1N32T

Structure of the thermus thermophilus 30s ribosomal subunit bound to codon and near-cognate transfer rna anticodon stem-loop mismatched at the first codon position at the a site with paromomycin
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
99
structure length
99
Chain Sequence
b'RNLSALKRHRQSLKRRLRNKAKKSAIKTLSKKAIQLAQEGKAEEALKIMRKAESLIDKAAKGSTLHKNAAARRKSRLMRKVRQLLEAAGAPLIGGGLSA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S RIBOSOMAL RNA
molecule tags Ribosome
publication title Selection of tRNA by the Ribosome Requires a Transition from an Open to a Closed Form
pubmed doi rcsb
total genus 34
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 2002-10-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
T PF01649 Ribosomal_S20p Ribosomal protein S20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.110 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Ribosomal protein S20 1n32T00
2UU9T 1HNWT 4JI5T 1IBKT 2UXDT 1N36T 1XNRT 4KHPT 1N32T 1J5ET 2UUCT 4X65T 2UUAT 4OX9T 4JI0T 2UXBT 2VQET 3T1YT 2UXCT 4YY3T 1IBMT 4NXNT 4GKJT 4JI8T 4GKKT 1XMQT 5IWAT 4DV5T 4LFAT 2HHHT 4DR4T 1HNXT 4JI2T 4AQYT 4JYAT 4DV3T 4X64T 4DUZT 4DV0T 1XMOT 4LF6T 4LF7T 4DR1T 4JI3T 4YHHT 4JI7T 1FJGT 4DR2T 4LF5T 3OTOT 4JI1T 2VQFT 4LF8T 4B3MT 4NXMT 4DV7T 4DR5T 4B3ST 5LMUT 4LFCT 4LFBT 4DV6T 1N34T 1HNZT 4DR7T 1IBLT 2E5LT 4LF4T 4X62T 1N33T 5BR8T 4DR6T 4DV4T 4DV1T 4JI4T 4LF9T 2UUBT 1XNQT 4B3RT 4JI6T 2F4VT 4DUYT 3T1HT 1I94T 4K0KT 2ZM6T 1HR0T 4DV2T 4DR3T 4JV5T 4B3TT 5LMNT 4X66T
chains in the Genus database with same CATH superfamily
1HS7A 2UU9T 4P09A 4E7ZA 3ZC1A 5HCMA 1MIWA 2XAHB 2M6IA 3UULA 5LGUB 4ZHQE 2UXDT 3H3MA 3RYHE 1FIOA 2CPTA 3QB5K 1XNRT 2V6YB 4GYRA 2KINB 4UXNB 4Q25A 3EAMA 3PTRB 4M1PA 4O4IE 2FJEA 1OWAA 2V7KA 5ETWA 2DL1A 4AQFC 4ZI3D 3N5LA 5HXSA 5CA0E 2UUCT 4TN7B 2ODVA 4MFRA 4UVBB 4V1Av 2G0UA 4ZS3A 3SOLA 1VRBA 2LSJA 3Q9DA 3RF1A 5AQGB 3TLWA 5HEHA 3ZCJA 4QH4A 3ZYKA 3ZT6A 3O1HA 4ADZA 2YOEA 4AKLA 5LG3A 5HXRA 3PE0A 1D1CA 1YQ3A 4U7YA 3AA6B 1WLXA 3ZMUB 3T1YT 4YT0A 5TAOA 3CWZB 3CX7B 2FJAA 3P4RA 1VOMA 3ZJ2A 2MTQA 3P4WA 5ABGA 2BBJA 1KNRA 1ZHCA 3AVSA 4U33A 4CI2B 3IF8B 3I9WA 1XMQT 3LG7A 5LA6E 1AJ3A 1KEYA 4KHZF 2YDRA 1XWMA 2FBWA 5AQLB 3N9NA 4LFAT 3O1JA 1G73A 3AE7A 3MXZA 3OKQA 4TZ4C 5LOVE 1QSDA 5L3FB 2HHHT 1N32T 5IHYA 2KXPB 3RYFE 3WAJA 4EAHA 2KLQA 3JADA 3CX8B 4AQYT 3GN5B 3IBPA 1D1BA 1ZEEA 2LJLA 5AQIB 3RH3A 3RPUA 1O3XA 3UU4A 3ONJA 1NENA 4DMWA 1KFYA 2I6HA 3RGLA 1D0XA 2XPKA 2V7IA 4AIUA 5LYJE 4E7SA 1V9DA 2WU5A 4JEUB 4MHCA 1MNEA 2K48A 3UU6A 4O2AE 4ILUA 4KBMB 4HFCA 4A5XA 4X66T 2BVLA 4O4HE 2M6BA 4DBRA 4IL9A 4QWNB 1Y64B 1FEWA 2L9QA 3MACA 2WMOA 3ZYLA 4U2ZA 2CE7A 3DTOA 2MAWA 1FJGT 1XZYA 4F8HA 2B76A 5JVDE 2Y8DA 3UU3A 4YJ2E 2EHOC 2GK9A 2VVNA 3ZN1B 2WB5A 3FHNA 3AE1A 3PJAJ 4UEMA 5IUXA 2C0SA 1I6ZA 5ADXL 4ZZCA 4CI1B 2WZIA 3UU8A 5JRCA 1SA0E 3BK9A 4BJMA 4B3MT 4PJJA 2WMNA 2JPFA 1LVFA 5FL1A 4GK0E 2LOPA 4L0RA 5F5WA 4YTNA 3AA1B 3K8PC 3NRXA 3AE4A 1QLBA 2MBGA 2W2UA 2XM1A 5LGNB 1HCIA 4UELA 4DR5T 4IREA 4DVDA 3KFWX 4HKAA 3ETUA 3FZMB 3P8CD 2KNDA 1YW0A 2XSAA 3I9YA 3KBTA 3ESLA 4U31A 5AQUB 3U3IA 4IE0A 4DV6T 5L4HA 2XQ7A 3A5XA 3DP7A 3EHZA 2XQAA 4UF0A 5FY1A 5AQRB 2FJBA 3VR9A 4COFA 1W09A 3M3ZB 5FVKA 2VB6A 3PU3A 2CEAA 2K3WA 3FB2A 4YLHA 1S94A 2A3DA 3T8OA 1M62A 2JQ9A 4H9RC 1XDPA 4OYJA 2EHOD 2MYSA 2WDVA 3AAAB 3AEDA 3GMIA 2BKPA 2KZ7B 5DQVA 4X62T 1HTJF 2HPJA 3N9QA 3KV6A 2DWKA 2L8KA 1UX5A 3JC6C 2X0HA 5HCJA 4LMJA 2VWAA 3RIUA 4CI3B 2NW9A 2BS4A 4IDQA 3ZKRA 5HWXA 2B1EA 2LHNA 3EUHA 4JI4T 3V5UA 4LF9T 1XNQT 4EIWA 3UUXB 2V7LA 4DUYT 3P4SA 2KSRA 5DABA 5LCYA 1VCSA 3OPCA 2V5DA 3P7IA 2AXDS 1T98A 3E08A 3MZKB 1WFDA 2I59A 3RYCE 3ZMTB 4DR3T 4JV5T 2LM2A 2NOXA 4ZI7E 2D5UA 5EK4A 2E2AA 2VK9A 3CPZA 3Q5EA 3OBVE 4X1KE 3UT5E 3TLSA 5FP3A 3K3NA 1BR1A 3LJCA 1HNWT 2JQKA 1R8IA 3PUZF 3TLVA 3ZT5A 4DNDA 2DNXA 2QRXA 5ABHA 1IBKT 5CGMA 1W0BA 5J2UE 4G2AA 4PJLA 2IDOB 2JMHA 4IIJE 1OEDB 1U4QA 3NBXX 2X68A 3CQXC 1HG2A 2E9XB 3IEEA 3MJXA 4HFBA 4I0UA 2VL0A 4OHFA 5ABEA 1NWMX 3ONLC 2CLYB 3PU8A 3JAEA 2XQ9A 4JI0T 2IMLA 3AEGA 3WAKA 2PG8A 3AEAA 1T72A 3EVYA 4I50E 4CQIA 3I1AA 2H88A 4UVAB 4ZEYA 2C5IT 2ODUA 2IUBA 3RX6A 4IDNA 4YY3T 2N1GA 4NXNT 1UGOA 1GQEA 3W15B 3J9X1 1HF8A 2IAKA 3AAEB 3B13A 1WYBA 4PJMA 3M65A 5JDLA 4JI8T 2SPCA 2X0YA 3LBXA 4GKKT 4QX8B 3LFMA 2VKOA 2V8SV 4X1YE 2KMFA 4P1NA 2CXFA 4ZS2A 5AQTB 3FXDB 2V1DB 5FNVE 3NKZA 3HR0A 3H3AA 4IDPA 2CXDA 4K0UA 3C4WA 3L39A 2V26A 5HEJA 3RC8A 1YKHB 4CXWA 4JI1T 4JI2T 4ERRA 1E2AA 2P9BA 3L8RA 4KX6A 3PUQA 3N2KE 2YN6A 4QXCB 2X51A 4CXXA 4EZHA 4DV3T 4JYAT 3G06A 2CBIA 2LEHA 5JRCB 4KUMB 1UURA 4PK6A 2KWIB 2XQ4A 2Y48B 3H37A 5HWYA 3PUVF 3L3PA 3N9MA 2D0TA 2QVAA 4YJ3E 4H9NC 3HKEE 1MNDA 3BQIA 1VCTA 2XQ6A 2PJQA 2QYWA 2L3LA 2X67A 2WWUA 4LF6T 4LF7T 5AQNB 1Z0PA 3QB5A 3FBLA 4DO0A 5KMGP 4YHHT 3ZCIA 2PFVA 2XJ7A 3ZPOA 3RRWA 1SE7A 4GK5E 4UF0B 2XQ8A 5A1LA 4LF5T 2V7MA 5ABFB 4A98A 2WCAA 2JIWA 5AQOB 3K1SA 3MK7C 3RIUC 2OLTA 3HI2A 4EOZB 2CBJA 2V6XA 3MKDA 4EXTA 1UUSA 3OYXA 5FL0A 5LBQB 2KWHA 4F6RC 4QX7B 3AEBA 4ZZBA 4HFIA 4HFDA 3RIFA 4NXMT 1MMDA 2JJ9A 1HX1B 1W9RA 2E5VA 3LK3B 4C90A 3EDVA 4TUYE 5LB7B 4EYYR 3PDYA 4WBNE 3BQLA 3C98B 1CHUA 3IA3A 4PK4A 4LFCT 1ZP0A 3LK2B 4QH5A 5J1GA 2C5JA 3ZEFB 5BMVE 4LFBT 2LT3A 2H7VC 5L3CB 3NRYA 2IIUA 2Q9QD 2W4XA 2WQYA 4NIQA 2V5CA 4DR7T 5JR9A 2VKHA 3DJBA 4U72A 4O4JE 5H6QB 3B5MA 4TWHA 2ZMAA 3NWIA 5CB4E 3GN5A 4YTMA 1KK7A 4YFSA 2JMKA 4ILBA 3UUBA 3AE8A 2W61A 5FXXA 2BKOA 2PBIA 2W66A 5EZYE 5JQGE 3KINB 4HGAA 4ZI3C 4YXDA 4CN4A 2IC9A 4PFOA 4B6XA 3C4ZA 5L4EA 4Z91A 4DR6T 4H9OC 1UX4A 2DLRA 2YK0A 1US7B 3AE5A 3JAFA 3F31A 3MA9A 4TWFA 2W62A 3RI5A 3SFDA 2UUBT 4B3RT 3UQ4A 4AI6A 3RQWA 3ETVA 5HXEA 3P4PA 5CA1E 1S35A 1YD8G 2UXXB 5EK2A 3ABVA 2W0GA 4JBWF 5LGTB 4DV2T 2ZM0A 4A56A 4GIWA 4GOUA 2VURA 4ZOLE 4UVCB 1OXZA 4HTEA 5LHHB 4AISA 3VU7H 2ZM8A 3AE6A 2Q9QB 2VASA 3HL6A 4JEHB 1IJ5A 4AKIA 2E9XD 4ZXLA 2LRLA 4CZZB 4TNWA 4CXYA 1CUNA 1UCUA 1J5WA 2XQ3A 3IHRA 4FI5A 1DU2A 3AE2A 4H9SE 2XM2A 3ONXA 1LVKA 2BDEA 5GONE 4JLEA 4OX9T 4XBFB 4HN9A 1YQ4A 3CMLA 2UXBT 3KV4A 3QOFA 1JNRA 2BS2A 3R84B 3VKGA 3RHWA 4YSYA 2VQET 3ZMZB 5KXJA 2J47A 2LE8A 2MOZA 3CQGB 3CVRA 2UXCT 3VR8A 5LJMA 4YHJA 1XDOA 2WU2A 4GKJT 4X5TA 4AXPA 1MMAA 3C4XA 4PAGA 3C64A 2BG9A 3RIAA 1WR0A 1WRDA 2ES0A 2OV9A 3ANWB 4N78D 2Y6XA 3HKBE 4O8SA 3UTKA 2FUPA 5CJ5A 3ZJ1A 5HYAA 2WDRA 3SRZA 3UUNA 2VKDA 5LJNA 2DHRA 1SHZC 2NW7A 5JTGA 2YKSA 1X9BA 3AB3B 4IT4A 2WZHA 4DR4T 1NEKA 3O4XE 1HNXT 3UFEA 4HFHA 2LSYA 4DMVA 3RYIE 4EGWA 5ABFA 5LXTE 2XTLA 1FMWA 2HN1A 2XAGB 2CWYA 2XAJB 4HWCA 4O4LE 3AE9A 5AQPB 3UFGA 4YSXA 2W67A 5E0OA 1IZNB 1Z8UA 2X9WA 2LHRA 2KT9A 3FZKB 4WW0A 5AQQB 5L2LA 4DUZT 4DV0T 3PUSA 4OYKA 1XMOT 1ZKEA 2D0UA 3N2GE 2BS3A 5AQKB 4GYSA 4BAYB 3PV0F 2BG9B 2XUEA 3AEEA 2WS3A 4P0AA 3RRCA 2JQHA 4Z8XA 3S4UA 4BA9A 4NUUA 5L3GB 3RKOA 3A7MA 5J0ZA 4DR1T 2YINA 5FY0A 2CHOA 2A9UA 3RC3A 1OEDA 3GWHA 5L3BB 5C3JA 3PUWF 4JI7T 2BZBA 4UR9A 1X79A 2J62A 4DR2T 5AQSB 1HG5A 1WCRA 2H3RA 3EI0A 3D0TA 1BR0A 4PNIA 2LRKA 2BG9E 5AQVB 2DWGA 1OEDE 4DIDB 5JR9B 3VHLA 2AE9A 2LKGA 3LSVA 4H9PC 4LF8T 3B57A 5HXCA 3I0QA 3ZMVB 3E0ZA 4MBQA 2ACXA 3JC6D 4I55E 3RLFF 2YDSA 3LK42 5JDNA 5M4YA 4TX5A 2CA5A 2LM9A 2R6GF 2QA7A 2V6YA 4MLKA 4U2YA 1LKXA 2ACZA 2X0LB 3AVRA 4DV7T 2CXLA 5KDMC 4B3ST 4H63H 2I0MA 4HFEA 4U74A 5AQFB 1U5PA 4KMCA 1UK5A 4YSZA 1N34T 3J7Yq 3FZHB 4EB6E 3TLUA 5FY7A 2OA5A 2X66A 3NZQA 1FMVA 4NUVA 5F3JA 5HXHA 2JQQA 3K3OA 3KVBA 2MPKA 5L3EB 5IYZE 1KNZA 4TV8E 2HH7A 3N9OA 4UIGA 2Q9QA 1B7TA 3PJAA 1L0VA 4EYUA 5C8YE 4TWDA 2LSKA 4EEDA 2HPLA 4PW8A 5F8PA 5HEGA 1N33T 1MMNA 3E22E 4H9QC 5FXZA 3PUXF 4TNVA 3F57A 4DV1T 3ZYMA 4MALA 1D0ZA 2K24A 3AE3A 5DJQC 5KX5E 2XQ5A 4EEBA 3CIRA 4JI6T 2XASB 2F4VT 4H63V 4O2BE 2HN2A 3ZMSB 4ASKA 4HWFA 3X1DA 4ZI2D 3HKCE 3AA7B 1HR0T 2DI4A 1EZ3A 4G63A 2CMRA 3F2EA 4J2CA 2V7JA 3C51A 2CHNA 3I0OA 5LG4A 2H7OA 3FBZA 4X1IE 5LMNT 3AAIA 3CK6A 5JH7E 4JI5T 4XAXB 4IL4A 3UUMA 1N36T 3SFEA 3ZSTA 2RP4A 5AQMB 2VVSA 4QH1A 5LHGB 1YXRA 5JREA 4KHPT 2WY2A 4L5GA 2CCQA 2NWBA 2XAFB 4X20E 5LHIB 1J5ET 3N2OA 1JNZA 3AXJA 4ISSA 2WAUA 2ZLYA 2NTXA 4X65T 2UUAT 1ZV4X 2XZEA 3JCFA 3CQCB 4FJOA 4Z90A 5HEOA 1H7CA 1LRZA 3ZLIA 4NPPA 3FZLB 3VKHA 2X9YA 3U78A 2BG9C 3OYZA 4OFZA 1D0YA 1BR2A 4IGUA 1WR6A 4KI0F 1D1AA 2A2FX 3O1IA 4ZI2C 2XY8B 2YDQA 5JDQA 1IBMT 3TKLB 3LDQB 3P50A 4CN1A 2E8IA 3QC9A 3QK6A 1KF6A 4UV9B 3KV9A 5LBMA 3OVUA 2JRKA 4IHJE 4AKRB 3PUYF 2CM0A 4IDZA 2BBHA 4HWDA 5J2TE 2CLYC 3L09A 5IWAT 2IC6A 4PFPA 2H89A 4AKHA 2WWVA 4ILCA 2E9XC 2BVMA 1KNPA 1W0AA 4QXHB 2XHEB 4IDOA 3ZN0B 4BJNA 5JDMA 5JDFA 1HX8A 2WP9A 4WNKA 3OJAA 2FJDA 2IW5B 3PURA 4OK0A 4A97A 3PUGA 4QXBB 1E1HB 4X64T 2K9AA 4AKGA 2XSBA 1E7PA 2VKJA 1BR4A 3Q5WA 4HE8A 2EHOA 4UV8B 1YKEB 3CKDA 5L3DB 1MIYA 2NW8A 4PJNA 3KVAA 3HKDE 1MMGA 4XZCA 5HEUA 2D9DA 3GA8A 3Q5XA 4DV5T 4ANJA 2NTYA 4LMLA 4JI3T 2LKHA 4ILAA 5HAXA 3ZC0A 4AQGA 3N9PA 5FXVA 4HEAA 1HFAA 2K5BB 2QGSA 3RQUA 2A72A 4DBQA 2ZM2A 3KV5A 4HWHA 4QHOA 2X9HA 3QUJA 4WZXA 3EDUA 5FXWA 3ZSSA 5JDHA 1T7SA 2Z6EA 4QKNA 2LSGA 3OTOT 2WM9A 2LOSA 3NZPA 2VQFT 3O9XA 2YEVC 4PK5A 2Q9QC 1QUUA 3VRBA 4U7IA 2XQYA 3V5SA 2C5KT 2M67A 3UU5A 3AEFA 4WYVA 2YU2A 2X9XA 4YTPA 1SUMB 5AFUL 5LP6E 2LSIA 1IJ6A 2N2NA 5JDGA 3Q5DA 1M7KA 3FXEB 1G8XA 2E9XA 4I4TE 5FYMA 2W00A 3ANWA 4CN6A 3QNUA 5JR9C 3BQKA 5LMUT 2CRBA 4ISTA 3WI3A 5C2TA 4EZ4A 4IE5A 4LMKA 2W63A 5AQHB 3KBUA 3AECA 3P4QA 1HNZT 4P0BA 2XAQB 5CFBA 1WYCA 2NP9A 5H6RB 5FVLA 1IBLT 2RPAA 2WSSV 4IE7A 4JUYA 5LNKA 2E5LT 2WDQA 4LF4T 3A8YC 3FZFB 3ZT7A 4WBOA 2LLYA 3AA0B 3PUAA 3LBXB 3SWHA 2YU1A 4IE6A 2RA1A 2EHOB 1T8BA 2UXNB 3SS1A 3EABA 5BR8T 3KDSE 3CX6B 1NAFA 4DV4T 2J1DG 1Y01A 5EK3A 3RKGA 3TLTA 2D2SA 3HA4A 5L47A 4HFVA 2N9DA 5DQWA 2WBLA 2VL8A 5FKYA 4AQFA 3VRAA 3AXJB 3N9LA 2DCFA 4C91A 4I43B 4EV6A 4HWIB 3NVOA 3T1HT 4IE4A 4TV9E 1OEDC 3Q2MA 2ZM6T 1I94T 4K0KT 3K3QC 3C50A 4L9IA 1ZOYA 1J1JA 4KP3C 2CWOA 4U3CA 5FMNA 3R6NA 2NR4A 2PTFA 1IAPA 4B3TT 2J4GA 2BKNA 5AQJB 1MIVA 3UQ7A 2IHR1
chains in the Genus database with same CATH topology
2UU9T 1HNWT 4JI5T 1IBKT 2UXDT 1N36T 1XNRT 4KHPT 1N32T 1J5ET 2UUCT 4X65T 2UUAT 4OX9T 4JI0T 2UXBT 2VQET 3T1YT 2UXCT 4YY3T 1IBMT 4NXNT 4GKJT 4JI8T 4GKKT 1XMQT 5IWAT 4DV5T 4LFAT 2HHHT 4DR4T 1HNXT 4JI2T 4AQYT 4JYAT 4DV3T 4X64T 4DUZT 4DV0T 1XMOT 4LF6T 4LF7T 4DR1T 4JI3T 4YHHT 4JI7T 1FJGT 4DR2T 4LF5T 3OTOT 4JI1T 2VQFT 4LF8T 4B3MT 4NXMT 4DV7T 4DR5T 4B3ST 5LMUT 4LFCT 4LFBT 4DV6T 1N34T 1HNZT 4DR7T 1IBLT 2E5LT 4LF4T 4X62T 1N33T 5BR8T 4DR6T 4DV4T 4DV1T 4JI4T 4LF9T 2UUBT 1XNQT 4B3RT 4JI6T 2F4VT 4DUYT 3T1HT 1I94T 4K0KT 2ZM6T 1HR0T 4DV2T 4DR3T 4JV5T 4B3TT 5LMNT 4X66T
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2UU9 T;  1HNW T;  4JI5 T;  1IBK T;  2UXD T;  1N36 T;  1XNR T;  4KHP T;  1N32 T;  1J5E T;  2UUC T;  4X65 T;  2UUA T;  4OX9 T;  4JI0 T;  2UXB T;  2VQE T;  3T1Y T;  2UXC T;  4YY3 T;  1IBM T;  4NXN T;  4GKJ T;  4JI8 T;  4GKK T;  1XMQ T;  5IWA T;  4DV5 T;  4LFA T;  2HHH T;  4DR4 T;  1HNX T;  4JI2 T;  4AQY T;  4JYA T;  4DV3 T;  4X64 T;  4DUZ T;  4DV0 T;  1XMO T;  4LF6 T;  4LF7 T;  4DR1 T;  4JI3 T;  4YHH T;  4JI7 T;  1FJG T;  4DR2 T;  4LF5 T;  3OTO T;  4JI1 T;  2VQF T;  4LF8 T;  4B3M T;  4NXM T;  4DV7 T;  4DR5 T;  4B3S T;  5LMU T;  4LFC T;  4LFB T;  4DV6 T;  1N34 T;  1HNZ T;  4DR7 T;  1IBL T;  2E5L T;  4LF4 T;  4X62 T;  1N33 T;  5BR8 T;  4DR6 T;  4DV4 T;  4DV1 T;  4JI4 T;  4LF9 T;  2UUB T;  1XNQ T;  4B3R T;  4JI6 T;  2F4V T;  4DUY T;  3T1H T;  1I94 T;  4K0K T;  2ZM6 T;  1HR0 T;  4DV2 T;  4DR3 T;  4JV5 T;  4B3T T;  5LMN T;  4X66 T; 
#chains in the Genus database with same CATH topology
 1HS7 A;  2UU9 T;  4P09 A;  4E7Z A;  3ZC1 A;  5HCM A;  1MIW A;  2XAH B;  2M6I A;  3UUL A;  5LGU B;  4ZHQ E;  2UXD T;  3H3M A;  3RYH E;  1FIO A;  2CPT A;  3QB5 K;  1XNR T;  2V6Y B;  4GYR A;  2KIN B;  4UXN B;  4Q25 A;  3EAM A;  3PTR B;  4M1P A;  4O4I E;  2FJE A;  1OWA A;  2V7K A;  5ETW A;  2DL1 A;  4AQF C;  4ZI3 D;  3N5L A;  5HXS A;  5CA0 E;  2UUC T;  4TN7 B;  2ODV A;  4MFR A;  4UVB B;  4V1A v;  2G0U A;  4ZS3 A;  3SOL A;  1VRB A;  2LSJ A;  3Q9D A;  3RF1 A;  5AQG B;  3TLW A;  5HEH A;  3ZCJ A;  4QH4 A;  3ZYK A;  3ZT6 A;  3O1H A;  4ADZ A;  2YOE A;  4AKL A;  5LG3 A;  5HXR A;  3PE0 A;  1D1C A;  1YQ3 A;  4U7Y A;  3AA6 B;  1WLX A;  3ZMU B;  3T1Y T;  4YT0 A;  5TAO A;  3CWZ B;  3CX7 B;  2FJA A;  3P4R A;  1VOM A;  3ZJ2 A;  2MTQ A;  3P4W A;  5ABG A;  2BBJ A;  1KNR A;  1ZHC A;  3AVS A;  4U33 A;  4CI2 B;  3IF8 B;  3I9W A;  1XMQ T;  3LG7 A;  5LA6 E;  1AJ3 A;  1KEY A;  4KHZ F;  2YDR A;  1XWM A;  2FBW A;  5AQL B;  3N9N A;  4LFA T;  3O1J A;  1G73 A;  3AE7 A;  3MXZ A;  3OKQ A;  4TZ4 C;  5LOV E;  1QSD A;  5L3F B;  2HHH T;  1N32 T;  5IHY A;  2KXP B;  3RYF E;  3WAJ A;  4EAH A;  2KLQ A;  3JAD A;  3CX8 B;  4AQY T;  3GN5 B;  3IBP A;  1D1B A;  1ZEE A;  2LJL A;  5AQI B;  3RH3 A;  3RPU A;  1O3X A;  3UU4 A;  3ONJ A;  1NEN A;  4DMW A;  1KFY A;  2I6H A;  3RGL A;  1D0X A;  2XPK A;  2V7I A;  4AIU A;  5LYJ E;  4E7S A;  1V9D A;  2WU5 A;  4JEU B;  4MHC A;  1MNE A;  2K48 A;  3UU6 A;  4O2A E;  4ILU A;  4KBM B;  4HFC A;  4A5X A;  4X66 T;  2BVL A;  4O4H E;  2M6B A;  4DBR A;  4IL9 A;  4QWN B;  1Y64 B;  1FEW A;  2L9Q A;  3MAC A;  2WMO A;  3ZYL A;  4U2Z A;  2CE7 A;  3DTO A;  2MAW A;  1FJG T;  1XZY A;  4F8H A;  2B76 A;  5JVD E;  2Y8D A;  3UU3 A;  4YJ2 E;  2EHO C;  2GK9 A;  2VVN A;  3ZN1 B;  2WB5 A;  3FHN A;  3AE1 A;  3PJA J;  4UEM A;  5IUX A;  2C0S A;  1I6Z A;  5ADX L;  4ZZC A;  4CI1 B;  2WZI A;  3UU8 A;  5JRC A;  1SA0 E;  3BK9 A;  4BJM A;  4B3M T;  4PJJ A;  2WMN A;  2JPF A;  1LVF A;  5FL1 A;  4GK0 E;  2LOP A;  4L0R A;  5F5W A;  4YTN A;  3AA1 B;  3K8P C;  3NRX A;  3AE4 A;  1QLB A;  2MBG A;  2W2U A;  2XM1 A;  5LGN B;  1HCI A;  4UEL A;  4DR5 T;  4IRE A;  4DVD A;  3KFW X;  4HKA A;  3ETU A;  3FZM B;  3P8C D;  2KND A;  1YW0 A;  2XSA A;  3I9Y A;  3KBT A;  3ESL A;  4U31 A;  5AQU B;  3U3I A;  4IE0 A;  4DV6 T;  5L4H A;  2XQ7 A;  3A5X A;  3DP7 A;  3EHZ A;  2XQA A;  4UF0 A;  5FY1 A;  5AQR B;  2FJB A;  3VR9 A;  4COF A;  1W09 A;  3M3Z B;  5FVK A;  2VB6 A;  3PU3 A;  2CEA A;  2K3W A;  3FB2 A;  4YLH A;  1S94 A;  2A3D A;  3T8O A;  1M62 A;  2JQ9 A;  4H9R C;  1XDP A;  4OYJ A;  2EHO D;  2MYS A;  2WDV A;  3AAA B;  3AED A;  3GMI A;  2BKP A;  2KZ7 B;  5DQV A;  4X62 T;  1HTJ F;  2HPJ A;  3N9Q A;  3KV6 A;  2DWK A;  2L8K A;  1UX5 A;  3JC6 C;  2X0H A;  5HCJ A;  4LMJ A;  2VWA A;  3RIU A;  4CI3 B;  2NW9 A;  2BS4 A;  4IDQ A;  3ZKR A;  5HWX A;  2B1E A;  2LHN A;  3EUH A;  4JI4 T;  3V5U A;  4LF9 T;  1XNQ T;  4EIW A;  3UUX B;  2V7L A;  4DUY T;  3P4S A;  2KSR A;  5DAB A;  5LCY A;  1VCS A;  3OPC A;  2V5D A;  3P7I A;  2AXD S;  1T98 A;  3E08 A;  3MZK B;  1WFD A;  2I59 A;  3RYC E;  3ZMT B;  4DR3 T;  4JV5 T;  2LM2 A;  2NOX A;  4ZI7 E;  2D5U A;  5EK4 A;  2E2A A;  2VK9 A;  3CPZ A;  3Q5E A;  3OBV E;  4X1K E;  3UT5 E;  3TLS A;  5FP3 A;  3K3N A;  1BR1 A;  3LJC A;  1HNW T;  2JQK A;  1R8I A;  3PUZ F;  3TLV A;  3ZT5 A;  4DND A;  2DNX A;  2QRX A;  5ABH A;  1IBK T;  5CGM A;  1W0B A;  5J2U E;  4G2A A;  4PJL A;  2IDO B;  2JMH A;  4IIJ E;  1OED B;  1U4Q A;  3NBX X;  2X68 A;  3CQX C;  1HG2 A;  2E9X B;  3IEE A;  3MJX A;  4HFB A;  4I0U A;  2VL0 A;  4OHF A;  5ABE A;  1NWM X;  3ONL C;  2CLY B;  3PU8 A;  3JAE A;  2XQ9 A;  4JI0 T;  2IML A;  3AEG A;  3WAK A;  2PG8 A;  3AEA A;  1T72 A;  3EVY A;  4I50 E;  4CQI A;  3I1A A;  2H88 A;  4UVA B;  4ZEY A;  2C5I T;  2ODU A;  2IUB A;  3RX6 A;  4IDN A;  4YY3 T;  2N1G A;  4NXN T;  1UGO A;  1GQE A;  3W15 B;  3J9X 1;  1HF8 A;  2IAK A;  3AAE B;  3B13 A;  1WYB A;  4PJM A;  3M65 A;  5JDL A;  4JI8 T;  2SPC A;  2X0Y A;  3LBX A;  4GKK T;  4QX8 B;  3LFM A;  2VKO A;  2V8S V;  4X1Y E;  2KMF A;  4P1N A;  2CXF A;  4ZS2 A;  5AQT B;  3FXD B;  2V1D B;  5FNV E;  3NKZ A;  3HR0 A;  3H3A A;  4IDP A;  2CXD A;  4K0U A;  3C4W A;  3L39 A;  2V26 A;  5HEJ A;  3RC8 A;  1YKH B;  4CXW A;  4JI1 T;  4JI2 T;  4ERR A;  1E2A A;  2P9B A;  3L8R A;  4KX6 A;  3PUQ A;  3N2K E;  2YN6 A;  4QXC B;  2X51 A;  4CXX A;  4EZH A;  4DV3 T;  4JYA T;  3G06 A;  2CBI A;  2LEH A;  5JRC B;  4KUM B;  1UUR A;  4PK6 A;  2KWI B;  2XQ4 A;  2Y48 B;  3H37 A;  5HWY A;  3PUV F;  3L3P A;  3N9M A;  2D0T A;  2QVA A;  4YJ3 E;  4H9N C;  3HKE E;  1MND A;  3BQI A;  1VCT A;  2XQ6 A;  2PJQ A;  2QYW A;  2L3L A;  2X67 A;  2WWU A;  4LF6 T;  4LF7 T;  5AQN B;  1Z0P A;  3QB5 A;  3FBL A;  4DO0 A;  5KMG P;  4YHH T;  3ZCI A;  2PFV A;  2XJ7 A;  3ZPO A;  3RRW A;  1SE7 A;  4GK5 E;  4UF0 B;  2XQ8 A;  5A1L A;  4LF5 T;  2V7M A;  5ABF B;  4A98 A;  2WCA A;  2JIW A;  5AQO B;  3K1S A;  3MK7 C;  3RIU C;  2OLT A;  3HI2 A;  4EOZ B;  2CBJ A;  2V6X A;  3MKD A;  4EXT A;  1UUS A;  3OYX A;  5FL0 A;  5LBQ B;  2KWH A;  4F6R C;  4QX7 B;  3AEB A;  4ZZB A;  4HFI A;  4HFD A;  3RIF A;  4NXM T;  1MMD A;  2JJ9 A;  1HX1 B;  1W9R A;  2E5V A;  3LK3 B;  4C90 A;  3EDV A;  4TUY E;  5LB7 B;  4EYY R;  3PDY A;  4WBN E;  3BQL A;  3C98 B;  1CHU A;  3IA3 A;  4PK4 A;  4LFC T;  1ZP0 A;  3LK2 B;  4QH5 A;  5J1G A;  2C5J A;  3ZEF B;  5BMV E;  4LFB T;  2LT3 A;  2H7V C;  5L3C B;  3NRY A;  2IIU A;  2Q9Q D;  2W4X A;  2WQY A;  4NIQ A;  2V5C A;  4DR7 T;  5JR9 A;  2VKH A;  3DJB A;  4U72 A;  4O4J E;  5H6Q B;  3B5M A;  4TWH A;  2ZMA A;  3NWI A;  5CB4 E;  3GN5 A;  4YTM A;  1KK7 A;  4YFS A;  2JMK A;  4ILB A;  3UUB A;  3AE8 A;  2W61 A;  5FXX A;  2BKO A;  2PBI A;  2W66 A;  5EZY E;  5JQG E;  3KIN B;  4HGA A;  4ZI3 C;  4YXD A;  4CN4 A;  2IC9 A;  4PFO A;  4B6X A;  3C4Z A;  5L4E A;  4Z91 A;  4DR6 T;  4H9O C;  1UX4 A;  2DLR A;  2YK0 A;  1US7 B;  3AE5 A;  3JAF A;  3F31 A;  3MA9 A;  4TWF A;  2W62 A;  3RI5 A;  3SFD A;  2UUB T;  4B3R T;  3UQ4 A;  4AI6 A;  3RQW A;  3ETV A;  5HXE A;  3P4P A;  5CA1 E;  1S35 A;  1YD8 G;  2UXX B;  5EK2 A;  3ABV A;  2W0G A;  4JBW F;  5LGT B;  4DV2 T;  2ZM0 A;  4A56 A;  4GIW A;  4GOU A;  2VUR A;  4ZOL E;  4UVC B;  1OXZ A;  4HTE A;  5LHH B;  4AIS A;  3VU7 H;  2ZM8 A;  3AE6 A;  2Q9Q B;  2VAS A;  3HL6 A;  4JEH B;  1IJ5 A;  4AKI A;  2E9X D;  4ZXL A;  2LRL A;  4CZZ B;  4TNW A;  4CXY A;  1CUN A;  1UCU A;  1J5W A;  2XQ3 A;  3IHR A;  4FI5 A;  1DU2 A;  3AE2 A;  4H9S E;  2XM2 A;  3ONX A;  1LVK A;  2BDE A;  5GON E;  4JLE A;  4OX9 T;  4XBF B;  4HN9 A;  1YQ4 A;  3CML A;  2UXB T;  3KV4 A;  3QOF A;  1JNR A;  2BS2 A;  3R84 B;  3VKG A;  3RHW A;  4YSY A;  2VQE T;  3ZMZ B;  5KXJ A;  2J47 A;  2LE8 A;  2MOZ A;  3CQG B;  3CVR A;  2UXC T;  3VR8 A;  5LJM A;  4YHJ A;  1XDO A;  2WU2 A;  4GKJ T;  4X5T A;  4AXP A;  1MMA A;  3C4X A;  4PAG A;  3C64 A;  2BG9 A;  3RIA A;  1WR0 A;  1WRD A;  2ES0 A;  2OV9 A;  3ANW B;  4N78 D;  2Y6X A;  3HKB E;  4O8S A;  3UTK A;  2FUP A;  5CJ5 A;  3ZJ1 A;  5HYA A;  2WDR A;  3SRZ A;  3UUN A;  2VKD A;  5LJN A;  2DHR A;  1SHZ C;  2NW7 A;  5JTG A;  2YKS A;  1X9B A;  3AB3 B;  4IT4 A;  2WZH A;  4DR4 T;  1NEK A;  3O4X E;  1HNX T;  3UFE A;  4HFH A;  2LSY A;  4DMV A;  3RYI E;  4EGW A;  5ABF A;  5LXT E;  2XTL A;  1FMW A;  2HN1 A;  2XAG B;  2CWY A;  2XAJ B;  4HWC A;  4O4L E;  3AE9 A;  5AQP B;  3UFG A;  4YSX A;  2W67 A;  5E0O A;  1IZN B;  1Z8U A;  2X9W A;  2LHR A;  2KT9 A;  3FZK B;  4WW0 A;  5AQQ B;  5L2L A;  4DUZ T;  4DV0 T;  3PUS A;  4OYK A;  1XMO T;  1ZKE A;  2D0U A;  3N2G E;  2BS3 A;  5AQK B;  4GYS A;  4BAY B;  3PV0 F;  2BG9 B;  2XUE A;  3AEE A;  2WS3 A;  4P0A A;  3RRC A;  2JQH A;  4Z8X A;  3S4U A;  4BA9 A;  4NUU A;  5L3G B;  3RKO A;  3A7M A;  5J0Z A;  4DR1 T;  2YIN A;  5FY0 A;  2CHO A;  2A9U A;  3RC3 A;  1OED A;  3GWH A;  5L3B B;  5C3J A;  3PUW F;  4JI7 T;  2BZB A;  4UR9 A;  1X79 A;  2J62 A;  4DR2 T;  5AQS B;  1HG5 A;  1WCR A;  2H3R A;  3EI0 A;  3D0T A;  1BR0 A;  4PNI A;  2LRK A;  2BG9 E;  5AQV B;  2DWG A;  1OED E;  4DID B;  5JR9 B;  3VHL A;  2AE9 A;  2LKG A;  3LSV A;  4H9P C;  4LF8 T;  3B57 A;  5HXC A;  3I0Q A;  3ZMV B;  3E0Z A;  4MBQ A;  2ACX A;  3JC6 D;  4I55 E;  3RLF F;  2YDS A;  3LK4 2;  5JDN A;  5M4Y A;  4TX5 A;  2CA5 A;  2LM9 A;  2R6G F;  2QA7 A;  2V6Y A;  4MLK A;  4U2Y A;  1LKX A;  2ACZ A;  2X0L B;  3AVR A;  4DV7 T;  2CXL A;  5KDM C;  4B3S T;  4H63 H;  2I0M A;  4HFE A;  4U74 A;  5AQF B;  1U5P A;  4KMC A;  1UK5 A;  4YSZ A;  1N34 T;  3J7Y q;  3FZH B;  4EB6 E;  3TLU A;  5FY7 A;  2OA5 A;  2X66 A;  3NZQ A;  1FMV A;  4NUV A;  5F3J A;  5HXH A;  2JQQ A;  3K3O A;  3KVB A;  2MPK A;  5L3E B;  5IYZ E;  1KNZ A;  4TV8 E;  2HH7 A;  3N9O A;  4UIG A;  2Q9Q A;  1B7T A;  3PJA A;  1L0V A;  4EYU A;  5C8Y E;  4TWD A;  2LSK A;  4EED A;  2HPL A;  4PW8 A;  5F8P A;  5HEG A;  1N33 T;  1MMN A;  3E22 E;  4H9Q C;  5FXZ A;  3PUX F;  4TNV A;  3F57 A;  4DV1 T;  3ZYM A;  4MAL A;  1D0Z A;  2K24 A;  3AE3 A;  5DJQ C;  5KX5 E;  2XQ5 A;  4EEB A;  3CIR A;  4JI6 T;  2XAS B;  2F4V T;  4H63 V;  4O2B E;  2HN2 A;  3ZMS B;  4ASK A;  4HWF A;  3X1D A;  4ZI2 D;  3HKC E;  3AA7 B;  1HR0 T;  2DI4 A;  1EZ3 A;  4G63 A;  2CMR A;  3F2E A;  4J2C A;  2V7J A;  3C51 A;  2CHN A;  3I0O A;  5LG4 A;  2H7O A;  3FBZ A;  4X1I E;  5LMN T;  3AAI A;  3CK6 A;  5JH7 E;  4JI5 T;  4XAX B;  4IL4 A;  3UUM A;  1N36 T;  3SFE A;  3ZST A;  2RP4 A;  5AQM B;  2VVS A;  4QH1 A;  5LHG B;  1YXR A;  5JRE A;  4KHP T;  2WY2 A;  4L5G A;  2CCQ A;  2NWB A;  2XAF B;  4X20 E;  5LHI B;  1J5E T;  3N2O A;  1JNZ A;  3AXJ A;  4ISS A;  2WAU A;  2ZLY A;  2NTX A;  4X65 T;  2UUA T;  1ZV4 X;  2XZE A;  3JCF A;  3CQC B;  4FJO A;  4Z90 A;  5HEO A;  1H7C A;  1LRZ A;  3ZLI A;  4NPP A;  3FZL B;  3VKH A;  2X9Y A;  3U78 A;  2BG9 C;  3OYZ A;  4OFZ A;  1D0Y A;  1BR2 A;  4IGU A;  1WR6 A;  4KI0 F;  1D1A A;  2A2F X;  3O1I A;  4ZI2 C;  2XY8 B;  2YDQ A;  5JDQ A;  1IBM T;  3TKL B;  3LDQ B;  3P50 A;  4CN1 A;  2E8I A;  3QC9 A;  3QK6 A;  1KF6 A;  4UV9 B;  3KV9 A;  5LBM A;  3OVU A;  2JRK A;  4IHJ E;  4AKR B;  3PUY F;  2CM0 A;  4IDZ A;  2BBH A;  4HWD A;  5J2T E;  2CLY C;  3L09 A;  5IWA T;  2IC6 A;  4PFP A;  2H89 A;  4AKH A;  2WWV A;  4ILC A;  2E9X C;  2BVM A;  1KNP A;  1W0A A;  4QXH B;  2XHE B;  4IDO A;  3ZN0 B;  4BJN A;  5JDM A;  5JDF A;  1HX8 A;  2WP9 A;  4WNK A;  3OJA A;  2FJD A;  2IW5 B;  3PUR A;  4OK0 A;  4A97 A;  3PUG A;  4QXB B;  1E1H B;  4X64 T;  2K9A A;  4AKG A;  2XSB A;  1E7P A;  2VKJ A;  1BR4 A;  3Q5W A;  4HE8 A;  2EHO A;  4UV8 B;  1YKE B;  3CKD A;  5L3D B;  1MIY A;  2NW8 A;  4PJN A;  3KVA A;  3HKD E;  1MMG A;  4XZC A;  5HEU A;  2D9D A;  3GA8 A;  3Q5X A;  4DV5 T;  4ANJ A;  2NTY A;  4LML A;  4JI3 T;  2LKH A;  4ILA A;  5HAX A;  3ZC0 A;  4AQG A;  3N9P A;  5FXV A;  4HEA A;  1HFA A;  2K5B B;  2QGS A;  3RQU A;  2A72 A;  4DBQ A;  2ZM2 A;  3KV5 A;  4HWH A;  4QHO A;  2X9H A;  3QUJ A;  4WZX A;  3EDU A;  5FXW A;  3ZSS A;  5JDH A;  1T7S A;  2Z6E A;  4QKN A;  2LSG A;  3OTO T;  2WM9 A;  2LOS A;  3NZP A;  2VQF T;  3O9X A;  2YEV C;  4PK5 A;  2Q9Q C;  1QUU A;  3VRB A;  4U7I A;  2XQY A;  3V5S A;  2C5K T;  2M67 A;  3UU5 A;  3AEF A;  4WYV A;  2YU2 A;  2X9X A;  4YTP A;  1SUM B;  5AFU L;  5LP6 E;  2LSI A;  1IJ6 A;  2N2N A;  5JDG A;  3Q5D A;  1M7K A;  3FXE B;  1G8X A;  2E9X A;  4I4T E;  5FYM A;  2W00 A;  3ANW A;  4CN6 A;  3QNU A;  5JR9 C;  3BQK A;  5LMU T;  2CRB A;  4IST A;  3WI3 A;  5C2T A;  4EZ4 A;  4IE5 A;  4LMK A;  2W63 A;  5AQH B;  3KBU A;  3AEC A;  3P4Q A;  1HNZ T;  4P0B A;  2XAQ B;  5CFB A;  1WYC A;  2NP9 A;  5H6R B;  5FVL A;  1IBL T;  2RPA A;  2WSS V;  4IE7 A;  4JUY A;  5LNK A;  2E5L T;  2WDQ A;  4LF4 T;  3A8Y C;  3FZF B;  3ZT7 A;  4WBO A;  2LLY A;  3AA0 B;  3PUA A;  3LBX B;  3SWH A;  2YU1 A;  4IE6 A;  2RA1 A;  2EHO B;  1T8B A;  2UXN B;  3SS1 A;  3EAB A;  5BR8 T;  3KDS E;  3CX6 B;  1NAF A;  4DV4 T;  2J1D G;  1Y01 A;  5EK3 A;  3RKG A;  3TLT A;  2D2S A;  3HA4 A;  5L47 A;  4HFV A;  2N9D A;  5DQW A;  2WBL A;  2VL8 A;  5FKY A;  4AQF A;  3VRA A;  3AXJ B;  3N9L A;  2DCF A;  4C91 A;  4I43 B;  4EV6 A;  4HWI B;  3NVO A;  3T1H T;  4IE4 A;  4TV9 E;  1OED C;  3Q2M A;  2ZM6 T;  1I94 T;  4K0K T;  3K3Q C;  3C50 A;  4L9I A;  1ZOY A;  1J1J A;  4KP3 C;  2CWO A;  4U3C A;  5FMN A;  3R6N A;  2NR4 A;  2PTF A;  1IAP A;  4B3T T;  2J4G A;  2BKN A;  5AQJ B;  1MIV A;  3UQ7 A;  2IHR 1; 
#chains in the Genus database with same CATH homology
 2UU9 T;  1HNW T;  4JI5 T;  1IBK T;  2UXD T;  1N36 T;  1XNR T;  4KHP T;  1N32 T;  1J5E T;  2UUC T;  4X65 T;  2UUA T;  4OX9 T;  4JI0 T;  2UXB T;  2VQE T;  3T1Y T;  2UXC T;  4YY3 T;  1IBM T;  4NXN T;  4GKJ T;  4JI8 T;  4GKK T;  1XMQ T;  5IWA T;  4DV5 T;  4LFA T;  2HHH T;  4DR4 T;  1HNX T;  4JI2 T;  4AQY T;  4JYA T;  4DV3 T;  4X64 T;  4DUZ T;  4DV0 T;  1XMO T;  4LF6 T;  4LF7 T;  4DR1 T;  4JI3 T;  4YHH T;  4JI7 T;  1FJG T;  4DR2 T;  4LF5 T;  3OTO T;  4JI1 T;  2VQF T;  4LF8 T;  4B3M T;  4NXM T;  4DV7 T;  4DR5 T;  4B3S T;  5LMU T;  4LFC T;  4LFB T;  4DV6 T;  1N34 T;  1HNZ T;  4DR7 T;  1IBL T;  2E5L T;  4LF4 T;  4X62 T;  1N33 T;  5BR8 T;  4DR6 T;  4DV4 T;  4DV1 T;  4JI4 T;  4LF9 T;  2UUB T;  1XNQ T;  4B3R T;  4JI6 T;  2F4V T;  4DUY T;  3T1H T;  1I94 T;  4K0K T;  2ZM6 T;  1HR0 T;  4DV2 T;  4DR3 T;  4JV5 T;  4B3T T;  5LMN T;  4X66 T; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...