1N32T

Structure of the thermus thermophilus 30s ribosomal subunit bound to codon and near-cognate transfer rna anticodon stem-loop mismatched at the first codon position at the a site with paromomycin
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
99
structure length
99
Chain Sequence
RNLSALKRHRQSLKRRLRNKAKKSAIKTLSKKAIQLAQEGKAEEALKIMRKAESLIDKAAKGSTLHKNAAARRKSRLMRKVRQLLEAAGAPLIGGGLSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S RIBOSOMAL RNA
publication title Selection of tRNA by the Ribosome Requires a Transition from an Open to a Closed Form
pubmed doi rcsb
molecule tags Ribosome
total genus 34
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 2002-10-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
T PF01649 Ribosomal_S20p Ribosomal protein S20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.110 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Ribosomal protein S20 1n32T00
4DV2T 4NXMT 4LF6T 4DV4T 4GKKT 4LF4T 1HR0T 1HNZT 3T1YT 4JI8T 2UUAT 4B3MT 1XMQT 4LF7T 4DV5T 1IBLT 2F4VT 4LFBT 1N36T 4LF9T 2UXBT 4JI5T 1IBKT 4DV7T 4JI4T 4DR2T 4DR3T 2ZM6T 4DR4T 4JV5T 4LFAT 4NXNT 4KHPT 2UXDT 2UXCT 1HNWT 2UUBT 5LMUT 1N33T 4LF8T 4DR6T 4LF5T 4DV3T 4X62T 4JYAT 1HNXT 4K0KT 1J5ET 2UUCT 4DR1T 4DV0T 2VQFT 3T1HT 3OTOT 4X66T 4DR5T 4LFCT 4JI6T 4B3RT 5BR8T 4DUYT 1XNQT 5IWAT 1IBMT 1XNRT 4OX9T 2VQET 1N34T 4JI1T 4YY3T 4X65T 4YHHT 4JI2T 4DUZT 4X64T 4DR7T 4JI3T 4AQYT 4B3TT 1N32T 5LMNT 4DV6T 1XMOT 4B3ST 2HHHT 4JI0T 1I94T 2E5LT 4DV1T 1FJGT 4GKJT 4JI7T 2UU9T
chains in the Genus database with same CATH superfamily
3NRYA 5IYZE 2E9XB 4LF6T 1ZOYA 3AB3B 4PW8A 5IHYA 3N9QA 1IBLT 3ZMUB 3UT5E 2LOSA 4NPPA 3Q2MA 5AQIB 4AQFC 4IDOA 1QUUA 1MMAA 4KHPT 3GN5B 3UU8A 3JAEA 3HA4A 3CQCB 4E7ZA 1I6ZA 3F57A 1HFAA 3KINB 1BR0A 2MOZA 2VVNA 3ZCJA 3VR8A 5ABHA 5LNKA 3Q5XA 2D9DA 4IGUA 1EZ3A 2CHNA 2FUPA 2N2NA 4A56A 3AE2A 4MFRA 2XSBA 3CMLA 5AQOB 3B13A 5J1GA 3PDYA 4JEHB 1YKEB 4CN1A 3L09A 2X67A 4JI1T 3N2GE 2CXFA 2NTYA 2CCQA 1NAFA 2XQ5A 3H3MA 4UXNB 2XQ8A 3EDUA 2HHHT 3W15B 4EZHA 3EABA 4ILUA 4YSZA 4MLKA 4QH1A 1CHUA 4GK0E 3UU3A 3RPUA 5HXCA 2PFVA 3H37A 3ZLIA 2V7LA 3ZMZB 4NXMT 1J1JA 3K8PC 5AQKB 2CXDA 4NIQA 3BK9A 4Z90A 3R84B 2LRLA 3PUAA 3AVSA 3RQUA 1Y64B 3AE7A 1HCIA 4PFOA 4H9SE 4UV9B 2B1EA 3N5LA 2XY8B 1W0AA 5CB4E 4GIWA 2FJEA 3ONJA 5ETWA 4I4TE 2CLYB 4AQFA 2ZM2A 1BR2A 5DQWA 2BS2A 1E7PA 3P4PA 4UIGA 4WBNE 4ZI7E 4DBQA 4WZXA 4TNWA 4XAXB 4DUYT 2IC9A 2LKGA 2DCFA 2CXLA 1WRDA 2JPFA 5J2TE 2DLRA 5JDHA 2HN1A 4O4HE 4DR7T 3GWHA 3P4WA 5CJ5A 3ZPOA 1XZYA 1W0BA 5C3JA 2YKSA 4G2AA 1AJ3A 5HCMA 4JI0T 3L8RA 3FZKB 3QNUA 2H89A 2LSGA 1KEYA 3FZHB 4YTPA 2ZMAA 3FHNA 2A3DA 1XWMA 3QK6A 3ZN1B 3RIAA 5AQUB 3TLTA 3PUWF 5JQGE 2CRBA 4HFEA 4EZ4A 4GOUA 4DR4T 3ZYLA 2W2UA 4JV5T 5FL0A 1BR4A 3AAEB 5JR9C 3X1DA 3KFWX 4NUUA 5JDQA 1HNXT 5FY1A 2X9HA 5L3DB 2JQ9A 1KFYA 1KF6A 4DV0T 2NW9A 3FZLB 5FY7A 3KV4A 4AI6A 2ZM8A 3MKDA 3AXJA 1MMNA 5IWAT 2ZLYA 1XDPA 4BAYB 2LM2A 3AEFA 2M6IA 4DUZT 2FBWA 4CXYA 3UU6A 4O4JE 4B3TT 2N9DA 4UELA 2IDOB 3ZSSA 4TV8E 3P4RA 1NENA 2A2FX 2E5LT 2XQ6A 4DO0A 5JTGA 3JC6D 3OYZA 1VOMA 3O1IA 3CK6A 3M65A 2QRXA 3I0OA 3PUSA 2FJBA 3AE1A 2BBHA 4GKKT 1X79A 2LHRA 2KSRA 3TLVA 4TX5A 5AQPB 5LHHB 2PJQA 1IBKT 4HWDA 3AVRA 3AEGA 3CQGB 3PE0A 3FBLA 4H9OC 3AA0B 1N33T 4TV9E 1MNEA 3N2OA 2LLYA 4FI5A 3NBXX 2YINA 5JR9A 5LHGB 3F2EA 4ERRA 3K3OA 4ZXLA 2WCAA 5HXSA 2NW7A 3PJAJ 1IAPA 5LGTB 4JI6T 4CXWA 3KVAA 3KBUA 4YTNA 2DI4A 3O1HA 4X65T 4P0AA 5AQNB 1MMGA 4PJJA 4U2ZA 3KV9A 3BQLA 4HFCA 3C64A 5L3BB 3ZC0A 3SRZA 4AKRB 3C51A 3SS1A 2VL0A 2V7MA 4GKJT 3H3AA 5LA6E 4OYJA 1MNDA 2NP9A 4GYRA 4DV4T 2IIUA 4H9RC 4EAHA 2VK9A 3FZMB 2IUBA 3MJXA 5A1LA 5LG3A 3RYHE 2W61A 4L0RA 4I55E 2J47A 1WCRA 3AEAA 4O4LE 4GYSA 2YDRA 4HN9A 4LFAT 2K48A 1HS7A 4UR9A 2XPKA 2Y48B 1Z0PA 4M1PA 2EHOB 2VL8A 3MK7C 4AKGA 2A72A 2LSIA 4YTMA 4EEBA 5HCJA 2XAQB 2V6YA 3IHRA 2WU5A 1R8IA 3K3QC 4X62T 3ZKRA 3UQ4A 3PUZF 1LVKA 5BMVE 1ZKEA 4IHJE 4QKNA 4DR1T 4G63A 4X66T 3UFGA 3RH3A 1ZV4X 2EHOD 5LJNA 4TUYE 1Y01A 5BR8T 5JDNA 2WDRA 4KX6A 2M67A 4WYVA 4FJOA 3EHZA 3ETVA 4UVBB 5F5WA 5HEGA 4IDZA 4CZZB 3VHLA 4YXDA 3L3PA 2E9XC 1ZEEA 1FJGT 3F31A 2UU9T 2H7OA 2VVSA 3UUNA 3P8CD 1NWMX 3O4XE 1D1BA 4EEDA 3LBXA 5LBQB 4IDNA 3HI2A 2HH7A 1U4QA 1WR6A 3R6NA 5FVLA 4K0UA 5L4HA 2I59A 2JQQA 2XM1A 2L8KA 2WZIA 1KNZA 5FYMA 1US7B 5KX5E 5L3FB 1M7KA 4O2BE 5FXWA 1FMVA 4I50E 3MA9A 1T72A 4YSXA 2L9QA 4ZS3A 2M6BA 3ANWB 3N9MA 2E9XD 3Q5WA 3DTOA 3KV5A 3V5SA 4EYUA 2DL1A 3C98B 1V9DA 2BKPA 1MIWA 4LMKA 1QSDA 2Y6XA 2X9XA 4ANJA 1YW0A 2CE7A 4Q25A 5JREA 3PV0F 4DMWA 4H63H 2D0TA 3RX6A 1WR0A 2LJLA 3AE8A 1H7CA 2XSAA 4HKAA 3IF8B 5KXJA 4PAGA 3T8OA 2JJ9A 3KBTA 2LRKA 5LBMA 5C8YE 1HR0T 1HNZT 2E9XA 3EUHA 4DMVA 3AECA 2UUAT 3QB5A 2X66A 2ACXA 4EV6A 5AQSB 1HTJF 3ONXA 4YLHA 3EI0A 4IDPA 3C4WA 2MBGA 3ZT7A 2V7JA 2CLYC 2LKHA 1T8BA 5AQFB 3A5XA 1HNWT 5J0ZA 2WDVA 4JEUB 2V5DA 4LF8T 3GN5A 3P4SA 1OWAA 2YDSA 4WW0A 3PUVF 2L3LA 2JMKA 4AKLA 4AKIA 4H9QC 4JUYA 4U3CA 1D0YA 5FXZA 4PNIA 3I0QA 1FIOA 2AE9A 4ISSA 2X9WA 4C90A 3K3NA 3AE5A 3SFDA 2SPCA 1HG5A 4HFBA 2JQHA 2VKOA 4OX9T 1N34T 1UCUA 4IE7A 4YY3T 4DIDB 2V7IA 3J9X1 4X64T 4MBQA 1OEDB 1SUMB 2KWIB 4QX8B 4PJLA 1XMOT 1J5WA 4P0BA 4YJ3E 1I94T 4IDQA 2XAHB 3O1JA 4AIUA 1YD8G 5DABA 1KNRA 1SA0E 4E7SA 2HPLA 2LHNA 4IL9A 1FMWA 2BBJA 3N9PA 4O2AE 4UVCB 3CQXC 4IE4A 1UGOA 2XQ7A 2LOPA 3P4QA 1G73A 3ZMVB 3T1YT 2Q9QC 3AAIA 1HG2A 4O4IE 3KV6A 3QOFA 4UF0B 3DJBA 4IREA 1UURA 4QH4A 5FL1A 2UXXB 4MHCA 2XUEA 2CBJA 3HKDE 2X0YA 4U33A 3LDQB 5HEUA 3ZT6A 3LFMA 4IE5A 2Q9QB 5LHIB 4CN4A 3MXZA 1JNZA 2K9AA 2BZBA 2VQFT 3JC6C 4XZCA 2LSKA 4LFCT 1X9BA 3HKEE 2FJAA 4ZEYA 4L5GA 4KBMB 1O3XA 4CQIA 2Q9QD 2X68A 4N78D 1E2AA 2OA5A 2XAJB 5J2UE 2YK0A 3A7MA 3C4ZA 2WWVA 2MYSA 4ZHQE 3NRXA 5HWXA 5AQGB 2WY2A 4HFVA 3IA3A 3SWHA 1OXZA 2WAUA 5HAXA 2BG9B 2WBLA 4TNVA 5L4EA 4LF4T 3ZYMA 5JRCB 4HFIA 3S4UA 3L39A 4B3MT 4Z91A 4DV5T 2R6GF 2ZM0A 2F4VT 1N36T 3LK2B 4O8SA 4LF9T 3EVYA 4JI4T 1YKHB 2Q9QA 2WP9A 4ZS2A 3CWZB 4TZ4C 2XQYA 5ABFB 3JCFA 4XBFB 3AA1B 2UUBT 5FXVA 3U3IA 2IHR1 2LT3A 5LG4A 3EAMA 5HXHA 3PURA 2MAWA 5JVDE 2GK9A 2XASB 3IEEA 4Z8XA 3C50A 3UQ7A 5CGMA 2K3WA 4ZOLE 1WYCA 3P50A 4U2YA 2V8SV 2C5JA 4HGAA 1YQ3A 2D2SA 4HFDA 1VCTA 5HEOA 3RRWA 5FKYA 2E2AA 3KVBA 2WWUA 1S94A 3SFEA 3C4XA 4MALA 4NUVA 1CUNA 3RHWA 4LMJA 2BS3A 2IW5B 2LSYA 3LK3B 1Z8UA 4EXTA 3PU8A 2XQ3A 2JRKA 4DNDA 3OPCA 4IE0A 2C0SA 4HFHA 3OYXA 3QUJA 3Q9DA 5AQQB 3RYFE 2RA1A 4DV7T 3RLFF 2EHOC 3PU3A 1HX1B 2CMRA 2JMHA 4ILCA 2BKNA 2WMOA 4QX7B 4QXBB 5LMUT 4HTEA 2VWAA 4LF5T 4OHFA 4EB6E 2KLQA 1J5ET 2J1DG 3AE3A 3ZC1A 2CA5A 4CN6A 1WYBA 1LRZA 3VRBA 4QXHB 5M4YA 2B76A 5L47A 2LEHA 1XNRT 5HEHA 3AA6B 2H88A 3CX6B 5LMNT 4DV6T 3UUMA 4CXXA 3QB5K 3ZEFB 5JDLA 4U31A 3AA7B 2W67A 4COFA 4PK5A 2X0HA 3RIFA 2YDQA 2YU1A 3VKGA 4JLEA 5CA0E 3BQIA 2W63A 3ESLA 4HWFA 3P7IA 4A97A 1YQ4A 4UEMA 4GK5E 4JI5T 2XAGB 2ZM6T 4DR2T 3OVUA 4NXNT 2KZ7B 3IBPA 2X0LB 4LMLA 5TAOA 5FVKA 2EHOA 3RYIE 2YU2A 3N9OA 4OYKA 2YOEA 2C5IT 3ONLC 2KWHA 4V1Av 3N9NA 3AEDA 2H7VC 2KNDA 3OKQA 3O9XA 2YN6A 4B3RT 4YHJA 3MZKB 1B7TA 1SHZC 4QH5A 3PUXF 4PK4A 1D0XA 3VU7H 2CEAA 3AEBA 3ZCIA 1MIYA 2E8IA 2WM9A 5HXRA 3PUGA 3ZJ2A 3NZPA 2BKOA 2NTXA 4HEAA 5LXTE 3N9LA 4JI7T 2HPJA 2HN2A 2J4GA 2VURA 2DWGA 1UUSA 2WU2A 2W62A 2V26A 2QGSA 2VKDA 2LSJA 2BVLA 3ZMSB 3NZQA 1JNRA 1IJ6A 4CI3B 4LFBT 2YEVC 5EK2A 2JIWA 4YT0A 2WS3A 3RC8A 4J2CA 5FMNA 4U7YA 3M3ZB 4HWIB 2PBIA 4A5XA 5HEJA 3JAFA 4H9PC 1OEDE 3V5UA 3HKBE 1D1AA 3G06A 4EOZB 4U7IA 5CA1E 2CPTA 5JDFA 2W66A 2UUCT 2LE8A 3D0TA 3LG7A 5LOVE 3ZMTB 5AQVB 2BVMA 4WNKA 1UX5A 3ANWA 1VCSA 4I43B 4DR5T 2WZHA 4AISA 3Q5DA 1L0VA 3CPZA 2BS4A 1OEDC 4C91A 1FEWA 3AE6A 4QXCB 5L3CB 1LKXA 4CI1B 4JI3T 4ILAA 1QLBA 2NW8A 3ZT5A 2Z6EA 4B3ST 3A8YC 5LGUB 4PFPA 4KHZF 4DV1T 5ABEA 1LVFA 3RYCE 3QC9A 4F8HA 4P09A 3BQKA 2OLTA 4JI8T 2AXDS 1YXRA 4LF7T 1MMDA 3GA8A 4ILBA 3HL6A 4ZZCA 5ADXL 4BJMA 2ACZA 4PJMA 5FY0A 4AQGA 3KDSE 4PJNA 1IJ5A 2UXCT 1HX8A 2CWOA 2KINB 2WMNA 5JDGA 3SOLA 3NKZA 3CX7B 2QVAA 2X51A 1W9RA 3AEEA 5AQTB 4TWDA 4TWHA 4IIJE 2X9YA 4I0UA 1KK7A 4EYYR 4K0KT 3ZJ1A 4X1IE 3I9YA 3E08A 3AXJB 4X5TA 3WAKA 5HXEA 5H6RB 3DP7A 2N1GA 3AE4A 2BG9E 2VQET 3CKDA 1WLXA 4DVDA 2ODUA 2XAFB 5F8PA 4QHOA 5LGNB 3WI3A 4AQYT 5GONE 2VKHA 2BDEA 3GMIA 3RC3A 3PUQA 2V5CA 1OEDA 2PG8A 4ASKA 2RP4A 1ZP0A 5FP3A 2G0UA 4OK0A 2BG9C 2NWBA 1KNPA 4ZI2C 2K24A 1MIVA 3B5MA 3HKCE 5JDMA 4TN7B 4IE6A 3I1AA 4ISTA 2XQ4A 3OBVE 1XMQT 4HWCA 5HYAA 2OV9A 1VRBA 5DQVA 3PJAA 2UXBT 1UX4A 3ABVA 5AQMB 1NEKA 2NR4A 4UF0A 3JADA 2VASA 1E1HB 4ZI3C 3CVRA 2WQYA 3WAJA 4IT4A 1D0ZA 5FXXA 4EIWA 3PUYF 4DR6T 2KT9A 5JR9B 1T98A 2UXNB 3U78A 2K5BB 2ODVA 1D1CA 3LSVA 4AKHA 4P1NA 3I9WA 3RIUC 3OTOT 2XJ7A 4H63V 3FB2A 4ZI2D 4UV8B 5L2LA 4EGWA 2CWYA 1IBMT 1U5PA 4HE8A 3ZN0B 5KDMC 4YHHT 3ZSTA 2NOXA 5LCYA 4DBRA 3UU4A 4L9IA 1N32T 3RKOA 2CM0A 3AE9A 2XQAA 4ZI3D 3B57A 2W00A 2XQ9A 4DV2T 3EDVA 1W09A 2W4XA 2BG9A 4UVAB 3MACA 4HWHA 5JRCA 3TKLB 2D0UA 3FXDB 4QWNB 5AFUL 3NVOA 2WB5A 3PTRB 4JBWF 4DR3T 2P9BA 2XZEA 3TLWA 2KXPB 2V6YB 1T7SA 5ABFA 2I0MA 2PTFA 1WFDA 4DV3T 4KI0F 3VRAA 4KP3C 2VKJA 3TLUA 1SE7A 4U72A 4X1YE 3RQWA 3T1HT 3RF1A 5LP6E 2IMLA 3LJCA 5L3EB 2W0GA 3TLSA 3FBZA 3RIUA 2IC6A 3J7Yq 4JI2T 4H9NC 3UUBA 1ZHCA 4PK6A 5FNVE 4A98A 3UUXB 1XDOA 2DNXA 4YSYA 2J62A 2ES0A 2XM2A 1HF8A 4AXPA 2CBIA 3E22E 2XTLA 3NWIA 3K1SA 3FXEB 5LB7B 1M62A 2IAKA 3Q5EA 2WSSV 1UK5A 4WBOA 2QYWA 2MTQA 5AQRB 3UU5A 5EK4A 1DU2A 4KMCA 5DJQC 3LBXB 4BJNA 4CI2B 2JQKA 5ABGA 5EK3A 5AQLB 4YFSA 4B6XA 2DWKA 2QA7A 4X1KE 5AQJB 3CX8B 2LM9A 3VKHA 2UXDT 3UTKA 4TWFA 2I6HA 3HR0A 3RRCA 5E0OA 2VB6A 4ADZA 3RGLA 2E5VA 4X20E 4YJ2E 2V7KA 2RPAA 4JYAT 5LJMA 1S35A 5F3JA 3FZFB 2Y8DA 5LYJE 1G8XA 1GQEA 5L3GB 4ZZBA 2WDQA 3RI5A 2A9UA 2V6XA 3AAAB 4IL4A 4KUMB 2V1DB 3RKGA 1XNQT 3ETUA 1IZNB 2FJDA 2MPKA 4U74A 3E0ZA 4F6RC 4OFZA 2CHOA 3N2KE 2KMFA 3VR9A 2D5UA 5JH7E 3ZYKA 3OJAA 5CFBA 3UULA 3UFEA 2H3RA 5H6QB 2C5KT 3LK42 1BR1A 5EZYE 5C2TA 5AQHB 2DHRA 5IUXA 3CIRA 4BA9A 5HWYA 5KMGP 2XHEB
chains in the Genus database with same CATH topology
4DV2T 4NXMT 4LF6T 4DV4T 4GKKT 4LF4T 1HR0T 1HNZT 3T1YT 4JI8T 2UUAT 4B3MT 1XMQT 4LF7T 4DV5T 1IBLT 2F4VT 4LFBT 1N36T 4LF9T 2UXBT 4JI5T 1IBKT 4DV7T 4JI4T 4DR2T 4DR3T 2ZM6T 4DR4T 4JV5T 4LFAT 4NXNT 4KHPT 2UXDT 2UXCT 1HNWT 2UUBT 5LMUT 1N33T 4LF8T 4DR6T 4LF5T 4DV3T 4X62T 4JYAT 1HNXT 4K0KT 1J5ET 2UUCT 4DR1T 4DV0T 2VQFT 3T1HT 3OTOT 4X66T 4DR5T 4LFCT 4JI6T 4B3RT 5BR8T 4DUYT 1XNQT 5IWAT 1IBMT 1XNRT 4OX9T 2VQET 1N34T 4JI1T 4YY3T 4X65T 4YHHT 4JI2T 4DUZT 4X64T 4DR7T 4JI3T 4AQYT 4B3TT 1N32T 5LMNT 4DV6T 1XMOT 4B3ST 2HHHT 4JI0T 1I94T 2E5LT 4DV1T 1FJGT 4GKJT 4JI7T 2UU9T
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DV2 T;  4NXM T;  4LF6 T;  4DV4 T;  4GKK T;  4LF4 T;  1HR0 T;  1HNZ T;  3T1Y T;  4JI8 T;  2UUA T;  4B3M T;  1XMQ T;  4LF7 T;  4DV5 T;  1IBL T;  2F4V T;  4LFB T;  1N36 T;  4LF9 T;  2UXB T;  4JI5 T;  1IBK T;  4DV7 T;  4JI4 T;  4DR2 T;  4DR3 T;  2ZM6 T;  4DR4 T;  4JV5 T;  4LFA T;  4NXN T;  4KHP T;  2UXD T;  2UXC T;  1HNW T;  2UUB T;  5LMU T;  1N33 T;  4LF8 T;  4DR6 T;  4LF5 T;  4DV3 T;  4X62 T;  4JYA T;  1HNX T;  4K0K T;  1J5E T;  2UUC T;  4DR1 T;  4DV0 T;  2VQF T;  3T1H T;  3OTO T;  4X66 T;  4DR5 T;  4LFC T;  4JI6 T;  4B3R T;  5BR8 T;  4DUY T;  1XNQ T;  5IWA T;  1IBM T;  1XNR T;  4OX9 T;  2VQE T;  1N34 T;  4JI1 T;  4YY3 T;  4X65 T;  4YHH T;  4JI2 T;  4DUZ T;  4X64 T;  4DR7 T;  4JI3 T;  4AQY T;  4B3T T;  1N32 T;  5LMN T;  4DV6 T;  1XMO T;  4B3S T;  2HHH T;  4JI0 T;  1I94 T;  2E5L T;  4DV1 T;  1FJG T;  4GKJ T;  4JI7 T;  2UU9 T; 
#chains in the Genus database with same CATH topology
 3NRY A;  5IYZ E;  2E9X B;  4LF6 T;  1ZOY A;  3AB3 B;  4PW8 A;  5IHY A;  3N9Q A;  1IBL T;  3ZMU B;  3UT5 E;  2LOS A;  4NPP A;  3Q2M A;  5AQI B;  4AQF C;  4IDO A;  1QUU A;  1MMA A;  4KHP T;  3GN5 B;  3UU8 A;  3JAE A;  3HA4 A;  3CQC B;  4E7Z A;  1I6Z A;  3F57 A;  1HFA A;  3KIN B;  1BR0 A;  2MOZ A;  2VVN A;  3ZCJ A;  3VR8 A;  5ABH A;  5LNK A;  3Q5X A;  2D9D A;  4IGU A;  1EZ3 A;  2CHN A;  2FUP A;  2N2N A;  4A56 A;  3AE2 A;  4MFR A;  2XSB A;  3CML A;  5AQO B;  3B13 A;  5J1G A;  3PDY A;  4JEH B;  1YKE B;  4CN1 A;  3L09 A;  2X67 A;  4JI1 T;  3N2G E;  2CXF A;  2NTY A;  2CCQ A;  1NAF A;  2XQ5 A;  3H3M A;  4UXN B;  2XQ8 A;  3EDU A;  2HHH T;  3W15 B;  4EZH A;  3EAB A;  4ILU A;  4YSZ A;  4MLK A;  4QH1 A;  1CHU A;  4GK0 E;  3UU3 A;  3RPU A;  5HXC A;  2PFV A;  3H37 A;  3ZLI A;  2V7L A;  3ZMZ B;  4NXM T;  1J1J A;  3K8P C;  5AQK B;  2CXD A;  4NIQ A;  3BK9 A;  4Z90 A;  3R84 B;  2LRL A;  3PUA A;  3AVS A;  3RQU A;  1Y64 B;  3AE7 A;  1HCI A;  4PFO A;  4H9S E;  4UV9 B;  2B1E A;  3N5L A;  2XY8 B;  1W0A A;  5CB4 E;  4GIW A;  2FJE A;  3ONJ A;  5ETW A;  4I4T E;  2CLY B;  4AQF A;  2ZM2 A;  1BR2 A;  5DQW A;  2BS2 A;  1E7P A;  3P4P A;  4UIG A;  4WBN E;  4ZI7 E;  4DBQ A;  4WZX A;  4TNW A;  4XAX B;  4DUY T;  2IC9 A;  2LKG A;  2DCF A;  2CXL A;  1WRD A;  2JPF A;  5J2T E;  2DLR A;  5JDH A;  2HN1 A;  4O4H E;  4DR7 T;  3GWH A;  3P4W A;  5CJ5 A;  3ZPO A;  1XZY A;  1W0B A;  5C3J A;  2YKS A;  4G2A A;  1AJ3 A;  5HCM A;  4JI0 T;  3L8R A;  3FZK B;  3QNU A;  2H89 A;  2LSG A;  1KEY A;  3FZH B;  4YTP A;  2ZMA A;  3FHN A;  2A3D A;  1XWM A;  3QK6 A;  3ZN1 B;  3RIA A;  5AQU B;  3TLT A;  3PUW F;  5JQG E;  2CRB A;  4HFE A;  4EZ4 A;  4GOU A;  4DR4 T;  3ZYL A;  2W2U A;  4JV5 T;  5FL0 A;  1BR4 A;  3AAE B;  5JR9 C;  3X1D A;  3KFW X;  4NUU A;  5JDQ A;  1HNX T;  5FY1 A;  2X9H A;  5L3D B;  2JQ9 A;  1KFY A;  1KF6 A;  4DV0 T;  2NW9 A;  3FZL B;  5FY7 A;  3KV4 A;  4AI6 A;  2ZM8 A;  3MKD A;  3AXJ A;  1MMN A;  5IWA T;  2ZLY A;  1XDP A;  4BAY B;  2LM2 A;  3AEF A;  2M6I A;  4DUZ T;  2FBW A;  4CXY A;  3UU6 A;  4O4J E;  4B3T T;  2N9D A;  4UEL A;  2IDO B;  3ZSS A;  4TV8 E;  3P4R A;  1NEN A;  2A2F X;  2E5L T;  2XQ6 A;  4DO0 A;  5JTG A;  3JC6 D;  3OYZ A;  1VOM A;  3O1I A;  3CK6 A;  3M65 A;  2QRX A;  3I0O A;  3PUS A;  2FJB A;  3AE1 A;  2BBH A;  4GKK T;  1X79 A;  2LHR A;  2KSR A;  3TLV A;  4TX5 A;  5AQP B;  5LHH B;  2PJQ A;  1IBK T;  4HWD A;  3AVR A;  3AEG A;  3CQG B;  3PE0 A;  3FBL A;  4H9O C;  3AA0 B;  1N33 T;  4TV9 E;  1MNE A;  3N2O A;  2LLY A;  4FI5 A;  3NBX X;  2YIN A;  5JR9 A;  5LHG B;  3F2E A;  4ERR A;  3K3O A;  4ZXL A;  2WCA A;  5HXS A;  2NW7 A;  3PJA J;  1IAP A;  5LGT B;  4JI6 T;  4CXW A;  3KVA A;  3KBU A;  4YTN A;  2DI4 A;  3O1H A;  4X65 T;  4P0A A;  5AQN B;  1MMG A;  4PJJ A;  4U2Z A;  3KV9 A;  3BQL A;  4HFC A;  3C64 A;  5L3B B;  3ZC0 A;  3SRZ A;  4AKR B;  3C51 A;  3SS1 A;  2VL0 A;  2V7M A;  4GKJ T;  3H3A A;  5LA6 E;  4OYJ A;  1MND A;  2NP9 A;  4GYR A;  4DV4 T;  2IIU A;  4H9R C;  4EAH A;  2VK9 A;  3FZM B;  2IUB A;  3MJX A;  5A1L A;  5LG3 A;  3RYH E;  2W61 A;  4L0R A;  4I55 E;  2J47 A;  1WCR A;  3AEA A;  4O4L E;  4GYS A;  2YDR A;  4HN9 A;  4LFA T;  2K48 A;  1HS7 A;  4UR9 A;  2XPK A;  2Y48 B;  1Z0P A;  4M1P A;  2EHO B;  2VL8 A;  3MK7 C;  4AKG A;  2A72 A;  2LSI A;  4YTM A;  4EEB A;  5HCJ A;  2XAQ B;  2V6Y A;  3IHR A;  2WU5 A;  1R8I A;  3K3Q C;  4X62 T;  3ZKR A;  3UQ4 A;  3PUZ F;  1LVK A;  5BMV E;  1ZKE A;  4IHJ E;  4QKN A;  4DR1 T;  4G63 A;  4X66 T;  3UFG A;  3RH3 A;  1ZV4 X;  2EHO D;  5LJN A;  4TUY E;  1Y01 A;  5BR8 T;  5JDN A;  2WDR A;  4KX6 A;  2M67 A;  4WYV A;  4FJO A;  3EHZ A;  3ETV A;  4UVB B;  5F5W A;  5HEG A;  4IDZ A;  4CZZ B;  3VHL A;  4YXD A;  3L3P A;  2E9X C;  1ZEE A;  1FJG T;  3F31 A;  2UU9 T;  2H7O A;  2VVS A;  3UUN A;  3P8C D;  1NWM X;  3O4X E;  1D1B A;  4EED A;  3LBX A;  5LBQ B;  4IDN A;  3HI2 A;  2HH7 A;  1U4Q A;  1WR6 A;  3R6N A;  5FVL A;  4K0U A;  5L4H A;  2I59 A;  2JQQ A;  2XM1 A;  2L8K A;  2WZI A;  1KNZ A;  5FYM A;  1US7 B;  5KX5 E;  5L3F B;  1M7K A;  4O2B E;  5FXW A;  1FMV A;  4I50 E;  3MA9 A;  1T72 A;  4YSX A;  2L9Q A;  4ZS3 A;  2M6B A;  3ANW B;  3N9M A;  2E9X D;  3Q5W A;  3DTO A;  3KV5 A;  3V5S A;  4EYU A;  2DL1 A;  3C98 B;  1V9D A;  2BKP A;  1MIW A;  4LMK A;  1QSD A;  2Y6X A;  2X9X A;  4ANJ A;  1YW0 A;  2CE7 A;  4Q25 A;  5JRE A;  3PV0 F;  4DMW A;  4H63 H;  2D0T A;  3RX6 A;  1WR0 A;  2LJL A;  3AE8 A;  1H7C A;  2XSA A;  4HKA A;  3IF8 B;  5KXJ A;  4PAG A;  3T8O A;  2JJ9 A;  3KBT A;  2LRK A;  5LBM A;  5C8Y E;  1HR0 T;  1HNZ T;  2E9X A;  3EUH A;  4DMV A;  3AEC A;  2UUA T;  3QB5 A;  2X66 A;  2ACX A;  4EV6 A;  5AQS B;  1HTJ F;  3ONX A;  4YLH A;  3EI0 A;  4IDP A;  3C4W A;  2MBG A;  3ZT7 A;  2V7J A;  2CLY C;  2LKH A;  1T8B A;  5AQF B;  3A5X A;  1HNW T;  5J0Z A;  2WDV A;  4JEU B;  2V5D A;  4LF8 T;  3GN5 A;  3P4S A;  1OWA A;  2YDS A;  4WW0 A;  3PUV F;  2L3L A;  2JMK A;  4AKL A;  4AKI A;  4H9Q C;  4JUY A;  4U3C A;  1D0Y A;  5FXZ A;  4PNI A;  3I0Q A;  1FIO A;  2AE9 A;  4ISS A;  2X9W A;  4C90 A;  3K3N A;  3AE5 A;  3SFD A;  2SPC A;  1HG5 A;  4HFB A;  2JQH A;  2VKO A;  4OX9 T;  1N34 T;  1UCU A;  4IE7 A;  4YY3 T;  4DID B;  2V7I A;  3J9X 1;  4X64 T;  4MBQ A;  1OED B;  1SUM B;  2KWI B;  4QX8 B;  4PJL A;  1XMO T;  1J5W A;  4P0B A;  4YJ3 E;  1I94 T;  4IDQ A;  2XAH B;  3O1J A;  4AIU A;  1YD8 G;  5DAB A;  1KNR A;  1SA0 E;  4E7S A;  2HPL A;  2LHN A;  4IL9 A;  1FMW A;  2BBJ A;  3N9P A;  4O2A E;  4UVC B;  3CQX C;  4IE4 A;  1UGO A;  2XQ7 A;  2LOP A;  3P4Q A;  1G73 A;  3ZMV B;  3T1Y T;  2Q9Q C;  3AAI A;  1HG2 A;  4O4I E;  3KV6 A;  3QOF A;  4UF0 B;  3DJB A;  4IRE A;  1UUR A;  4QH4 A;  5FL1 A;  2UXX B;  4MHC A;  2XUE A;  2CBJ A;  3HKD E;  2X0Y A;  4U33 A;  3LDQ B;  5HEU A;  3ZT6 A;  3LFM A;  4IE5 A;  2Q9Q B;  5LHI B;  4CN4 A;  3MXZ A;  1JNZ A;  2K9A A;  2BZB A;  2VQF T;  3JC6 C;  4XZC A;  2LSK A;  4LFC T;  1X9B A;  3HKE E;  2FJA A;  4ZEY A;  4L5G A;  4KBM B;  1O3X A;  4CQI A;  2Q9Q D;  2X68 A;  4N78 D;  1E2A A;  2OA5 A;  2XAJ B;  5J2U E;  2YK0 A;  3A7M A;  3C4Z A;  2WWV A;  2MYS A;  4ZHQ E;  3NRX A;  5HWX A;  5AQG B;  2WY2 A;  4HFV A;  3IA3 A;  3SWH A;  1OXZ A;  2WAU A;  5HAX A;  2BG9 B;  2WBL A;  4TNV A;  5L4E A;  4LF4 T;  3ZYM A;  5JRC B;  4HFI A;  3S4U A;  3L39 A;  4B3M T;  4Z91 A;  4DV5 T;  2R6G F;  2ZM0 A;  2F4V T;  1N36 T;  3LK2 B;  4O8S A;  4LF9 T;  3EVY A;  4JI4 T;  1YKH B;  2Q9Q A;  2WP9 A;  4ZS2 A;  3CWZ B;  4TZ4 C;  2XQY A;  5ABF B;  3JCF A;  4XBF B;  3AA1 B;  2UUB T;  5FXV A;  3U3I A;  2IHR 1;  2LT3 A;  5LG4 A;  3EAM A;  5HXH A;  3PUR A;  2MAW A;  5JVD E;  2GK9 A;  2XAS B;  3IEE A;  4Z8X A;  3C50 A;  3UQ7 A;  5CGM A;  2K3W A;  4ZOL E;  1WYC A;  3P50 A;  4U2Y A;  2V8S V;  2C5J A;  4HGA A;  1YQ3 A;  2D2S A;  4HFD A;  1VCT A;  5HEO A;  3RRW A;  5FKY A;  2E2A A;  3KVB A;  2WWU A;  1S94 A;  3SFE A;  3C4X A;  4MAL A;  4NUV A;  1CUN A;  3RHW A;  4LMJ A;  2BS3 A;  2IW5 B;  2LSY A;  3LK3 B;  1Z8U A;  4EXT A;  3PU8 A;  2XQ3 A;  2JRK A;  4DND A;  3OPC A;  4IE0 A;  2C0S A;  4HFH A;  3OYX A;  3QUJ A;  3Q9D A;  5AQQ B;  3RYF E;  2RA1 A;  4DV7 T;  3RLF F;  2EHO C;  3PU3 A;  1HX1 B;  2CMR A;  2JMH A;  4ILC A;  2BKN A;  2WMO A;  4QX7 B;  4QXB B;  5LMU T;  4HTE A;  2VWA A;  4LF5 T;  4OHF A;  4EB6 E;  2KLQ A;  1J5E T;  2J1D G;  3AE3 A;  3ZC1 A;  2CA5 A;  4CN6 A;  1WYB A;  1LRZ A;  3VRB A;  4QXH B;  5M4Y A;  2B76 A;  5L47 A;  2LEH A;  1XNR T;  5HEH A;  3AA6 B;  2H88 A;  3CX6 B;  5LMN T;  4DV6 T;  3UUM A;  4CXX A;  3QB5 K;  3ZEF B;  5JDL A;  4U31 A;  3AA7 B;  2W67 A;  4COF A;  4PK5 A;  2X0H A;  3RIF A;  2YDQ A;  2YU1 A;  3VKG A;  4JLE A;  5CA0 E;  3BQI A;  2W63 A;  3ESL A;  4HWF A;  3P7I A;  4A97 A;  1YQ4 A;  4UEM A;  4GK5 E;  4JI5 T;  2XAG B;  2ZM6 T;  4DR2 T;  3OVU A;  4NXN T;  2KZ7 B;  3IBP A;  2X0L B;  4LML A;  5TAO A;  5FVK A;  2EHO A;  3RYI E;  2YU2 A;  3N9O A;  4OYK A;  2YOE A;  2C5I T;  3ONL C;  2KWH A;  4V1A v;  3N9N A;  3AED A;  2H7V C;  2KND A;  3OKQ A;  3O9X A;  2YN6 A;  4B3R T;  4YHJ A;  3MZK B;  1B7T A;  1SHZ C;  4QH5 A;  3PUX F;  4PK4 A;  1D0X A;  3VU7 H;  2CEA A;  3AEB A;  3ZCI A;  1MIY A;  2E8I A;  2WM9 A;  5HXR A;  3PUG A;  3ZJ2 A;  3NZP A;  2BKO A;  2NTX A;  4HEA A;  5LXT E;  3N9L A;  4JI7 T;  2HPJ A;  2HN2 A;  2J4G A;  2VUR A;  2DWG A;  1UUS A;  2WU2 A;  2W62 A;  2V26 A;  2QGS A;  2VKD A;  2LSJ A;  2BVL A;  3ZMS B;  3NZQ A;  1JNR A;  1IJ6 A;  4CI3 B;  4LFB T;  2YEV C;  5EK2 A;  2JIW A;  4YT0 A;  2WS3 A;  3RC8 A;  4J2C A;  5FMN A;  4U7Y A;  3M3Z B;  4HWI B;  2PBI A;  4A5X A;  5HEJ A;  3JAF A;  4H9P C;  1OED E;  3V5U A;  3HKB E;  1D1A A;  3G06 A;  4EOZ B;  4U7I A;  5CA1 E;  2CPT A;  5JDF A;  2W66 A;  2UUC T;  2LE8 A;  3D0T A;  3LG7 A;  5LOV E;  3ZMT B;  5AQV B;  2BVM A;  4WNK A;  1UX5 A;  3ANW A;  1VCS A;  4I43 B;  4DR5 T;  2WZH A;  4AIS A;  3Q5D A;  1L0V A;  3CPZ A;  2BS4 A;  1OED C;  4C91 A;  1FEW A;  3AE6 A;  4QXC B;  5L3C B;  1LKX A;  4CI1 B;  4JI3 T;  4ILA A;  1QLB A;  2NW8 A;  3ZT5 A;  2Z6E A;  4B3S T;  3A8Y C;  5LGU B;  4PFP A;  4KHZ F;  4DV1 T;  5ABE A;  1LVF A;  3RYC E;  3QC9 A;  4F8H A;  4P09 A;  3BQK A;  2OLT A;  4JI8 T;  2AXD S;  1YXR A;  4LF7 T;  1MMD A;  3GA8 A;  4ILB A;  3HL6 A;  4ZZC A;  5ADX L;  4BJM A;  2ACZ A;  4PJM A;  5FY0 A;  4AQG A;  3KDS E;  4PJN A;  1IJ5 A;  2UXC T;  1HX8 A;  2CWO A;  2KIN B;  2WMN A;  5JDG A;  3SOL A;  3NKZ A;  3CX7 B;  2QVA A;  2X51 A;  1W9R A;  3AEE A;  5AQT B;  4TWD A;  4TWH A;  4IIJ E;  2X9Y A;  4I0U A;  1KK7 A;  4EYY R;  4K0K T;  3ZJ1 A;  4X1I E;  3I9Y A;  3E08 A;  3AXJ B;  4X5T A;  3WAK A;  5HXE A;  5H6R B;  3DP7 A;  2N1G A;  3AE4 A;  2BG9 E;  2VQE T;  3CKD A;  1WLX A;  4DVD A;  2ODU A;  2XAF B;  5F8P A;  4QHO A;  5LGN B;  3WI3 A;  4AQY T;  5GON E;  2VKH A;  2BDE A;  3GMI A;  3RC3 A;  3PUQ A;  2V5C A;  1OED A;  2PG8 A;  4ASK A;  2RP4 A;  1ZP0 A;  5FP3 A;  2G0U A;  4OK0 A;  2BG9 C;  2NWB A;  1KNP A;  4ZI2 C;  2K24 A;  1MIV A;  3B5M A;  3HKC E;  5JDM A;  4TN7 B;  4IE6 A;  3I1A A;  4IST A;  2XQ4 A;  3OBV E;  1XMQ T;  4HWC A;  5HYA A;  2OV9 A;  1VRB A;  5DQV A;  3PJA A;  2UXB T;  1UX4 A;  3ABV A;  5AQM B;  1NEK A;  2NR4 A;  4UF0 A;  3JAD A;  2VAS A;  1E1H B;  4ZI3 C;  3CVR A;  2WQY A;  3WAJ A;  4IT4 A;  1D0Z A;  5FXX A;  4EIW A;  3PUY F;  4DR6 T;  2KT9 A;  5JR9 B;  1T98 A;  2UXN B;  3U78 A;  2K5B B;  2ODV A;  1D1C A;  3LSV A;  4AKH A;  4P1N A;  3I9W A;  3RIU C;  3OTO T;  2XJ7 A;  4H63 V;  3FB2 A;  4ZI2 D;  4UV8 B;  5L2L A;  4EGW A;  2CWY A;  1IBM T;  1U5P A;  4HE8 A;  3ZN0 B;  5KDM C;  4YHH T;  3ZST A;  2NOX A;  5LCY A;  4DBR A;  3UU4 A;  4L9I A;  1N32 T;  3RKO A;  2CM0 A;  3AE9 A;  2XQA A;  4ZI3 D;  3B57 A;  2W00 A;  2XQ9 A;  4DV2 T;  3EDV A;  1W09 A;  2W4X A;  2BG9 A;  4UVA B;  3MAC A;  4HWH A;  5JRC A;  3TKL B;  2D0U A;  3FXD B;  4QWN B;  5AFU L;  3NVO A;  2WB5 A;  3PTR B;  4JBW F;  4DR3 T;  2P9B A;  2XZE A;  3TLW A;  2KXP B;  2V6Y B;  1T7S A;  5ABF A;  2I0M A;  2PTF A;  1WFD A;  4DV3 T;  4KI0 F;  3VRA A;  4KP3 C;  2VKJ A;  3TLU A;  1SE7 A;  4U72 A;  4X1Y E;  3RQW A;  3T1H T;  3RF1 A;  5LP6 E;  2IML A;  3LJC A;  5L3E B;  2W0G A;  3TLS A;  3FBZ A;  3RIU A;  2IC6 A;  3J7Y q;  4JI2 T;  4H9N C;  3UUB A;  1ZHC A;  4PK6 A;  5FNV E;  4A98 A;  3UUX B;  1XDO A;  2DNX A;  4YSY A;  2J62 A;  2ES0 A;  2XM2 A;  1HF8 A;  4AXP A;  2CBI A;  3E22 E;  2XTL A;  3NWI A;  3K1S A;  3FXE B;  5LB7 B;  1M62 A;  2IAK A;  3Q5E A;  2WSS V;  1UK5 A;  4WBO A;  2QYW A;  2MTQ A;  5AQR B;  3UU5 A;  5EK4 A;  1DU2 A;  4KMC A;  5DJQ C;  3LBX B;  4BJN A;  4CI2 B;  2JQK A;  5ABG A;  5EK3 A;  5AQL B;  4YFS A;  4B6X A;  2DWK A;  2QA7 A;  4X1K E;  5AQJ B;  3CX8 B;  2LM9 A;  3VKH A;  2UXD T;  3UTK A;  4TWF A;  2I6H A;  3HR0 A;  3RRC A;  5E0O A;  2VB6 A;  4ADZ A;  3RGL A;  2E5V A;  4X20 E;  4YJ2 E;  2V7K A;  2RPA A;  4JYA T;  5LJM A;  1S35 A;  5F3J A;  3FZF B;  2Y8D A;  5LYJ E;  1G8X A;  1GQE A;  5L3G B;  4ZZB A;  2WDQ A;  3RI5 A;  2A9U A;  2V6X A;  3AAA B;  4IL4 A;  4KUM B;  2V1D B;  3RKG A;  1XNQ T;  3ETU A;  1IZN B;  2FJD A;  2MPK A;  4U74 A;  3E0Z A;  4F6R C;  4OFZ A;  2CHO A;  3N2K E;  2KMF A;  3VR9 A;  2D5U A;  5JH7 E;  3ZYK A;  3OJA A;  5CFB A;  3UUL A;  3UFE A;  2H3R A;  5H6Q B;  2C5K T;  3LK4 2;  1BR1 A;  5EZY E;  5C2T A;  5AQH B;  2DHR A;  5IUX A;  3CIR A;  4BA9 A;  5HWY A;  5KMG P;  2XHE B; 
#chains in the Genus database with same CATH homology
 4DV2 T;  4NXM T;  4LF6 T;  4DV4 T;  4GKK T;  4LF4 T;  1HR0 T;  1HNZ T;  3T1Y T;  4JI8 T;  2UUA T;  4B3M T;  1XMQ T;  4LF7 T;  4DV5 T;  1IBL T;  2F4V T;  4LFB T;  1N36 T;  4LF9 T;  2UXB T;  4JI5 T;  1IBK T;  4DV7 T;  4JI4 T;  4DR2 T;  4DR3 T;  2ZM6 T;  4DR4 T;  4JV5 T;  4LFA T;  4NXN T;  4KHP T;  2UXD T;  2UXC T;  1HNW T;  2UUB T;  5LMU T;  1N33 T;  4LF8 T;  4DR6 T;  4LF5 T;  4DV3 T;  4X62 T;  4JYA T;  1HNX T;  4K0K T;  1J5E T;  2UUC T;  4DR1 T;  4DV0 T;  2VQF T;  3T1H T;  3OTO T;  4X66 T;  4DR5 T;  4LFC T;  4JI6 T;  4B3R T;  5BR8 T;  4DUY T;  1XNQ T;  5IWA T;  1IBM T;  1XNR T;  4OX9 T;  2VQE T;  1N34 T;  4JI1 T;  4YY3 T;  4X65 T;  4YHH T;  4JI2 T;  4DUZ T;  4X64 T;  4DR7 T;  4JI3 T;  4AQY T;  4B3T T;  1N32 T;  5LMN T;  4DV6 T;  1XMO T;  4B3S T;  2HHH T;  4JI0 T;  1I94 T;  2E5L T;  4DV1 T;  1FJG T;  4GKJ T;  4JI7 T;  2UU9 T; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...