1N32T

Structure of the thermus thermophilus 30s ribosomal subunit bound to codon and near-cognate transfer rna anticodon stem-loop mismatched at the first codon position at the a site with paromomycin
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
99
structure length
99
Chain Sequence
RNLSALKRHRQSLKRRLRNKAKKSAIKTLSKKAIQLAQEGKAEEALKIMRKAESLIDKAAKGSTLHKNAAARRKSRLMRKVRQLLEAAGAPLIGGGLSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Selection of tRNA by the Ribosome Requires a Transition from an Open to a Closed Form
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 16S RIBOSOMAL RNA
total genus 34
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 2002-10-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
T PF01649 Ribosomal_S20p Ribosomal protein S20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.110 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Ribosomal protein S20 1n32T00
1N34T 1J5ET 4DV1T 1XNRT 4NXMT 4DR6T 4JV5T 4JI6T 4GKJT 4LFAT 4DR1T 4LF4T 4DV0T 1N36T 4DUYT 1XMOT 4LF7T 4JYAT 4JI8T 4DV5T 1HNXT 4K0KT 2F4VT 2UXBT 4X62T 4X65T 3T1YT 4LFBT 4YHHT 4LF6T 4JI4T 2UUBT 1N32T 4X66T 1I94T 2HHHT 3T1HT 4DV7T 2ZM6T 4OX9T 4LF5T 3OTOT 2UUAT 1XMQT 4GKKT 4B3TT 4KHPT 4JI0T 1XNQT 4DUZT 1N33T 4DR7T 4LF8T 4DR2T 4LF9T 5LMUT 4DR3T 2UXCT 1FJGT 4JI1T 5IWAT 4JI3T 2UXDT 4AQYT 5BR8T 2E5LT 4DV6T 1IBLT 4X64T 4B3MT 1IBMT 1HNZT 4JI7T 4DR5T 4B3RT 4DV3T 4LFCT 4DR4T 2VQET 4JI5T 2UUCT 4DV2T 4DV4T 4NXNT 1IBKT 5LMNT 4B3ST 1HNWT 4YY3T 1HR0T 4JI2T 2UU9T 2VQFT
chains in the Genus database with same CATH superfamily
3N9QA 2JRKA 2L9QA 4UR9A 5LGNB 5CB4E 1N34T 3DJBA 2IAKA 3E22E 5FY7A 1EZ3A 2V26A 2XSAA 2EHOC 3QNUA 3EUHA 2HH7A 4X1KE 4ZOLE 4EZ4A 5C8YE 2UXNB 2FBWA 4EGWA 4BAYB 4ZI3C 2LRKA 2C5IT 2WS3A 4JUYA 1D1BA 1MNEA 4N78D 1NWMX 1HTJF 1KNPA 1OEDB 2RA1A 2WM9A 1SUMB 1YKHB 2M67A 3BQKA 2Q9QB 5JR9B 3IEEA 1WCRA 1WFDA 2CEAA 4Z8XA 2E8IA 3P4QA 4Z90A 3PE0A 3RIUC 5GONE 4A56A 2XZEA 3EAMA 1OEDA 5JR9A 5AQGB 4GKJT 3NVOA 5AQOB 2Q9QA 2XQ3A 2X0HA 2X67A 4FJOA 5F3JA 5BMVE 1FMWA 3AA7B 2KMFA 3HKBE 1WYCA 5AQNB 5JH7E 5H6RB 4X5TA 2XAHB 3AAAB 2XPKA 4ZI7E 3U3IA 2VL0A 2X9YA 5AFUL 3R84B 5JDLA 4PJMA 3Q9DA 3QOFA 4PJNA 5AQMB 2VURA 3L3PA 2F4VT 2DWKA 1XDOA 1KNRA 1J5WA 2H3RA 4CXXA 3O4XE 4QX7B 4YTPA 2YEVC 4UV8B 3T1YT 2NOXA 1LRZA 1MIYA 5LNKA 4XBFB 2CXFA 3CMLA 5LG4A 4PFOA 3JADA 4HN9A 1JNZA 3LG7A 3RGLA 3L39A 4EAHA 4CI2B 4HWFA 3C98B 3H3AA 5LOVE 1NENA 3TLTA 2WU5A 1YKEB 2WSSV 3V5UA 4X66T 1OWAA 2W0GA 4TWDA 2I59A 3ZT7A 3ZCJA 2XQ6A 3I1AA 4OFZA 2D9DA 2PJQA 3PJAA 5AQUB 2C5KT 4AKRB 2HHHT 1T7SA 4GYSA 4DV7T 1MMGA 2E9XC 2XQ8A 2W67A 2LM2A 3K3QC 3N9PA 2JIWA 1US7B 2I6HA 1B7TA 4FI5A 4KUMB 3OTOT 4ILCA 4CI1B 1OXZA 4C91A 2W62A 3UUBA 2XSBA 3RKOA 4GIWA 4HFBA 3OKQA 3LBXA 4WNKA 5EZYE 5HEJA 1BR1A 3AECA 1M7KA 3IBPA 3MZKB 3PUXF 4EEBA 2KT9A 1WLXA 2M6BA 2CWYA 4U2ZA 5DJQC 4F8HA 4JI0T 2ODUA 1ZV4X 3PTRB 4J2CA 2Q9QD 4KBMB 2BKOA 4DUZT 3AE6A 2BZBA 2X51A 2XJ7A 4KP3C 3P7IA 2R6GF 2WB5A 1BR4A 2A72A 4U33A 5L3CB 4AQGA 1FJGT 3K3NA 4EXTA 3N9LA 3RC8A 2AE9A 2N1GA 1QUUA 2VB6A 4OHFA 2H7VC 2G0UA 2LSJA 3BQIA 2W00A 4HWIB 4I0UA 4O2BE 4AISA 4ANJA 5FL0A 1T8BA 4DMVA 5IWAT 2BKNA 4ILAA 4BA9A 3RHWA 2E5LT 3MACA 4DV6T 2CPTA 2FUPA 2XASB 1XWMA 4U3CA 2PFVA 1M62A 1WYBA 2DNXA 4GYRA 4B3MT 2VK9A 1KNZA 2WDQA 4HE8A 2PBIA 3ESLA 4O4JE 2LLYA 4LFCT 4U7IA 5JRCB 3ZPOA 5L3FB 2VQET 3FZHB 3HKCE 3ANWA 3KV6A 1MMAA 3AXJA 3OJAA 3MXZA 3P50A 1UX4A 1YQ3A 4IREA 3OBVE 1I6ZA 3ZEFB 3KV9A 2WDRA 3LBXB 3PDYA 2WDVA 3VR8A 5CFBA 1U4QA 5HXHA 4YSYA 4GOUA 4DV4T 4I4TE 1NAFA 1IBKT 4X65T 1LVKA 3ONJA 1HX8A 3K1SA 1MMDA 2YOEA 1JNRA 4B3ST 2YDRA 3U78A 2J4GA 1HG5A 1HNWT 1S94A 3PU3A 4YFSA 5FXXA 3ZLIA 1G73A 1L0VA 4YSXA 3Q5XA 3UUMA 4DV5T 4MBQA 4IHJE 2M6IA 1ZHCA 3SFDA 3ZYLA 2D0TA 2E5VA 3AE2A 3NZPA 2IMLA 3I0QA 4DIDB 2OA5A 4AQFA 2FJEA 1VOMA 3C50A 4CZZB 4CXWA 5CJ5A 2W66A 5JDFA 5L3EB 2DHRA 2NTXA 1ZP0A 1XNRT 5DABA 2XQ9A 4ZZCA 1T98A 4P0BA 1YD8G 5AQQB 3SS1A 3AVRA 2XAJB 3PUQA 4QHOA 2QYWA 4H9PC 4LF4T 5FVLA 2CCQA 2Q9QC 4ERRA 2QRXA 4ILUA 4EYUA 4DUYT 3AXJB 4IE6A 5JDNA 1SE7A 2VASA 5KXJA 1XMOT 4DR7T 3PURA 1VRBA 3HA4A 3MA9A 3IF8B 4KHZF 5ETWA 1KEYA 3C51A 3N2OA 4IL9A 3ZJ1A 3LJCA 4WYVA 3SOLA 3ZYKA 2IHR1 2XTLA 3F31A 2RPAA 4QH1A 4YJ3E 1KK7A 3BQLA 3N9NA 1YW0A 2LSKA 4H9OC 1R8IA 3LDQB 3QB5K 4LMKA 4IE0A 3SRZA 1D0YA 1QLBA 3ZJ2A 1HNXT 4O4IE 1AJ3A 2E2AA 4LMLA 2V5CA 3UUNA 3UFEA 3GA8A 2UXBT 5JDQA 2W61A 1E7PA 2BS3A 4AQFC 3ABVA 4PK4A 2K3WA 3A7MA 4QKNA 3FZLB 3N9MA 4JBWF 1G8XA 3KINB 5HEGA 2J1DG 3JAFA 3LK2B 2V7MA 1H7CA 5LA6E 2DCFA 3FZKB 3PUZF 4HFHA 1W0AA 3AEFA 4U72A 3VU7H 4YHHT 5LGUB 1U5PA 1OEDE 5JDMA 2E9XA 2VL8A 4E7ZA 5EK2A 4X62T 3T8OA 2XUEA 3EABA 4IIJE 2WCAA 4UELA 4ZI2D 2ZM0A 2C0SA 2YKSA 4QXCB 3EI0A 4IE7A 5FP3A 3UQ4A 2VVSA 2WBLA 2N9DA 2H89A 1Y01A 3DTOA 3ANWB 2IC9A 5FY0A 1IAPA 3IHRA 2ZMAA 4A97A 4DNDA 5A1LA 5LHIB 2D0UA 2ZM2A 3A8YC 3CQXC 4Z91A 3RYCE 4HTEA 3TLSA 1Z8UA 3ZSTA 4QWNB 3O1HA 3AA6B 3I9YA 2H88A 3RI5A 5M4YA 5AQJB 3NWIA 2IW5B 4YTNA 3WI3A 1HS7A 4X1IE 3AB3B 3Q5WA 4PFPA 4G2AA 2MYSA 4ILBA 2LE8A 4LF8T 4DR2T 4U7YA 1X9BA 2DL1A 3P4SA 4TNWA 5BR8T 4EEDA 3FB2A 3CX8B 5FL1A 2JQQA 3AAEB 2XQYA 4KMCA 4PJLA 4IE5A 5AQSB 4DBRA 2VKHA 2WU2A 2LRLA 3OPCA 4KI0F 5LG3A 3ETVA 2E9XB 2XAGB 2WMOA 3UU5A 2XQAA 2XM2A 3MJXA 2CBJA 2LSYA 2JMHA 3LK3B 3AE7A 3UUXB 1D0ZA 5AQTB 3RYFE 4X64T 4O4LE 1HNZT 4PK6A 2LT3A 4JI7T 2ODVA 2I0MA 4DVDA 3PUYF 2YU1A 4F6RC 3MK7C 3B5MA 5LB7B 4TNVA 5HXSA 4HFCA 2WP9A 3JAEA 3RLFF 3UU4A 1HCIA 3JC6C 4IE4A 2XQ5A 3ZCIA 3UU6A 2A9UA 1S35A 3AEDA 3RC3A 4PNIA 4ZS3A 3AA1B 5E0OA 5HEUA 4IDOA 3LFMA 2BBJA 3ZN1B 3AE8A 5LMNT 2BVMA 4UEMA 1WR6A 2X68A 4UVAB 3ZC0A 2CHOA 4IL4A 4GK0E 3UU3A 5LJMA 2ZLYA 3LK42 4HFIA 3P8CD 4HWCA 5HCMA 4ZXLA 4ASKA 3R6NA 2V8SV 1KF6A 2ZM8A 4IGUA 3KBUA 3KBTA 5FYMA 5L4EA 4YSZA 5J2TE 1J5ET 2NWBA 3C4ZA 2KLQA 3W15B 3S4UA 4I55E 4YT0A 4CXYA 1E1HB 2D5UA 4NXMT 1WR0A 2MTQA 3ZMZB 2UXCT 4TV8E 4JV5T 1ZKEA 3F57A 5J1GA 3ZMUB 3X1DA 4MFRA 2K5BB 5AQRB 4UVCB 1UK5A 3GMIA 3NRXA 3QUJA 2NW7A 4K0UA 1SHZC 1UURA 2MOZA 5H6QB 4DV0T 3KVBA 4YJ2E 4OX9T 4H9NC 4TX5A 4LF7T 2XQ7A 2X9HA 3G06A 3E08A 5LCYA 2DLRA 3UTKA 2NP9A 3RIFA 4JI8T 3RX6A 2KZ7B 3AE3A 3KVAA 4HFVA 2LOPA 4O4HE 4UXNB 3AE5A 3GN5B 2OV9A 4YTMA 1XZYA 4AKIA 3FBZA 4DO0A 2ACXA 2CM0A 4PK5A 5IUXA 3WAJA 5ABFA 4ISSA 3L8RA 3AAIA 2MBGA 2YN6A 3GN5A 4H63H 2D2SA 2MAWA 3PUVF 4O8SA 5FXWA 5HXEA 3TLUA 3PV0F 3O1IA 2JQHA 4NUUA 2JQ9A 4GK5E 2B76A 4MLKA 1BR2A 3BK9A 3C4WA 3HL6A 5J0ZA 5IHYA 2Z6EA 4HWDA 3RRWA 5ADXL 4LF6T 3ONLC 4ZZBA 5FNVE 1FMVA 3O1JA 5FVKA 3CK6A 3PU8A 3RPUA 1N32T 2YINA 2YK0A 4TN7B 4A5XA 2KWHA 4MALA 4BJNA 5CA0E 5JVDE 3T1HT 2V6YB 2WWVA 5J2UE 4LF5T 1MIVA 4JEHB 1FIOA 4L9IA 5EK4A 2RP4A 4DBQA 1Z0PA 3VRBA 1KFYA 2UXXB 2V6YA 3NBXX 5L2LA 3JC6D 4AI6A 4GKKT 2ES0A 3AEGA 4B3TT 3ZT6A 2GK9A 2AXDS 3VR9A 4DMWA 5ABFB 1NEKA 2BS2A 3C4XA 2N2NA 2KNDA 3CQCB 3EVYA 3H3MA 4OK0A 4QX8B 3ETUA 3N5LA 3RYHE 3UULA 3P4PA 5L3DB 3PJAJ 3I9WA 5KDMC 1N33T 1XNQT 1T72A 2CLYB 5F5WA 2BG9A 2IIUA 3OYZA 2CLYC 4TWFA 4DR3T 1LKXA 3CVRA 3QC9A 3UT5E 1ZEEA 3K8PC 4NPPA 5L4HA 2BG9E 4P1NA 4U2YA 1MMNA 4EB6E 1W0BA 2QVAA 2X0LB 3Q5DA 3FHNA 1X79A 5FXZA 3ZKRA 4AQYT 2UXDT 2IUBA 4L0RA 4I43B 4YHJA 3CX7B 1IBLT 3B57A 2HN1A 2K9AA 4X1YE 1IBMT 2V6XA 3K3OA 4DR5T 5HXCA 4DV3T 4B3RT 1J1JA 1IZNB 2CXDA 1D0XA 4ZHQE 4JI5T 1W9RA 4PW8A 2ACZA 4CN6A 4XZCA 4YXDA 3EDUA 4QXBB 3J9X1 5IYZE 1E2AA 2LM9A 2CMRA 2NW9A 5KX5E 4DV2T 4HGAA 2V7LA 2LSGA 1CUNA 2WMNA 3C64A 4G63A 5F8PA 3ZSSA 2CWOA 4TWHA 3RRCA 4WBNE 1DU2A 2QA7A 3MKDA 2KSRA 5FMNA 2KXPB 3F2EA 4TUYE 4UV9B 1UGOA 2LKHA 3AE9A 2BG9B 5FKYA 1YXRA 2VKJA 4NUVA 3AA0B 4EV6A 1HG2A 2WY2A 2JQKA 4YY3T 1BR0A 5HEOA 5LHHB 4LFAT 4HWHA 3DP7A 5AQKB 1HR0T 3VHLA 2VKOA 4ZS2A 5LJNA 5AQLB 2JPFA 2HN2A 3CPZA 3A5XA 1V9DA 2CHNA 4WBOA 2WQYA 2VWAA 4COFA 4EIWA 2VQFT 3EHZA 2QGSA 4U74A 3RH3A 3FXEB 4IDPA 3ZYMA 5AQFB 4DV1T 2NW8A 3ZC1A 2LOSA 2YDSA 3Q5EA 2NR4A 1MIWA 4UVBB 5DQWA 4BJMA 4DR6T 3B13A 1ZOYA 5AQHB 5HEHA 4P0AA 4C90A 2V7JA 4JI6T 4I50E 4UF0B 2CE7A 4DR1T 1N36T 1UX5A 3AE4A 4O2AE 4YLHA 3HKDE 2W63A 2ZM6T 3D0TA 4WW0A 4B6XA 4QXHB 5LYJE 2W2UA 4JYAT 2Y48B 4LMJA 3NRYA 4Q25A 4UF0A 1WRDA 2XM1A 2CXLA 2V7IA 3O9XA 3VKGA 3SWHA 5C2TA 2IDOB 1CHUA 2V5DA 3KFWX 4U31A 3RKGA 3QB5A 4CN4A 5LBMA 4H9SE 2DI4A 2CBIA 2XAQB 2XQ4A 2BG9C 4KX6A 3ZT5A 2IC6A 1HX1B 5LXTE 3KDSE 5FXVA 3I0OA 4CI3B 3AEAA 3AE1A 2LKGA 2K48A 2VVNA 3H37A 2CA5A 4AIUA 4K0KT 4EOZB 2V1DB 4L5GA 2BKPA 2FJBA 4CQIA 3EDVA 2HPJA 3FXDB 5JREA 5CA1E 2WAUA 4ZI2C 1SA0E 2V7KA 3HR0A 5ABHA 3GWHA 3KV4A 4ZEYA 2XHEB 4OYJA 2LSIA 5HYAA 1QSDA 2LHNA 3UFGA 2W4XA 4JI4T 2UUBT 2J62A 2LHRA 2K24A 3OVUA 4IDNA 4IDQA 5KMGP 4IDZA 1I94T 4EZHA 1D1CA 5TAOA 1VCSA 3FBLA 2EHOA 3NZQA 3ZMSB 1XDPA 4NIQA 5LHGB 1GQEA 2YDQA 2BVLA 2B1EA 3PUGA 3M65A 5HXRA 2UUAT 4EYYR 1HFAA 3VRAA 5AQPB 2EHOB 4HKAA 1UUSA 2JJ9A 3CKDA 1XMQT 1Y64B 2KINB 2BS4A 1HF8A 2SPCA 3NKZA 4UIGA 3RIUA 4JEUB 5ABEA 2X66A 5HWXA 2XY8B 3P4WA 3PUSA 2NTYA 5HWYA 3RQUA 3WAKA 1OEDC 1D1AA 5DQVA 3TLVA 5JR9C 4KHPT 5JDGA 4IT4A 4E7SA 4HFDA 2X9XA 3VKHA 4H63V 3CWZB 2WZIA 5LBQB 3ONXA 4ZI3D 3HKEE 5L3BB 4AKHA 2HPLA 4PAGA 2X0YA 3PUAA 3JCFA 5HCJA 4LF9T 4M1PA 5LMUT 2EHOD 1MNDA 3ZN0B 1IJ6A 5L47A 4JI1T 1LVFA 3J7Yq 4CN1A 3FZFB 2OLTA 5FY1A 4P09A 3L09A 4JI3T 1YQ4A 2A2FX 2KWIB 3CX6B 4JLEA 4QH5A 3SFEA 4XAXB 3ZMVB 3E0ZA 3IA3A 2YU2A 2J47A 5JRCA 2FJAA 2WZHA 2L3LA 3AEEA 3LSVA 3OYXA 2CRBA 2Y8DA 3N2KE 4TV9E 5AQIB 5LGTB 5JTGA 4LFBT 2DWGA 1W09A 3AEBA 4OYKA 4X20E 5ABGA 4AXPA 4H9RC 3RF1A 4QH4A 3RYIE 4DR4T 1O3XA 2PTFA 3P4RA 4MHCA 3UU8A 5CGMA 5C3JA 3RIAA 3TLWA 4AKLA 5LP6E 3UQ7A 2BDEA 5AQVB 2C5JA 3QK6A 4HEAA 2A3DA 4HFEA 4ADZA 2L8KA 4WZXA 2MPKA 3N2GE 4TZ4C 3HI2A 3M3ZB 3Q2MA 5EK3A 2JMKA 2UUCT 1FEWA 2BBHA 2Y6XA 3TKLB 2X9WA 3ZMTB 4NXNT 3CQGB 2VKDA 2PG8A 5JQGE 1VCTA 1IJ5A 3N9OA 5L3GB 3AVSA 2WWUA 1UCUA 3FZMB 4AKGA 3V5SA 2P9BA 4PJJA 2H7OA 2LEHA 4H9QC 3RQWA 2XAFB 3CIRA 3PUWF 2LJLA 4A98A 5HAXA 2E9XD 2FJDA 4ISTA 4V1Av 4JI2T 2UU9T 3KV5A 5JDHA
chains in the Genus database with same CATH topology
1N34T 1J5ET 4DV1T 1XNRT 4NXMT 4DR6T 4JV5T 4JI6T 4GKJT 4LFAT 4DR1T 4LF4T 4DV0T 1N36T 4DUYT 1XMOT 4LF7T 4JYAT 4JI8T 4DV5T 1HNXT 4K0KT 2F4VT 2UXBT 4X62T 4X65T 3T1YT 4LFBT 4YHHT 4LF6T 4JI4T 2UUBT 1N32T 4X66T 1I94T 2HHHT 3T1HT 4DV7T 2ZM6T 4OX9T 4LF5T 3OTOT 2UUAT 1XMQT 4GKKT 4B3TT 4KHPT 4JI0T 1XNQT 4DUZT 1N33T 4DR7T 4LF8T 4DR2T 4LF9T 5LMUT 4DR3T 2UXCT 1FJGT 4JI1T 5IWAT 4JI3T 2UXDT 4AQYT 5BR8T 2E5LT 4DV6T 1IBLT 4X64T 4B3MT 1IBMT 1HNZT 4JI7T 4DR5T 4B3RT 4DV3T 4LFCT 4DR4T 2VQET 4JI5T 2UUCT 4DV2T 4DV4T 4NXNT 1IBKT 5LMNT 4B3ST 1HNWT 4YY3T 1HR0T 4JI2T 2UU9T 2VQFT
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1N34 T;  1J5E T;  4DV1 T;  1XNR T;  4NXM T;  4DR6 T;  4JV5 T;  4JI6 T;  4GKJ T;  4LFA T;  4DR1 T;  4LF4 T;  4DV0 T;  1N36 T;  4DUY T;  1XMO T;  4LF7 T;  4JYA T;  4JI8 T;  4DV5 T;  1HNX T;  4K0K T;  2F4V T;  2UXB T;  4X62 T;  4X65 T;  3T1Y T;  4LFB T;  4YHH T;  4LF6 T;  4JI4 T;  2UUB T;  1N32 T;  4X66 T;  1I94 T;  2HHH T;  3T1H T;  4DV7 T;  2ZM6 T;  4OX9 T;  4LF5 T;  3OTO T;  2UUA T;  1XMQ T;  4GKK T;  4B3T T;  4KHP T;  4JI0 T;  1XNQ T;  4DUZ T;  1N33 T;  4DR7 T;  4LF8 T;  4DR2 T;  4LF9 T;  5LMU T;  4DR3 T;  2UXC T;  1FJG T;  4JI1 T;  5IWA T;  4JI3 T;  2UXD T;  4AQY T;  5BR8 T;  2E5L T;  4DV6 T;  1IBL T;  4X64 T;  4B3M T;  1IBM T;  1HNZ T;  4JI7 T;  4DR5 T;  4B3R T;  4DV3 T;  4LFC T;  4DR4 T;  2VQE T;  4JI5 T;  2UUC T;  4DV2 T;  4DV4 T;  4NXN T;  1IBK T;  5LMN T;  4B3S T;  1HNW T;  4YY3 T;  1HR0 T;  4JI2 T;  2UU9 T;  2VQF T; 
#chains in the Genus database with same CATH topology
 3N9Q A;  2JRK A;  2L9Q A;  4UR9 A;  5LGN B;  5CB4 E;  1N34 T;  3DJB A;  2IAK A;  3E22 E;  5FY7 A;  1EZ3 A;  2V26 A;  2XSA A;  2EHO C;  3QNU A;  3EUH A;  2HH7 A;  4X1K E;  4ZOL E;  4EZ4 A;  5C8Y E;  2UXN B;  2FBW A;  4EGW A;  4BAY B;  4ZI3 C;  2LRK A;  2C5I T;  2WS3 A;  4JUY A;  1D1B A;  1MNE A;  4N78 D;  1NWM X;  1HTJ F;  1KNP A;  1OED B;  2RA1 A;  2WM9 A;  1SUM B;  1YKH B;  2M67 A;  3BQK A;  2Q9Q B;  5JR9 B;  3IEE A;  1WCR A;  1WFD A;  2CEA A;  4Z8X A;  2E8I A;  3P4Q A;  4Z90 A;  3PE0 A;  3RIU C;  5GON E;  4A56 A;  2XZE A;  3EAM A;  1OED A;  5JR9 A;  5AQG B;  4GKJ T;  3NVO A;  5AQO B;  2Q9Q A;  2XQ3 A;  2X0H A;  2X67 A;  4FJO A;  5F3J A;  5BMV E;  1FMW A;  3AA7 B;  2KMF A;  3HKB E;  1WYC A;  5AQN B;  5JH7 E;  5H6R B;  4X5T A;  2XAH B;  3AAA B;  2XPK A;  4ZI7 E;  3U3I A;  2VL0 A;  2X9Y A;  5AFU L;  3R84 B;  5JDL A;  4PJM A;  3Q9D A;  3QOF A;  4PJN A;  5AQM B;  2VUR A;  3L3P A;  2F4V T;  2DWK A;  1XDO A;  1KNR A;  1J5W A;  2H3R A;  4CXX A;  3O4X E;  4QX7 B;  4YTP A;  2YEV C;  4UV8 B;  3T1Y T;  2NOX A;  1LRZ A;  1MIY A;  5LNK A;  4XBF B;  2CXF A;  3CML A;  5LG4 A;  4PFO A;  3JAD A;  4HN9 A;  1JNZ A;  3LG7 A;  3RGL A;  3L39 A;  4EAH A;  4CI2 B;  4HWF A;  3C98 B;  3H3A A;  5LOV E;  1NEN A;  3TLT A;  2WU5 A;  1YKE B;  2WSS V;  3V5U A;  4X66 T;  1OWA A;  2W0G A;  4TWD A;  2I59 A;  3ZT7 A;  3ZCJ A;  2XQ6 A;  3I1A A;  4OFZ A;  2D9D A;  2PJQ A;  3PJA A;  5AQU B;  2C5K T;  4AKR B;  2HHH T;  1T7S A;  4GYS A;  4DV7 T;  1MMG A;  2E9X C;  2XQ8 A;  2W67 A;  2LM2 A;  3K3Q C;  3N9P A;  2JIW A;  1US7 B;  2I6H A;  1B7T A;  4FI5 A;  4KUM B;  3OTO T;  4ILC A;  4CI1 B;  1OXZ A;  4C91 A;  2W62 A;  3UUB A;  2XSB A;  3RKO A;  4GIW A;  4HFB A;  3OKQ A;  3LBX A;  4WNK A;  5EZY E;  5HEJ A;  1BR1 A;  3AEC A;  1M7K A;  3IBP A;  3MZK B;  3PUX F;  4EEB A;  2KT9 A;  1WLX A;  2M6B A;  2CWY A;  4U2Z A;  5DJQ C;  4F8H A;  4JI0 T;  2ODU A;  1ZV4 X;  3PTR B;  4J2C A;  2Q9Q D;  4KBM B;  2BKO A;  4DUZ T;  3AE6 A;  2BZB A;  2X51 A;  2XJ7 A;  4KP3 C;  3P7I A;  2R6G F;  2WB5 A;  1BR4 A;  2A72 A;  4U33 A;  5L3C B;  4AQG A;  1FJG T;  3K3N A;  4EXT A;  3N9L A;  3RC8 A;  2AE9 A;  2N1G A;  1QUU A;  2VB6 A;  4OHF A;  2H7V C;  2G0U A;  2LSJ A;  3BQI A;  2W00 A;  4HWI B;  4I0U A;  4O2B E;  4AIS A;  4ANJ A;  5FL0 A;  1T8B A;  4DMV A;  5IWA T;  2BKN A;  4ILA A;  4BA9 A;  3RHW A;  2E5L T;  3MAC A;  4DV6 T;  2CPT A;  2FUP A;  2XAS B;  1XWM A;  4U3C A;  2PFV A;  1M62 A;  1WYB A;  2DNX A;  4GYR A;  4B3M T;  2VK9 A;  1KNZ A;  2WDQ A;  4HE8 A;  2PBI A;  3ESL A;  4O4J E;  2LLY A;  4LFC T;  4U7I A;  5JRC B;  3ZPO A;  5L3F B;  2VQE T;  3FZH B;  3HKC E;  3ANW A;  3KV6 A;  1MMA A;  3AXJ A;  3OJA A;  3MXZ A;  3P50 A;  1UX4 A;  1YQ3 A;  4IRE A;  3OBV E;  1I6Z A;  3ZEF B;  3KV9 A;  2WDR A;  3LBX B;  3PDY A;  2WDV A;  3VR8 A;  5CFB A;  1U4Q A;  5HXH A;  4YSY A;  4GOU A;  4DV4 T;  4I4T E;  1NAF A;  1IBK T;  4X65 T;  1LVK A;  3ONJ A;  1HX8 A;  3K1S A;  1MMD A;  2YOE A;  1JNR A;  4B3S T;  2YDR A;  3U78 A;  2J4G A;  1HG5 A;  1HNW T;  1S94 A;  3PU3 A;  4YFS A;  5FXX A;  3ZLI A;  1G73 A;  1L0V A;  4YSX A;  3Q5X A;  3UUM A;  4DV5 T;  4MBQ A;  4IHJ E;  2M6I A;  1ZHC A;  3SFD A;  3ZYL A;  2D0T A;  2E5V A;  3AE2 A;  3NZP A;  2IML A;  3I0Q A;  4DID B;  2OA5 A;  4AQF A;  2FJE A;  1VOM A;  3C50 A;  4CZZ B;  4CXW A;  5CJ5 A;  2W66 A;  5JDF A;  5L3E B;  2DHR A;  2NTX A;  1ZP0 A;  1XNR T;  5DAB A;  2XQ9 A;  4ZZC A;  1T98 A;  4P0B A;  1YD8 G;  5AQQ B;  3SS1 A;  3AVR A;  2XAJ B;  3PUQ A;  4QHO A;  2QYW A;  4H9P C;  4LF4 T;  5FVL A;  2CCQ A;  2Q9Q C;  4ERR A;  2QRX A;  4ILU A;  4EYU A;  4DUY T;  3AXJ B;  4IE6 A;  5JDN A;  1SE7 A;  2VAS A;  5KXJ A;  1XMO T;  4DR7 T;  3PUR A;  1VRB A;  3HA4 A;  3MA9 A;  3IF8 B;  4KHZ F;  5ETW A;  1KEY A;  3C51 A;  3N2O A;  4IL9 A;  3ZJ1 A;  3LJC A;  4WYV A;  3SOL A;  3ZYK A;  2IHR 1;  2XTL A;  3F31 A;  2RPA A;  4QH1 A;  4YJ3 E;  1KK7 A;  3BQL A;  3N9N A;  1YW0 A;  2LSK A;  4H9O C;  1R8I A;  3LDQ B;  3QB5 K;  4LMK A;  4IE0 A;  3SRZ A;  1D0Y A;  1QLB A;  3ZJ2 A;  1HNX T;  4O4I E;  1AJ3 A;  2E2A A;  4LML A;  2V5C A;  3UUN A;  3UFE A;  3GA8 A;  2UXB T;  5JDQ A;  2W61 A;  1E7P A;  2BS3 A;  4AQF C;  3ABV A;  4PK4 A;  2K3W A;  3A7M A;  4QKN A;  3FZL B;  3N9M A;  4JBW F;  1G8X A;  3KIN B;  5HEG A;  2J1D G;  3JAF A;  3LK2 B;  2V7M A;  1H7C A;  5LA6 E;  2DCF A;  3FZK B;  3PUZ F;  4HFH A;  1W0A A;  3AEF A;  4U72 A;  3VU7 H;  4YHH T;  5LGU B;  1U5P A;  1OED E;  5JDM A;  2E9X A;  2VL8 A;  4E7Z A;  5EK2 A;  4X62 T;  3T8O A;  2XUE A;  3EAB A;  4IIJ E;  2WCA A;  4UEL A;  4ZI2 D;  2ZM0 A;  2C0S A;  2YKS A;  4QXC B;  3EI0 A;  4IE7 A;  5FP3 A;  3UQ4 A;  2VVS A;  2WBL A;  2N9D A;  2H89 A;  1Y01 A;  3DTO A;  3ANW B;  2IC9 A;  5FY0 A;  1IAP A;  3IHR A;  2ZMA A;  4A97 A;  4DND A;  5A1L A;  5LHI B;  2D0U A;  2ZM2 A;  3A8Y C;  3CQX C;  4Z91 A;  3RYC E;  4HTE A;  3TLS A;  1Z8U A;  3ZST A;  4QWN B;  3O1H A;  3AA6 B;  3I9Y A;  2H88 A;  3RI5 A;  5M4Y A;  5AQJ B;  3NWI A;  2IW5 B;  4YTN A;  3WI3 A;  1HS7 A;  4X1I E;  3AB3 B;  3Q5W A;  4PFP A;  4G2A A;  2MYS A;  4ILB A;  2LE8 A;  4LF8 T;  4DR2 T;  4U7Y A;  1X9B A;  2DL1 A;  3P4S A;  4TNW A;  5BR8 T;  4EED A;  3FB2 A;  3CX8 B;  5FL1 A;  2JQQ A;  3AAE B;  2XQY A;  4KMC A;  4PJL A;  4IE5 A;  5AQS B;  4DBR A;  2VKH A;  2WU2 A;  2LRL A;  3OPC A;  4KI0 F;  5LG3 A;  3ETV A;  2E9X B;  2XAG B;  2WMO A;  3UU5 A;  2XQA A;  2XM2 A;  3MJX A;  2CBJ A;  2LSY A;  2JMH A;  3LK3 B;  3AE7 A;  3UUX B;  1D0Z A;  5AQT B;  3RYF E;  4X64 T;  4O4L E;  1HNZ T;  4PK6 A;  2LT3 A;  4JI7 T;  2ODV A;  2I0M A;  4DVD A;  3PUY F;  2YU1 A;  4F6R C;  3MK7 C;  3B5M A;  5LB7 B;  4TNV A;  5HXS A;  4HFC A;  2WP9 A;  3JAE A;  3RLF F;  3UU4 A;  1HCI A;  3JC6 C;  4IE4 A;  2XQ5 A;  3ZCI A;  3UU6 A;  2A9U A;  1S35 A;  3AED A;  3RC3 A;  4PNI A;  4ZS3 A;  3AA1 B;  5E0O A;  5HEU A;  4IDO A;  3LFM A;  2BBJ A;  3ZN1 B;  3AE8 A;  5LMN T;  2BVM A;  4UEM A;  1WR6 A;  2X68 A;  4UVA B;  3ZC0 A;  2CHO A;  4IL4 A;  4GK0 E;  3UU3 A;  5LJM A;  2ZLY A;  3LK4 2;  4HFI A;  3P8C D;  4HWC A;  5HCM A;  4ZXL A;  4ASK A;  3R6N A;  2V8S V;  1KF6 A;  2ZM8 A;  4IGU A;  3KBU A;  3KBT A;  5FYM A;  5L4E A;  4YSZ A;  5J2T E;  1J5E T;  2NWB A;  3C4Z A;  2KLQ A;  3W15 B;  3S4U A;  4I55 E;  4YT0 A;  4CXY A;  1E1H B;  2D5U A;  4NXM T;  1WR0 A;  2MTQ A;  3ZMZ B;  2UXC T;  4TV8 E;  4JV5 T;  1ZKE A;  3F57 A;  5J1G A;  3ZMU B;  3X1D A;  4MFR A;  2K5B B;  5AQR B;  4UVC B;  1UK5 A;  3GMI A;  3NRX A;  3QUJ A;  2NW7 A;  4K0U A;  1SHZ C;  1UUR A;  2MOZ A;  5H6Q B;  4DV0 T;  3KVB A;  4YJ2 E;  4OX9 T;  4H9N C;  4TX5 A;  4LF7 T;  2XQ7 A;  2X9H A;  3G06 A;  3E08 A;  5LCY A;  2DLR A;  3UTK A;  2NP9 A;  3RIF A;  4JI8 T;  3RX6 A;  2KZ7 B;  3AE3 A;  3KVA A;  4HFV A;  2LOP A;  4O4H E;  4UXN B;  3AE5 A;  3GN5 B;  2OV9 A;  4YTM A;  1XZY A;  4AKI A;  3FBZ A;  4DO0 A;  2ACX A;  2CM0 A;  4PK5 A;  5IUX A;  3WAJ A;  5ABF A;  4ISS A;  3L8R A;  3AAI A;  2MBG A;  2YN6 A;  3GN5 A;  4H63 H;  2D2S A;  2MAW A;  3PUV F;  4O8S A;  5FXW A;  5HXE A;  3TLU A;  3PV0 F;  3O1I A;  2JQH A;  4NUU A;  2JQ9 A;  4GK5 E;  2B76 A;  4MLK A;  1BR2 A;  3BK9 A;  3C4W A;  3HL6 A;  5J0Z A;  5IHY A;  2Z6E A;  4HWD A;  3RRW A;  5ADX L;  4LF6 T;  3ONL C;  4ZZB A;  5FNV E;  1FMV A;  3O1J A;  5FVK A;  3CK6 A;  3PU8 A;  3RPU A;  1N32 T;  2YIN A;  2YK0 A;  4TN7 B;  4A5X A;  2KWH A;  4MAL A;  4BJN A;  5CA0 E;  5JVD E;  3T1H T;  2V6Y B;  2WWV A;  5J2U E;  4LF5 T;  1MIV A;  4JEH B;  1FIO A;  4L9I A;  5EK4 A;  2RP4 A;  4DBQ A;  1Z0P A;  3VRB A;  1KFY A;  2UXX B;  2V6Y A;  3NBX X;  5L2L A;  3JC6 D;  4AI6 A;  4GKK T;  2ES0 A;  3AEG A;  4B3T T;  3ZT6 A;  2GK9 A;  2AXD S;  3VR9 A;  4DMW A;  5ABF B;  1NEK A;  2BS2 A;  3C4X A;  2N2N A;  2KND A;  3CQC B;  3EVY A;  3H3M A;  4OK0 A;  4QX8 B;  3ETU A;  3N5L A;  3RYH E;  3UUL A;  3P4P A;  5L3D B;  3PJA J;  3I9W A;  5KDM C;  1N33 T;  1XNQ T;  1T72 A;  2CLY B;  5F5W A;  2BG9 A;  2IIU A;  3OYZ A;  2CLY C;  4TWF A;  4DR3 T;  1LKX A;  3CVR A;  3QC9 A;  3UT5 E;  1ZEE A;  3K8P C;  4NPP A;  5L4H A;  2BG9 E;  4P1N A;  4U2Y A;  1MMN A;  4EB6 E;  1W0B A;  2QVA A;  2X0L B;  3Q5D A;  3FHN A;  1X79 A;  5FXZ A;  3ZKR A;  4AQY T;  2UXD T;  2IUB A;  4L0R A;  4I43 B;  4YHJ A;  3CX7 B;  1IBL T;  3B57 A;  2HN1 A;  2K9A A;  4X1Y E;  1IBM T;  2V6X A;  3K3O A;  4DR5 T;  5HXC A;  4DV3 T;  4B3R T;  1J1J A;  1IZN B;  2CXD A;  1D0X A;  4ZHQ E;  4JI5 T;  1W9R A;  4PW8 A;  2ACZ A;  4CN6 A;  4XZC A;  4YXD A;  3EDU A;  4QXB B;  3J9X 1;  5IYZ E;  1E2A A;  2LM9 A;  2CMR A;  2NW9 A;  5KX5 E;  4DV2 T;  4HGA A;  2V7L A;  2LSG A;  1CUN A;  2WMN A;  3C64 A;  4G63 A;  5F8P A;  3ZSS A;  2CWO A;  4TWH A;  3RRC A;  4WBN E;  1DU2 A;  2QA7 A;  3MKD A;  2KSR A;  5FMN A;  2KXP B;  3F2E A;  4TUY E;  4UV9 B;  1UGO A;  2LKH A;  3AE9 A;  2BG9 B;  5FKY A;  1YXR A;  2VKJ A;  4NUV A;  3AA0 B;  4EV6 A;  1HG2 A;  2WY2 A;  2JQK A;  4YY3 T;  1BR0 A;  5HEO A;  5LHH B;  4LFA T;  4HWH A;  3DP7 A;  5AQK B;  1HR0 T;  3VHL A;  2VKO A;  4ZS2 A;  5LJN A;  5AQL B;  2JPF A;  2HN2 A;  3CPZ A;  3A5X A;  1V9D A;  2CHN A;  4WBO A;  2WQY A;  2VWA A;  4COF A;  4EIW A;  2VQF T;  3EHZ A;  2QGS A;  4U74 A;  3RH3 A;  3FXE B;  4IDP A;  3ZYM A;  5AQF B;  4DV1 T;  2NW8 A;  3ZC1 A;  2LOS A;  2YDS A;  3Q5E A;  2NR4 A;  1MIW A;  4UVB B;  5DQW A;  4BJM A;  4DR6 T;  3B13 A;  1ZOY A;  5AQH B;  5HEH A;  4P0A A;  4C90 A;  2V7J A;  4JI6 T;  4I50 E;  4UF0 B;  2CE7 A;  4DR1 T;  1N36 T;  1UX5 A;  3AE4 A;  4O2A E;  4YLH A;  3HKD E;  2W63 A;  2ZM6 T;  3D0T A;  4WW0 A;  4B6X A;  4QXH B;  5LYJ E;  2W2U A;  4JYA T;  2Y48 B;  4LMJ A;  3NRY A;  4Q25 A;  4UF0 A;  1WRD A;  2XM1 A;  2CXL A;  2V7I A;  3O9X A;  3VKG A;  3SWH A;  5C2T A;  2IDO B;  1CHU A;  2V5D A;  3KFW X;  4U31 A;  3RKG A;  3QB5 A;  4CN4 A;  5LBM A;  4H9S E;  2DI4 A;  2CBI A;  2XAQ B;  2XQ4 A;  2BG9 C;  4KX6 A;  3ZT5 A;  2IC6 A;  1HX1 B;  5LXT E;  3KDS E;  5FXV A;  3I0O A;  4CI3 B;  3AEA A;  3AE1 A;  2LKG A;  2K48 A;  2VVN A;  3H37 A;  2CA5 A;  4AIU A;  4K0K T;  4EOZ B;  2V1D B;  4L5G A;  2BKP A;  2FJB A;  4CQI A;  3EDV A;  2HPJ A;  3FXD B;  5JRE A;  5CA1 E;  2WAU A;  4ZI2 C;  1SA0 E;  2V7K A;  3HR0 A;  5ABH A;  3GWH A;  3KV4 A;  4ZEY A;  2XHE B;  4OYJ A;  2LSI A;  5HYA A;  1QSD A;  2LHN A;  3UFG A;  2W4X A;  4JI4 T;  2UUB T;  2J62 A;  2LHR A;  2K24 A;  3OVU A;  4IDN A;  4IDQ A;  5KMG P;  4IDZ A;  1I94 T;  4EZH A;  1D1C A;  5TAO A;  1VCS A;  3FBL A;  2EHO A;  3NZQ A;  3ZMS B;  1XDP A;  4NIQ A;  5LHG B;  1GQE A;  2YDQ A;  2BVL A;  2B1E A;  3PUG A;  3M65 A;  5HXR A;  2UUA T;  4EYY R;  1HFA A;  3VRA A;  5AQP B;  2EHO B;  4HKA A;  1UUS A;  2JJ9 A;  3CKD A;  1XMQ T;  1Y64 B;  2KIN B;  2BS4 A;  1HF8 A;  2SPC A;  3NKZ A;  4UIG A;  3RIU A;  4JEU B;  5ABE A;  2X66 A;  5HWX A;  2XY8 B;  3P4W A;  3PUS A;  2NTY A;  5HWY A;  3RQU A;  3WAK A;  1OED C;  1D1A A;  5DQV A;  3TLV A;  5JR9 C;  4KHP T;  5JDG A;  4IT4 A;  4E7S A;  4HFD A;  2X9X A;  3VKH A;  4H63 V;  3CWZ B;  2WZI A;  5LBQ B;  3ONX A;  4ZI3 D;  3HKE E;  5L3B B;  4AKH A;  2HPL A;  4PAG A;  2X0Y A;  3PUA A;  3JCF A;  5HCJ A;  4LF9 T;  4M1P A;  5LMU T;  2EHO D;  1MND A;  3ZN0 B;  1IJ6 A;  5L47 A;  4JI1 T;  1LVF A;  3J7Y q;  4CN1 A;  3FZF B;  2OLT A;  5FY1 A;  4P09 A;  3L09 A;  4JI3 T;  1YQ4 A;  2A2F X;  2KWI B;  3CX6 B;  4JLE A;  4QH5 A;  3SFE A;  4XAX B;  3ZMV B;  3E0Z A;  3IA3 A;  2YU2 A;  2J47 A;  5JRC A;  2FJA A;  2WZH A;  2L3L A;  3AEE A;  3LSV A;  3OYX A;  2CRB A;  2Y8D A;  3N2K E;  4TV9 E;  5AQI B;  5LGT B;  5JTG A;  4LFB T;  2DWG A;  1W09 A;  3AEB A;  4OYK A;  4X20 E;  5ABG A;  4AXP A;  4H9R C;  3RF1 A;  4QH4 A;  3RYI E;  4DR4 T;  1O3X A;  2PTF A;  3P4R A;  4MHC A;  3UU8 A;  5CGM A;  5C3J A;  3RIA A;  3TLW A;  4AKL A;  5LP6 E;  3UQ7 A;  2BDE A;  5AQV B;  2C5J A;  3QK6 A;  4HEA A;  2A3D A;  4HFE A;  4ADZ A;  2L8K A;  4WZX A;  2MPK A;  3N2G E;  4TZ4 C;  3HI2 A;  3M3Z B;  3Q2M A;  5EK3 A;  2JMK A;  2UUC T;  1FEW A;  2BBH A;  2Y6X A;  3TKL B;  2X9W A;  3ZMT B;  4NXN T;  3CQG B;  2VKD A;  2PG8 A;  5JQG E;  1VCT A;  1IJ5 A;  3N9O A;  5L3G B;  3AVS A;  2WWU A;  1UCU A;  3FZM B;  4AKG A;  3V5S A;  2P9B A;  4PJJ A;  2H7O A;  2LEH A;  4H9Q C;  3RQW A;  2XAF B;  3CIR A;  3PUW F;  2LJL A;  4A98 A;  5HAX A;  2E9X D;  2FJD A;  4IST A;  4V1A v;  4JI2 T;  2UU9 T;  3KV5 A;  5JDH A; 
#chains in the Genus database with same CATH homology
 1N34 T;  1J5E T;  4DV1 T;  1XNR T;  4NXM T;  4DR6 T;  4JV5 T;  4JI6 T;  4GKJ T;  4LFA T;  4DR1 T;  4LF4 T;  4DV0 T;  1N36 T;  4DUY T;  1XMO T;  4LF7 T;  4JYA T;  4JI8 T;  4DV5 T;  1HNX T;  4K0K T;  2F4V T;  2UXB T;  4X62 T;  4X65 T;  3T1Y T;  4LFB T;  4YHH T;  4LF6 T;  4JI4 T;  2UUB T;  1N32 T;  4X66 T;  1I94 T;  2HHH T;  3T1H T;  4DV7 T;  2ZM6 T;  4OX9 T;  4LF5 T;  3OTO T;  2UUA T;  1XMQ T;  4GKK T;  4B3T T;  4KHP T;  4JI0 T;  1XNQ T;  4DUZ T;  1N33 T;  4DR7 T;  4LF8 T;  4DR2 T;  4LF9 T;  5LMU T;  4DR3 T;  2UXC T;  1FJG T;  4JI1 T;  5IWA T;  4JI3 T;  2UXD T;  4AQY T;  5BR8 T;  2E5L T;  4DV6 T;  1IBL T;  4X64 T;  4B3M T;  1IBM T;  1HNZ T;  4JI7 T;  4DR5 T;  4B3R T;  4DV3 T;  4LFC T;  4DR4 T;  2VQE T;  4JI5 T;  2UUC T;  4DV2 T;  4DV4 T;  4NXN T;  1IBK T;  5LMN T;  4B3S T;  1HNW T;  4YY3 T;  1HR0 T;  4JI2 T;  2UU9 T;  2VQF T; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...