1N32T

Structure of the thermus thermophilus 30s ribosomal subunit bound to codon and near-cognate transfer rna anticodon stem-loop mismatched at the first codon position at the a site with paromomycin
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
99
structure length
99
Chain Sequence
b'RNLSALKRHRQSLKRRLRNKAKKSAIKTLSKKAIQLAQEGKAEEALKIMRKAESLIDKAAKGSTLHKNAAARRKSRLMRKVRQLLEAAGAPLIGGGLSA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S RIBOSOMAL RNA
publication title Selection of tRNA by the Ribosome Requires a Transition from an Open to a Closed Form
pubmed doi rcsb
molecule tags Ribosome
total genus 34
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 2002-10-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
T PF01649 Ribosomal_S20p Ribosomal protein S20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.110 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Ribosomal protein S20 1n32T00
5BR8T 1N34T 4DV5T 3T1YT 4AQYT 4B3RT 4B3TT 4DUYT 4JI8T 2UXDT 4DV1T 4DV6T 2VQFT 4GKKT 4LF5T 4DR5T 4B3MT 1FJGT 4JI4T 4YY3T 4X65T 4LF8T 3T1HT 4KHPT 4X62T 4NXMT 1N33T 4DR1T 1HNWT 1I94T 4DV4T 2UXCT 4DV3T 1J5ET 4JI3T 2UXBT 4LF4T 2HHHT 1IBLT 4LFBT 4DR2T 4DV0T 4B3ST 4DR7T 4OX9T 3OTOT 2VQET 4JI6T 4DUZT 4DV2T 2ZM6T 2F4VT 4DR3T 4JI7T 2E5LT 2UUAT 5IWAT 1XNRT 1HNXT 4DV7T 4JI2T 5LMNT 4DR4T 4X66T 4X64T 4LF6T 1IBMT 2UUCT 4YHHT 1XNQT 4JYAT 1XMQT 4JV5T 1XMOT 4LF7T 1HNZT 4LFAT 4JI1T 4LF9T 2UUBT 1N32T 1HR0T 4NXNT 4JI0T 4JI5T 4K0KT 2UU9T 4DR6T 4LFCT 1IBKT 4GKJT 5LMUT 1N36T
chains in the Genus database with same CATH superfamily
2LM2A 2X68A 2W62A 4Z91A 2V5CA 3U3IA 2XQ4A 5EK4A 4ILCA 1MMGA 2ZMAA 3CQGB 4LMJA 4X5TA 4ZI2D 2Y8DA 2OLTA 3ONJA 3ZYMA 4AQGA 3C4ZA 3AA1B 1IJ5A 2FJEA 4JI4T 2WZHA 1M62A 2Y6XA 2WU5A 3AEEA 3ZN1B 1XDOA 1FEWA 4QWNB 5AQKB 3N5LA 1E7PA 4K0UA 2NTYA 3HL6A 4ZI7E 4UXNB 3HKCE 2RP4A 3UU3A 1IJ6A 2XHEB 4ILUA 1IAPA 3LG7A 2CWOA 2D0TA 5LYJE 1HCIA 4BJNA 1MIWA 3AE6A 2NTXA 2VKOA 5KMGP 1YKHB 2K24A 5J1GA 2XTLA 4U33A 2XSBA 3WAJA 5KDMC 5HXHA 5FL1A 3SOLA 4ILBA 4JI7T 2L9QA 3IEEA 4H9NC 1HX1B 3AAEB 2XY8B 1X9BA 3FBLA 2WBLA 2HN1A 3RX6A 3FXDB 4JYAT 2D2SA 2BS3A 4XZCA 2WQYA 2JPFA 4CXWA 3EVYA 1WR0A 3LK2B 3HI2A 5LJNA 2MOZA 3A7MA 3UUBA 3E08A 2VKDA 2G0UA 4X20E 5CJ5A 4GKJT 4EYYR 3TKLB 1N36T 3RKGA 3PUWF 4CZZB 2L8KA 2B76A 4UEMA 2WSSV 2IIUA 2AE9A 1UX5A 5LHHB 3PURA 2KWIB 4KMCA 3O1IA 3GA8A 3OKQA 4UVAB 4AKGA 4ZHQE 4NXMT 3GWHA 4IHJE 3QNUA 1I94T 5CB4E 2YU1A 3ZC1A 4DV4T 4QHOA 1KF6A 4X1IE 4C90A 5M4YA 2VKJA 3JC6C 1XWMA 2V6XA 5HEGA 1GQEA 3ZCJA 5JH7E 4B3ST 4JI6T 4PJJA 3N9NA 2IMLA 4ISSA 2F4VT 1E1HB 4YTNA 2XSAA 2XAQB 3KFWX 2V7JA 4O4HE 2PFVA 3AE5A 3EDVA 3AEDA 3R84B 2BZBA 1XMOT 3OJAA 1D0YA 2X67A 5ABEA 3MZKB 3J7Yq 3ANWB 4P0BA 4GYSA 3ZSSA 3KV9A 3UU5A 1MIVA 5LP6E 4EYUA 2YU2A 2BKPA 4YSXA 3CK6A 3JC6D 3P4PA 2BBJA 4IE0A 3RF1A 4V1Av 3Q5EA 4HWHA 3UU6A 2LRKA 3QB5K 3QOFA 3K1SA 3PUSA 4LF8T 3MKDA 1WFDA 3FBZA 4X62T 4DNDA 3IBPA 5DABA 4TN7B 5ABFA 3PDYA 3HR0A 2CWYA 2HHHT 1KEYA 3RPUA 5EK2A 3UQ4A 5HXSA 2JIWA 5JDQA 3TLSA 3C4XA 4JUYA 1S35A 2WU2A 3CPZA 2VKHA 5L3FB 4IL9A 5HWYA 2X66A 3VKHA 4TWFA 3F31A 3AVSA 4X1KE 3UQ7A 5IUXA 2W61A 3AE3A 4C91A 3RYHE 5HYAA 2X9XA 2C5JA 3CX8B 5L4HA 4GK5E 3G06A 5LB7B 3RHWA 2V7KA 3KV5A 4J2CA 5LJMA 1LRZA 5FYMA 4HN9A 4NIQA 4FJOA 4AQFA 3OBVE 2RA1A 3GN5B 2E9XA 2YK0A 2XUEA 2IDOB 4U7IA 5JRCB 2VVNA 3BQLA 5JR9B 1YQ3A 4ILAA 1W0BA 4HWFA 2EHOA 3OYZA 2WY2A 2XAHB 4ZEYA 1E2AA 3FZMB 2Q9QA 4L5GA 2YDQA 2IUBA 3M65A 1SE7A 5AQPB 3N9OA 2KMFA 4TZ4C 2XAFB 3L09A 4DV0T 4UVBB 3UU8A 3OTOT 4YHJA 3Q9DA 1ZV4X 4HEAA 4PJNA 4L0RA 4H63H 2NOXA 1MMNA 5L3CB 3VKGA 5JR9A 3LK3B 4LF6T 2KXPB 4XAXB 1IBMT 2UUCT 2W00A 4OYKA 3O1JA 2K48A 3CQCB 1JNZA 2VB6A 3RYIE 1CHUA 3AE4A 2QYWA 2M6BA 3PUYF 2CBJA 4IGUA 2BKOA 3ZN0B 4ADZA 1US7B 4JLEA 3UUNA 3PV0F 3FHNA 5FL0A 1HX8A 4GK0E 5AQNB 3ZJ1A 2N2NA 1J5WA 2UXDT 2LSGA 3KINB 3LFMA 5JVDE 5AQFB 1D0ZA 4WBNE 3HA4A 4WYVA 2E8IA 1XDPA 3ZMSB 3SFEA 4EEBA 3RYFE 1S94A 2ODVA 4YFSA 5ABGA 2WDVA 3N2KE 2NWBA 3O9XA 3B5MA 4I43B 1JNRA 4TNVA 1OEDB 3RKOA 2ZLYA 4IL4A 2L3LA 5FVLA 2AXDS 1L0VA 3UTKA 3RC3A 2OA5A 4UF0A 3N9MA 2NR4A 2E5LT 1SHZC 5ABHA 1YKEB 2CHNA 1OEDC 4AKHA 4UV9B 2XPKA 3P4QA 3UULA 3K3NA 4YHHT 1VCSA 4E7SA 2XZEA 3EHZA 4PFOA 4LF7T 4I55E 4COFA 1ZHCA 3KVAA 3NZPA 4DVDA 1QUUA 5FNVE 3BQIA 2WM9A 3L39A 3ZMUB 4Q25A 3W15B 4GYRA 2BVLA 2BBHA 3NKZA 5HEHA 3D0TA 5AQLB 4DBQA 3OPCA 2VQFT 3VR8A 3BQKA 2HPLA 2C5IT 1ZP0A 2H89A 4ASKA 2M67A 3Q2MA 4UELA 2W4XA 2V6YB 2ZM0A 3PJAJ 2FJAA 3RIUC 2KSRA 3FB2A 3PUQA 3SRZA 3CKDA 4QX8B 2XQ5A 3FZHB 2W2UA 4IDQA 3A5XA 2X0HA 2CM0A 2LRLA 3AA0B 4KUMB 2FJDA 4U74A 3UUMA 4YT0A 1J1JA 4ZS3A 3IF8B 4WW0A 3C4WA 2A9UA 2VVSA 4HWCA 4NXNT 3P50A 2M6IA 5AQIB 3KBTA 3AXJB 2LSIA 5AQUB 4U72A 5LXTE 1FMWA 5JQGE 3FXEB 4X1YE 3RRWA 2XAGB 4OHFA 4QXHB 4DBRA 3RI5A 5HEOA 4ZI3C 3PUVF 3F2EA 4G2AA 1IZNB 1SA0E 3C50A 4HE8A 4DO0A 4X65T 2WAUA 3C98B 2ZM8A 2LOPA 3CQXC 2HN2A 4DMVA 1UX4A 2XAJB 4I50E 3TLUA 1KFYA 5L3BB 4KP3C 4O4IE 5JDMA 3IA3A 3ZT5A 1I6ZA 4IE7A 4WNKA 2NW9A 1IBLT 5LHGB 2H88A 3SS1A 4TV9E 2BS2A 4H9RC 5AQMB 1OEDE 1D1CA 2V7LA 3BK9A 4BJMA 3Q5XA 1HTJF 4CN1A 2D9DA 3FZKB 3N2GE 4DR4T 3P8CD 4GIWA 4ZI3D 1XMQT 2DHRA 4HWIB 4EZHA 4UV8B 1MNEA 2XQ6A 3DJBA 3DP7A 4LF9T 1N32T 4KBMB 1HR0T 2E5VA 4HFBA 2XASB 4DR6T 5L4EA 1HFAA 2X9YA 5BR8T 3AE2A 2V5DA 3ZT7A 1W0AA 3C64A 3ETUA 3CX6B 2CXLA 2XQ7A 2CEAA 2LM9A 1LVKA 3PJAA 3KV4A 1WCRA 5TAOA 4I0UA 3VRAA 4B3MT 5HCMA 3EAMA 4CQIA 1W9RA 2CCQA 2W67A 1N33T 2GK9A 4YXDA 4DR1T 2V7MA 5JTGA 4LMLA 5CFBA 1DU2A 4CXXA 4KI0F 5HAXA 4DV3T 4PJLA 2K3WA 3UFEA 2H7OA 3QB5A 2JQ9A 2LSJA 2D0UA 2JMHA 5J2UE 3SFDA 4QH4A 2J62A 2I59A 5DJQC 4EB6E 5FXWA 3M3ZB 2DLRA 3O1HA 4P09A 5J2TE 3AE9A 1MMDA 4JBWF 2KNDA 1FMVA 3PUXF 4P0AA 2IC6A 3ANWA 3HKEE 4IE4A 2DI4A 2MTQA 2LHRA 2UXNB 1UUSA 4X66T 5AQOB 4ZZCA 3AE7A 5GONE 3N2OA 3ABVA 4U2ZA 4UVCB 3AEAA 1VOMA 3RIAA 4I4TE 4LFAT 2X51A 3LBXB 2FJBA 2CPTA 1QSDA 3NRXA 2WWUA 1IBKT 1KK7A 4CI3B 4NUUA 2JQQA 2J47A 1UGOA 3T1YT 1G8XA 3I0QA 4JI8T 4PK4A 5LHIB 2XQ3A 1FIOA 1FJGT 3F57A 4CXYA 4YY3T 5HXRA 1HNWT 2LT3A 1Z8UA 4EOZB 3P4SA 3E22E 4YJ3E 3VU7H 5LGUB 2QVAA 4QH5A 3R6NA 2C0SA 5CGMA 3O4XE 3E0ZA 2EHOC 4TUYE 2HH7A 2I6HA 4DR7T 2VQET 4MBQA 2ZM6T 5FXVA 3ZJ2A 3WAKA 2WB5A 3MJXA 4DV7T 3LK42 4WZXA 2C5KT 4HWDA 3PUAA 4IDPA 4NPPA 5JDGA 3GN5A 2CLYB 4EZ4A 3DTOA 3RIFA 1ZKEA 3Q5DA 2WDRA 1T98A 5JDFA 5HEUA 2UU9T 5JRCA 5EK3A 2N1GA 4LMKA 2E9XD 3ZKRA 5L2LA 1AJ3A 3FZFB 2BG9B 2LE8A 4CI2B 2J1DG 4EV6A 5LCYA 1BR0A 1XZYA 4DV6T 1T72A 2VWAA 4IREA 5LGTB 4HFIA 2EHOD 2JRKA 3UT5E 2CLYC 1YXRA 3LJCA 4AISA 2YDSA 1NENA 2V7IA 4IDOA 3AA6B 3ZPOA 1O3XA 1NAFA 2LSYA 1MNDA 5FY7A 2XJ7A 3VHLA 2BG9C 5AQTB 2XM1A 2P9BA 5EZYE 3PE0A 4DR2T 2FUPA 5IYZE 2D5UA 2KINB 5IHYA 4CN6A 3UU4A 4OK0A 4ANJA 4DUZT 4IIJE 3I1AA 3N9LA 4ZXLA 1KNPA 4O4LE 4BA9A 4JI2T 1Y01A 2CA5A 2PG8A 1NWMX 3B57A 3VR9A 4JV5T 5FXXA 5AQGB 3ZC0A 2WMNA 3GMIA 3ZCIA 2IC9A 1HF8A 3J9X1 4HTEA 4JI5T 5DQWA 4AXPA 4H63V 4QXBB 5FXZA 3MK7C 2KLQA 4L9IA 4B3RT 2NP9A 1OXZA 1OEDA 4GKKT 4DR5T 2LEHA 2ACXA 1LVFA 2OV9A 1YQ4A 4KHPT 3ZLIA 2LJLA 2BKNA 3K3OA 3TLTA 3RQUA 4JI3T 2CXDA 1Y64B 2XQAA 3T8OA 2IHR1 5LG4A 2UXBT 2X9HA 2CXFA 2Z6EA 2Y48B 4U7YA 2BS4A 5E0OA 2ACZA 4H9PC 4A5XA 3JADA 4OX9T 1VCTA 4H9SE 2UXXB 4Z8XA 2PTFA 3AVRA 4TWHA 3PU8A 1G73A 5LOVE 1ZOYA 2UUAT 2MPKA 4AKRB 2IW5B 4ISTA 3NRYA 4PK6A 5HXCA 5C2TA 1WYBA 4HFHA 2NW8A 4IT4A 1CUNA 3RIUA 5DQVA 5LBMA 4KHZF 2KZ7B 5LA6E 5AQQB 4MFRA 4YSYA 4M1PA 1HS7A 5KX5E 5KXJA 3CIRA 2K9AA 1X79A 1BR2A 3X1DA 1VRBA 3V5SA 4JEHB 1U5PA 4AI6A 5ETWA 4DUYT 2KT9A 2WS3A 3RLFF 5L3DB 2V6YA 4PFPA 5AQRB 4PNIA 1LKXA 3CX7B 4CN4A 2BG9E 1WRDA 2XQ8A 4QH1A 3IHRA 3N9PA 4ZZBA 3ZYLA 5FMNA 1HG5A 3EABA 2WZIA 2JQKA 1WR6A 5L3EB 5AQHB 3L8RA 4F6RC 2VL0A 4G63A 1QLBA 4U3CA 2LLYA 2QRXA 4JEUB 1HNXT 1ZEEA 3I9YA 2A3DA 5LMNT 4X64T 1XNQT 3AXJA 1HNZT 1WYCA 3KVBA 3MACA 3ZMZB 1BR4A 5C8YE 3AECA 4HFCA 4O2AE 4K0KT 2PBIA 3NWIA 1EZ3A 2BDEA 3TLWA 1H7CA 4DV5T 3EDUA 4HKAA 1WLXA 4E7ZA 3RRCA 4AQYT 5F8PA 3ZMVB 4PW8A 3AEGA 4DV1T 5ADXL 1YW0A 3JAFA 4ZS2A 3KDSE 4YJ2E 2V8SV 5LNKA 4N78D 4HGAA 3AEBA 4TWDA 4HFEA 2UXCT 2YOEA 2KWHA 3AEFA 4LF4T 2YDRA 3QUJA 2W66A 3I0OA 4LFBT 1OWAA 3OVUA 1W09A 5JREA 5ABFB 4FI5A 3RQWA 5AQJB 2DNXA 3UUXB 1R8IA 3LDQB 1UK5A 5LGNB 4EEDA 2NW7A 1Z0PA 2LOSA 3AB3B 4QXCB 3L3PA 5FVKA 2FBWA 1KNZA 4JI1T 1MIYA 2WDQA 5L3GB 3AA7B 2CE7A 4OFZA 3S4UA 3RC8A 2W0GA 2DWKA 2PJQA 2JJ9A 3H3AA 4EXTA 4U31A 4YTMA 2CBIA 3AE1A 2J4GA 3CWZB 4ZOLE 2DCFA 1B7TA 5J0ZA 3AE8A 4LF5T 2E2AA 2LKGA 2WP9A 5A1LA 3T1HT 3P4RA 4TX5A 3Q5WA 4U2YA 2E9XB 5FY0A 1SUMB 1KNRA 1J5ET 3LSVA 5H6RB 3JAEA 2ODUA 3B13A 4O8SA 2EHOB 3KBUA 5FKYA 4A98A 3SWHA 3EUHA 2HPJA 3PUZF 2Q9QB 4WBOA 4AQFC 5FP3A 2MBGA 2RPAA 4TV8E 4DV2T 4O2BE 2E9XC 2YINA 4BAYB 3MXZA 3PUGA 2XQYA 3LBXA 3AAAB 3I9WA 5CA1E 5LG3A 2IAKA 3ETVA 3MA9A 3OYXA 2WWVA 1D0XA 4PK5A 4AIUA 3CVRA 2Q9QC 1D1AA 1NEKA 4JI0T 2H7VC 2X0YA 3P7IA 3RYCE 5HCJA 1V9DA 5JDLA 2B1EA 3WI3A 4H9QC 4A56A 3ESLA 1N34T 4XBFB 5L47A 3ZT6A 5H6QB 5FY1A 4MLKA 4EGWA 2DWGA 2CMRA 3HKDE 4IDNA 4CI1B 3ZSTA 3EI0A 4KX6A 3TLVA 5HEJA 4F8HA 4MHCA 5LBQB 2XQ9A 5JR9C 3JCFA 2A2FX 5C3JA 2QGSA 4Z90A 4TNWA 2VURA 2V1DB 4UIGA 3N9QA 2A72A 5HWXA 3K8PC 4P1NA 3QK6A 2X0LB 2VL8A 2JMKA 2WMOA 2Q9QD 3PU3A 4B6XA 3HKBE 4YLHA 1UURA 5JDHA 4DR3T 3ONLC 2DL1A 2ZM2A 4ERRA 1HG2A 2YEVC 1XNRT 5F5WA 3V5UA 2I0MA 4A97A 3PTRB 4DMWA 3H3MA 3KV6A 1U4QA 1T8BA 4GOUA 2W63A 3CMLA 4UF0B 5JDNA 1UCUA 3P4WA 2LSKA 2UUBT 2K5BB 2BG9A 2JQHA 2XM2A 3FZLB 4EAHA 2SPCA 3AAIA 2H3RA 2YKSA 4LFCT 3ZMTB 5LMUT 2LKHA 4PAGA 4AKLA 1BR1A 4B3TT 4UR9A 5BMVE 4IE6A 4YSZA 3QC9A 4HFDA 1T7SA 3RH3A 3K3QC 3U78A 5AFUL 3RGLA 4YTPA 1M7KA 2VASA 2BVMA 2CRBA 2VK9A 3NVOA 4NUVA 2V26A 4QKNA 3NBXX 3ZYKA 2MYSA 4AKIA 5AQVB 4MALA 5CA0E 4ZI2C 2X9WA 3A8YC 4OYJA 5HXEA 1MMAA 1YD8G 2LHNA 3ZEFB 3VRBA 4EIWA 3H37A 2MAWA 3NZQA 5IWAT 2WCAA 5AQSB 2N9DA 2R6GF 3ONXA 2CHOA 5F3JA 4IDZA 3C51A 4H9OC 4IE5A 4O4JE 4DIDB 2YN6A 4PJMA 2ES0A 2QA7A 4HFVA 1D1BA 3UFGA 4QX7B
chains in the Genus database with same CATH topology
5BR8T 1N34T 4DV5T 3T1YT 4AQYT 4B3RT 4B3TT 4DUYT 4JI8T 2UXDT 4DV1T 4DV6T 2VQFT 4GKKT 4LF5T 4DR5T 4B3MT 1FJGT 4JI4T 4YY3T 4X65T 4LF8T 3T1HT 4KHPT 4X62T 4NXMT 1N33T 4DR1T 1HNWT 1I94T 4DV4T 2UXCT 4DV3T 1J5ET 4JI3T 2UXBT 4LF4T 2HHHT 1IBLT 4LFBT 4DR2T 4DV0T 4B3ST 4DR7T 4OX9T 3OTOT 2VQET 4JI6T 4DUZT 4DV2T 2ZM6T 2F4VT 4DR3T 4JI7T 2E5LT 2UUAT 5IWAT 1XNRT 1HNXT 4DV7T 4JI2T 5LMNT 4DR4T 4X66T 4X64T 4LF6T 1IBMT 2UUCT 4YHHT 1XNQT 4JYAT 1XMQT 4JV5T 1XMOT 4LF7T 1HNZT 4LFAT 4JI1T 4LF9T 2UUBT 1N32T 1HR0T 4NXNT 4JI0T 4JI5T 4K0KT 2UU9T 4DR6T 4LFCT 1IBKT 4GKJT 5LMUT 1N36T
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5BR8 T;  1N34 T;  4DV5 T;  3T1Y T;  4AQY T;  4B3R T;  4B3T T;  4DUY T;  4JI8 T;  2UXD T;  4DV1 T;  4DV6 T;  2VQF T;  4GKK T;  4LF5 T;  4DR5 T;  4B3M T;  1FJG T;  4JI4 T;  4YY3 T;  4X65 T;  4LF8 T;  3T1H T;  4KHP T;  4X62 T;  4NXM T;  1N33 T;  4DR1 T;  1HNW T;  1I94 T;  4DV4 T;  2UXC T;  4DV3 T;  1J5E T;  4JI3 T;  2UXB T;  4LF4 T;  2HHH T;  1IBL T;  4LFB T;  4DR2 T;  4DV0 T;  4B3S T;  4DR7 T;  4OX9 T;  3OTO T;  2VQE T;  4JI6 T;  4DUZ T;  4DV2 T;  2ZM6 T;  2F4V T;  4DR3 T;  4JI7 T;  2E5L T;  2UUA T;  5IWA T;  1XNR T;  1HNX T;  4DV7 T;  4JI2 T;  5LMN T;  4DR4 T;  4X66 T;  4X64 T;  4LF6 T;  1IBM T;  2UUC T;  4YHH T;  1XNQ T;  4JYA T;  1XMQ T;  4JV5 T;  1XMO T;  4LF7 T;  1HNZ T;  4LFA T;  4JI1 T;  4LF9 T;  2UUB T;  1N32 T;  1HR0 T;  4NXN T;  4JI0 T;  4JI5 T;  4K0K T;  2UU9 T;  4DR6 T;  4LFC T;  1IBK T;  4GKJ T;  5LMU T;  1N36 T; 
#chains in the Genus database with same CATH topology
 2LM2 A;  2X68 A;  2W62 A;  4Z91 A;  2V5C A;  3U3I A;  2XQ4 A;  5EK4 A;  4ILC A;  1MMG A;  2ZMA A;  3CQG B;  4LMJ A;  4X5T A;  4ZI2 D;  2Y8D A;  2OLT A;  3ONJ A;  3ZYM A;  4AQG A;  3C4Z A;  3AA1 B;  1IJ5 A;  2FJE A;  4JI4 T;  2WZH A;  1M62 A;  2Y6X A;  2WU5 A;  3AEE A;  3ZN1 B;  1XDO A;  1FEW A;  4QWN B;  5AQK B;  3N5L A;  1E7P A;  4K0U A;  2NTY A;  3HL6 A;  4ZI7 E;  4UXN B;  3HKC E;  2RP4 A;  3UU3 A;  1IJ6 A;  2XHE B;  4ILU A;  1IAP A;  3LG7 A;  2CWO A;  2D0T A;  5LYJ E;  1HCI A;  4BJN A;  1MIW A;  3AE6 A;  2NTX A;  2VKO A;  5KMG P;  1YKH B;  2K24 A;  5J1G A;  2XTL A;  4U33 A;  2XSB A;  3WAJ A;  5KDM C;  5HXH A;  5FL1 A;  3SOL A;  4ILB A;  4JI7 T;  2L9Q A;  3IEE A;  4H9N C;  1HX1 B;  3AAE B;  2XY8 B;  1X9B A;  3FBL A;  2WBL A;  2HN1 A;  3RX6 A;  3FXD B;  4JYA T;  2D2S A;  2BS3 A;  4XZC A;  2WQY A;  2JPF A;  4CXW A;  3EVY A;  1WR0 A;  3LK2 B;  3HI2 A;  5LJN A;  2MOZ A;  3A7M A;  3UUB A;  3E08 A;  2VKD A;  2G0U A;  4X20 E;  5CJ5 A;  4GKJ T;  4EYY R;  3TKL B;  1N36 T;  3RKG A;  3PUW F;  4CZZ B;  2L8K A;  2B76 A;  4UEM A;  2WSS V;  2IIU A;  2AE9 A;  1UX5 A;  5LHH B;  3PUR A;  2KWI B;  4KMC A;  3O1I A;  3GA8 A;  3OKQ A;  4UVA B;  4AKG A;  4ZHQ E;  4NXM T;  3GWH A;  4IHJ E;  3QNU A;  1I94 T;  5CB4 E;  2YU1 A;  3ZC1 A;  4DV4 T;  4QHO A;  1KF6 A;  4X1I E;  4C90 A;  5M4Y A;  2VKJ A;  3JC6 C;  1XWM A;  2V6X A;  5HEG A;  1GQE A;  3ZCJ A;  5JH7 E;  4B3S T;  4JI6 T;  4PJJ A;  3N9N A;  2IML A;  4ISS A;  2F4V T;  1E1H B;  4YTN A;  2XSA A;  2XAQ B;  3KFW X;  2V7J A;  4O4H E;  2PFV A;  3AE5 A;  3EDV A;  3AED A;  3R84 B;  2BZB A;  1XMO T;  3OJA A;  1D0Y A;  2X67 A;  5ABE A;  3MZK B;  3J7Y q;  3ANW B;  4P0B A;  4GYS A;  3ZSS A;  3KV9 A;  3UU5 A;  1MIV A;  5LP6 E;  4EYU A;  2YU2 A;  2BKP A;  4YSX A;  3CK6 A;  3JC6 D;  3P4P A;  2BBJ A;  4IE0 A;  3RF1 A;  4V1A v;  3Q5E A;  4HWH A;  3UU6 A;  2LRK A;  3QB5 K;  3QOF A;  3K1S A;  3PUS A;  4LF8 T;  3MKD A;  1WFD A;  3FBZ A;  4X62 T;  4DND A;  3IBP A;  5DAB A;  4TN7 B;  5ABF A;  3PDY A;  3HR0 A;  2CWY A;  2HHH T;  1KEY A;  3RPU A;  5EK2 A;  3UQ4 A;  5HXS A;  2JIW A;  5JDQ A;  3TLS A;  3C4X A;  4JUY A;  1S35 A;  2WU2 A;  3CPZ A;  2VKH A;  5L3F B;  4IL9 A;  5HWY A;  2X66 A;  3VKH A;  4TWF A;  3F31 A;  3AVS A;  4X1K E;  3UQ7 A;  5IUX A;  2W61 A;  3AE3 A;  4C91 A;  3RYH E;  5HYA A;  2X9X A;  2C5J A;  3CX8 B;  5L4H A;  4GK5 E;  3G06 A;  5LB7 B;  3RHW A;  2V7K A;  3KV5 A;  4J2C A;  5LJM A;  1LRZ A;  5FYM A;  4HN9 A;  4NIQ A;  4FJO A;  4AQF A;  3OBV E;  2RA1 A;  3GN5 B;  2E9X A;  2YK0 A;  2XUE A;  2IDO B;  4U7I A;  5JRC B;  2VVN A;  3BQL A;  5JR9 B;  1YQ3 A;  4ILA A;  1W0B A;  4HWF A;  2EHO A;  3OYZ A;  2WY2 A;  2XAH B;  4ZEY A;  1E2A A;  3FZM B;  2Q9Q A;  4L5G A;  2YDQ A;  2IUB A;  3M65 A;  1SE7 A;  5AQP B;  3N9O A;  2KMF A;  4TZ4 C;  2XAF B;  3L09 A;  4DV0 T;  4UVB B;  3UU8 A;  3OTO T;  4YHJ A;  3Q9D A;  1ZV4 X;  4HEA A;  4PJN A;  4L0R A;  4H63 H;  2NOX A;  1MMN A;  5L3C B;  3VKG A;  5JR9 A;  3LK3 B;  4LF6 T;  2KXP B;  4XAX B;  1IBM T;  2UUC T;  2W00 A;  4OYK A;  3O1J A;  2K48 A;  3CQC B;  1JNZ A;  2VB6 A;  3RYI E;  1CHU A;  3AE4 A;  2QYW A;  2M6B A;  3PUY F;  2CBJ A;  4IGU A;  2BKO A;  3ZN0 B;  4ADZ A;  1US7 B;  4JLE A;  3UUN A;  3PV0 F;  3FHN A;  5FL0 A;  1HX8 A;  4GK0 E;  5AQN B;  3ZJ1 A;  2N2N A;  1J5W A;  2UXD T;  2LSG A;  3KIN B;  3LFM A;  5JVD E;  5AQF B;  1D0Z A;  4WBN E;  3HA4 A;  4WYV A;  2E8I A;  1XDP A;  3ZMS B;  3SFE A;  4EEB A;  3RYF E;  1S94 A;  2ODV A;  4YFS A;  5ABG A;  2WDV A;  3N2K E;  2NWB A;  3O9X A;  3B5M A;  4I43 B;  1JNR A;  4TNV A;  1OED B;  3RKO A;  2ZLY A;  4IL4 A;  2L3L A;  5FVL A;  2AXD S;  1L0V A;  3UTK A;  3RC3 A;  2OA5 A;  4UF0 A;  3N9M A;  2NR4 A;  2E5L T;  1SHZ C;  5ABH A;  1YKE B;  2CHN A;  1OED C;  4AKH A;  4UV9 B;  2XPK A;  3P4Q A;  3UUL A;  3K3N A;  4YHH T;  1VCS A;  4E7S A;  2XZE A;  3EHZ A;  4PFO A;  4LF7 T;  4I55 E;  4COF A;  1ZHC A;  3KVA A;  3NZP A;  4DVD A;  1QUU A;  5FNV E;  3BQI A;  2WM9 A;  3L39 A;  3ZMU B;  4Q25 A;  3W15 B;  4GYR A;  2BVL A;  2BBH A;  3NKZ A;  5HEH A;  3D0T A;  5AQL B;  4DBQ A;  3OPC A;  2VQF T;  3VR8 A;  3BQK A;  2HPL A;  2C5I T;  1ZP0 A;  2H89 A;  4ASK A;  2M67 A;  3Q2M A;  4UEL A;  2W4X A;  2V6Y B;  2ZM0 A;  3PJA J;  2FJA A;  3RIU C;  2KSR A;  3FB2 A;  3PUQ A;  3SRZ A;  3CKD A;  4QX8 B;  2XQ5 A;  3FZH B;  2W2U A;  4IDQ A;  3A5X A;  2X0H A;  2CM0 A;  2LRL A;  3AA0 B;  4KUM B;  2FJD A;  4U74 A;  3UUM A;  4YT0 A;  1J1J A;  4ZS3 A;  3IF8 B;  4WW0 A;  3C4W A;  2A9U A;  2VVS A;  4HWC A;  4NXN T;  3P50 A;  2M6I A;  5AQI B;  3KBT A;  3AXJ B;  2LSI A;  5AQU B;  4U72 A;  5LXT E;  1FMW A;  5JQG E;  3FXE B;  4X1Y E;  3RRW A;  2XAG B;  4OHF A;  4QXH B;  4DBR A;  3RI5 A;  5HEO A;  4ZI3 C;  3PUV F;  3F2E A;  4G2A A;  1IZN B;  1SA0 E;  3C50 A;  4HE8 A;  4DO0 A;  4X65 T;  2WAU A;  3C98 B;  2ZM8 A;  2LOP A;  3CQX C;  2HN2 A;  4DMV A;  1UX4 A;  2XAJ B;  4I50 E;  3TLU A;  1KFY A;  5L3B B;  4KP3 C;  4O4I E;  5JDM A;  3IA3 A;  3ZT5 A;  1I6Z A;  4IE7 A;  4WNK A;  2NW9 A;  1IBL T;  5LHG B;  2H88 A;  3SS1 A;  4TV9 E;  2BS2 A;  4H9R C;  5AQM B;  1OED E;  1D1C A;  2V7L A;  3BK9 A;  4BJM A;  3Q5X A;  1HTJ F;  4CN1 A;  2D9D A;  3FZK B;  3N2G E;  4DR4 T;  3P8C D;  4GIW A;  4ZI3 D;  1XMQ T;  2DHR A;  4HWI B;  4EZH A;  4UV8 B;  1MNE A;  2XQ6 A;  3DJB A;  3DP7 A;  4LF9 T;  1N32 T;  4KBM B;  1HR0 T;  2E5V A;  4HFB A;  2XAS B;  4DR6 T;  5L4E A;  1HFA A;  2X9Y A;  5BR8 T;  3AE2 A;  2V5D A;  3ZT7 A;  1W0A A;  3C64 A;  3ETU A;  3CX6 B;  2CXL A;  2XQ7 A;  2CEA A;  2LM9 A;  1LVK A;  3PJA A;  3KV4 A;  1WCR A;  5TAO A;  4I0U A;  3VRA A;  4B3M T;  5HCM A;  3EAM A;  4CQI A;  1W9R A;  2CCQ A;  2W67 A;  1N33 T;  2GK9 A;  4YXD A;  4DR1 T;  2V7M A;  5JTG A;  4LML A;  5CFB A;  1DU2 A;  4CXX A;  4KI0 F;  5HAX A;  4DV3 T;  4PJL A;  2K3W A;  3UFE A;  2H7O A;  3QB5 A;  2JQ9 A;  2LSJ A;  2D0U A;  2JMH A;  5J2U E;  3SFD A;  4QH4 A;  2J62 A;  2I59 A;  5DJQ C;  4EB6 E;  5FXW A;  3M3Z B;  2DLR A;  3O1H A;  4P09 A;  5J2T E;  3AE9 A;  1MMD A;  4JBW F;  2KND A;  1FMV A;  3PUX F;  4P0A A;  2IC6 A;  3ANW A;  3HKE E;  4IE4 A;  2DI4 A;  2MTQ A;  2LHR A;  2UXN B;  1UUS A;  4X66 T;  5AQO B;  4ZZC A;  3AE7 A;  5GON E;  3N2O A;  3ABV A;  4U2Z A;  4UVC B;  3AEA A;  1VOM A;  3RIA A;  4I4T E;  4LFA T;  2X51 A;  3LBX B;  2FJB A;  2CPT A;  1QSD A;  3NRX A;  2WWU A;  1IBK T;  1KK7 A;  4CI3 B;  4NUU A;  2JQQ A;  2J47 A;  1UGO A;  3T1Y T;  1G8X A;  3I0Q A;  4JI8 T;  4PK4 A;  5LHI B;  2XQ3 A;  1FIO A;  1FJG T;  3F57 A;  4CXY A;  4YY3 T;  5HXR A;  1HNW T;  2LT3 A;  1Z8U A;  4EOZ B;  3P4S A;  3E22 E;  4YJ3 E;  3VU7 H;  5LGU B;  2QVA A;  4QH5 A;  3R6N A;  2C0S A;  5CGM A;  3O4X E;  3E0Z A;  2EHO C;  4TUY E;  2HH7 A;  2I6H A;  4DR7 T;  2VQE T;  4MBQ A;  2ZM6 T;  5FXV A;  3ZJ2 A;  3WAK A;  2WB5 A;  3MJX A;  4DV7 T;  3LK4 2;  4WZX A;  2C5K T;  4HWD A;  3PUA A;  4IDP A;  4NPP A;  5JDG A;  3GN5 A;  2CLY B;  4EZ4 A;  3DTO A;  3RIF A;  1ZKE A;  3Q5D A;  2WDR A;  1T98 A;  5JDF A;  5HEU A;  2UU9 T;  5JRC A;  5EK3 A;  2N1G A;  4LMK A;  2E9X D;  3ZKR A;  5L2L A;  1AJ3 A;  3FZF B;  2BG9 B;  2LE8 A;  4CI2 B;  2J1D G;  4EV6 A;  5LCY A;  1BR0 A;  1XZY A;  4DV6 T;  1T72 A;  2VWA A;  4IRE A;  5LGT B;  4HFI A;  2EHO D;  2JRK A;  3UT5 E;  2CLY C;  1YXR A;  3LJC A;  4AIS A;  2YDS A;  1NEN A;  2V7I A;  4IDO A;  3AA6 B;  3ZPO A;  1O3X A;  1NAF A;  2LSY A;  1MND A;  5FY7 A;  2XJ7 A;  3VHL A;  2BG9 C;  5AQT B;  2XM1 A;  2P9B A;  5EZY E;  3PE0 A;  4DR2 T;  2FUP A;  5IYZ E;  2D5U A;  2KIN B;  5IHY A;  4CN6 A;  3UU4 A;  4OK0 A;  4ANJ A;  4DUZ T;  4IIJ E;  3I1A A;  3N9L A;  4ZXL A;  1KNP A;  4O4L E;  4BA9 A;  4JI2 T;  1Y01 A;  2CA5 A;  2PG8 A;  1NWM X;  3B57 A;  3VR9 A;  4JV5 T;  5FXX A;  5AQG B;  3ZC0 A;  2WMN A;  3GMI A;  3ZCI A;  2IC9 A;  1HF8 A;  3J9X 1;  4HTE A;  4JI5 T;  5DQW A;  4AXP A;  4H63 V;  4QXB B;  5FXZ A;  3MK7 C;  2KLQ A;  4L9I A;  4B3R T;  2NP9 A;  1OXZ A;  1OED A;  4GKK T;  4DR5 T;  2LEH A;  2ACX A;  1LVF A;  2OV9 A;  1YQ4 A;  4KHP T;  3ZLI A;  2LJL A;  2BKN A;  3K3O A;  3TLT A;  3RQU A;  4JI3 T;  2CXD A;  1Y64 B;  2XQA A;  3T8O A;  2IHR 1;  5LG4 A;  2UXB T;  2X9H A;  2CXF A;  2Z6E A;  2Y48 B;  4U7Y A;  2BS4 A;  5E0O A;  2ACZ A;  4H9P C;  4A5X A;  3JAD A;  4OX9 T;  1VCT A;  4H9S E;  2UXX B;  4Z8X A;  2PTF A;  3AVR A;  4TWH A;  3PU8 A;  1G73 A;  5LOV E;  1ZOY A;  2UUA T;  2MPK A;  4AKR B;  2IW5 B;  4IST A;  3NRY A;  4PK6 A;  5HXC A;  5C2T A;  1WYB A;  4HFH A;  2NW8 A;  4IT4 A;  1CUN A;  3RIU A;  5DQV A;  5LBM A;  4KHZ F;  2KZ7 B;  5LA6 E;  5AQQ B;  4MFR A;  4YSY A;  4M1P A;  1HS7 A;  5KX5 E;  5KXJ A;  3CIR A;  2K9A A;  1X79 A;  1BR2 A;  3X1D A;  1VRB A;  3V5S A;  4JEH B;  1U5P A;  4AI6 A;  5ETW A;  4DUY T;  2KT9 A;  2WS3 A;  3RLF F;  5L3D B;  2V6Y A;  4PFP A;  5AQR B;  4PNI A;  1LKX A;  3CX7 B;  4CN4 A;  2BG9 E;  1WRD A;  2XQ8 A;  4QH1 A;  3IHR A;  3N9P A;  4ZZB A;  3ZYL A;  5FMN A;  1HG5 A;  3EAB A;  2WZI A;  2JQK A;  1WR6 A;  5L3E B;  5AQH B;  3L8R A;  4F6R C;  2VL0 A;  4G63 A;  1QLB A;  4U3C A;  2LLY A;  2QRX A;  4JEU B;  1HNX T;  1ZEE A;  3I9Y A;  2A3D A;  5LMN T;  4X64 T;  1XNQ T;  3AXJ A;  1HNZ T;  1WYC A;  3KVB A;  3MAC A;  3ZMZ B;  1BR4 A;  5C8Y E;  3AEC A;  4HFC A;  4O2A E;  4K0K T;  2PBI A;  3NWI A;  1EZ3 A;  2BDE A;  3TLW A;  1H7C A;  4DV5 T;  3EDU A;  4HKA A;  1WLX A;  4E7Z A;  3RRC A;  4AQY T;  5F8P A;  3ZMV B;  4PW8 A;  3AEG A;  4DV1 T;  5ADX L;  1YW0 A;  3JAF A;  4ZS2 A;  3KDS E;  4YJ2 E;  2V8S V;  5LNK A;  4N78 D;  4HGA A;  3AEB A;  4TWD A;  4HFE A;  2UXC T;  2YOE A;  2KWH A;  3AEF A;  4LF4 T;  2YDR A;  3QUJ A;  2W66 A;  3I0O A;  4LFB T;  1OWA A;  3OVU A;  1W09 A;  5JRE A;  5ABF B;  4FI5 A;  3RQW A;  5AQJ B;  2DNX A;  3UUX B;  1R8I A;  3LDQ B;  1UK5 A;  5LGN B;  4EED A;  2NW7 A;  1Z0P A;  2LOS A;  3AB3 B;  4QXC B;  3L3P A;  5FVK A;  2FBW A;  1KNZ A;  4JI1 T;  1MIY A;  2WDQ A;  5L3G B;  3AA7 B;  2CE7 A;  4OFZ A;  3S4U A;  3RC8 A;  2W0G A;  2DWK A;  2PJQ A;  2JJ9 A;  3H3A A;  4EXT A;  4U31 A;  4YTM A;  2CBI A;  3AE1 A;  2J4G A;  3CWZ B;  4ZOL E;  2DCF A;  1B7T A;  5J0Z A;  3AE8 A;  4LF5 T;  2E2A A;  2LKG A;  2WP9 A;  5A1L A;  3T1H T;  3P4R A;  4TX5 A;  3Q5W A;  4U2Y A;  2E9X B;  5FY0 A;  1SUM B;  1KNR A;  1J5E T;  3LSV A;  5H6R B;  3JAE A;  2ODU A;  3B13 A;  4O8S A;  2EHO B;  3KBU A;  5FKY A;  4A98 A;  3SWH A;  3EUH A;  2HPJ A;  3PUZ F;  2Q9Q B;  4WBO A;  4AQF C;  5FP3 A;  2MBG A;  2RPA A;  4TV8 E;  4DV2 T;  4O2B E;  2E9X C;  2YIN A;  4BAY B;  3MXZ A;  3PUG A;  2XQY A;  3LBX A;  3AAA B;  3I9W A;  5CA1 E;  5LG3 A;  2IAK A;  3ETV A;  3MA9 A;  3OYX A;  2WWV A;  1D0X A;  4PK5 A;  4AIU A;  3CVR A;  2Q9Q C;  1D1A A;  1NEK A;  4JI0 T;  2H7V C;  2X0Y A;  3P7I A;  3RYC E;  5HCJ A;  1V9D A;  5JDL A;  2B1E A;  3WI3 A;  4H9Q C;  4A56 A;  3ESL A;  1N34 T;  4XBF B;  5L47 A;  3ZT6 A;  5H6Q B;  5FY1 A;  4MLK A;  4EGW A;  2DWG A;  2CMR A;  3HKD E;  4IDN A;  4CI1 B;  3ZST A;  3EI0 A;  4KX6 A;  3TLV A;  5HEJ A;  4F8H A;  4MHC A;  5LBQ B;  2XQ9 A;  5JR9 C;  3JCF A;  2A2F X;  5C3J A;  2QGS A;  4Z90 A;  4TNW A;  2VUR A;  2V1D B;  4UIG A;  3N9Q A;  2A72 A;  5HWX A;  3K8P C;  4P1N A;  3QK6 A;  2X0L B;  2VL8 A;  2JMK A;  2WMO A;  2Q9Q D;  3PU3 A;  4B6X A;  3HKB E;  4YLH A;  1UUR A;  5JDH A;  4DR3 T;  3ONL C;  2DL1 A;  2ZM2 A;  4ERR A;  1HG2 A;  2YEV C;  1XNR T;  5F5W A;  3V5U A;  2I0M A;  4A97 A;  3PTR B;  4DMW A;  3H3M A;  3KV6 A;  1U4Q A;  1T8B A;  4GOU A;  2W63 A;  3CML A;  4UF0 B;  5JDN A;  1UCU A;  3P4W A;  2LSK A;  2UUB T;  2K5B B;  2BG9 A;  2JQH A;  2XM2 A;  3FZL B;  4EAH A;  2SPC A;  3AAI A;  2H3R A;  2YKS A;  4LFC T;  3ZMT B;  5LMU T;  2LKH A;  4PAG A;  4AKL A;  1BR1 A;  4B3T T;  4UR9 A;  5BMV E;  4IE6 A;  4YSZ A;  3QC9 A;  4HFD A;  1T7S A;  3RH3 A;  3K3Q C;  3U78 A;  5AFU L;  3RGL A;  4YTP A;  1M7K A;  2VAS A;  2BVM A;  2CRB A;  2VK9 A;  3NVO A;  4NUV A;  2V26 A;  4QKN A;  3NBX X;  3ZYK A;  2MYS A;  4AKI A;  5AQV B;  4MAL A;  5CA0 E;  4ZI2 C;  2X9W A;  3A8Y C;  4OYJ A;  5HXE A;  1MMA A;  1YD8 G;  2LHN A;  3ZEF B;  3VRB A;  4EIW A;  3H37 A;  2MAW A;  3NZQ A;  5IWA T;  2WCA A;  5AQS B;  2N9D A;  2R6G F;  3ONX A;  2CHO A;  5F3J A;  4IDZ A;  3C51 A;  4H9O C;  4IE5 A;  4O4J E;  4DID B;  2YN6 A;  4PJM A;  2ES0 A;  2QA7 A;  4HFV A;  1D1B A;  3UFG A;  4QX7 B; 
#chains in the Genus database with same CATH homology
 5BR8 T;  1N34 T;  4DV5 T;  3T1Y T;  4AQY T;  4B3R T;  4B3T T;  4DUY T;  4JI8 T;  2UXD T;  4DV1 T;  4DV6 T;  2VQF T;  4GKK T;  4LF5 T;  4DR5 T;  4B3M T;  1FJG T;  4JI4 T;  4YY3 T;  4X65 T;  4LF8 T;  3T1H T;  4KHP T;  4X62 T;  4NXM T;  1N33 T;  4DR1 T;  1HNW T;  1I94 T;  4DV4 T;  2UXC T;  4DV3 T;  1J5E T;  4JI3 T;  2UXB T;  4LF4 T;  2HHH T;  1IBL T;  4LFB T;  4DR2 T;  4DV0 T;  4B3S T;  4DR7 T;  4OX9 T;  3OTO T;  2VQE T;  4JI6 T;  4DUZ T;  4DV2 T;  2ZM6 T;  2F4V T;  4DR3 T;  4JI7 T;  2E5L T;  2UUA T;  5IWA T;  1XNR T;  1HNX T;  4DV7 T;  4JI2 T;  5LMN T;  4DR4 T;  4X66 T;  4X64 T;  4LF6 T;  1IBM T;  2UUC T;  4YHH T;  1XNQ T;  4JYA T;  1XMQ T;  4JV5 T;  1XMO T;  4LF7 T;  1HNZ T;  4LFA T;  4JI1 T;  4LF9 T;  2UUB T;  1N32 T;  1HR0 T;  4NXN T;  4JI0 T;  4JI5 T;  4K0K T;  2UU9 T;  4DR6 T;  4LFC T;  1IBK T;  4GKJ T;  5LMU T;  1N36 T; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...