4B3T L;  5M5W H;  3PIO A;  3HOW B;  2L0C A;  1TS2 A;  3W1G A;  1A0I A;  5CV8 A;  3D0F A;  3K59 A;  3AFP A;  1KNE A;  5CBA E;  3ER0 A;  4HIO A;  2M00 A;  4A3K G;  4A3M G;  3D4D A;  1FNV A;  1J8I A;  2H1E A;  1K73 C;  2RSN A;  2EYJ A;  2O4X A;  5T1G A;  2Z1C A;  1B70 B;  1X3F A;  4DV5 Q;  1XNR L;  3SK6 A;  1I3Q H;  1AEX A;  1Z6H A;  3QR8 A;  1HJP A;  3PSI A;  1KDA A;  2AUK A;  1HNZ L;  1O7I A;  2KCM A;  3SK8 A;  5EQ0 A;  2JSO A;  1X9N A;  1CFM A;  4LF5 Q;  1JIC A;  4BY1 B;  2KJX A;  2O5I C;  3H0G G;  4RFB A;  1FYC A;  3M7N A;  4PZ8 A;  2UXB Q;  5JJK A;  2R3Z A;  1QZH A;  5FLX L;  4XT1 B;  3TRE A;  1EL0 A;  4B3T Q;  4BS9 A;  1Y1W B;  4R4T A;  2D5D A;  2L5T A;  3EQL C;  1SRO A;  4JI1 Q;  4DUZ L;  1ENA A;  1A63 A;  1STA A;  4XDX A;  2ZXO A;  4ZKB B;  3OPO A;  4DPG A;  2NVQ H;  1PTO D;  4DV4 Q;  3CC7 A;  1WVL A;  2JA8 G;  2PZW A;  2K01 A;  3TEH B;  2KEC A;  4AYB E;  2AWO A;  4GNX B;  1E3P A;  3GTJ H;  3T16 A;  2EYH A;  3WWV A;  5I9P A;  3NBH A;  4JI3 L;  1HUM A;  2WB1 G;  3GTQ H;  3KBX A;  2WAC A;  4A4I A;  5LMU Q;  3RUZ A;  1EYD A;  1GUG A;  1L2F A;  3RMH A;  1NMG A;  1PH1 A;  3E5S A;  2PW5 A;  1TVX A;  4IN3 A;  1V1O A;  1I6H B;  1VQB A;  2UUB Q;  4ZYS A;  5NUC A;  3GTM B;  3UDI A;  1X55 A;  2RVL A;  1LM0 A;  2JA8 B;  5KIX A;  4LF7 Q;  1SMX A;  1KLG D;  4PMC A;  5I9O A;  2KHS A;  1Q46 A;  1PZI D;  1ROD A;  2B2T C;  3STB D;  2XTI A;  4DV6 Q;  5FO9 B;  4CJ1 B;  3HOY H;  1PH8 A;  2SEB D;  1XNR Q;  5BN4 A;  4K8I A;  2NBF A;  3DXJ C;  3I4M H;  1SRU A;  3M4Y A;  4LFB Q;  1EY8 A;  1QE6 A;  4RG1 A;  4JI4 Q;  4AH6 A;  5C6A A;  2F4I A;  1BBX C;  2Q8I B;  4ZLT F;  1TWC B;  1NNX A;  3WOE A;  4DK3 C;  1AFP A;  5M3M B;  1L0X B;  1WTR A;  4A3E H;  1XTC D;  1D1K A;  4YHH Q;  4GN5 A;  5EPJ A;  2JJQ A;  3NPP A;  2EPB A;  3U4Z A;  2PQA B;  4XTC S;  5JJZ A;  3GTG H;  5M5X B;  4GOP A;  3BU2 A;  1KQS A;  3F2D A;  2YU9 B;  3A8K E;  3S1R H;  1QJO A;  2BOS A;  3H0G B;  4HJA A;  5KYI A;  2SNM A;  2LFN A;  2N78 A;  1UEB A;  2KCN A;  1VQC A;  3I4O A;  1TY0 A;  5M3M G;  3BYY B;  3HOZ H;  2AQ3 B;  5C4J B;  1A2T A;  3DLL A;  1I50 H;  1I4G A;  4LAA A;  1PA6 A;  1R9T B;  2VUM B;  4ABN A;  4DXF A;  3A56 A;  3GTP B;  5G3L F;  1A15 A;  3T13 A;  5C0X G;  5IGF A;  3HKZ E;  4DR7 Q;  1VQ6 A;  3I70 A;  4XQJ A;  1SYB A;  1I94 Q;  5CGK A;  4LFB L;  2BA1 A;  1EY7 A;  5CMD A;  3HOU G;  2Z0S A;  2FXQ A;  2X6L A;  4CGY B;  1AP0 A;  2L9H A;  3KLS X;  4DNR B;  3S24 A;  4HJ7 A;  3BG3 A;  1XNQ Q;  2EYL A;  5DAU A;  1LTR D;  1TR5 A;  1MBY A;  3I4N H;  2D0P A;  2BH8 A;  4EVO A;  4DV1 L;  1WTW A;  5IT9 L;  5JEA H;  3CD6 A;  3TME A;  1GO3 E;  1JJ2 A;  1EYC A;  4C1N I;  1LLR D;  4R8N A;  3MXP A;  1TS4 A;  1GXD C;  2CW0 D;  4JI2 L;  4GN3 B;  3ULL A;  4CKC A;  3QO2 A;  3EJI A;  1IBM L;  3L0O A;  4J6H A;  4G7O C;  1E24 A;  4OEL B;  3GP7 A;  4RKB A;  2AUJ D;  4HID A;  3BZK A;  5E3F A;  2N49 A;  3DM3 A;  4A3B B;  2OTL A;  4NDX A;  5FLX c;  3FEW X;  3BVZ A;  1OXX K;  1TWH H;  4HSP A;  4A3E G;  5A2Q L;  4DA2 A;  3L2P A;  1X3Q A;  3K7A H;  2V4D A;  3PCO B;  1DON A;  1D7Q A;  4QIW E;  5JJL A;  2MO1 A;  1O78 A;  3K6O A;  4I7Z C;  2Z6B A;  3V2T A;  2PI2 E;  4O2D A;  5FO8 B;  1HHV A;  1SNQ A;  3S2H H;  4B3S Q;  5ELB A;  4IUU A;  1GUS A;  3MEF A;  1IYU A;  5I6Y A;  3CCS A;  1CA6 A;  4A3E B;  4HCS A;  1AH9 A;  1BCP C;  4X62 L;  2X69 A;  3JAM L;  4DV3 Q;  5LHY 1;  1IKM A;  3CCU A;  1K0R A;  2E2I H;  4OIK A;  1TU2 B;  3K5O A;  1EQV A;  2K1B A;  1C0A A;  3AYH B;  3DUZ A;  4A3I H;  4RMF A;  5DM6 3;  4CBV A;  2KED A;  1P8L A;  5C4X H;  4S3S A;  1UE6 A;  3PGZ A;  3TS2 A;  3OYY A;  1QNK A;  2F0S A;  3S14 H;  4FVM A;  1RTO A;  5AJ3 Q;  1LAB A;  4FXG C;  4UAI A;  2DGY A;  1E2W A;  2D0O A;  3GTL B;  1J9O A;  1HCZ A;  4JC0 A;  2JA6 G;  4KV6 A;  3SK5 A;  2UUC Q;  1Q1E A;  1YHB A;  4HJ8 A;  4DR5 L;  1HFG A;  2K5D A;  3SDZ A;  1ZEQ X;  5I2Y A;  4C3I H;  4P71 A;  3S14 B;  4MN3 A;  3H6M A;  4NKL A;  1FVI A;  4B9X A;  4DXG A;  2B2T A;  1DD2 A;  1Y14 B;  4A3K H;  1MGS A;  2F0N A;  4X3T A;  4GLA C;  3L7Z C;  2I5L X;  1LTT D;  2IX1 A;  2JA8 H;  2CW0 C;  5ELN A;  3E0J A;  3H15 A;  2EZV A;  2OCE A;  3IFD A;  1WI5 A;  4DV3 L;  1KXL A;  1LTI D;  3I90 A;  4X3K A;  1VQA A;  2L55 A;  4JI8 L;  2I0Q A;  5I6W A;  5C44 B;  1IBK L;  1LYL A;  1VQ9 A;  4DR3 Q;  2RHS B;  3NEM A;  3I56 A;  3E9I A;  1TS5 A;  3KJO A;  1EOT A;  3K5L A;  3S2D H;  3K7A B;  1BCP D;  4DV4 L;  1GUN A;  4C3I B;  3ZJY C;  5LMN L;  2ZTC A;  4Z9C B;  5J22 A;  1SNO A;  2FJ2 A;  2B63 G;  2A69 C;  4L5R C;  1BCP B;  4ZRZ A;  1QNU A;  3QOL A;  2R92 B;  4LF5 L;  3S17 H;  3G6E A;  4C1N K;  3KYH C;  1N34 L;  2QEX A;  4N8F A;  1CSP A;  3E9H A;  4NXN L;  1JT8 A;  4APV A;  1KAA A;  1TWG H;  1HRJ A;  3TP6 A;  4EQO A;  3K58 A;  2PNR C;  2L12 A;  3DHQ A;  4TVA B;  2LXJ A;  3OMC A;  1R4P B;  2IX3 A;  4PV1 C;  5IOD A;  3S17 B;  4IPG A;  2VXW A;  1XNQ L;  2PYK A;  1VQJ A;  5GRO A;  1QUQ A;  4IOA A;  2UUA Q;  3FKI G;  4M1U B;  2MFI A;  3MFY A;  3MEH A;  4KJO A;  4C3J H;  4NXM Q;  2NZ1 D;  1YNN C;  5FK9 C;  4JI6 L;  2MGS A;  3W1B A;  3S2D B;  3MXG A;  4TKO B;  4B3S L;  5BR8 Q;  4JI5 Q;  4IFD H;  1I94 L;  1TXY A;  3S1R B;  4A3M H;  3I3C A;  4JI0 L;  3M3Y H;  3CME A;  1VQO A;  4U67 3;  4JBK A;  5J3B A;  2QIL A;  4B3M Q;  4DR6 L;  2CWP A;  2F0I A;  4GOP C;  1V9P A;  2B63 H;  5A35 A;  1SN8 A;  1YHA A;  3BZC A;  5C0X H;  1CA5 A;  3LWE A;  2B2W A;  2KEE A;  4LFA L;  1FJG Q;  4QY7 A;  3IAY A;  2F52 A;  4DV2 L;  3VR2 A;  1YHQ A;  1YVC A;  2E75 C;  4CKE A;  3I4M B;  3K81 C;  3ERQ A;  3I73 A;  4H44 C;  3SE0 A;  3U4V A;  4KMU C;  5IP9 H;  4RH6 A;  1TWA H;  4KD4 A;  4FF4 A;  2ZJR A;  1OO9 B;  4NXM L;  1XMQ Q;  1EOV A;  2J7Z A;  5COY A;  1K0S A;  2JA7 H;  1BXT A;  4DNI A;  2K5H A;  3CCR A;  1Q90 A;  3EVQ A;  1VQ8 A;  4KI0 A;  5G3L D;  1B8A A;  3Q22 A;  2UU9 Q;  3OMG A;  2WAQ E;  3MXU A;  5FJ8 H;  4C3H G;  1Y8N B;  2VB3 X;  2MP1 A;  4JBM A;  1V1Q A;  1H9K A;  1N9W A;  4JOI C;  1JJG A;  4IFD I;  3RLF A;  5EAY A;  2QW7 A;  1SR3 A;  5IGD A;  4TSS A;  5IP7 G;  2A5H A;  5M5Y H;  2IPK D;  1TII D;  4IQZ A;  1IYJ B;  1PRT F;  4KY7 A;  2PQE A;  1STG A;  3SGI A;  2XGT A;  5ELC A;  1HR0 L;  1SYC A;  5K36 H;  1TT2 A;  4H0L C;  1M90 C;  2F0F A;  3FRP B;  1Q1B A;  3MXN A;  4PZ6 A;  3GTM H;  4R8I A;  4DR5 Q;  4GKK L;  1I6H H;  1L0W A;  4L5T A;  3KLS A;  4ZKC B;  1BUV T;  1I3Q B;  2KQ3 A;  1U9R A;  2A73 B;  4DR4 L;  3MZ5 A;  2QDB A;  2ID0 A;  1SE3 A;  3TS0 A;  5GAG C;  1W6J A;  1Y1V H;  2RQX A;  1HH2 P;  4P75 A;  3STB C;  1E0B A;  1CHQ D;  1NAP A;  4AQY L;  3UI2 A;  5IT9 c;  2A68 D;  3FPP A;  4OWT B;  1CKM A;  5E7N A;  4DU9 A;  4X64 L;  3P1H A;  2G9H D;  4LW1 A;  3I2Z A;  1IBL Q;  2EJF C;  4A3G G;  4X64 Q;  1KIX A;  1U4R A;  4CJ0 B;  1JOR A;  3HOY G;  2OEO A;  1WD1 A;  4B9W A;  3GDE A;  1SBB B;  2R6G A;  4MHE A;  2F3V A;  1Y1W G;  4C56 C;  1K83 H;  4N8X 1;  3J81 E;  1D6E C;  1PFN A;  2IT1 A;  1Y8O B;  1OTC A;  3WDN A;  1VMP A;  5D3D A;  5KYL A;  1AN8 A;  1S3O A;  5IGE A;  5DNF A;  3Q24 A;  2B39 A;  3N6R A;  2L4N A;  3H0G H;  1JR0 D;  5AJ3 L;  3J7Y W;  1O80 A;  2KVM A;  1KAW A;  1EIF A;  2NVX H;  1DZ1 A;  2NWG A;  2Z6K A;  4EX5 A;  4O1N A;  4DV0 L;  2Q8T A;  2NN6 G;  3HEJ A;  3WOF A;  1FL0 A;  3KDF A;  4DAV A;  1R9T H;  2VUM H;  4NB3 A;  3P75 A;  1Q7Y C;  1M1K C;  2UUC L;  1SXT A;  1I50 B;  5C3W A;  1ASZ A;  3URY A;  4WRD A;  1PDQ A;  4FP5 D;  4POG A;  1T5X D;  1MIU A;  3HGB A;  5IYD G;  3AEV A;  3HOU B;  3A8J E;  1BO0 A;  5IWA L;  1VMC A;  5IYC H;  3I8Z A;  4EQN A;  3J80 i;  4ZQ3 A;  1PH6 A;  5ELD A;  2ICE C;  1GKH A;  4QCL A;  1L0Y B;  5CC4 A;  5IYD H;  1G91 A;  1GHJ A;  4A75 A;  5E4W C;  3G6J B;  2XVS A;  1S5F D;  3EFX D;  3TSS A;  1PZK D;  4IUT A;  1CSQ A;  2RHQ B;  4A3J B;  5FJ8 G;  4LMQ D;  4LUO A;  2G5D A;  2ZJQ A;  1FGB D;  2F0K A;  1LT5 D;  3U9S A;  4DV2 Q;  4BBS G;  3J7A 5;  4LF8 Q;  1HUN A;  2E2H H;  1MD2 D;  4CKB A;  5C4H A;  5HGQ A;  1S5E D;  4A3I G;  1F9Q A;  5E1F A;  4X65 L;  1N8R C;  3W5O A;  1K8O A;  4A3J H;  1H95 A;  3GTO H;  2K52 A;  3TBI B;  5L37 A;  2ZT9 C;  2MQH A;  2I5M X;  3S1M B;  1H9S A;  1PFS A;  4UHV A;  3DM1 A;  1B3Q A;  3PIP A;  1VQD A;  4BY7 H;  4KKS A;  1J6Q A;  4Y7N H;  5COR A;  2Q2H A;  5BR8 L;  5EPL A;  3BVM A;  4LF4 L;  3I4N B;  1Y1V B;  2A8V A;  1X32 A;  3O13 A;  2OQ0 A;  1PH4 A;  3J80 L;  3PF5 A;  1G51 A;  2A69 D;  3CW2 C;  3UDG A;  1BQQ T;  3BVG A;  1B1Z A;  5FKA C;  2N3S A;  1L1O B;  2NVY H;  4A93 G;  3QWN A;  4KHP Q;  2LKV A;  2C9O A;  5F2D A;  4JV5 L;  1X6O A;  1LTS D;  5LL6 X;  3S9W A;  1N34 Q;  2K5N A;  1ZKO A;  2UUB L;  1YEZ A;  2VB2 X;  3FP9 A;  3PUZ A;  4G4K A;  4C3J B;  4J15 A;  1IW7 D;  1GD7 A;  4K5X A;  2N8N A;  2TSS A;  2YTX A;  4RGT A;  1IW7 C;  1OXV A;  2A1A A;  4DNT B;  4HIM A;  2HQL A;  1EY4 A;  2BCO A;  1SDF A;  3S1N H;  4BA2 I;  3BS1 A;  4IO9 A;  2JEA I;  4MTN A;  2OTJ A;  1O7Y A;  4OXP A;  2UXC L;  5GAD C;  2B8G A;  3GTJ B;  4DR1 Q;  4PMW A;  5M5X H;  3C1E A;  4AIM A;  1PH2 A;  2WAQ B;  3M4P A;  4I7A A;  3OW2 A;  1SE4 A;  1VQI A;  5C5M A;  4H13 C;  2PMZ E;  2NVY B;  5H1S E;  2Z8L A;  2R93 G;  4QL5 A;  4UY8 C;  1B3A A;  5J39 A;  1KLU D;  1NSN S;  4ILW A;  1C4Q A;  2K32 A;  1SLJ A;  2R7D A;  1QVG A;  2EOT A;  2VQF Q;  1H9R A;  1ML0 D;  4KHZ A;  3CCE A;  4IAL A;  1QG7 A;  2F0E A;  4IOC A;  4QUC A;  2F0W A;  2Q2T A;  3KFU A;  1WOC A;  1JB7 A;  5KRU A;  5JVG 3;  3CRK C;  1AZQ A;  2JA7 B;  2IY5 B;  3M7G A;  1EQR A;  1PH7 A;  2FIN B;  2DJF C;  4BBR B;  4IPH A;  2EQS A;  5CV9 A;  5ELF A;  1VQM A;  2F0H A;  2QEJ C;  5C3E G;  4L63 B;  4YCW A;  1TS3 A;  1NMF A;  4YHH L;  1IXR A;  2WV6 D;  3VR4 A;  4A3C G;  1KNA A;  1IL8 A;  5FLX E;  4LK1 C;  1HZA A;  5FLM H;  2V1C C;  2VW9 A;  3RLO A;  1U4L A;  4KLK A;  1Z7T A;  4LF9 L;  4DV7 Q;  1FNU A;  3GV3 A;  4UDU C;  3MWY W;  3HOV G;  2PMZ B;  3OSO A;  3PMF A;  4IPD A;  4K5W A;  4HN7 A;  2K75 A;  5EGT A;  3G7L A;  1WTH A;  5C3E B;  1C8C A;  2ASB A;  4KN7 C;  4OO1 H;  4RCN A;  1F2L A;  2HUG A;  4X66 L;  3KF6 A;  4IPC A;  3M4Q A;  3D4R A;  5EKK A;  2ICI A;  2BDN A;  5C0X J;  1WTO A;  1G6P A;  3I55 A;  4MZ9 A;  1D5Z C;  4BBR G;  1EY9 A;  1BR9 A;  3K80 C;  1SND A;  1GJX A;  2K50 A;  2JP1 A;  2WIN B;  1XYI A;  3HP3 A;  5LMN W;  2WII B;  2F0M A;  3L9A X;  2HT1 A;  3JAM c;  1SJH D;  4WFN 3;  2PPB C;  1PH9 A;  4X6A H;  1NE3 A;  1YNJ C;  2E2J B;  1DGS A;  1TY2 A;  5EPK A;  1VQH A;  2ES2 A;  2AMC B;  1I4P A;  1A8V A;  1PH5 A;  4DV6 L;  1HZB A;  2F03 A;  3EBE A;  2SNS A;  2ZTE A;  4DV7 L;  4BBS B;  1DOM A;  4ME5 A;  1QB5 D;  5IYB G;  1YJ9 A;  3H3V H;  5M3M H;  5C4Z A;  4CDC C;  1QCB D;  4IUQ A;  3PO3 B;  1M8A A;  3S1Q B;  3NEL A;  3M3Y B;  4Y7N B;  2NVX B;  3AMU A;  2HDL A;  3G48 A;  4GLV B;  1F2M A;  1Y8P B;  2K03 A;  2N55 A;  4JI0 Q;  1SE2 A;  5HGT A;  1GVP A;  2WKC A;  2EXD A;  2NYZ D;  4RGM A;  3R3O A;  4V0B A;  1HR0 W;  4DV1 Q;  5JEA J;  2RCN A;  4LF6 L;  3S1N B;  4OO1 I;  4IJH A;  1EIG A;  3SXH A;  2XNA C;  1TWH B;  1BBW A;  2EY6 A;  4MIU A;  4HTH A;  4DR3 L;  4GKJ L;  1VQK A;  4X3S A;  4JI7 Q;  1XJV A;  1X3E A;  2UXD Q;  4BBR H;  4F8M A;  3I91 A;  4C2M H;  3MTS A;  1N33 Q;  4KTA A;  2RDF A;  1PTO F;  4HR7 B;  3U9O A;  1CI3 M;  3PUY A;  3GTG B;  5IYC G;  1S5D D;  4WJW A;  5GAE C;  4KKU A;  3OW7 A;  3NWT A;  3UDF A;  2F0L A;  2DNE A;  2BH2 A;  4R4C A;  1NR4 A;  1RIP A;  1WTV A;  1VF7 A;  2KCC A;  4IFD J;  1KL9 A;  2XN9 C;  1W6K A;  1YIT A;  2A19 A;  1IBL L;  4P73 A;  5C3X A;  5E4X A;  2QCP X;  1NJI C;  1MI2 A;  3NTH A;  4RAU C;  3D31 A;  1XWE A;  1SJE D;  1D2B A;  2AKW B;  2A74 C;  3RZO H;  2KCT A;  2DN8 A;  3X3M A;  4DFA A;  4QGU A;  5HY6 A;  4EGV A;  3KUP A;  2K5V A;  2WFW A;  1P16 A;  3W3A A;  1HZC A;  4ID6 A;  4BY7 B;  1UAP A;  4A3F H;  1WCM G;  2RSO A;  1XMO Q;  2XRQ D;  3HOX H;  1GOZ A;  5KGU A;  4JI7 L;  2EIF A;  2Y0S E;  4OWX B;  2IHF A;  1II3 A;  3ND9 A;  2YV5 A;  2L1B A;  4JI5 L;  3HOZ G;  1FR3 A;  4A3F G;  3DEP A;  1HR0 Q;  5EKL A;  3VYR A;  3N52 A;  4LF6 Q;  4QQB X;  3CCL A;  3OIQ A;  3CQZ H;  1MSG A;  1SMY C;  4AYB G;  1WTX A;  4A3G B;  1A3V A;  4A3M B;  2IX0 A;  4A3K B;  2ATW A;  5CYU A;  1LTB D;  5GAH C;  2B3G A;  1LUZ A;  3A54 A;  3FHW A;  4A76 A;  1EFW A;  1I4R A;  1M4V A;  2HCI A;  2K7V A;  1V8Q A;  1I4X A;  1QOH A;  4IUP A;  1SYG A;  1Q8I A;  3T1H Q;  1EWI A;  4PMB A;  2K14 A;  2JE6 I;  2HDM A;  3I4M G;  1RF2 D;  4A3D B;  3HS0 C;  4XYO A;  3JAM i;  2K05 A;  4WJ4 A;  1PLF A;  2QKI C;  1STE A;  1AE3 A;  1K9M C;  1HTP A;  4YWL A;  4A3B G;  3SVM A;  5DLQ E;  3ULP A;  4LFC Q;  1JJC B;  4ULL A;  1VCI A;  1B44 D;  3HOW H;  3R2I A;  4JG2 A;  2YU9 H;  1XMO L;  4J1M A;  1HTL D;  4OX9 Q;  3CKI B;  1KRS A;  1FNW A;  1I4H A;  4JI8 Q;  1EFI D;  4IZ8 A;  2Z4H A;  3CU7 A;  4LF9 Q;  4PNY A;  1IYV A;  1JOQ A;  2B2U A;  2R93 H;  4IJL A;  4MTK A;  1IKL A;  5CR3 A;  4NPS A;  2KEN A;  3MXN B;  3L3O C;  2F0T A;  4FO2 A;  2HD3 A;  1U4M A;  5C3E H;  2ZXP A;  1LT4 D;  3A8I E;  1JWM D;  1SFO H;  3J7A F;  1VQ7 A;  1IHZ A;  3KF8 A;  3VR6 A;  2MPM A;  4YCU A;  2F4V L;  2WB1 B;  3LNN A;  5JOB A;  4L5S A;  2NB0 A;  4K2L A;  1WCM B;  1GUO A;  3A7A B;  4DN4 M;  3PQI A;  2EY1 A;  4JV5 Q;  4C2M B;  1ZYR D;  4EQP A;  1SFO B;  1HPC A;  1EEF D;  1LAC A;  3FKI B;  4L6T B;  1PTO C;  3F1Z A;  1CK1 A;  3K0X A;  5EJW A;  3OWF A;  2E5L L;  3FMC A;  4OO1 G;  3W2D A;  3CMA A;  1XMQ L;  4ALP A;  4FNF A;  3TN2 A;  2BE5 C;  4ZAI A;  2KBN A;  4HED A;  1QVC A;  1STH A;  3I7F A;  4OIJ A;  1ESR A;  1VF5 C;  4DK0 A;  1CUK A;  4BWG B;  1IBM Q;  3HOY B;  2I5H A;  1Q3L A;  1SSO A;  3S2H B;  3H3V C;  4JOI A;  1PYW D;  1S40 A;  3DMU A;  1E1O A;  2K28 A;  3B6Y A;  3T51 B;  3CCQ A;  2TMP A;  2LS0 1;  5IIF A;  1FJG L;  2O2L D;  5HUR A;  3A74 A;  4K5V A;  1YJW A;  1OXS C;  5LMN Q;  1WCM H;  2XSC A;  5IGC A;  2JK8 A;  2FMM A;  2VQF L;  3LWU A;  3BJU A;  3AU7 A;  4M8A A;  2KUM A;  5M5W B;  2NVT B;  1SYE A;  3OWE B;  3SR1 A;  2F0J A;  2ZXR A;  3IL8 A;  1HQM C;  5M3F G;  2R7Z G;  3K57 A;  1Q81 C;  2J0T D;  4C3H B;  2DUD A;  1SNP A;  1VQG A;  2UUA L;  1DJR D;  2JA6 H;  4QUF A;  1VQ5 A;  4LF8 L;  2F0U A;  4PG3 A;  2Q2I A;  3OHX C;  1GM5 A;  2GVB A;  2VQE Q;  1S72 A;  4ME3 A;  1EWC A;  3J81 c;  3BDL A;  2HHH Q;  1D8L A;  1H9J A;  3P7J A;  4DUY L;  5K5P A;  1STY A;  4GN4 B;  5IOC A;  5IP7 H;  3RNU A;  1N32 Q;  2WP8 J;  3RZO B;  3TZU A;  2ZTD A;  1K8M A;  1X54 A;  2DY8 A;  1N32 L;  2DJG C;  4JI3 Q;  4E6I A;  3OTO L;  1TWF H;  4N9P A;  5IE8 A;  3OOC A;  4UPA A;  3H94 A;  4CDD C;  4B3R Q;  2CHB D;  2XWB B;  4K14 A;  4WOR A;  4LUZ A;  2Z9H A;  2JA5 B;  2O5J C;  2E8G A;  4ZK9 B;  3RN5 A;  1CT1 D;  2QA4 A;  1WYD A;  3HFZ B;  1WD0 A;  4LJZ C;  1RJT A;  1UNS A;  2VL6 A;  4AQY Q;  1I5F A;  3JAM E;  3ND8 A;  2EDG A;  3ZYY X;  4C3I G;  1UUP A;  1HZ9 A;  1VQL A;  1DCZ A;  3RN2 A;  3HRZ C;  3MFG A;  3RD4 A;  1CM9 A;  2EY5 A;  3VA5 A;  3NTI A;  3M4O B;  1BVS A;  1UE1 A;  1AW7 A;  1ASY A;  4JCV E;  4A93 H;  3TRZ A;  1HNZ Q;  1SAP A;  1F9R A;  1Q12 A;  3R2T A;  2CWA A;  1VQP A;  1ILP A;  3NQI A;  5A2Q E;  1TWA B;  5JPN C;  1GUT A;  1Z9F A;  3TDQ A;  4DV0 Q;  1QZG A;  4RHR A;  4GS3 A;  4FF1 A;  3SHL A;  4KD3 A;  1DM0 B;  2JA5 H;  2WKD A; 
#chains in the Genus database with same CATH homology
 4RMF A;  1EQR A;  1NY4 A;  1PH7 A;  4A3G H;  3HOX G;  1FGU A;  2NN6 I;  1CKN A;  4IPH A;  4DAM A;  1P8L A;  5C4X H;  1Y1W H;  2EQS A;  1VQM A;  1UE6 A;  3PGZ A;  3TS2 A;  2Z6K C;  3OYY A;  5C3E G;  4YCW A;  2QGQ A;  1XPU A;  3PO3 G;  3S14 H;  1NMF A;  5AJ3 Q;  1E1T A;  5C4J H;  4HJ9 A;  1KD1 C;  3CPW A;  4YHH L;  1IXR A;  2DGY A;  2VZA A;  3KLW A;  4L5Q A;  4R4O A;  2D0O A;  5C44 H;  2K4K A;  3CAM A;  4A3C G;  1HZA A;  5FLM H;  2V1C C;  4JC0 A;  2VW9 A;  1L1O C;  2JA6 G;  3RLO A;  2UUC Q;  1Q1E A;  5C0X I;  1YHB A;  4HJ8 A;  4DR5 L;  3ULJ A;  4KLK A;  2LSS A;  4LF9 L;  4DV7 Q;  1Q82 C;  3ICE A;  3HOV G;  4C3I H;  4P71 A;  2PI2 A;  1VQE A;  4IPD A;  3CXC A;  4JBW A;  1OXU A;  1PHJ A;  3EIV A;  2K75 A;  4WJ3 M;  1FVI A;  3GTL H;  2ASB A;  2PNH A;  4MNO A;  2WB1 E;  1Y14 B;  4EQ5 A;  4A3K H;  2HIX A;  4X66 L;  3KF6 A;  4IPC A;  3M4Q A;  4K0K L;  4DAY B;  4GLA C;  4R1J A;  1TWC H;  1B7Y B;  3L7Z C;  2I5L X;  1VQ4 A;  2IX1 A;  5C0X J;  2JA8 H;  1G6P A;  1OXT A;  1IZ6 A;  4JBJ A;  3I55 A;  4MZ9 A;  1RL2 A;  5ELN A;  4BBR G;  4DKA C;  3H15 A;  1WFQ A;  3K80 C;  2OCE A;  1WI5 A;  4DV3 L;  1KXL A;  3TQY A;  2K50 A;  5LMN W;  4JI6 Q;  2HT1 A;  3S16 H;  1VQF A;  2YTY A;  1Y1V G;  4BY1 H;  4JI4 L;  3JAM c;  1VQA A;  1VS0 A;  4JI8 L;  2I0Q A;  1N33 L;  1IBK L;  2E5L Q;  1PYB A;  2RF4 A;  1PH9 A;  1LYL A;  4X6A H;  1NE3 A;  3RZD H;  2UXB L;  1DGS A;  2CQO A;  2H5X A;  2BA0 A;  1BKB A;  1VQH A;  2ES2 A;  1VQ9 A;  3RLN A;  2AMC B;  4DR3 Q;  2RHS B;  3NEM A;  3I56 A;  1EIY B;  1A8V A;  1PH5 A;  4DV6 L;  3E9I A;  1HZB A;  2OQK A;  3KJO A;  4OWW B;  4DK6 C;  3EBE A;  3S2D H;  3E0E A;  2ZTE A;  4DV7 L;  4DV4 L;  3G71 A;  2NVT H;  4TQU S;  3ZJY C;  5IYB G;  1YJ9 A;  3H3V H;  5LMN L;  2ZTC A;  5M3M H;  4A3L H;  4LWC A;  3PF4 A;  2KHI A;  2UXC Q;  3J81 j;  1IL2 A;  4FDB A;  2B63 G;  1U0L A;  3NEL A;  4OON A;  4A3J G;  4L5R C;  2OWO A;  3OTO Q;  1JMC A;  4LF5 L;  3S17 H;  3G6E A;  1Q86 C;  3M4O H;  3KYH C;  4B3R L;  3G48 A;  4GLV B;  1N34 L;  1BBU A;  2QEX A;  3GD7 A;  3T1Y L;  4JI0 Q;  4LNQ A;  1GVP A;  1CSP A;  3E9H A;  2EXD A;  3KF8 B;  4NXN L;  1JT8 A;  4APV A;  1HR0 W;  4NXN Q;  4A3B H;  1TWG H;  5JEA J;  4DV1 Q;  3S1Q H;  2RCN A;  4LF6 L;  4YY3 Q;  4OO1 I;  4IJH A;  3T1Y Q;  4TVA B;  2LXJ A;  1BBW A;  3CCJ A;  2Y0S G;  3KDF B;  1E22 A;  1MJC A;  4IPG A;  2ZM6 L;  3PUV A;  2HHH L;  4DR3 L;  1XNQ L;  4GKJ L;  1VQK A;  4JI7 Q;  4LF7 L;  5IP9 G;  1X3E A;  1VQJ A;  5GRO A;  1XJV A;  2UXD Q;  2UU9 L;  4BBR H;  2UXD L;  1QUQ A;  2YTV A;  3CF5 A;  4UP9 A;  3U50 C;  2UUA Q;  4LF4 Q;  1YNX A;  3FKI G;  4IOA A;  4C2M H;  2MFI A;  1N33 Q;  3GTP H;  2GN5 A;  3KOJ A;  3PUY A;  4C3J H;  4NXM Q;  4JI6 L;  5IYC G;  3W1B A;  5GAE C;  4B3S L;  5BR8 Q;  2D62 A;  4P74 A;  3U58 A;  4JI5 Q;  4DR7 L;  3UDF A;  1I94 L;  1JJG A;  1TXY A;  2JA9 A;  2WAQ G;  3F2C A;  2BH2 A;  3I4N G;  4R4C A;  4P72 A;  1Z47 A;  1EQQ A;  3M85 A;  1RIP A;  3RR5 A;  4A3M H;  2F4V Q;  3CC4 A;  4JI0 L;  4IFD J;  1KL9 A;  3M3Y H;  5C44 G;  3CME A;  1VQO A;  2F3I A;  1YIT A;  1K8A C;  2A19 A;  1IBL L;  4JBK A;  4P73 A;  5J3B A;  1E7Z A;  4B3M Q;  4DR6 L;  2CWP A;  4K0K Q;  1NJI C;  3D31 A;  3PUW A;  1W2B A;  4GOP C;  3KJP A;  2AKW B;  3A5U A;  3RZO H;  1V9P A;  1X3G A;  2KCT A;  2B63 H;  2AWN A;  4Y52 H;  2VS1 A;  1SN8 A;  1YHA A;  3BZC A;  4YWM A;  1L1O A;  2YYZ A;  2ZM6 Q;  4QGU A;  1QUQ B;  2GVA A;  5HY6 A;  3UDX A;  2VUM G;  4LFA L;  1FJG Q;  3GTK H;  2K5V A;  2WFW A;  1P16 A;  5JEA G;  1KHI A;  4QY7 A;  1HZC A;  4LFA Q;  4POF A;  4DR1 L;  3VDY A;  3CC2 A;  4DR2 Q;  2B29 A;  2F52 A;  4DR4 Q;  3ERS X;  1C7Y A;  4UP7 A;  4DV2 L;  1YJN A;  4A3F H;  1YHQ A;  3CP0 A;  1WCM G;  1YVC A;  1XMO Q;  4BBS H;  3HOX H;  4A3D H;  4JYA L;  5ELO A;  3K81 C;  2EIF A;  2Y0S E;  4JI7 L;  4OWX B;  2IHF A;  4BY1 G;  3U4V A;  5IP9 H;  1XTD A;  2YV5 A;  1YZ6 A;  4JI5 L;  3HOZ G;  4B3T L;  1TWA H;  4A3F G;  5M5W H;  3T1H L;  5IY0 A;  2ZJR A;  1HR0 Q;  4NXM L;  1XMQ Q;  1EOV A;  3PIO A;  4KHP L;  2L15 A;  4H02 A;  2JA7 H;  3M9B A;  4LF6 Q;  3Q8D A;  4QQB X;  4DNI A;  3W1G A;  2C35 B;  1A0I A;  2K5H A;  3CCR A;  3CCL A;  1VQ8 A;  3D0F A;  3CQZ H;  4JYA Q;  4KI0 A;  2UU9 Q;  1B8A A;  3AFP A;  4DUY Q;  3GO5 A;  3ER0 A;  2WAQ E;  5FJ8 H;  1KRT A;  4AYB G;  4HIO A;  2JA7 G;  2ATW A;  4A3K G;  2IX0 A;  4A3M G;  5GAH C;  4JBM A;  1V1Q A;  1N9W A;  4JOI C;  1K73 C;  3PO2 H;  4BXX H;  1EYG A;  4IFD I;  2B3G A;  4IFD G;  1LUZ A;  3FHW A;  4A76 A;  1EFW A;  3RLF A;  4X62 Q;  5EAY A;  1J5E Q;  1SR3 A;  5IP7 G;  1B70 B;  1X3F A;  5M5Y H;  4DV5 Q;  1XNR L;  1I3Q H;  1IYJ B;  1HJP A;  3PSI A;  3SGI A;  1HNZ L;  3LGJ A;  1O7I A;  2KCM A;  2CFM A;  2XGT A;  2R92 H;  1KC8 C;  3T1H Q;  1EWI A;  1X9N A;  1HR0 L;  2KHJ A;  4LF5 Q;  1M90 C;  3GTM H;  1Q1B A;  2K14 A;  4PZ6 A;  1EUJ A;  2JE6 I;  4DR5 Q;  3H3V I;  4GKK L;  1I6H H;  3H0G G;  3I4M G;  3M7N A;  1G29 1;  1L0W A;  4L5T A;  4PZ8 A;  2UXB Q;  3JAM i;  5JJK A;  1C9O A;  1QVF A;  4WJ4 A;  4DR4 L;  1QZH A;  3S1M H;  1AE3 A;  2ID0 A;  1K9M C;  3TRE A;  3TS0 A;  4YWL A;  5GAG C;  4A3B G;  4B3T Q;  1Y1V H;  5DLQ E;  4QJF A;  4R4T A;  1HH2 P;  4P75 A;  3STB C;  4AQY L;  1JJC B;  3ULP A;  1VCI A;  1SRO A;  4LFC Q;  3HOW H;  3IRB A;  5IT9 c;  4JI1 Q;  4JG2 A;  2YU9 H;  4DUZ L;  1A63 A;  1XMO L;  4OWT B;  1CKM A;  1SE8 A;  5E7N A;  4OX9 Q;  3K7U C;  4X64 L;  1KRS A;  4DPG A;  2NVQ H;  4JI8 Q;  4DV4 Q;  3CC7 A;  4LW1 A;  3I2Z A;  2JA5 G;  2JA8 G;  4LF9 Q;  1IBL Q;  3TEH B;  1K3R A;  4AYB E;  2AWO A;  4GNX B;  4A3G G;  4X64 Q;  1E3P A;  4IJL A;  2NZH A;  3NBH B;  5IYB H;  3GTJ H;  1KIX A;  2R93 H;  3HOY G;  3WWV A;  3J80 c;  4NPS A;  2KEN A;  4JI3 L;  3MXN B;  2R7F A;  3GDE A;  2WB1 G;  5C3E H;  2R6G A;  3CCM A;  3A5Z B;  4GNX C;  3GTQ H;  4A4I A;  1Y1W G;  3HOW G;  5LMU Q;  1K83 H;  1L2F A;  1SFO H;  1PH1 A;  1YI2 A;  1NMG A;  1VQ7 A;  2IT1 A;  2LXK A;  2MNA A;  1OTC A;  4YCU A;  2F4V L;  1VQB A;  2UUB Q;  1S3O A;  3UDI A;  1X55 A;  1CKO A;  1LM0 A;  3G4S A;  1J5E L;  4L5S A;  4LF7 Q;  3H0G H;  1SMX A;  1VQN A;  5AJ3 L;  4JV5 Q;  1KAW A;  1Q46 A;  1CKN B;  1EIF A;  3STB D;  2NVX H;  2XTI A;  5K36 G;  2Z6K A;  4EX5 A;  4X66 Q;  4DV6 Q;  3HOY H;  1PH8 A;  4DV0 L;  1LTL A;  1YBY A;  1HNW Q;  1XNR Q;  2NN6 G;  1FL0 A;  3KDF A;  1R9T H;  2VUM H;  4NB3 A;  1M1K C;  1Q7Y C;  2UUC L;  2NZO A;  4GNX A;  3F1Z A;  1UE5 A;  1JE5 A;  1ASZ A;  3K0X A;  3I4M H;  1SRU A;  4LFB Q;  2E5L L;  4POG A;  4RG1 A;  2E2J H;  1MIU A;  3AEV A;  5IYD G;  4OO1 G;  4JI4 Q;  3CMA A;  1XMQ L;  4AH6 A;  4ALP A;  5IWA L;  5IYC H;  2R7Z H;  2KBN A;  1YIJ A;  1HNX Q;  1WJJ A;  1QVC A;  2AHO B;  3AQQ A;  3I7F A;  3J80 i;  3J7Z C;  1IBM Q;  1CUK A;  4YY3 L;  1PH6 A;  2I5H A;  4C3H H;  4DK3 C;  1X65 A;  1GKH A;  5IYD H;  4JOI A;  1NTG A;  1S40 A;  1W3S A;  4A75 A;  4A3E H;  1E1O A;  4YHH Q;  3B6Y A;  1V43 A;  3CCQ A;  4GN5 A;  3PO2 G;  4BXX G;  4YCV A;  2JJQ A;  4UP8 A;  1CSQ A;  2PQA B;  3U4Z A;  1FJG L;  3JC6 6;  2RHQ B;  5JJI A;  4XTC S;  3GTG H;  1UWV A;  5FJ8 G;  4PZ7 A;  3HOV H;  3A74 A;  4GOP A;  1YJW A;  3BU2 A;  4LUO A;  3F2D A;  1KQS A;  2ZJQ A;  3AFQ A;  1MKH A;  1OXS C;  3S1R H;  2R92 G;  4DV2 Q;  5LMN Q;  2CCZ A;  3KF6 B;  4HJA A;  1WCM H;  4BBS G;  2JK8 A;  1PVO A;  3J7A 5;  4LF8 Q;  2N78 A;  1UEB A;  2VQF L;  3F8T A;  2E2H H;  5HGQ A;  3BJU A;  1VQC A;  3I4O A;  5M3M G;  4DUZ Q;  4R4I A;  3HOZ H;  4A3I G;  2JEB I;  4X65 L;  1N8R C;  4XIG S;  3W5O A;  4A3J H;  3A0J A;  3DLL A;  1I50 H;  1H95 A;  4A3L G;  3GTO H;  2K52 A;  1PA6 A;  1IBK Q;  2MQH A;  2I5M X;  3PO3 H;  1PFS A;  4LUV A;  5M3F G;  2R7Z G;  3PIP A;  1Q81 C;  1VQD A;  5C0X G;  4HJ5 A;  4BY7 H;  1J6Q A;  3HKZ E;  4Y7N H;  2Q2H A;  2DUD A;  1XPO A;  1VQG A;  5BR8 L;  4R4Q A;  4DR7 Q;  1HNW L;  4HIK A;  2UUA L;  2CKZ B;  4JI2 Q;  1PYS B;  4LF4 L;  2A8V A;  1PH4 A;  1VQ6 A;  2OQ0 A;  2JA6 H;  1VQ5 A;  3PF5 A;  4LF8 L;  4PG3 A;  1G51 A;  2Q2I A;  1GM5 A;  4GKJ Q;  3CW2 C;  3UDG A;  1I94 Q;  4LFB L;  2BA1 A;  4BY7 G;  3HOU G;  2Z0S A;  2GVB A;  2N3S A;  2FXQ A;  2VQE Q;  2ZJP A;  1L1O B;  2NVY H;  1S72 A;  3J81 i;  4ME3 A;  3HKZ G;  3S24 A;  3J81 c;  4HJ7 A;  2HHH Q;  1XNQ Q;  1D8L A;  4A93 G;  4DUY L;  3I4N H;  3CCV A;  2D0P A;  3FKI H;  2BH8 A;  4DV1 L;  3UE1 A;  4KHP Q;  4GN4 B;  5IP7 H;  3PV0 A;  3K8A A;  3RNU A;  1X6O A;  4JV5 L;  1N32 Q;  3CD6 A;  2WP8 J;  1GO3 E;  2ZTD A;  4YWK A;  1JJ2 A;  1PH3 A;  1N34 Q;  1X54 A;  2K5N A;  1MJE A;  3NEN A;  4A3D G;  4JI2 L;  1N32 L;  4GN3 B;  3ULL A;  4JI3 Q;  2UUB L;  1YEZ A;  3OTO L;  1TWF H;  1IBM L;  3L0O A;  5IE8 A;  3CPF A;  3FP9 A;  3PUZ A;  4UPA A;  4DR2 L;  1E24 A;  4B3R Q;  3F2B A;  4J15 A;  2IHE A;  4LUZ A;  1GD7 A;  2N8N A;  1T9H A;  2YTX A;  4HID A;  3HKS A;  1OXV A;  5GQO A;  2A1A A;  4GOP B;  3BZK A;  4HIM A;  2E8G A;  2HQL A;  4O0A A;  3S1N H;  4BA2 I;  5FLM G;  2N49 A;  3RN5 A;  3DM3 A;  2OTL A;  1N36 L;  4A3C H;  4IO9 A;  2JEA I;  4MTN A;  2OTJ A;  2QA4 A;  1WYD A;  4OXP A;  4BA1 I;  5GAD C;  3HFZ B;  2UXC L;  1AE2 A;  5FLX c;  4GLX A;  5M3F H;  2MO0 A;  2VL6 A;  4LFC L;  1OXX K;  1TWH H;  4DR1 Q;  4PMW A;  4AQY Q;  4A3E G;  1I5F A;  2HIV A;  3L2P A;  5M5X H;  1N36 Q;  1U5K A;  2VQE L;  4AIM A;  1PH2 A;  3K7A H;  3PCO B;  1D7Q A;  1HZ9 A;  2JQO A;  2MO1 A;  3M4P A;  4QIW E;  1VQL A;  4OX9 L;  3OW2 A;  5JJL A;  2ALY B;  1VQI A;  4B3M L;  4DR6 Q;  2PMZ E;  3RN2 A;  5H1S E;  4JI1 L;  3EN2 A;  3HOU H;  2R93 G;  2PI2 E;  4QL5 A;  4UY8 C;  4O2D A;  4X65 Q;  2Q2U A;  1BVS A;  3S2H H;  3PUX A;  3S15 H;  1SLJ A;  2R7D A;  4B3S Q;  5C4X G;  1UE1 A;  1ASY A;  1UE7 A;  4JCV E;  1QVG A;  5IWA Q;  4A93 H;  2VQF Q;  1XPR A;  3TRZ A;  5LMU L;  1HNZ Q;  2VNU D;  1A62 A;  1X56 A;  3MEF A;  1K8G A;  1Q12 A;  2PQA A;  2VY3 A;  3CCS A;  4KHZ A;  3CCE A;  4DV5 L;  3UE0 A;  1PV4 A;  2CWA A;  1VQP A;  1AH9 A;  4GKK Q;  4X62 L;  4DV3 Q;  1Q8K A;  4IOC A;  3CCU A;  1K0R A;  1Z9F A;  4DV0 Q;  1HNX L;  2E2I H;  2Q2T A;  3KFU A;  1QZG A;  1WOC A;  4GS3 A;  1JB7 A;  1NBW A;  2JA5 H;  1C0A A;  2IY5 B;  3AYH B;  4A3I H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...