1N33D

Structure of the thermus thermophilus 30s ribosomal subunit bound to codon and near-cognate transfer rna anticodon stem-loop mismatched at the second codon position at the a site with paromomycin
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
208
structure length
208
Chain Sequence
GRYIGPVCRLCRREGVKLYLKGERCYSPKCAMERRPYPPGQHGQKRARRPSDYAVRLREKQKLRRIYGISERQFRNLFEEASKKKGVTGSVFLGLLESRLDNVVYRLGFAVSRRQARQLVRHGHITVNGRRVDLPSYRVRPGDEIAVAEKSRNLELIRQNLEAMKGRKVGPWLSLDVEGMKGKFLRLPDREDLALPVNEQLVIEFYSR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S RIBOSOMAL RNA
publication title Selection of tRNA by the Ribosome Requires a Transition from an Open to a Closed Form
pubmed doi rcsb
molecule tags Ribosome
total genus 57
structure length 208
sequence length 208
ec nomenclature
pdb deposition date 2002-10-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF00163 Ribosomal_S4 Ribosomal protein S4/S9 N-terminal domain
D PF01479 S4 S4 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1050.10 Mainly Alpha Orthogonal Bundle Ribosomal Protein S4 Delta 41; Chain A, domain 1 Ribosomal Protein S4 Delta 41; Chain A, domain 1 1n33D01
3.10.290.10 Alpha Beta Roll Structural Genomics Hypothetical 15.5 Kd Protein In mrcA-pckA Intergenic Region; Chain A RNA-binding S4 domain 1n33D02
4DV5D 4B3MD 1JH3A 4B3RD 4JI7D 4LF8D 1J5ED 1KSKA 2UUCD 2VQFD 3T1HD 4X62D 4LFAD 1N32D 2ISTA 4B3SD 4GKJD 4LF9D 1IBKD 1DM9A 2VQED 1H3EA 4GKKD 1KSLA 1C06A 3KBGA 1HR0D 4JV5D 4OX9D 4B3TD 5BR8D 4AQYD 2UUAD 1HNWD 4DV1D 4LGTA 1XMOD 4JI8D 1N33D 4DV6D 1H3FA 4DV2D 4JYAD 4YHHD 2KTLA 4JI6D 1P9KA 4NXND 1XNQD 4OUDA 4JI2D 4DV0D 4DR4D 4DR6D 4LF6D 1IBMD 5LMND 2UXBD 1FJGD 4DR3D 1XNRD 4LF5D 4LF4D 4KHPD 2UXCD 4X64D 4DV7D 1IBLD 2JANA 4NXMD 4LF7D 1N36D 3OTOD 4JI5D 1HNZD 2F4VD 2UXDD 4JI0D 4X66D 1N34D 4DR7D 4LFCD 2E5LD 3HP7A 4K0KD 1I94D 4LFBD 4DV3D 4DUZD 2HHHD 4X65D 3DH3A 1HNXD 5IWAD 4JI1D 2ZM6D 1VIOA 2UUBD 1XMQD 4YY3D 4DR2D 4DR1D 1C05A 2K6PA 1KSVA 1FKAD 4DUYD 5LMUD 4JI4D 4DR5D 4DV4D 3T1YD 4JI3D 2UU9D
chains in the Genus database with same CATH superfamily
4DV5D 4B3MD 1JH3A 2I1SA 1Y8RB 4B3RD 4JI7D 4LF8D 1J5ED 1KSKA 2NVUB 2UUCD 2VQFD 3T1HD 4II2A 4X62D 3J80E 4LFAD 1N32D 2ISTA 4B3SD 4GKJD 4LF9D 1IBKD 1DM9A 2VQED 1H3EA 4GKKD 1KSLA 1C06A 3KBGA 1HR0D 4JV5D 4OX9D 4B3TD 5BR8D 3KYDB 4AQYD 2UUAD 1HNWD 2LQ7A 4DV1D 4LGTA 1XMOD 4JI8D 1N33D 4DV6D 1H3FA 4DV2D 4JYAD 4YHHD 2KTLA 4JI6D 1P9KA 3J7AF 4NXND 1XNQD 4OUDA 4JI2D 4DV0D 4DR4D 4DR6D 4LF6D 1IBMD 5LMND 4W5VB 2UXBD 3JAME 3ONHA 1FJGD 4DR3D 1XNRD 4LF5D 1Y8XB 4LF4D 4KHPD 2UXCD 4X64D 4DV7D 1IBLD 2JANA 4NXMD 4LF7D 4NNJA 1N36D 3OTOD 4JI5D 1HNZD 2F4VD 3ONGA 2UXDD 1Y8QB 4JI0D 4X66D 1N34D 4DR7D 3CMMA 4LFCD 2E5LD 3HP7A 4K0KD 1I94D 5IT9E 4LFBD 4DV3D 4DUZD 3J81E 2HHHD 4X65D 5A2QE 4II3A 3DH3A 1HNXD 5IWAD 5FLXE 5LL6S 5FQ2B 4JI1D 3KYCB 2ZM6D 1VIOA 2UUBD 5KNLA 1XMQD 4YY3D 4DR2D 4DR1D 1C05A 2K6PA 3FN1A 1KSVA 1FKAD 4DUYD 5LMUD 4JI4D 2ZTBA 4DR5D 4DV4D 3T1YD 4JI3D 2UU9D 2L3NA
chains in the Genus database with same CATH topology
4DV5D 4B3MD 1JH3A 4B3RD 4JI7D 4LF8D 1J5ED 1KSKA 2UUCD 2VQFD 3T1HD 4X62D 4LFAD 1N32D 2ISTA 4B3SD 4GKJD 4LF9D 1IBKD 1DM9A 2VQED 1H3EA 4GKKD 1KSLA 1C06A 3KBGA 1HR0D 4JV5D 4OX9D 4B3TD 5BR8D 4AQYD 2UUAD 1HNWD 4DV1D 4LGTA 1XMOD 4JI8D 1N33D 4DV6D 1H3FA 4DV2D 4JYAD 4YHHD 2KTLA 4JI6D 1P9KA 4NXND 1XNQD 4OUDA 4JI2D 4DV0D 4DR4D 4DR6D 4LF6D 1IBMD 5LMND 2UXBD 1FJGD 4DR3D 1XNRD 4LF5D 4LF4D 4KHPD 2UXCD 4X64D 4DV7D 1IBLD 2JANA 4NXMD 4LF7D 1N36D 3OTOD 4JI5D 1HNZD 2F4VD 2UXDD 4JI0D 4X66D 1N34D 4DR7D 4LFCD 2E5LD 3HP7A 4K0KD 1I94D 4LFBD 4DV3D 4DUZD 2HHHD 4X65D 3DH3A 1HNXD 5IWAD 4JI1D 2ZM6D 1VIOA 2UUBD 1XMQD 4YY3D 4DR2D 4DR1D 1C05A 2K6PA 1KSVA 1FKAD 4DUYD 5LMUD 4JI4D 4DR5D 4DV4D 3T1YD 4JI3D 2UU9D 2L3NA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DV5 D;  4B3M D;  1JH3 A;  4B3R D;  4JI7 D;  4LF8 D;  1J5E D;  1KSK A;  2UUC D;  2VQF D;  3T1H D;  4X62 D;  4LFA D;  1N32 D;  2IST A;  4B3S D;  4GKJ D;  4LF9 D;  1IBK D;  1DM9 A;  2VQE D;  1H3E A;  4GKK D;  1KSL A;  1C06 A;  3KBG A;  1HR0 D;  4JV5 D;  4OX9 D;  4B3T D;  5BR8 D;  4AQY D;  2UUA D;  1HNW D;  4DV1 D;  4LGT A;  1XMO D;  4JI8 D;  1N33 D;  4DV6 D;  1H3F A;  4DV2 D;  4JYA D;  4YHH D;  2KTL A;  4JI6 D;  1P9K A;  4NXN D;  1XNQ D;  4OUD A;  4JI2 D;  4DV0 D;  4DR4 D;  4DR6 D;  4LF6 D;  1IBM D;  5LMN D;  2UXB D;  1FJG D;  4DR3 D;  1XNR D;  4LF5 D;  4LF4 D;  4KHP D;  2UXC D;  4X64 D;  4DV7 D;  1IBL D;  2JAN A;  4NXM D;  4LF7 D;  1N36 D;  3OTO D;  4JI5 D;  1HNZ D;  2F4V D;  2UXD D;  4JI0 D;  4X66 D;  1N34 D;  4DR7 D;  4LFC D;  2E5L D;  3HP7 A;  4K0K D;  1I94 D;  4LFB D;  4DV3 D;  4DUZ D;  2HHH D;  4X65 D;  3DH3 A;  1HNX D;  5IWA D;  4JI1 D;  2ZM6 D;  1VIO A;  2UUB D;  1XMQ D;  4YY3 D;  4DR2 D;  4DR1 D;  1C05 A;  2K6P A;  1KSV A;  1FKA D;  4DUY D;  5LMU D;  4JI4 D;  4DR5 D;  4DV4 D;  3T1Y D;  4JI3 D;  2UU9 D; 
#chains in the Genus database with same CATH topology
 4DV5 D;  4B3M D;  1JH3 A;  2I1S A;  1Y8R B;  4B3R D;  4JI7 D;  4LF8 D;  1J5E D;  1KSK A;  2NVU B;  2UUC D;  2VQF D;  3T1H D;  4II2 A;  4X62 D;  3J80 E;  4LFA D;  1N32 D;  2IST A;  4B3S D;  4GKJ D;  4LF9 D;  1IBK D;  1DM9 A;  2VQE D;  1H3E A;  4GKK D;  1KSL A;  1C06 A;  3KBG A;  1HR0 D;  4JV5 D;  4OX9 D;  4B3T D;  5BR8 D;  3KYD B;  4AQY D;  2UUA D;  1HNW D;  2LQ7 A;  4DV1 D;  4LGT A;  1XMO D;  4JI8 D;  1N33 D;  4DV6 D;  1H3F A;  4DV2 D;  4JYA D;  4YHH D;  2KTL A;  4JI6 D;  1P9K A;  3J7A F;  4NXN D;  1XNQ D;  4OUD A;  4JI2 D;  4DV0 D;  4DR4 D;  4DR6 D;  4LF6 D;  1IBM D;  5LMN D;  4W5V B;  2UXB D;  3JAM E;  3ONH A;  1FJG D;  4DR3 D;  1XNR D;  4LF5 D;  1Y8X B;  4LF4 D;  4KHP D;  2UXC D;  4X64 D;  4DV7 D;  1IBL D;  2JAN A;  4NXM D;  4LF7 D;  4NNJ A;  1N36 D;  3OTO D;  4JI5 D;  1HNZ D;  2F4V D;  3ONG A;  2UXD D;  1Y8Q B;  4JI0 D;  4X66 D;  1N34 D;  4DR7 D;  3CMM A;  4LFC D;  2E5L D;  3HP7 A;  4K0K D;  1I94 D;  5IT9 E;  4LFB D;  4DV3 D;  4DUZ D;  3J81 E;  2HHH D;  4X65 D;  5A2Q E;  4II3 A;  3DH3 A;  1HNX D;  5IWA D;  5FLX E;  5LL6 S;  5FQ2 B;  4JI1 D;  3KYC B;  2ZM6 D;  1VIO A;  2UUB D;  5KNL A;  1XMQ D;  4YY3 D;  4DR2 D;  4DR1 D;  1C05 A;  2K6P A;  3FN1 A;  1KSV A;  1FKA D;  4DUY D;  5LMU D;  4JI4 D;  2ZTB A;  4DR5 D;  4DV4 D;  3T1Y D;  4JI3 D;  2UU9 D;  2L3N A; 
#chains in the Genus database with same CATH homology
 4DV5 D;  4B3M D;  1JH3 A;  4B3R D;  4JI7 D;  4LF8 D;  1J5E D;  1KSK A;  2UUC D;  2VQF D;  3T1H D;  4X62 D;  4LFA D;  1N32 D;  2IST A;  4B3S D;  4GKJ D;  4LF9 D;  1IBK D;  1DM9 A;  2VQE D;  1H3E A;  4GKK D;  1KSL A;  1C06 A;  3KBG A;  1HR0 D;  4JV5 D;  4OX9 D;  4B3T D;  5BR8 D;  4AQY D;  2UUA D;  1HNW D;  4DV1 D;  4LGT A;  1XMO D;  4JI8 D;  1N33 D;  4DV6 D;  1H3F A;  4DV2 D;  4JYA D;  4YHH D;  2KTL A;  4JI6 D;  1P9K A;  4NXN D;  1XNQ D;  4OUD A;  4JI2 D;  4DV0 D;  4DR4 D;  4DR6 D;  4LF6 D;  1IBM D;  5LMN D;  2UXB D;  1FJG D;  4DR3 D;  1XNR D;  4LF5 D;  4LF4 D;  4KHP D;  2UXC D;  4X64 D;  4DV7 D;  1IBL D;  2JAN A;  4NXM D;  4LF7 D;  1N36 D;  3OTO D;  4JI5 D;  1HNZ D;  2F4V D;  2UXD D;  4JI0 D;  4X66 D;  1N34 D;  4DR7 D;  4LFC D;  2E5L D;  3HP7 A;  4K0K D;  1I94 D;  4LFB D;  4DV3 D;  4DUZ D;  2HHH D;  4X65 D;  3DH3 A;  1HNX D;  5IWA D;  4JI1 D;  2ZM6 D;  1VIO A;  2UUB D;  1XMQ D;  4YY3 D;  4DR2 D;  4DR1 D;  1C05 A;  2K6P A;  1KSV A;  1FKA D;  4DUY D;  5LMU D;  4JI4 D;  4DR5 D;  4DV4 D;  3T1Y D;  4JI3 D;  2UU9 D;  2L3N A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...