1N32T

Structure of the thermus thermophilus 30s ribosomal subunit bound to codon and near-cognate transfer rna anticodon stem-loop mismatched at the first codon position at the a site with paromomycin
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
99
structure length
99
Chain Sequence
RNLSALKRHRQSLKRRLRNKAKKSAIKTLSKKAIQLAQEGKAEEALKIMRKAESLIDKAAKGSTLHKNAAARRKSRLMRKVRQLLEAAGAPLIGGGLSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Selection of tRNA by the Ribosome Requires a Transition from an Open to a Closed Form
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 16S RIBOSOMAL RNA
total genus 34
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 2002-10-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
T PF01649 Ribosomal_S20p Ribosomal protein S20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.110 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Ribosomal protein S20 1n32T00
1XNQT 1IBKT 1XMOT 3T1YT 4LF5T 4DV4T 1N32T 1IBMT 4JYAT 5LMNT 4DR4T 4DUZT 1I94T 2UUAT 2UUCT 4KHPT 1HNXT 1N33T 4JI4T 5IWAT 4JI0T 4JI5T 2UXBT 2UUBT 4JI7T 4LFAT 4X64T 4DR6T 4DUYT 4B3TT 4K0KT 4NXNT 4DR5T 2ZM6T 4LF4T 4LFCT 4B3MT 4YHHT 4DR1T 1XNRT 4B3ST 4GKKT 2F4VT 4JI3T 4OX9T 4LF9T 4LF7T 1HNWT 4B3RT 1IBLT 4X65T 2VQET 1FJGT 4DR2T 2E5LT 4LF8T 4NXMT 4DV1T 4DV6T 1J5ET 3T1HT 2VQFT 4DV2T 1HR0T 5BR8T 4DR3T 4DV5T 4LF6T 4DV7T 5LMUT 4DV0T 2UU9T 4DV3T 1N34T 4DR7T 1N36T 4X62T 2UXCT 4JI1T 4GKJT 2HHHT 4JV5T 2UXDT 1XMQT 4YY3T 4JI8T 4AQYT 3OTOT 4LFBT 4JI6T 4JI2T 4X66T 1HNZT
chains in the Genus database with same CATH superfamily
5LGTB 3LDQB 4QHOA 4QKNA 1XNQT 4I4TE 2VURA 2RP4A 2NP9A 1XWMA 3EHZA 4CN1A 5AQKB 4F8HA 1W0AA 4NUVA 1D1CA 2Q9QB 1SE7A 5AQHB 2H7VC 3ZMSB 2QGSA 3MZKB 3QNUA 3AE6A 4QH1A 3FBZA 5AQTB 5FY1A 3RPUA 4DV4T 4CZZB 5CA1E 2JQQA 3B57A 4DR4T 3VRBA 1HCIA 3ZT7A 4DUZT 5FKYA 1KF6A 3ZEFB 5HCMA 2K24A 2UUCT 4O4HE 4TWDA 3AE8A 4UF0B 4KHPT 5EK3A 3C4XA 2IDOB 2M67A 3LK2B 4JI4T 2LSGA 1QLBA 3HI2A 3RX6A 3H3MA 5LCYA 4AIUA 4CI2B 3JAEA 2ZM0A 2IUBA 3RYHE 2KSRA 4IDPA 1HS7A 2I59A 3AA7B 2VVSA 3WAKA 5HYAA 2H88A 4PW8A 4HGAA 2IIUA 3K3NA 3ZCIA 1IAPA 4HFDA 3CX8B 1OEDC 4U7IA 2ODUA 2LKGA 3VHLA 5LHGB 1E7PA 4LFAT 2BVLA 2XQ8A 5HEHA 3MACA 5KXJA 3KDSE 1YKEB 2YN6A 4CN6A 5LJMA 2NTXA 1WYCA 4A56A 3ZPOA 4EB6E 4EYUA 5EK2A 4NXNT 2WU2A 3NBXX 4NPPA 1FMVA 3VR8A 3NKZA 3JCFA 4DR1T 2CWOA 2X9WA 2KZ7B 3AE7A 2B1EA 4EV6A 5L3GB 4HWIB 3HKCE 3UFGA 3RI5A 2BG9A 3CQXC 2F4VT 2KNDA 4GIWA 2WDQA 4HFIA 4U74A 3AEAA 2E9XC 3EVYA 4K0UA 3FZHB 2KINB 4ADZA 5HXEA 4IE0A 3PU8A 3E0ZA 2CHNA 5HEJA 2AE9A 3CX6B 2V7JA 2CBIA 2HPLA 4QXBB 1IBLT 3K3QC 4B3RT 2XSAA 5F5WA 3A7MA 4UVBB 4YHHT 3X1DA 2VQET 3U78A 2WZIA 4DR2T 2WAUA 2CHOA 1HG5A 4NIQA 4ZXLA 2E9XB 4L0RA 2DHRA 4U33A 3VR9A 4AISA 1UX4A 3I0QA 4P0BA 2H7OA 5LGUB 4DV6T 3PUXF 3OPCA 1MIWA 2FJBA 3QOFA 2HH7A 5AFUL 2QVAA 4IT4A 4WBOA 2J62A 2XQAA 3ANWB 3Q9DA 4E7ZA 4UXNB 4HFBA 5FMNA 3NRYA 4PAGA 3KFWX 1YW0A 1FEWA 3NWIA 3UULA 2JPFA 3K8PC 5LP6E 5BR8T 4PK5A 3BQLA 4Z91A 4KP3C 2MPKA 3H37A 4GYRA 5H6QB 1KNRA 2YDSA 5JRCA 3UUXB 4XBFB 3ZT5A 2ZMAA 1MIYA 4CXWA 2WWUA 4AKLA 3E08A 4HE8A 4JBWF 4PK6A 4TV8E 4ZI2C 1V9DA 3E22E 4TWHA 4DV3T 1HX1B 4MFRA 2CLYB 2X9XA 2VVNA 3FB2A 4MHCA 2BKPA 5AQOB 3RC3A 1N36T 4EIWA 4KBMB 2K9AA 4CXXA 4ZHQE 5L3CB 1ZHCA 1Y01A 3Q5WA 5L2LA 2VK9A 4X62T 2UXXB 2UXCT 2I6HA 4BJNA 4YLHA 2D2SA 3TLUA 4JI1T 3RYCE 5FXZA 2VASA 3IA3A 3PUVF 1I6ZA 4UV8B 1D1BA 4U7YA 1HG2A 4IE6A 5AQPB 2QA7A 3ZMVB 2BVMA 3N9MA 2CRBA 3OYZA 4KHZF 5JDLA 3N9QA 5JQGE 2XTLA 2Y8DA 2XQ5A 5FVKA 4V1Av 3AE9A 2V5DA 3OJAA 4BAYB 4LFBT 2BS3A 2VKDA 4QH4A 4UELA 4GYSA 4QXCB 5JR9B 4HEAA 4ILCA 2E9XD 1S94A 3HKBE 3JAFA 4X1IE 1YXRA 4TNVA 3TKLB 3ABVA 2M6BA 4L9IA 4ANJA 2W66A 3ZN1B 3PUZF 3RQUA 4EEBA 5CA0E 4I0UA 1IBKT 4DIDB 5H6RB 2CXLA 1J5WA 3D0TA 3RH3A 2UXNB 5IYZE 5HXCA 2CXFA 3MA9A 2XUEA 3UU4A 5JREA 4ISTA 4LF5T 2Y6XA 1UUSA 2A9UA 2DWGA 3AAAB 4YT0A 2Q9QD 2VL0A 2V7KA 4DVDA 3IBPA 2BG9C 2PJQA 4HFCA 4YTMA 3SS1A 5LOVE 2MBGA 1Y64B 1MMGA 2UUAT 1UCUA 4UVCB 2BDEA 2LKHA 2A2FX 3AVRA 3P4RA 3ANWA 2FJDA 4H9RC 4CXYA 3GWHA 4AQFC 1VOMA 5HWYA 4ZI3C 3SFDA 1QSDA 3UQ4A 4IDNA 2JQKA 4ISSA 1NWMX 5HXRA 3RRCA 3LBXA 4J2CA 4A97A 5JDGA 2UXBT 5KMGP 1VRBA 2CEAA 1YD8G 5LG3A 2KWIB 2IAKA 2CCQA 2NOXA 2CE7A 1S35A 5JR9C 2LSJA 4QXHB 2WU5A 2FBWA 3FHNA 4P1NA 4AXPA 4U31A 4DUYT 3RF1A 5ABEA 4FI5A 3C4ZA 3K3OA 1MMAA 2X67A 3EDUA 5FP3A 3ZJ2A 5KDMC 2ZM6T 4LF4T 5L3BB 1WR6A 4EAHA 2Q9QC 2W62A 1FMWA 3M3ZB 2RPAA 2HN1A 4EZHA 4ZI7E 5C8YE 3PV0F 4U3CA 2IC6A 3KBTA 4ZZBA 3ZCJA 4IL9A 2XQ9A 2LRKA 3J7Yq 1OWAA 3K1SA 4TV9E 4G63A 2M6IA 4DMWA 4EEDA 3CQGB 2W61A 3O1IA 4UF0A 4OX9T 4ZI2D 2LOPA 3N9NA 1MNEA 5AQVB 5CFBA 2BBHA 5FYMA 1CHUA 3LJCA 3N9LA 4X65T 4MBQA 4JUYA 2W0GA 3CMLA 2YDQA 3PUSA 3MK7C 3MJXA 3QUJA 1FJGT 2B76A 3VKHA 2XAFB 3P4QA 4G2AA 3L39A 4AKGA 4LF8T 3PUGA 4E7SA 5ETWA 2LT3A 4DV1T 3V5UA 2OA5A 1UURA 1ZP0A 1ZOYA 3TLVA 2CPTA 4YTNA 4XZCA 5CJ5A 2KMFA 2PBIA 3T1HT 5LBQB 4O4IE 1MMDA 1EZ3A 1BR0A 4HWDA 2XQ7A 2VB6A 4YSYA 4U2ZA 4DV5T 2XAJB 3KV6A 3RKGA 3C64A 4IHJE 1XDOA 2MTQA 3UQ7A 3AE1A 4DV7T 3PE0A 4YSZA 1L0VA 3VU7H 3RQWA 3AEBA 5LB7B 3Q2MA 4TX5A 4WYVA 3J9X1 4KMCA 4AQGA 4HWFA 5C3JA 3VKGA 2FJEA 4ZI3D 3LK42 2XSBA 4I43B 3AE3A 2BBJA 3C4WA 3A8YC 3L8RA 3ZMUB 2DCFA 3F31A 1QUUA 2CM0A 2D5UA 2ES0A 2XZEA 3F57A 4H63H 5LA6E 3SRZA 4LMKA 4H9OC 3CKDA 2V6YA 3B5MA 4GOUA 4ILAA 4OK0A 4QH5A 1Z0PA 3ZYKA 3AA6B 3TLWA 3PJAA 2H3RA 4HFVA 2LSIA 5AQFB 3RGLA 2FJAA 4X1YE 5JDMA 2C5IT 5EK4A 1VCTA 2L8KA 3HR0A 2VL8A 3ZYMA 3L3PA 4U2YA 4COFA 5LJNA 1MMNA 4DNDA 2XM2A 2FUPA 2ZLYA 2MYSA 2X9YA 5F8PA 3SWHA 2WB5A 5AQLB 3LBXB 3AEDA 4CN4A 2EHOA 4PJNA 3ZN0B 2JMHA 4NUUA 4YXDA 3PJAJ 4KX6A 4PNIA 3ZC0A 2BKOA 4H9PC 3RYIE 1W9RA 1SHZC 2X0HA 1DU2A 5IUXA 1OEDB 2NR4A 4HWHA 3QC9A 1M62A 3PUYF 3PU3A 4CI1B 2K48A 5C2TA 2XASB 3WAJA 3AA1B 3O4XE 4P0AA 3HKEE 5J0ZA 2X68A 3I0OA 3AEEA 2XM1A 2E5VA 2JIWA 1O3XA 2IHR1 3MXZA 3UUNA 3PTRB 5ABFB 5L3EB 3IEEA 3T1YT 3UFEA 1KK7A 2ZM2A 4AKIA 3G06A 3RRWA 5AQSB 4BA9A 3H3AA 2YDRA 3DJBA 4JYAT 2D9DA 4IDZA 5KX5E 3UU3A 4YFSA 5LMNT 2D0TA 2WS3A 3N9OA 4A98A 4HFEA 1XMOT 3UUMA 2CLYC 3CIRA 1D0YA 2BKNA 2NW8A 3BQKA 2DLRA 2LHNA 3RIUC 3AAIA 3C98B 3ZJ1A 2C5KT 5JR9A 4GK5E 5HAXA 4JI0T 4JI5T 2LOSA 2YU2A 2YKSA 5FY7A 3M65A 1YKHB 5L3FB 2WSSV 2AXDS 3AE2A 3RIUA 2UUBT 3ZC1A 3O1HA 4ZOLE 1W0BA 3ONXA 1U4QA 1H7CA 2PFVA 5DJQC 2NWBA 3ZSSA 2LEHA 2E9XA 3FXEB 4L5GA 3HL6A 5FL1A 2ACZA 2HN2A 2VWAA 4H9NC 3N2OA 4H9QC 2DNXA 2X66A 3CX7B 1WCRA 4N78D 3ZMZB 1MIVA 4C90A 4WZXA 2KLQA 2LE8A 3F2EA 1XNRT 3W15B 2J47A 3AEGA 4OYKA 5AQQB 1B7TA 2WWVA 1XZYA 2BZBA 2X51A 4PFOA 2WDVA 1HX8A 4JI3T 3SFEA 3EDVA 3ZSTA 3I1AA 2J4GA 1KNZA 1WRDA 4ILBA 4LF7T 1T7SA 1SUMB 2Q9QA 2W4XA 2NW7A 3BQIA 4KUMB 4M1PA 4TNWA 2DWKA 3EUHA 3OVUA 5DQVA 5F3JA 1N33T 3LG7A 5LBMA 5LHHB 2E5LT 3FZMB 3Q5DA 5FXXA 4AKRB 1D0ZA 2IW5B 3VRAA 4GK0E 4NXMT 3ZT6A 5IWAT 2OV9A 3I9YA 3KBUA 5AQRB 5JDQA 4P09A 1J5ET 2Z6EA 4YSXA 3RC8A 5FVLA 5ABGA 2VQFT 4JLEA 3CPZA 3DTOA 2WCAA 2EHOB 4IGUA 4I50E 3ZLIA 4X5TA 1OEDE 4WBNE 1LKXA 3ONJA 4DR3T 2XAGB 3Q5EA 5HEGA 5ADXL 5L4EA 4TWFA 3V5SA 1G73A 3EI0A 1UGOA 2WQYA 3PUAA 3AVSA 1XDPA 3AXJB 2A3DA 1WFDA 2UU9T 1E1HB 2JQ9A 5L3DB 2MAWA 3GN5B 4UVAB 4DBRA 3AA0B 4Q25A 4TZ4C 3KV9A 1N34T 3LK3B 5HEUA 1ZKEA 2CMRA 5LYJE 2CXDA 3C51A 1T8BA 4IE7A 2LJLA 3DP7A 2V26A 4WW0A 3FZFB 3GMIA 4O4JE 5E0OA 5FXVA 3RIFA 5DABA 5A1LA 5ABHA 2YK0A 3FBLA 3ZKRA 2G0UA 4BJMA 4GKJT 3AEFA 1US7B 2EHOC 2HHHT 4X1KE 2V8SV 2WMNA 4JV5T 5IHYA 1Z8UA 2A72A 3GA8A 3JC6D 4UV9B 5FL0A 3AE4A 3L09A 2ODVA 4I55E 4ZZCA 4B3MT 4IREA 1UX5A 4YY3T 3QK6A 3ZMTB 2LSKA 2WM9A 4YJ3E 1HF8A 1E2AA 1FIOA 1YQ4A 4AQYT 2XQ3A 1JNRA 3AB3B 1WYBA 4HWCA 2P9BA 2L9QA 4OHFA 2RA1A 4IE5A 5JTGA 4JI6T 5HWXA 1HFAA 2V7IA 2VKOA 4EGWA 3CWZB 4DO0A 4PFPA 1BR2A 2K5BB 4JI2T 1M7KA 3HKDE 4EXTA 4PJJA 2LLYA 5JVDE 4A5XA 3I9WA 2X0LB 4JEUB 1D1AA 3R6NA 4O2AE 1LVFA 2JMKA 4YTPA 1LRZA 3NVOA 2V6YB 2W00A 2L3LA 3ONLC 4HFHA 1OXZA 2X0YA 3N2GE 5JDFA 2HPJA 3LFMA 3QB5K 5BMVE 2PTFA 3RYFE 5J1GA 3TLTA 1R8IA 2H89A 3C50A 5LXTE 2N2NA 5JRCB 1D0XA 2KWHA 4HN9A 4JEHB 4UR9A 3T8OA 5HXHA 1N32T 1IBMT 4PJMA 2LSYA 2MOZA 2V1DB 4PK4A 1I94T 2BG9E 2C0SA 3CVRA 3R84B 4QWNB 3RIAA 2PG8A 4YHJA 1NENA 2K3WA 4ZEYA 2XAHB 1OEDA 2SPCA 4UIGA 3UU8A 3FZKB 3FXDB 3IHRA 1HNXT 1WLXA 3UU5A 4B3TT 5CB4E 4O2BE 5TAOA 4IIJE 3KV4A 4DMVA 5JDHA 4O8SA 2CA5A 2I0MA 3KVBA 4EOZB 4ILUA 4AI6A 1GQEA 2IMLA 2QYWA 2WZHA 2XHEB 2JJ9A 3ETVA 3N2KE 3KVAA 2WP9A 5FXWA 5AQIB 4IDOA 4FJOA 4JI7T 1JNZA 3IF8B 3JC6C 3MKDA 4QX7B 3O1JA 5AQMB 2XY8B 5EZYE 2DL1A 2V5CA 4X64T 4DR6T 3RHWA 4K0KT 4DR5T 2KT9A 5AQGB 2ZM8A 1X79A 4ERRA 4CQIA 2W63A 4LFCT 2WBLA 2XJ7A 2VKHA 3PDYA 3PURA 1IJ5A 2NTYA 3EABA 4B3ST 4QX8B 4Z90A 4GKKT 1NAFA 2E8IA 3AAEB 3LSVA 4OYJA 4X20E 3SOLA 2WMOA 3N5LA 3FZLB 5HCJA 4AKHA 2WDRA 4TN7B 1W09A 3P4WA 4YJ2E 5AQNB 5L47A 3Q5XA 4LF9T 2E2AA 3NZPA 3N9PA 1HTJF 5AQUB 1HNWT 1YQ3A 3TLSA 2W67A 2N1GA 3U3IA 4AQFA 1UK5A 2CWYA 2KXPB 3P4PA 4KI0F 2XPKA 2YINA 3EAMA 3KV5A 3UUBA 1MNDA 4IL4A 2QRXA 3GN5A 2V6XA 5HXSA 3ZYLA 2C5JA 1NEKA 4TUYE 2OLTA 3WI3A 5ABFA 4EZ4A 2XQ4A 2V7LA 1WR0A 1X9BA 5L4HA 1VCSA 4ASKA 3HA4A 4MLKA 3O9XA 2BS4A 2DI4A 4Z8XA 4DV2T 4C91A 1HR0T 2JRKA 3PUWF 5J2TE 3ETUA 3RLFF 5JH7E 2LRLA 3B13A 2EHOD 3BK9A 3ESLA 3OBVE 3P50A 4XAXB 4LF6T 2VKJA 3UTKA 2N9DA 4ZS2A 5LMUT 4DV0T 4WNKA 2W2UA 3AXJA 3NZQA 2IC9A 2JQHA 2R6GF 3KINB 2GK9A 4HKAA 5AQJB 5FNVE 3UU6A 1U5PA 5CGMA 3OKQA 2ACXA 5M4YA 4DR7T 1ZV4X 3RKOA 2LM9A 3S4UA 4ZS3A 3A5XA 4HTEA 2YOEA 2LM2A 3P7IA 2XAQB 5J2UE 1T98A 2LHRA 4IE4A 5DQWA 4MALA 4F6RC 3NRXA 1KFYA 2BG9B 4EYYR 1IJ6A 4O4LE 1IZNB 5GONE 1ZEEA 5FY0A 4CI3B 5LNKA 4IDQA 3OYXA 1BR1A 2XQYA 4H63V 4U72A 1XMQT 2UXDT 2V7MA 3AECA 4OFZA 4JI8T 3PUQA 2J1DG 3CK6A 3JADA 5LG4A 3CQCB 3P8CD 1G8XA 2YEVC 4PJLA 4B6XA 1LVKA 3OTOT 2D0UA 5JDNA 2NW9A 4H9SE 4LMJA 4UEMA 1KNPA 5HEOA 4DBQA 1BR4A 2XQ6A 2X9HA 3QB5A 4LMLA 3P4SA 1T72A 2WY2A 2Y48B 3UT5E 1KEYA 1CUNA 1J1JA 5LGNB 2BS2A 3AE5A 5LHIB 4X66T 1HNZT 1AJ3A 2CBJA 1SA0E 2YU1A
chains in the Genus database with same CATH topology
1XNQT 1IBKT 1XMOT 3T1YT 4LF5T 4DV4T 1N32T 1IBMT 4JYAT 5LMNT 4DR4T 4DUZT 1I94T 2UUAT 2UUCT 4KHPT 1HNXT 1N33T 4JI4T 5IWAT 4JI0T 4JI5T 2UXBT 2UUBT 4JI7T 4LFAT 4X64T 4DR6T 4DUYT 4B3TT 4K0KT 4NXNT 4DR5T 2ZM6T 4LF4T 4LFCT 4B3MT 4YHHT 4DR1T 1XNRT 4B3ST 4GKKT 2F4VT 4JI3T 4OX9T 4LF9T 4LF7T 1HNWT 4B3RT 1IBLT 4X65T 2VQET 1FJGT 4DR2T 2E5LT 4LF8T 4NXMT 4DV1T 4DV6T 1J5ET 3T1HT 2VQFT 4DV2T 1HR0T 5BR8T 4DR3T 4DV5T 4LF6T 4DV7T 5LMUT 4DV0T 2UU9T 4DV3T 1N34T 4DR7T 1N36T 4X62T 2UXCT 4JI1T 4GKJT 2HHHT 4JV5T 2UXDT 1XMQT 4YY3T 4JI8T 4AQYT 3OTOT 4LFBT 4JI6T 4JI2T 4X66T 1HNZT
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1XNQ T;  1IBK T;  1XMO T;  3T1Y T;  4LF5 T;  4DV4 T;  1N32 T;  1IBM T;  4JYA T;  5LMN T;  4DR4 T;  4DUZ T;  1I94 T;  2UUA T;  2UUC T;  4KHP T;  1HNX T;  1N33 T;  4JI4 T;  5IWA T;  4JI0 T;  4JI5 T;  2UXB T;  2UUB T;  4JI7 T;  4LFA T;  4X64 T;  4DR6 T;  4DUY T;  4B3T T;  4K0K T;  4NXN T;  4DR5 T;  2ZM6 T;  4LF4 T;  4LFC T;  4B3M T;  4YHH T;  4DR1 T;  1XNR T;  4B3S T;  4GKK T;  2F4V T;  4JI3 T;  4OX9 T;  4LF9 T;  4LF7 T;  1HNW T;  4B3R T;  1IBL T;  4X65 T;  2VQE T;  1FJG T;  4DR2 T;  2E5L T;  4LF8 T;  4NXM T;  4DV1 T;  4DV6 T;  1J5E T;  3T1H T;  2VQF T;  4DV2 T;  1HR0 T;  5BR8 T;  4DR3 T;  4DV5 T;  4LF6 T;  4DV7 T;  5LMU T;  4DV0 T;  2UU9 T;  4DV3 T;  1N34 T;  4DR7 T;  1N36 T;  4X62 T;  2UXC T;  4JI1 T;  4GKJ T;  2HHH T;  4JV5 T;  2UXD T;  1XMQ T;  4YY3 T;  4JI8 T;  4AQY T;  3OTO T;  4LFB T;  4JI6 T;  4JI2 T;  4X66 T;  1HNZ T; 
#chains in the Genus database with same CATH topology
 5LGT B;  3LDQ B;  4QHO A;  4QKN A;  1XNQ T;  4I4T E;  2VUR A;  2RP4 A;  2NP9 A;  1XWM A;  3EHZ A;  4CN1 A;  5AQK B;  4F8H A;  1W0A A;  4NUV A;  1D1C A;  2Q9Q B;  1SE7 A;  5AQH B;  2H7V C;  3ZMS B;  2QGS A;  3MZK B;  3QNU A;  3AE6 A;  4QH1 A;  3FBZ A;  5AQT B;  5FY1 A;  3RPU A;  4DV4 T;  4CZZ B;  5CA1 E;  2JQQ A;  3B57 A;  4DR4 T;  3VRB A;  1HCI A;  3ZT7 A;  4DUZ T;  5FKY A;  1KF6 A;  3ZEF B;  5HCM A;  2K24 A;  2UUC T;  4O4H E;  4TWD A;  3AE8 A;  4UF0 B;  4KHP T;  5EK3 A;  3C4X A;  2IDO B;  2M67 A;  3LK2 B;  4JI4 T;  2LSG A;  1QLB A;  3HI2 A;  3RX6 A;  3H3M A;  5LCY A;  4AIU A;  4CI2 B;  3JAE A;  2ZM0 A;  2IUB A;  3RYH E;  2KSR A;  4IDP A;  1HS7 A;  2I59 A;  3AA7 B;  2VVS A;  3WAK A;  5HYA A;  2H88 A;  4PW8 A;  4HGA A;  2IIU A;  3K3N A;  3ZCI A;  1IAP A;  4HFD A;  3CX8 B;  1OED C;  4U7I A;  2ODU A;  2LKG A;  3VHL A;  5LHG B;  1E7P A;  4LFA T;  2BVL A;  2XQ8 A;  5HEH A;  3MAC A;  5KXJ A;  3KDS E;  1YKE B;  2YN6 A;  4CN6 A;  5LJM A;  2NTX A;  1WYC A;  4A56 A;  3ZPO A;  4EB6 E;  4EYU A;  5EK2 A;  4NXN T;  2WU2 A;  3NBX X;  4NPP A;  1FMV A;  3VR8 A;  3NKZ A;  3JCF A;  4DR1 T;  2CWO A;  2X9W A;  2KZ7 B;  3AE7 A;  2B1E A;  4EV6 A;  5L3G B;  4HWI B;  3HKC E;  3UFG A;  3RI5 A;  2BG9 A;  3CQX C;  2F4V T;  2KND A;  4GIW A;  2WDQ A;  4HFI A;  4U74 A;  3AEA A;  2E9X C;  3EVY A;  4K0U A;  3FZH B;  2KIN B;  4ADZ A;  5HXE A;  4IE0 A;  3PU8 A;  3E0Z A;  2CHN A;  5HEJ A;  2AE9 A;  3CX6 B;  2V7J A;  2CBI A;  2HPL A;  4QXB B;  1IBL T;  3K3Q C;  4B3R T;  2XSA A;  5F5W A;  3A7M A;  4UVB B;  4YHH T;  3X1D A;  2VQE T;  3U78 A;  2WZI A;  4DR2 T;  2WAU A;  2CHO A;  1HG5 A;  4NIQ A;  4ZXL A;  2E9X B;  4L0R A;  2DHR A;  4U33 A;  3VR9 A;  4AIS A;  1UX4 A;  3I0Q A;  4P0B A;  2H7O A;  5LGU B;  4DV6 T;  3PUX F;  3OPC A;  1MIW A;  2FJB A;  3QOF A;  2HH7 A;  5AFU L;  2QVA A;  4IT4 A;  4WBO A;  2J62 A;  2XQA A;  3ANW B;  3Q9D A;  4E7Z A;  4UXN B;  4HFB A;  5FMN A;  3NRY A;  4PAG A;  3KFW X;  1YW0 A;  1FEW A;  3NWI A;  3UUL A;  2JPF A;  3K8P C;  5LP6 E;  5BR8 T;  4PK5 A;  3BQL A;  4Z91 A;  4KP3 C;  2MPK A;  3H37 A;  4GYR A;  5H6Q B;  1KNR A;  2YDS A;  5JRC A;  3UUX B;  4XBF B;  3ZT5 A;  2ZMA A;  1MIY A;  4CXW A;  2WWU A;  4AKL A;  3E08 A;  4HE8 A;  4JBW F;  4PK6 A;  4TV8 E;  4ZI2 C;  1V9D A;  3E22 E;  4TWH A;  4DV3 T;  1HX1 B;  4MFR A;  2CLY B;  2X9X A;  2VVN A;  3FB2 A;  4MHC A;  2BKP A;  5AQO B;  3RC3 A;  1N36 T;  4EIW A;  4KBM B;  2K9A A;  4CXX A;  4ZHQ E;  5L3C B;  1ZHC A;  1Y01 A;  3Q5W A;  5L2L A;  2VK9 A;  4X62 T;  2UXX B;  2UXC T;  2I6H A;  4BJN A;  4YLH A;  2D2S A;  3TLU A;  4JI1 T;  3RYC E;  5FXZ A;  2VAS A;  3IA3 A;  3PUV F;  1I6Z A;  4UV8 B;  1D1B A;  4U7Y A;  1HG2 A;  4IE6 A;  5AQP B;  2QA7 A;  3ZMV B;  2BVM A;  3N9M A;  2CRB A;  3OYZ A;  4KHZ F;  5JDL A;  3N9Q A;  5JQG E;  2XTL A;  2Y8D A;  2XQ5 A;  5FVK A;  4V1A v;  3AE9 A;  2V5D A;  3OJA A;  4BAY B;  4LFB T;  2BS3 A;  2VKD A;  4QH4 A;  4UEL A;  4GYS A;  4QXC B;  5JR9 B;  4HEA A;  4ILC A;  2E9X D;  1S94 A;  3HKB E;  3JAF A;  4X1I E;  1YXR A;  4TNV A;  3TKL B;  3ABV A;  2M6B A;  4L9I A;  4ANJ A;  2W66 A;  3ZN1 B;  3PUZ F;  3RQU A;  4EEB A;  5CA0 E;  4I0U A;  1IBK T;  4DID B;  5H6R B;  2CXL A;  1J5W A;  3D0T A;  3RH3 A;  2UXN B;  5IYZ E;  5HXC A;  2CXF A;  3MA9 A;  2XUE A;  3UU4 A;  5JRE A;  4IST A;  4LF5 T;  2Y6X A;  1UUS A;  2A9U A;  2DWG A;  3AAA B;  4YT0 A;  2Q9Q D;  2VL0 A;  2V7K A;  4DVD A;  3IBP A;  2BG9 C;  2PJQ A;  4HFC A;  4YTM A;  3SS1 A;  5LOV E;  2MBG A;  1Y64 B;  1MMG A;  2UUA T;  1UCU A;  4UVC B;  2BDE A;  2LKH A;  2A2F X;  3AVR A;  3P4R A;  3ANW A;  2FJD A;  4H9R C;  4CXY A;  3GWH A;  4AQF C;  1VOM A;  5HWY A;  4ZI3 C;  3SFD A;  1QSD A;  3UQ4 A;  4IDN A;  2JQK A;  4ISS A;  1NWM X;  5HXR A;  3RRC A;  3LBX A;  4J2C A;  4A97 A;  5JDG A;  2UXB T;  5KMG P;  1VRB A;  2CEA A;  1YD8 G;  5LG3 A;  2KWI B;  2IAK A;  2CCQ A;  2NOX A;  2CE7 A;  1S35 A;  5JR9 C;  2LSJ A;  4QXH B;  2WU5 A;  2FBW A;  3FHN A;  4P1N A;  4AXP A;  4U31 A;  4DUY T;  3RF1 A;  5ABE A;  4FI5 A;  3C4Z A;  3K3O A;  1MMA A;  2X67 A;  3EDU A;  5FP3 A;  3ZJ2 A;  5KDM C;  2ZM6 T;  4LF4 T;  5L3B B;  1WR6 A;  4EAH A;  2Q9Q C;  2W62 A;  1FMW A;  3M3Z B;  2RPA A;  2HN1 A;  4EZH A;  4ZI7 E;  5C8Y E;  3PV0 F;  4U3C A;  2IC6 A;  3KBT A;  4ZZB A;  3ZCJ A;  4IL9 A;  2XQ9 A;  2LRK A;  3J7Y q;  1OWA A;  3K1S A;  4TV9 E;  4G63 A;  2M6I A;  4DMW A;  4EED A;  3CQG B;  2W61 A;  3O1I A;  4UF0 A;  4OX9 T;  4ZI2 D;  2LOP A;  3N9N A;  1MNE A;  5AQV B;  5CFB A;  2BBH A;  5FYM A;  1CHU A;  3LJC A;  3N9L A;  4X65 T;  4MBQ A;  4JUY A;  2W0G A;  3CML A;  2YDQ A;  3PUS A;  3MK7 C;  3MJX A;  3QUJ A;  1FJG T;  2B76 A;  3VKH A;  2XAF B;  3P4Q A;  4G2A A;  3L39 A;  4AKG A;  4LF8 T;  3PUG A;  4E7S A;  5ETW A;  2LT3 A;  4DV1 T;  3V5U A;  2OA5 A;  1UUR A;  1ZP0 A;  1ZOY A;  3TLV A;  2CPT A;  4YTN A;  4XZC A;  5CJ5 A;  2KMF A;  2PBI A;  3T1H T;  5LBQ B;  4O4I E;  1MMD A;  1EZ3 A;  1BR0 A;  4HWD A;  2XQ7 A;  2VB6 A;  4YSY A;  4U2Z A;  4DV5 T;  2XAJ B;  3KV6 A;  3RKG A;  3C64 A;  4IHJ E;  1XDO A;  2MTQ A;  3UQ7 A;  3AE1 A;  4DV7 T;  3PE0 A;  4YSZ A;  1L0V A;  3VU7 H;  3RQW A;  3AEB A;  5LB7 B;  3Q2M A;  4TX5 A;  4WYV A;  3J9X 1;  4KMC A;  4AQG A;  4HWF A;  5C3J A;  3VKG A;  2FJE A;  4ZI3 D;  3LK4 2;  2XSB A;  4I43 B;  3AE3 A;  2BBJ A;  3C4W A;  3A8Y C;  3L8R A;  3ZMU B;  2DCF A;  3F31 A;  1QUU A;  2CM0 A;  2D5U A;  2ES0 A;  2XZE A;  3F57 A;  4H63 H;  5LA6 E;  3SRZ A;  4LMK A;  4H9O C;  3CKD A;  2V6Y A;  3B5M A;  4GOU A;  4ILA A;  4OK0 A;  4QH5 A;  1Z0P A;  3ZYK A;  3AA6 B;  3TLW A;  3PJA A;  2H3R A;  4HFV A;  2LSI A;  5AQF B;  3RGL A;  2FJA A;  4X1Y E;  5JDM A;  2C5I T;  5EK4 A;  1VCT A;  2L8K A;  3HR0 A;  2VL8 A;  3ZYM A;  3L3P A;  4U2Y A;  4COF A;  5LJN A;  1MMN A;  4DND A;  2XM2 A;  2FUP A;  2ZLY A;  2MYS A;  2X9Y A;  5F8P A;  3SWH A;  2WB5 A;  5AQL B;  3LBX B;  3AED A;  4CN4 A;  2EHO A;  4PJN A;  3ZN0 B;  2JMH A;  4NUU A;  4YXD A;  3PJA J;  4KX6 A;  4PNI A;  3ZC0 A;  2BKO A;  4H9P C;  3RYI E;  1W9R A;  1SHZ C;  2X0H A;  1DU2 A;  5IUX A;  1OED B;  2NR4 A;  4HWH A;  3QC9 A;  1M62 A;  3PUY F;  3PU3 A;  4CI1 B;  2K48 A;  5C2T A;  2XAS B;  3WAJ A;  3AA1 B;  3O4X E;  4P0A A;  3HKE E;  5J0Z A;  2X68 A;  3I0O A;  3AEE A;  2XM1 A;  2E5V A;  2JIW A;  1O3X A;  2IHR 1;  3MXZ A;  3UUN A;  3PTR B;  5ABF B;  5L3E B;  3IEE A;  3T1Y T;  3UFE A;  1KK7 A;  2ZM2 A;  4AKI A;  3G06 A;  3RRW A;  5AQS B;  4BA9 A;  3H3A A;  2YDR A;  3DJB A;  4JYA T;  2D9D A;  4IDZ A;  5KX5 E;  3UU3 A;  4YFS A;  5LMN T;  2D0T A;  2WS3 A;  3N9O A;  4A98 A;  4HFE A;  1XMO T;  3UUM A;  2CLY C;  3CIR A;  1D0Y A;  2BKN A;  2NW8 A;  3BQK A;  2DLR A;  2LHN A;  3RIU C;  3AAI A;  3C98 B;  3ZJ1 A;  2C5K T;  5JR9 A;  4GK5 E;  5HAX A;  4JI0 T;  4JI5 T;  2LOS A;  2YU2 A;  2YKS A;  5FY7 A;  3M65 A;  1YKH B;  5L3F B;  2WSS V;  2AXD S;  3AE2 A;  3RIU A;  2UUB T;  3ZC1 A;  3O1H A;  4ZOL E;  1W0B A;  3ONX A;  1U4Q A;  1H7C A;  2PFV A;  5DJQ C;  2NWB A;  3ZSS A;  2LEH A;  2E9X A;  3FXE B;  4L5G A;  3HL6 A;  5FL1 A;  2ACZ A;  2HN2 A;  2VWA A;  4H9N C;  3N2O A;  4H9Q C;  2DNX A;  2X66 A;  3CX7 B;  1WCR A;  4N78 D;  3ZMZ B;  1MIV A;  4C90 A;  4WZX A;  2KLQ A;  2LE8 A;  3F2E A;  1XNR T;  3W15 B;  2J47 A;  3AEG A;  4OYK A;  5AQQ B;  1B7T A;  2WWV A;  1XZY A;  2BZB A;  2X51 A;  4PFO A;  2WDV A;  1HX8 A;  4JI3 T;  3SFE A;  3EDV A;  3ZST A;  3I1A A;  2J4G A;  1KNZ A;  1WRD A;  4ILB A;  4LF7 T;  1T7S A;  1SUM B;  2Q9Q A;  2W4X A;  2NW7 A;  3BQI A;  4KUM B;  4M1P A;  4TNW A;  2DWK A;  3EUH A;  3OVU A;  5DQV A;  5F3J A;  1N33 T;  3LG7 A;  5LBM A;  5LHH B;  2E5L T;  3FZM B;  3Q5D A;  5FXX A;  4AKR B;  1D0Z A;  2IW5 B;  3VRA A;  4GK0 E;  4NXM T;  3ZT6 A;  5IWA T;  2OV9 A;  3I9Y A;  3KBU A;  5AQR B;  5JDQ A;  4P09 A;  1J5E T;  2Z6E A;  4YSX A;  3RC8 A;  5FVL A;  5ABG A;  2VQF T;  4JLE A;  3CPZ A;  3DTO A;  2WCA A;  2EHO B;  4IGU A;  4I50 E;  3ZLI A;  4X5T A;  1OED E;  4WBN E;  1LKX A;  3ONJ A;  4DR3 T;  2XAG B;  3Q5E A;  5HEG A;  5ADX L;  5L4E A;  4TWF A;  3V5S A;  1G73 A;  3EI0 A;  1UGO A;  2WQY A;  3PUA A;  3AVS A;  1XDP A;  3AXJ B;  2A3D A;  1WFD A;  2UU9 T;  1E1H B;  2JQ9 A;  5L3D B;  2MAW A;  3GN5 B;  4UVA B;  4DBR A;  3AA0 B;  4Q25 A;  4TZ4 C;  3KV9 A;  1N34 T;  3LK3 B;  5HEU A;  1ZKE A;  2CMR A;  5LYJ E;  2CXD A;  3C51 A;  1T8B A;  4IE7 A;  2LJL A;  3DP7 A;  2V26 A;  4WW0 A;  3FZF B;  3GMI A;  4O4J E;  5E0O A;  5FXV A;  3RIF A;  5DAB A;  5A1L A;  5ABH A;  2YK0 A;  3FBL A;  3ZKR A;  2G0U A;  4BJM A;  4GKJ T;  3AEF A;  1US7 B;  2EHO C;  2HHH T;  4X1K E;  2V8S V;  2WMN A;  4JV5 T;  5IHY A;  1Z8U A;  2A72 A;  3GA8 A;  3JC6 D;  4UV9 B;  5FL0 A;  3AE4 A;  3L09 A;  2ODV A;  4I55 E;  4ZZC A;  4B3M T;  4IRE A;  1UX5 A;  4YY3 T;  3QK6 A;  3ZMT B;  2LSK A;  2WM9 A;  4YJ3 E;  1HF8 A;  1E2A A;  1FIO A;  1YQ4 A;  4AQY T;  2XQ3 A;  1JNR A;  3AB3 B;  1WYB A;  4HWC A;  2P9B A;  2L9Q A;  4OHF A;  2RA1 A;  4IE5 A;  5JTG A;  4JI6 T;  5HWX A;  1HFA A;  2V7I A;  2VKO A;  4EGW A;  3CWZ B;  4DO0 A;  4PFP A;  1BR2 A;  2K5B B;  4JI2 T;  1M7K A;  3HKD E;  4EXT A;  4PJJ A;  2LLY A;  5JVD E;  4A5X A;  3I9W A;  2X0L B;  4JEU B;  1D1A A;  3R6N A;  4O2A E;  1LVF A;  2JMK A;  4YTP A;  1LRZ A;  3NVO A;  2V6Y B;  2W00 A;  2L3L A;  3ONL C;  4HFH A;  1OXZ A;  2X0Y A;  3N2G E;  5JDF A;  2HPJ A;  3LFM A;  3QB5 K;  5BMV E;  2PTF A;  3RYF E;  5J1G A;  3TLT A;  1R8I A;  2H89 A;  3C50 A;  5LXT E;  2N2N A;  5JRC B;  1D0X A;  2KWH A;  4HN9 A;  4JEH B;  4UR9 A;  3T8O A;  5HXH A;  1N32 T;  1IBM T;  4PJM A;  2LSY A;  2MOZ A;  2V1D B;  4PK4 A;  1I94 T;  2BG9 E;  2C0S A;  3CVR A;  3R84 B;  4QWN B;  3RIA A;  2PG8 A;  4YHJ A;  1NEN A;  2K3W A;  4ZEY A;  2XAH B;  1OED A;  2SPC A;  4UIG A;  3UU8 A;  3FZK B;  3FXD B;  3IHR A;  1HNX T;  1WLX A;  3UU5 A;  4B3T T;  5CB4 E;  4O2B E;  5TAO A;  4IIJ E;  3KV4 A;  4DMV A;  5JDH A;  4O8S A;  2CA5 A;  2I0M A;  3KVB A;  4EOZ B;  4ILU A;  4AI6 A;  1GQE A;  2IML A;  2QYW A;  2WZH A;  2XHE B;  2JJ9 A;  3ETV A;  3N2K E;  3KVA A;  2WP9 A;  5FXW A;  5AQI B;  4IDO A;  4FJO A;  4JI7 T;  1JNZ A;  3IF8 B;  3JC6 C;  3MKD A;  4QX7 B;  3O1J A;  5AQM B;  2XY8 B;  5EZY E;  2DL1 A;  2V5C A;  4X64 T;  4DR6 T;  3RHW A;  4K0K T;  4DR5 T;  2KT9 A;  5AQG B;  2ZM8 A;  1X79 A;  4ERR A;  4CQI A;  2W63 A;  4LFC T;  2WBL A;  2XJ7 A;  2VKH A;  3PDY A;  3PUR A;  1IJ5 A;  2NTY A;  3EAB A;  4B3S T;  4QX8 B;  4Z90 A;  4GKK T;  1NAF A;  2E8I A;  3AAE B;  3LSV A;  4OYJ A;  4X20 E;  3SOL A;  2WMO A;  3N5L A;  3FZL B;  5HCJ A;  4AKH A;  2WDR A;  4TN7 B;  1W09 A;  3P4W A;  4YJ2 E;  5AQN B;  5L47 A;  3Q5X A;  4LF9 T;  2E2A A;  3NZP A;  3N9P A;  1HTJ F;  5AQU B;  1HNW T;  1YQ3 A;  3TLS A;  2W67 A;  2N1G A;  3U3I A;  4AQF A;  1UK5 A;  2CWY A;  2KXP B;  3P4P A;  4KI0 F;  2XPK A;  2YIN A;  3EAM A;  3KV5 A;  3UUB A;  1MND A;  4IL4 A;  2QRX A;  3GN5 A;  2V6X A;  5HXS A;  3ZYL A;  2C5J A;  1NEK A;  4TUY E;  2OLT A;  3WI3 A;  5ABF A;  4EZ4 A;  2XQ4 A;  2V7L A;  1WR0 A;  1X9B A;  5L4H A;  1VCS A;  4ASK A;  3HA4 A;  4MLK A;  3O9X A;  2BS4 A;  2DI4 A;  4Z8X A;  4DV2 T;  4C91 A;  1HR0 T;  2JRK A;  3PUW F;  5J2T E;  3ETU A;  3RLF F;  5JH7 E;  2LRL A;  3B13 A;  2EHO D;  3BK9 A;  3ESL A;  3OBV E;  3P50 A;  4XAX B;  4LF6 T;  2VKJ A;  3UTK A;  2N9D A;  4ZS2 A;  5LMU T;  4DV0 T;  4WNK A;  2W2U A;  3AXJ A;  3NZQ A;  2IC9 A;  2JQH A;  2R6G F;  3KIN B;  2GK9 A;  4HKA A;  5AQJ B;  5FNV E;  3UU6 A;  1U5P A;  5CGM A;  3OKQ A;  2ACX A;  5M4Y A;  4DR7 T;  1ZV4 X;  3RKO A;  2LM9 A;  3S4U A;  4ZS3 A;  3A5X A;  4HTE A;  2YOE A;  2LM2 A;  3P7I A;  2XAQ B;  5J2U E;  1T98 A;  2LHR A;  4IE4 A;  5DQW A;  4MAL A;  4F6R C;  3NRX A;  1KFY A;  2BG9 B;  4EYY R;  1IJ6 A;  4O4L E;  1IZN B;  5GON E;  1ZEE A;  5FY0 A;  4CI3 B;  5LNK A;  4IDQ A;  3OYX A;  1BR1 A;  2XQY A;  4H63 V;  4U72 A;  1XMQ T;  2UXD T;  2V7M A;  3AEC A;  4OFZ A;  4JI8 T;  3PUQ A;  2J1D G;  3CK6 A;  3JAD A;  5LG4 A;  3CQC B;  3P8C D;  1G8X A;  2YEV C;  4PJL A;  4B6X A;  1LVK A;  3OTO T;  2D0U A;  5JDN A;  2NW9 A;  4H9S E;  4LMJ A;  4UEM A;  1KNP A;  5HEO A;  4DBQ A;  1BR4 A;  2XQ6 A;  2X9H A;  3QB5 A;  4LML A;  3P4S A;  1T72 A;  2WY2 A;  2Y48 B;  3UT5 E;  1KEY A;  1CUN A;  1J1J A;  5LGN B;  2BS2 A;  3AE5 A;  5LHI B;  4X66 T;  1HNZ T;  1AJ3 A;  2CBJ A;  1SA0 E;  2YU1 A; 
#chains in the Genus database with same CATH homology
 1XNQ T;  1IBK T;  1XMO T;  3T1Y T;  4LF5 T;  4DV4 T;  1N32 T;  1IBM T;  4JYA T;  5LMN T;  4DR4 T;  4DUZ T;  1I94 T;  2UUA T;  2UUC T;  4KHP T;  1HNX T;  1N33 T;  4JI4 T;  5IWA T;  4JI0 T;  4JI5 T;  2UXB T;  2UUB T;  4JI7 T;  4LFA T;  4X64 T;  4DR6 T;  4DUY T;  4B3T T;  4K0K T;  4NXN T;  4DR5 T;  2ZM6 T;  4LF4 T;  4LFC T;  4B3M T;  4YHH T;  4DR1 T;  1XNR T;  4B3S T;  4GKK T;  2F4V T;  4JI3 T;  4OX9 T;  4LF9 T;  4LF7 T;  1HNW T;  4B3R T;  1IBL T;  4X65 T;  2VQE T;  1FJG T;  4DR2 T;  2E5L T;  4LF8 T;  4NXM T;  4DV1 T;  4DV6 T;  1J5E T;  3T1H T;  2VQF T;  4DV2 T;  1HR0 T;  5BR8 T;  4DR3 T;  4DV5 T;  4LF6 T;  4DV7 T;  5LMU T;  4DV0 T;  2UU9 T;  4DV3 T;  1N34 T;  4DR7 T;  1N36 T;  4X62 T;  2UXC T;  4JI1 T;  4GKJ T;  2HHH T;  4JV5 T;  2UXD T;  1XMQ T;  4YY3 T;  4JI8 T;  4AQY T;  3OTO T;  4LFB T;  4JI6 T;  4JI2 T;  4X66 T;  1HNZ T; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...