1N33Q

Structure of the thermus thermophilus 30s ribosomal subunit bound to codon and near-cognate transfer rna anticodon stem-loop mismatched at the second codon position at the a site with paromomycin
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
104
structure length
104
Chain Sequence
PKKVLTGVVVSDKMQKTVTVLVERQFPHPLYGKVIKRSKKYLAHDPEEKYKLGDVVEIIESRPISKRKRFRVLRLVESGRMDLVEKYLIRRQNYQSLSKRGGKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S RIBOSOMAL RNA
publication title Selection of tRNA by the Ribosome Requires a Transition from an Open to a Closed Form
pubmed doi rcsb
molecule tags Ribosome
total genus 20
structure length 104
sequence length 104
ec nomenclature
pdb deposition date 2002-10-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Q PF00366 Ribosomal_S17 Ribosomal protein S17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 1n33Q00
4H02A 2ZM6L 2JEAI 1XMOL 3S2DH 1VCIA 1VQ5A 5C3EH 1HNWQ 4GOPB 3CAMA 3NEMA 1S72A 4DR6Q 1CUKA 2DUDA 1QZHA 1YJ9A 4A75A 3CPFA 4JI0L 4GKJL 5H1SE 4B3ML 2K4KA 4DR7Q 2HQLA 1Q81C 1VQJA 1B7YB 2CQOA 5LMUQ 4HJ9A 5IWAQ 4POGA 5HY6A 2UXBQ 1PH7A 2KCMA 2BA1A 1YHQA 3FP9A 4UP9A 1CKNA 3M7NA 2OTLA 1HZCA 3HOZH 1A63A 4A3CH 2WAQE 4R1JA 1Q46A 4GNXA 2PI2A 2RF4A 1KC8C 3S1QH 1OXXK 4QJFA 1BBUA 1UE5A 1PH3A 1VQCA 1VQ9A 3AQQA 3E0EA 1S3OA 3S17H 3ULLA 4PZ7A 2YYZA 1FJGQ 4DV0L 5IT9c 1QUQB 1K3RA 3OTOQ 4HIKA 1ASZA 2QA4A 4A3LG 4OXPA 4L5TA 1WJJA 2R93G 2BH2A 4DR5L 1VQMA 1K8GA 4L5RC 4GOPC 4OX9Q 1IL2A 5C44G 4A3KG 2JE6I 2NZOA 1VQBA 4X62Q 3GD7A 1NE3A 1IBKL 4NXMQ 2VUMG 4QQBX 5C44H 4A3KH 1OXSC 1K8AC 1WCMH 4JI3Q 3J81j 4A3FG 1X65A 4R4QA 4GOPA 3KF8B 4YHHL 5IP7G 4DNIA 3RR5A 1PH5A 2HT1A 3PO3G 5C4XG 4OWWB 3G71A 1LYLA 1PH1A 4PZ6A 1RIPA 1PH2A 1N36Q 1IXRA 1JB7A 3HOYH 2AWNA 3ULJA 5C4XH 3H3VH 2CWPA 1QVGA 1D7QA 3A5UA 3UE0A 4C3JH 2UU9L 1Q86C 3CC2A 1TWFH 2WAQG 4DAMA 1VQLA 2NVTH 1SROA 3GTJH 1VQ7A 3BU2A 4X64Q 5M3FG 3CF5A 4LF9L 2K5HA 2OQKA 3G6EA 3CC7A 1YJNA 5M5WH 4X65Q 1QVCA 3CMAA 2LXKA 4DV5L 5M3FH 1EIFA 2PQAB 3M4OH 4POFA 1HNXQ 4A3IH 1QZGA 3G4SA 2UXCL 4IOCA 4JI4L 3A74A 2AWOA 1N34Q 4Y52H 1KQSA 1QUQA 3S2HH 3GTGH 3TREA 1M1KC 3EIVA 1HH2P 1VQFA 3IRBA 1EOVA 3RZOH 1GKHA 3F1ZA 4MTNA 2VW9A 4HIDA 4DV1Q 4JI7Q 4LF7L 4LF6L 1QVFA 2A8VA 5BR8Q 2KHJA 3H0GG 2DGYA 4YY3Q 2MO1A 2XTIA 2Z0SA 2F4VL 2UXDL 1KHIA 4KHZA 2NZHA 4AYBG 3J80c 4DV2L 3PUWA 2UUCQ 3K80C 1XMQL 5IYDG 2Q2IA 4R4IA 3VDYA 4BBSH 2Q2UA 2E5LL 4BXXG 4DV7Q 4X66Q 1GO3E 4DV6Q 3CCQA 4IO9A 1E3PA 1TWHH 1VQHA 3GDEA 1PH4A 1HR0Q 2NVQH 3HOUH 3GTMH 4BXXH 1XNRL 3ICEA 3K0XA 5ELNA 3OYYA 3PUZA 3L7ZC 4BA1I 5C0XI 3ERSX 1HNZQ 4GLXA 2FXQA 2CCZA 1L0WA 2UUAL 4AH6A 1XPUA 3PUYA 2R92H 1MJCA 4GS3A 1XTDA 3PF4A 1JJCB 2JA5H 1PYBA 2OWOA 4B3TQ 4P73A 2ASBA 2Z6KA 2PQAA 4NXNL 4IFDI 2ZJPA 2ZM6Q 2R7FA 3DM3A 1JE5A 3KOJA 4IPGA 5LMNQ 3KDFB 4A3BG 1JT8A 1NMGA 2IT1A 4JI8L 1EQRA 2JA8G 3JAMi 5DLQE 3AFQA 4JI0Q 4B3MQ 4NPSA 2JA7G 2JEBI 1SFOH 2B29A 1EFWA 1E1TA 2JA8H 3PO2G 3G48A 1MKHA 1H95A 1AE2A 3A5ZB 1YITA 4KHPL 1YI2A 3CC4A 3D31A 2E8GA 3HKZE 5ELOA 4DR4L 2HIVA 1X55A 4DV4L 4B3SL 3L0OA 1X9NA 5JJIA 1X56A 5C0XG 2BA0A 1N9WA 5JEAJ 1UEBA 4JI2L 1FL0A 1D8LA 2PI2E 3BJUA 4BY1G 2KENA 4DR1L 3L2PA 5GAHC 1PVOA 3TS2A 1MJEA 2AMCB 4PMWA 1N8RC 3TQYA 1CSQA 4DV0Q 1AH9A 1WI5A 4BY1H 1N32L 4A4IA 2K5NA 4YCVA 2JQOA 1Q1EA 4P71A 4IFDG 4LFBL 4JV5L 1MIUA 4DR5Q 3S1RH 5JJLA 5EAYA 1VQAA 1KL9A 5IYCG 4DR3L 1Q1BA 4EX5A 1CKOA 2NVXH 4K0KL 2ID0A 1IBKQ 4JI6L 2ZTCA 3W1BA 5IYCH 3S1NH 2K52A 3LGJA 4OWTB 2OCEA 4HJAA 3TS0A 1SR3A 3I56A 2IHFA 2V1CC 5FJ8G 3F2BA 4HJ7A 1X3EA 1NY4A 2KHIA 1V43A 1VQ4A 4LFAL 2B3GA 3E9HA 3NBHB 1L2FA 2YTYA 5FJ8H 3RLOA 1WOCA 1B70B 3K7UC 2LSSA 1G51A 3HKZG 2GVAA 2UU9Q 4LF4L 4GN5A 3J7ZC 4A3LH 1UE7A 1KRSA 2R93H 1GD7A 3TEHB 3PF5A 3STBD 3S16H 4UY8C 4GKKL 2YTXA 3ZJYC 2ZJQA 4KI0A 1TWGH 1K9MC 1Q8KA 3I2ZA 1B8AA 4L5SA 5GROA 2YV5A 4RG1A 4AYBE 2VUMH 1A0IA 5IE8A 2I5HA 1R9TH 4JI4Q 2AKWB 4O0AA 2IX1A 4DR7L 4A3FH 1KRTA 2E2HH 4LW1A 4TVAB 5IP7H 1EUJA 3M4PA 3PO3H 5LMUL 4A3JG 2HHHL 5K36G 4IJLA 1K73C 3KF6B 2UXBL 1OXUA 1YZ6A 4LF7Q 4LF6Q 5C4JH 1PH9A 4A3JH 1X3FA 2Q2HA 4Y7NH 3PGZA 3U58A 3T1YL 4LF5L 2D62A 4A3MG 3I4NG 2UXDQ 4LF8Q 4UPAA 1X54A 3K7AH 1SE8A 4DV2Q 3OW2A 1C7YA 1E7ZA 4ALPA 1XMQQ 1N33L 4O2DA 4JOIC 4MZ9A 5GAEC 1SLJA 3GTKH 3I4NH 1U5KA 3A0JA 3HOVG 4JI1Q 1DGSA 5LMNW 4GLVB 5IP9G 3CCUA 2VY3A 3UDFA 2OTJA 1E1OA 3WWVA 1BBWA 2D0OA 2R7ZG 1VQPA 1C0AA 5IP9H 4OX9L 1CKMA 3KLWA 2R7ZH 2B63G 2VQFL 1UWVA 2GVBA 4P72A 4LFCQ 1JMCA 4A76A 4NXML 1Y1VG 1SN8A 2OQ0A 1YIJA 1XPRA 1I5FA 4DUZL 4JI5L 3CP0A 3H0GH 2B63H 1Q82C 4A3GG 1KXLA 4WJ4A 1I3QH 2BH8A 3MEFA 1Y1VH 4DK3C 2L15A 4IJHA 1G291 5IYDH 1JJGA 3NENA 3CCLA 3MXNB 1RL2A 4JI8Q 1IBML 5FLXc 2C35B 3FHWA 4R4TA 3KJOA 3KF6A 1X6OA 4IPDA 4X64L 5HGQA 3PUXA 1PH8A 2EQSA 2PMZE 3K81C 3EN2A 4IOAA 3NELA 4BY7G 3I7FA 4YWKA 1I94L 4DR4Q 1YEZA 4B3SQ 4DPGA 1YJWA 3RNUA 1HNXL 3T1HL 4JBWA 4DUYL 3RLNA 5M5YH 1XMOQ 3S1MH 4BBRG 1YVCA 2Q2TA 2ES2A 4JI2Q 3J81c 1L1OB 4DR1Q 3PUVA 1SMXA 3BZCA 1PYSB 2GN5A 4GKJQ 4BBRH 4A3BH 4JYAL 4APVA 1GM5A 4C2MH 4QGUA 4LFBQ 1XNQL 4JV5Q 1U0LA 4XTCS 1EYGA 4KLKA 4YY3L 2JA7H 2Y0SE 1CKNB 4IPHA 4MNOA 2E2JH 1Z9FA 2UUBL 3GTPH 3PO2H 2K50A 2UUCL 2CKZB 2KBNA 3AYHB 1M90C 5JJKA 4GNXB 4LUZA 3U4VA 3W1GA 2EXDA 4IPCA 4NB3A 3STBC 2ZJRA 5FLMG 4JI6Q 4QL5A 3S24A 4DV3L 1P8LA 4HJ5A 3JC66 4AQYL 4DV6L 2JA6G 4GKKQ 1VS0A 3W5OA 1HR0L 4DR2L 1OXVA 1VQKA 3B6YA 2YU9H 2MNAA 4J15A 3F8TA 3RN2A 4YWLA 2JA6H 4LFAQ 1K0RA 1IBLL 3I4MG 1LUZA 3U4ZA 3HKSA 3U50C 3M3YH 2HIXA 2R7DA 3CMEA 4OWXB 1PV4A 3HOWG 3KJPA 5JEAG 3I4MH 3SGIA 3BZKA 1VQIA 1L1OC 2MQHA 2ALYB 4JBJA 5E7NA 4B3TL 5C3EG 2WB1E 4IFDJ 1X3GA 3CCJA 1UE1A 1J6QA 1WFQA 2WFWA 4YCWA 5AJ3L 3RZDH 1EQQA 4BA2I 2QGQA 5LMNL 3UDGA 4A93G 1GVPA 4GN3B 1VQOA 3KDFA 1J5EL 2E2IH 4A3EG 1VQDA 5GQOA 1W2BA 1L1OA 4YHHQ 1E22A 3TRZA 2YTVA 3CCEA 4A93H 2VQEL 1JJ2A 3ER0A 3I4OA 4P74A 4A3EH 4GNXC 4B3RL 2JA9A 1PHJA 3HOZG 2I5LX 2HHHQ 2Y0SG 3AFPA 2VNUD 1OTCA 4A3CG 4UP8A 1LTLA 4JBKA 1YHAA 2RHQB 3KFUA 4OO1I 1C9OA 2A1AA 2IY5B 3H3VI 3UE1A 2ZTDA 1HZBA 1I6HH 4LF9Q 1NTGA 1A8VA 1NMFA 2ZTEA 4R4OA 3PIPA 3T1YQ 4LF5Q 2JK8A 4DV5Q 3PIOA 2IHEA 1N33Q 2D0PA 3DLLA 1HNWL 4L5QA 4DR6L 3HOXG 2IX0A 1A62A 2UXCQ 1BVSA 3GTLH 3RLFA 3HOXH 4AIMA 1XPOA 5IWAL 1HR0W 3CCRA 1KAWA 1TWCH 2A19A 4DAYB 1E24A 4A3DG 2WB1G 2NVYH 2CFMA 2JJQA 3HFZB 2RHSB 1KD1C 1WCMG 2VQFQ 3CD6A 3RN5A 3CQZH 2F4VQ 1V9PA 4A3DH 4DUZQ 3GO5A 1AE3A 1Y1WG 4JI5Q 4LNQA 3CCVA 1LM0A 3HOYG 1TWAH 4A3MH 2E5LQ 1OXTA 3E9IA 3PSIA 4C3HH 3AEVA 4JBMA 4OO1G 1Y1WH 1WYDA 3KYHC 1FJGL 2MO0A 3ULPA 1IZ6A 1FGUA 4GLAC 3OTOL 3CPWA 2N3SA 3UDXA 1IBMQ 1VQEA 3HOVH 1XNRQ 4JOIA 5GADC 3CXCA 5IYBG 5GAGC 1Y14B 3F2DA 2K75A 3S15H 4JC0A 2UUAQ 1ASYA 1VQNA 2I0QA 3M85A 4X62L 4GN4B 5IYBH 4HJ8A 4A3IG 1I94Q 2KCTA 4JI3L 4NXNQ 1NJIC 2H5XA 3T1HQ 1BKBA 5M3MG 4DUYQ 1T9HA 4A3GH 1PFSA 2VZAA 4JCVE 1XJVA 4R4CA 1W3SA 3PCOB 2MFIA 5IY0A 1N36L 1VQGA 2PNHA 2XGTA 1Q7YC 4P75A 5M3MH 3M9BA 3S14H 4JYAQ 4WJ3M 3UDIA 2F52A 4C3IH 2ATWA 1P16A 2AHOB 1K83H 1XNQQ 4KHPQ 2N49A 1G6PA 4ME3A 4BBSG 2WP8J 4X65L 4DKAC 1S40A 1PA6A 1UE6A 2R6GA 2I5MX 3K8AA 4UP7A 2UUBQ 4LF8L 3JAMc 1VQ6A 4DV4Q 4HIOA 4LUVA 1NBWA 2N8NA 2NN6I 4BY7H 1FVIA 3HOUG 4FDBA 2F3IA 5J3BA 2LXJA 4DV3Q 1N34L 4YCUA 4JI1L 3FKIG 4EQ5A 3I55A 4AQYQ 4X6AH 1I50H 1SRUA 4XIGS 3J80i 4DR2Q 1PH6A 2R92G 3CW2C 2RCNA 3FKIH 1YHBA 3Q8DA 1N32Q 1IYJB 2CWAA 1HZAA 2Z6KC 3PV0A 4DV1L 1IBLQ 4QY7A 5BR8L 4JI7L 3GTQH 2JA5G 1Z47A 5M5XH 4LFCL 2N78A 1CSPA 2VL6A 1V1QA 2K5VA 3H15A 4DK6C 3CCMA 1HJPA 4DR3Q 4K0KQ 1YNXA 1VQ8A 5AJ3Q 1YBYA 3CCSA 3EBEA 4OONA 4X66L 4DV7L 1J5EQ 1Q12A 3J7A5 5FLMH 3M4QA 4RMFA 5C0XJ 4LWCA 2QEXA 2VQEQ 1HNZL 3F2CA 2NN6G 4HIMA 4B3RQ 1EIYB 1HZ9A 2VS1A 4YWMA 4TQUS 3D0FA 3J81i 4LF4Q 1TXYA 4PG3A 2EIFA 4QIWE 1KIXA 4JG2A 4PZ8A 3GTOH 2K14A 3HOWH 4LUOA 1O7IA 1EWIA
chains in the Genus database with same CATH superfamily
1MHWC 1F9PA 1YNNC 1VQ5A 2I46A 5COYA 2G9DA 4A75A 3J7YW 1KLGD 1B7YB 3DXJC 2CQOA 5HY6A 1BCPC 2QILA 3VYRA 2KCMA 2R3ZA 5FOBB 1SE2A 2BA1A 4OHJA 1YHQA 2WAQE 1Y1VB 1K28A 2F0JA 3QG1A 1D5ZC 1G2SA 3K0YA 1UE5A 1PH3A 3NHHA 3AQQA 2YYZA 1DOMA 5HURA 3DEPA 3U9OA 3IL8A 1SYCA 1K83B 4HIKA 5KIXA 5E3FA 4J8QA 3I8ZA 4RAUC 3A54A 3K5LA 4CDEC 3JAML 1WTXA 2NZOA 3QWNA 2QCPX 1SYGA 3GD7A 1K8AC 1WCMH 3G6JB 2QF7A 3SR1A 4BBRB 3PO3G 2NTSA 4QMGA 5ELFA 1RIPA 2FHTA 4ZKCB 1JB7A 3ULJA 4F88A 5CV7A 4RCNA 2WAQG 5M9OA 1VQLA 3GTJH 1X3PA 5M3FG 1Q3LA 1PYWD 1E2VA 1EQVA 2HDMA 2OQKA 4S3SA 1YJNA 1PDQA 2E75C 4DV5L 3CMAA 5M3FH 1ZXTA 1EIFA 2XWBB 3M4OH 1HNXQ 1QZGA 2YU9B 2UXCL 4RHRA 4IOCA 1KQSA 1M1KC 3IRBA 2PMZB 2L1BA 4MTNA 1QVFA 4LF7L 5BR8Q 4H13C 3H0GG 4WFN3 1AP0A 1PZJD 2MO1A 4YY3Q 2F4VL 5C6AA 3X3MA 1QNKA 2Q2IA 1U4RA 4KN7C 4RHSA 4EGVA 4DFAA 2FMCA 4IO9A 3GTMH 5C0XI 4BA1I 3HOZB 2DN8A 2FXQA 1I6HB 2M9VA 1L0WA 1VF7A 3PUYA 1XTDA 1JJCB 2OWOA 1JWSD 1JORA 2ZJPA 3IFTA 1HQMC 3KDFB 2BCOA 1NMGA 1D6EC 2IT1A 3V2TA 1TIID 1TWCB 5DLQE 3AFQA 4B3MQ 4NPSA 1EFWA 1H95A 3G48A 3SHLA 1HUMA 3A5ZB 4I7AA 4A3DB 4DXFA 1QNUA 2NN6H 3KUPA 3AMUA 3D31A 5ELOA 3HKZE 5JJIA 4C3HB 3I72A 3H94A 1VDZA 4EVOA 2KOLA 4PMWA 1N8RC 1RKNA 1CSQA 1PTOF 3TQYA 1ESFA 4A4IA 4IFDG 4LFBL 5G3LF 4DR5Q 3PQIA 4IFDH 5EAYA 3MC0B 4A3GB 2B2UA 1FR3A 5EKKA 4OWTB 3TS0A 1JOKA 4FF2A 4C3IB 1J8IA 1WOCA 3ND9A 3HKZG 1BUVT 2GVAA 4A3LH 1MI2A 4BBSB 1GD7A 3TEHB 3STBD 4UY8C 4KI0A 2MGSA 1Q8KA 1TVXA 1B8AA 3HOUB 1Y8NB 2NVQB 1STBA 4RG1A 5IE8A 1F2MA 2I5HA 4JI4Q 1K8OA 2AKWB 4IUPA 4LW1A 5IP7H 3OMCA 4IZ8A 5CGKA 3KF6B 4HMIA 2EJFC 2JA5B 1TS2A 1PH9A 4Y7NH 2KA7A 1O7ZA 1HFNA 4EQOA 4DV2Q 3OW2A 1N33L 2FJ2A 3A0JA 1BOSA 4JI1Q 3CCUA 3NXWA 5JPMC 1BBWA 1VQPA 1C0AA 2B2YA 3NPPA 1RTNA 2EYJA 3BYYB 3NTIA 4G4KA 3A55A 2I07B 2A74C 4LFCQ 1UWVA 1EEFD 1YNJD 2EVBA 1JMCA 1Y1VG 5IGDA 4NXML 5C3EB 1CTMA 4JI5L 2XWJB 3FVQA 3R2TA 1I3QH 5EBCA 3MEFA 1Y1VH 3KF8A 5EPJA 4IJHA 3DHQA 3SVMA 3CCLA 1LTBD 1B4OA 4PMCA 3MXNB 1RL2A 3TZDA 5IYDH 1IBML 1BQQT 2MP1A 1K3BC 2FFKB 4X64L 1A3UA 3IFDA 5ELEA 2PMZE 3NELA 1O7YA 4YWKA 2HUGA 4B3SQ 2PPBC 2HQEA 3Q23A 3TN2A 4IUNA 4DA2A 4NP5A 5IGEA 1XMOQ 3S1MH 4BBRG 2ES2A 2GN5A 4GKJQ 4BBRH 4A3BH 2VB2X 4APVA 1GM5A 4C2MH 3S16B 3C3LA 4KMUC 5C44B 1SNQA 2K50A 5JJKA 3AYHB 4HAEA 4GNXB 2JSOA 1R9TB 5EBDA 4IPCA 3STBC 4CJ1B 2ZJRA 4QL5A 4A3FB 4DV3L 5C4XB 5C0XH 3W5OA 4C3JB 1F2LA 1OO9B 1W6JA 2YU9H 5E4WC 2MNAA 2KEDA 4KHVA 2F0MA 1IBLL 4DF7A 3MXGA 3HKSA 2M2LA 2EYFA 1V1PB 3KJPA 2MQHA 1HTPA 2B2WA 3CCJA 1STEA 4BA2I 3UDGA 4GN3B 1VQOA 2PNRC 3GTPH 1L1OA 1FNUA 1PLFA 1JJ2A 2KCNA 3ER0A 4GNXC 2JA9A 3HOZG 2VNUD 3I70A 1OTCA 4UP8A 4A3CG 2RHQB 2IY5B 1C9OA 5T1GA 3H3VI 3UE1A 2ZTDA 1HZBA 4WORA 4CKBA 1I6HH 5LL6S 1WTWA 4G57A 4ZRZA 3T1YQ 4U68A 1SNPA 1YNJC 3MHBA 4CDCC 1HNWL 1JOOA 4BS9A 1LTGD 4RGMA 4X3KA 1PZKD 4B9WA 4DAYB 1TWCH 2HCIA 1IKMA 4A3DG 4FXGC 4KY6A 4MHEA 5D3IB 2JJQA 3Q22A 3HFZB 3CQZH 4A3DH 4C3HG 3DM1A 4DUZQ 3CCVA 1B53A 1LM0A 4HCSA 3HOYG 2E5LQ 1OXTA 3PSIA 4C3HH 3AEVA 4JBMA 1WYDA 1TS3A 4X3TA 4LMQD 3NBHA 1G2TA 1CQVA 4JOIA 4HEDA 3CXCA 3F2DA 1Y14B 4FXDA 2UUAQ 1VQNA 2I0QA 4R8NA 3SE0A 4X62L 4OELB 4HJ8A 1I94Q 4JI3L 2H5XA 3T1HQ 4DUYQ 4A3GH 1PFSA 2VZAA 4C56C 1KLUD 1N36L 1VQGA 1WTQA 1Q7YC 3M3YB 4C3IG 3S1RB 4JYAQ 3TMEA 3LWEA 3C1FA 4C3IH 1CZWA 1G6PA 4BBSG 4DKAC 1S40A 1UE6A 2R6GA 2I5MX 2E2IB 1U4LA 3BVMA 3BDOA 4BY7H 3SK4A 3HOUG 4FDBA 2LXJA 1CZGA 2PZTA 4EQ5A 1UUPA 4X6AH 3EROA 5A2QE 1PH6A 2RCNA 1IYJB 1HZAA 2Z6KC 4DV1L 1CT1D 3QOLA 2JA5G 1TWGB 1SJED 3E3XA 4FXKC 1T5EA 2CH4W 4DR3Q 2J4XA 5CBAE 2K6AA 5AJ3Q 3K58A 3Q0AA 4X66L 4KKSA 2QDLA 5CBEE 1SEBD 1HNZL 4G7OC 2JP1A 5L37A 4HIMA 2VS1A 5IIFA 4YWMA 3D0FA 4LF4Q 3FEWX 1TXYA 4XQNA 2C9OA 3HOWH 4DXGA 5K5PA 4GKKQ 2Z8LA 1VCIA 5C3EH 4GOPB 2QKIC 4DR6Q 1CUKA 2DUDA 3CPFA 1ENCA 2K4KA 5TSSA 1BBXC 4DR7Q 1VQJA 2Q8TA 4J6HA 4POGA 3HRZC 3EFXD 3SXHA 3VR3A 3H0GB 4UP9A 1CKNA 3Q24A 3OHXC 2B63B 1A63A 2F0TA 2OXPA 4KD4A 4R1JA 1Q46A 2RF4A 4RFBA 1KC8C 1STYA 1EYAA 4HTHA 3QR8A 1VQ9A 3E0EA 2DNEA 2RDFA 4PZ7A 5CR3A 1FJGQ 4DV0L 2F0FA 4G7HC 4WJWA 4MTKA 2AUKA 3VR6A 1EWCA 4KJOA 1ASZA 5FK9C 2B2TC 4L5TA 1WJJA 4PNYA 4L5RC 2EXZA 4GOPC 1B1ZA 2F0VA 3MVVA 5C44G 1VQBA 1IBKL 2VUMG 3BDCA 5DM73 5C44H 4A3FG 1IL8A 1EU3A 1RF2D 1X65A 5C4XG 3RR5A 4F7XA 4C3JG 2AQ1B 1PH2A 1Y8PB 2AWNA 5C4XH 1ILPA 5M5XB 2CWPA 3WOFA 1QVGA 3A5UA 4C3JH 3H3VH 3CC2A 2E2JB 4KTAA 1TWFH 4DAMA 1HRJA 5JOBA 1B9NA 3CF5A 3DWQA 4LF9L 3I4LA 4V0BA 5M5WH 4X65Q 1QVCA 1U4MA 2SDFA 2PQAB 2ENBA 4POFA 4A3IH 1A6XA 3G4SA 3NBIA 4Y52H 3GTGH 5CV6A 3VA5A 1QJOA 4LK1C 1GKHA 1EIGA 2XSCA 3F1ZA 1LO5D 2A8VA 4JI7Q 4LF6L 4XQJA 1ET9A 3I73A 2KHJA 2A6ED 3VYSA 2XTIA 1NUCA 3DMUA 2UXDL 1KHIA 2NZHA 4AYBG 3J80c 2UUCQ 3PUWA 2G9HD 3OMGA 1TT2A 4A93B 4O1NA 4DK1A 3OWFA 4DV7Q 1H9JA 5EKIA 1HR0Q 2XRSD 1XNRL 1Q90A 3K0XA 3OYYA 3L7ZC 3MTSA 3QB3A 3ITPA 4AH6A 1XPUA 4JVZA 1MJCA 5DNFA 1G91A 4NXNL 4IFDI 3G7LA 5EQ0A 2QW7A 5D65A 2SEBD 1STNA 3KOJA 1JE5A 5LMNQ 3HOXB 1JT8A 3QOJA 4N9PA 2JEBI 3I3CA 3TP8A 1E1TA 4I65A 1MKHA 2B8FA 1TS4A 3C46A 1YI2A 2E8GA 4F87A 1X55A 3L0OA 1X9NA 2VB3X 1STGA 2K32A 2PCFB 3AB9A 3I91A 5KYIA 1X56A 1Y1WB 3MAQA 4H0LC 3T16A 5CV9A 3BJUA 1D8LA 2PI2E 4JI2L 2F0UA 4DR1L 1PVOA 3L2PA 2EY1A 1MJEA 4MIUA 3S15B 4HR7B 1N32L 5CV4A 2A68D 4JV5L 3A8JE 4QB4A 3S1RH 3GQBA 4N8FA 5A2QL 1VQAA 3R8BA 4YIJA 1EY9A 1K8MA 1CKOA 1II3A 2F3WA 4K0KL 1RD9D 2ID0A 1SDFA 2ZTCA 4ILWA 5M3MB 3LGJA 3RZOB 2IHFA 1X3EA 1EYCA 4E6IA 1VQ4A 2B3GA 3E9HA 4OEMB 1EY6A 1L2FA 1A2TA 4IURA 2LSSA 1Y8OB 4CGYB 3J80L 3PF5A 2A6EC 2YTXA 2ZJQA 1EOTA 1TWGH 1K9MC 2ZXRA 1I50B 3LX0A 5GROA 4MN3A 4RWSC 4R8IA 1ICFB 2IX1A 1KRTA 3PO3H 3M4PA 1S5FD 2O5JC 5K36G 3H6MA 1OXUA 1A3TA 4LF7Q 5BN5A 2LFNA 1X3FA 2Q2HA 1HA5A 3MXUA 3BG3A 4LF5L 4LF8Q 4UPAA 1SE8A 4ALPA 3WDNA 1U5KA 1BO0A 4NMZA 3HOVG 2K7VA 5LMNW 1GUTA 3FPUB 3OIPA 2D0OA 2WACA 3T56B 4IALA 1V1OA 3GTOB 1I4PA 3KLWA 2NWGA 2B63G 4P72A 2F0EA 3IAYA 4A76A 3S2DB 1XPRA 2EYLA 3CP0A 3H0GH 2B63H 2KJXA 1ZYRD 1JJGA 1G291 4ID6A 3NENA 3T51B 1WTRA 1TY2A 5FLXc 2C35B 1PRTB 3FHWA 1WTHA 3KJOA 3KF6A 1X6OA 4IPDA 5HGQA 4IOAA 1PFBA 2A68C 3K81C 1PH8A 2NVXB 4PMBA 3S1QB 3S1NB 4K2KA 4IN3A 1PFMA 4KV6A 1HNXL 3S17B 1KDAA 1YVCA 4KN4C 3TP6A 2R93B 3VYUA 4QGUA 4LFBQ 5CMDA 4KLKA 4YY3L 4MNOA 4A3KB 5KNBA 2E2JH 2XVSA 1O80A 2EY5A 1PRTC 5FLMG 3S24A 3HOYB 4B08A 1RTOA 1SE4A 4AQYL 3MXNA 3OWEB 4DR2L 2LY7A 2CW0D 2RDGA 1VQKA 4XXEA 3F8TA 2NVTB 5C5MA 3CKIB 1LUZA 1SMYC 2TSSA 3OW7A 3U50C 2EJGC 2R7DA 5KYLA 3TP7A 5JEAG 2A73B 3K7AB 3BZKA 2Q8RE 2ALYB 4LAAA 3NTKA 4NKLA 1UE1A 1H9SA 4A93G 1VMCA 3H09A 1J5EL 3TRZA 1VQDA 4YHHQ 4JPBW 1E22A 4PV1C 4C1NK 4CDDC 2OT2A 1JWMD 4CHTB 4A93H 5KNCA 4L6TB 2VQEL 1TU2B 3I4OA 1UNSA 1LT4D 3AFPA 1C48A 5HGTA 2H4OA 3KFUA 2K5WA 2A1AA 2XNAC 3PIPA 1A8VA 4R4OA 4RGTA 3PIOA 2WINB 4OIJA 1XWEA 1N33Q 1TWHB 2N55A 3HOXG 2B39A 1ZYRC 3GTLH 3OIQA 3HOXH 3A56A 5IWAL 1V1PA 5BN4A 1DCZA 1E24A 2RHSB 1S5CD 1ZKOA 1EFID 3NTHA 1IYUA 1E2ZA 1Y1WG 4JI5Q 4LNQA 4FNFA 3D3RA 1Y1WH 5G3LD 1O78A 1SFOB 1CK1A 2MO0A 4CBVA 3ULPA 1G8ZD 1FGUA 2F0DA 4GLAC 3OTOL 2N3SA 1JICA 1IBMQ 2E76C 2JA7B 1WTOA 1S4ZA 2K5QA 1IW7D 1B2TA 5GAGC 1EY4A 2K75A 3S15H 4JC0A 3P75A 5C4ZA 3M85A 1HTLD 5IT9E 2HDLA 1AZQA 4DN4M 5JAVA 1NJIC 5M3MG 5KGUA 3PCOB 5IODA 1Y69U 3J7AV 2XGTA 5M3MH 4QF4A 3OOCA 2CW0C 3PIO3 1TR5A 1GUOA 2F52A 1P16A 1L0XB 1K83H 4KHPQ 4KJNA 1L0YB 2WP8J 1AFPA 1PA6A 4DV4Q 1I6VC 1GOZA 5J3BA 4DV3Q 1VMPA 2X6GA 4YCUA 4JI1L 1N34L 3I55A 1RCVD 1A2UA 1I50H 4XIGS 3J80i 2ZT9C 2R92G 3Q8DA 2CWAA 4R9WA 1IBLQ 4QY7A 2K04A 1I4HA 2RKSA 1Z47A 4LFCL 3H15A 2K5VA 2ZXOA 1XYIA 1E0BA 2VUMB 4K14A 1ILQA 1VQ8A 1GXDC 3P1HA 1YBYA 2E2HB 3CCSA 2EE1A 4OONA 1ZEQX 3BZDB 3KLRA 3LNNA 4RMFA 4LWCA 2FINB 5C4JB 3E0JA 1XXGA 3WOEA 2V4DA 5J22A 1HZ9A 4PG3A 3GTOH 3EVQA 4LUOA 1O7IA 2ZM6L 2JEAI 1XMOL 3S2DH 3QIAA 4FO2A 1HNWQ 1NR2A 1QZHA 4FF1A 3TP5A 4JI0L 4GKJL 2HQLA 2L5TA 2R7ZB 4IUTA 4HJ9A 5LMUQ 2B2UC 4CJ0B 2UXBQ 1PH7A 5JVH3 2J7ZA 1A3VA 3HOZH 1IW7C 3RUZA 4A3CH 4AYBB 2PI2A 3D8GA 3S1QH 1MGSA 1J9OA 4QJFA 4TKOB 1MSGA 1BBUA 1VQCA 4K2LA 3S14B 3LWUA 3S17H 1AZPA 5IT9c 1QUQB 2PZUA 2QA4A 5AFWA 4OXPA 4IUVA 1EY5A 2R93G 2K28A 2MUYA 1K8GA 1T5XD 3P7JA 4OX9Q 1IL2A 4A3KG 1H9RA 2JE6I 4X62Q 1NE3A 4ZCKA 4K8IA 1S5BD 4A3KH 4JI3Q 4R4QA 1EWHA 4GOPA 3KF8B 4DNIA 4XDXA 4KY5A 3OSOA 3VR2A 1RHPA 3G71A 1LYLA 4OIKA 3GTQB 4PZ6A 1N36Q 1I4RA 2F0QA 1IXRA 3HOYH 1D5MC 3UE0A 2L4NA 3V05A 2UU9L 1CQFA 2NVTH 1SROA 3BU2A 1RJTA 3EJIA 2E74C 2K5HA 1HQRD 1F9SA 2LXKA 4IUQA 3S9WA 1QCBD 1F77A 4RGOS 1DZ1A 2KECA 2B2YC 4K8JA 2JA6B 3A74A 3EIVA 1HH2P 1VQFA 1EOVA 3I4MB 2VW9A 4HIDA 4DV1Q 1S5ED 4ABNA 5CC4A 2DGYA 3CRKC 2WKDA 2Z0SA 1RDPD 3VR4A 1XMQL 3SK5A 1M8AA 4BBSH 2E5LL 1QOHA 2CQAA 2L0CA 3K6OA 4DAVA 5C4HA 1QWYA 2J0TD 1HUNA 4X66Q 1AW7A 1GO3E 4DV6Q 3CCQA 1I4GA 1E3PA 1TWHH 1VQHA 2Z4HA 3GDEA 4P2CB 1PH4A 2NVQH 3HOUH 5FO8B 5ELNA 1HNZQ 3PUZA 1GUGA 2CCZA 2Y0SB 3ERSX 4GLXA 1KAAA 2UUAL 2XRQD 4X3SA 3R93A 2NTTA 1A15A 2JA5H 1PYBA 1PFNA 4B3TQ 5DM63 2EY6A 2PQAA 1SAPA 2G5DA 4WRDA 2R7FA 3DM3A 4IPGA 2XIWA 4PQXA 5IT9L 2DJFC 4RCOA 4JI8L 1MD2D 1X32A 2EYHA 3J80E 2NVYB 5EPKA 2JA7G 1HCZA 1SFOH 2O4XA 3PO2G 5C3WA 1AE2A 2RDHA 3MWYW 1YITA 3CC4A 1LT6D 1WCMB 4DR4L 2KCCA 2HIVA 4FF4A 4ULLA 2BDNA 2Z1CA 5JEAJ 3O13A 3HP3A 3HOVB 3TS2A 2AUJD 1C8CA 4DV0Q 1AH9A 3GTJB 2B2WC 2K5NA 4YCVA 2JQOA 1Q1EA 4P71A 1VF5C 1ENAA 1MIUA 4RA8A 1JE4A 1BCPF 5EJWA 3H91A 4DR3L 4EX5A 1IBKQ 2HD3A 4JI6L 3W1BA 2DNCA 1B44D 2L11A 1SR3A 1UAPA 2V1CC 3F2BA 4HJ7A 5ELCA 1NY4A 4BWGB 2KHIA 1EYDA 4LFAL 2IL8A 3NBHB 2YTYA 3RLOA 1B70B 3K7UC 4LF4L 3W3AA 2IW3A 3J7ZC 1DYQA 3T4AC 1U9RA 2IJ0A 3S16H 4GKKL 3TZUA 3I2ZA 1STHA 1EY8A 1B50A 1DONA 4L5SA 2F0GA 4AYBE 2VUMH 3FKIB 1R9TH 1STAA 4O0AA 4DR7L 4A3FH 2E2HH 4TVAB 3VR5A 1EUJA 2HHHL 4KK7A 3NWSA 4IJLA 1K73C 2EOTA 2B2VC 2O5IC 1JC7A 4ZK9B 4LF6Q 5C4JH 1QE6A 3PGZA 2VXWA 5C3XA 2D62A 4A3MG 2UXDQ 1X54A 3X3NA 2X6LA 4V190 4JOIC 2RBMA 1SLJA 1LABA 1DGSA 1SBBB 3ERQA 2VY3A 2OTJA 1E1OA 3J7AF 2R7ZG 5EGTA 2RSOA 5C5LA 3RMHA 4X3UA 2R7ZH 2VQFL 4OGQC 2JN4A 1I5FA 4WJ4A 1EY0A 2P5ZX 4UHVA 2ICIA 2L15A 1CHQD 2LKVA 2NBFA 5JPNC 2KVMA 5I2XA 4HSVA 3DUZA 2EQSA 3EN2A 3NUCA 1WD1A 5CV5A 3A8IE 3I7FA 5E1FA 4XYOA 4LJZC 1YJWA 3GP7A 3RNUA 3R2IA 4JBWA 3V96A 5D3DA 3M7GA 2PO4A 4JI2Q 1IHZA 4DR1Q 3PUVA 1B3QA 2NB0A 3BZCA 1ENFA 3QO2A 4QIWB 1H9KA 1XNQL 4JV5Q 1DOLA 1U0LA 2AQ2B 1EYGA 1JCKB 2Y0SE 1CKNB 4IPHA 2UUBL 1Z9FA 2UUCL 1SYFA 2CKZB 1M90C 2A6HD 5FLXE 1LTTD 4NB3A 1LT5D 5ISRA 4HJ5A 1P8LA 2JA6G 1HR0L 2RA4A 4ZAIA 5I9PA 4L8JA 1U4PA 3RN2A 2JA6H 2IX3A 1K0RA 3I4MG 4Y7NB 1EL0A 4RGNA 1K0SA 3NP8A 3M3YH 3I90A 3CMEA 1PV4A 2EY2A 3I4MH 1DOKA 1VQIA 4JBJA 1TY0A 1X3GA 2K01A 1D2BA 1F9RA 1WFQA 4RH6A 2WFWA 1EQQA 3S2HB 2QGQA 5LMNL 1GVPA 1HPCA 3KDFA 2E2IH 3BYTB 5GQOA 1W2BA 3CCEA 4ZYSA 5ELDA 4B3RL 1PHJA 3FPPA 2I5LX 2Y0SG 3NE5B 4O42A 1LTLA 2BE5D 1BXTA 1MBYA 1YHAA 2OEOA 3GV6A 4ZUJA 2GA4B 3BVGA 1D1KA 4DNRB 1PRTD 1SNDA 1SNOA 1I3QB 1NTGA 2ZTEA 4LF5Q 4DV5Q 3D4RA 1E2WA 3SK6A 2Z6BA 2D0PA 4XT3B 4L5QA 1A62A 2UXCQ 1BVSA 1CFMA 2EJMA 1SMYD 1XPOA 2R92B 4U673 1HR0W 1LTID 1KAWA 2NVYH 5K36H 1GJXA 1KD1C 1WCMG 3RN5A 2F4VQ 1V9PA 3S1MB 1SNCA 5IGCA 3F2UA 3E6ZX 3HG9A 4CJ2C 4A3BB 3E9IA 2TMPA 4OO1G 4FYDA 1FD7D 4C2MB 4JW0A 2JA8B 3R3OA 4OO1H 3HOVH 2Z9HA 4TRDA 4EQNA 1EEID 5GADC 1PZID 2RQXA 2EYPA 1BNZA 3AU7A 4GN4B 1ESRA 2KCTA 5CORA 2A6HC 1KDCA 4JCVE 1XJVA 1WD0A 4BY1B 4R4CA 1W3SA 2MFIA 2F0LA 5DEHA 1QILA 1GHKA 3M9BA 3URYA 3K5MA 3UDIA 4WJ3M 2C5CA 3A7LA 2ATWA 2AHOB 4KKUA 5EPLA 2SNMA 1SYBA 1TQOA 3HS0C 3C2PA 4LF8L 1VQ6A 3GTPB 4LUVA 3HGBA 1NBWA 2N8NA 1CM9A 3HEJA 1FVIA 3KLSX 3ND8A 3TSSA 3FKIG 4AQYQ 1RODA 1SE3A 3ONAB 1SRUA 4DR2Q 5FO9B 1KTKA 3FKIH 2NYZD 3PV0A 4Z9CB 2RSNA 5BR8L 3T13A 1LT3D 5M5XH 1CSPA 2VL6A 1ONLA 2WIIB 1V1QA 2BE5C 4DK6C 3CCMA 1HJPA 3N6RA 1YNXA 1NR4A 4ODGA 3W2DA 5EKLA 1Q12A 1EQTA 1J5EQ 1AEXA 2AQ3B 4ZLTF 5FLMH 3M4QA 1UEAB 3A8KE 1FYCA 2VQEQ 1W6KA 1SJHD 4A3JB 3F2CA 1ET6A 1MSHA 1DXMA 2NN6G 4JK1C 3CQZB 1WTVA 1F2ZA 2X69A 3J81i 1FGBD 4Q5VA 4QIWE 2EIFA 4PZ8A 2K14A 3I4NB 3GTKB 3IKJA 1EWIA 5I9OA 5JEAH 4H02A 3CAMA 3NEMA 3L3OC 1S72A 4FP5D 3L9AX 1B3AA 1YJ9A 1LTSD 5H1SE 4B3ML 1Q81C 1JR0D 5IWAQ 1TS5A 1HXYD 2QDBA 4DU9A 3FP9A 3M7NA 2OTLA 1HZCA 2N88A 4K5VA 5DAUA 2F0HA 4Q0FA 4GNXA 2RVLA 1Q8IA 4H44C 1ML0D 1OXXK 5IGFA 5LL6X 1ICWA 1NAPA 3EA6A 1S3OA 2EDGA 3ULLA 5FLXL 2OF1A 1K3RA 3OTOQ 3DWPA 4A3LG 2EPBA 2BH2A 1FNWA 1PXUA 4DAPA 5I6YA 4DR5L 1VQMA 1JQYD 4BY7B 1GUNA 4K5XA 4HN7A 5M5YB 1G6ZA 4NXMQ 4QQBX 1SSOA 1OXSC 1PTOD 2IWHA 2QEJC 5I4DA 3J81j 5LHY1 1JOQA 3K5OA 4YHHL 5IP7G 1Z7TA 1PH5A 2HT1A 3NWTA 4OWWB 2F0SA 5CYUA 1LTAD 1PH1A 2EZVA 1M4VA 4ZUIA 4IQZA 1D7QA 1SYEA 1Q86C 3PO2B 1HA6A 1H9MA 5JVG3 4I7ZC 2Q8IB 1VQ7A 4X64Q 3G6EA 3CC7A 2RCFA 3K57A 5IOCA 1B9MA 3KLSA 1LV9A 4CKEA 1WTPA 4JI4L 2AWOA 1N34Q 3S2HH 1QUQA 3TREA 3PIP3 1EZ6A 3RZOH 3VYTA 4DAYA 1D1IA 2O2LD 3HOWB 2F0WA 2E2DC 1O7LA 3RZDB 1CI3M 4KHZA 4DV2L 3K80C 5IYDG 4R4IA 3VDYA 2Q2UA 4EQPA 3MFGA 2A69D 4A3EB 2F0KA 2PW5A 4BXXG 4XYQA 1EZ8A 1QG7A 4BXXH 3ICEA 5BN3A 2R92H 1PTOB 1AN8A 1CA5A 4GS3A 3PF4A 2PQEA 4P73A 4DK0A 5KNDA 2Z6KA 2ASBA 2BOSA 4G7ZC 2K5DA 2BDOA 2ZM6Q 1H9SB 4KD3A 1NCVA 4A3BG 4XQQA 4NDXA 1BDOA 1EQRA 3JAMi 2JA8G 2PYKA 4JI0Q 2F0PA 2B29A 2JA8H 4KHPL 2WB1B 2K03A 2F1MA 4XT1B 1S5DD 3MXPA 3MZ5A 1TWAB 4DV4L 4A3MB 4B3SL 5C0XG 2BA0A 1N9WA 2F0IA 3NSWA 1UEBA 1FL0A 4BY1G 1PTOC 2KENA 2XN9C 5GAHC 2FMMA 2AMCB 1TWFB 3EQLC 1WI5A 4BY1H 4N8X1 2PW7A 5M5WB 5JJLA 3J81E 1KL9A 4C1NI 5IYCG 4A3IB 1Q1BA 2NVXH 1SYDA 4KY7A 1KDBA 5IYCH 3GTGB 3S1NH 2K52A 2OCEA 4HJAA 3D4WA 3I56A 2JXMB 2DY7A 4K6LA 5FJ8G 3T53B 1V43A 3RD4A 3C1EA 5FJ8H 2UU9Q 1NSNS 1G51A 4GN5A 2PZWA 1UE7A 1KRSA 3H3VC 2CVRA 2KHSA 4HCEA 2R93H 1V8QA 2SNSA 5T1IA 1QB5D 3ZJYC 2B2TA 2LMCB 2KEEA 2YV5A 1A0IA 1HFGA 2F4IA 1IKLA 2A5HA 2A69C 3K59A 1GHJA 5LMUL 4A3JG 2K05A 2UXBL 2SOBA 2L55A 1YZ6A 3CHBD 1DM0B 4A3JH 4CDFC 3BS1A 3U58A 3T1YL 3FDTA 3I4NG 5ELBA 3K7AH 1C7YA 5IGGA 1E7ZA 2B2VA 3FRPB 1XMQQ 4O2DA 2L12A 4MZ9A 5GAEC 3GTKH 3I4NH 2CHBD 3QJYA 3NK9A 4GLVB 5IP9G 2DY8A 3NQTA 1KNEA 3UDFA 3WWVA 5IP9H 1BR9A 1X3QA 4NW2A 4OX9L 1CKMA 1XTCD 2GVBA 1Z6HA 2B8GA 3CU7A 1SN8A 2OQ0A 1YIJA 4A3GG 1KXLA 4DUZL 1Q82C 3CRLC 5J39A 2BH8A 2MHVA 4DK3C 1WVLA 1PMRA 2D9UA 4UDUC 5NUCA 1GUWA 3M4YA 4JI8Q 2F0OA 4R4TA 4GZYC 2NUCA 3PUXA 3FMCA 1EY7A 4BY7G 1I94L 4DR4Q 1YEZA 4ME5A 4TSSA 1R4QB 3SK8A 4DPGA 1LACA 3T1HL 4DUYL 2KQ3A 3RLNA 5M5YH 3E5SA 1SNMA 2Q2TA 2H1EA 3J81c 1L1OB 2D5DA 1SMXA 3D6CA 1PYSB 4QCLA 1FNVA 4JYAL 4M1UB 2DJGC 4XTCS 1C4QA 2JA7H 3PO2H 1KNAA 1R4PB 2KBNA 4LUZA 3U4VA 3W1GA 2EXDA 2K1BA 4JI6Q 3OPOA 3P20A 1IYVA 3SDZA 3JC66 3PO3B 4DV6L 1VS0A 4OL7A 2L9HA 1I4XA 1OXVA 1XX8A 3B6YA 4J15A 2EYOA 3DEOA 3Q6SA 4YWLA 3JAME 4LFAQ 3U4ZA 1EIHA 3U9SA 4J1MA 2WAQB 2HIXA 3HOWG 4OWXB 5M3FB 1KABA 3SGIA 2R61A 1L1OC 5IGBA 4K6DA 5E7NA 3M4OB 4B3TL 2WV6D 5KEEA 5C3EG 2WB1E 5FKAC 4IFDJ 1J6QA 1SXTA 4YCWA 4N9TA 5AJ3L 3RZDH 3DWAA 4B9XA 2EYMA 1JB3A 4F8MA 4M8AA 4RKLA 4A3EG 2YTVA 4A3EH 4P74A 2HHHQ 2ICEC 4JBKA 1I4QA 4OO1I 3PMFA 4IUUA 3D6WA 4QUCA 4QUFA 1F9QA 2Z4IA 4LF9Q 1NMFA 2JK8A 1PTOH 2WKCA 2CH4A 2IHEA 4KKTA 3DLLA 2D2CC 4HSPA 3GTMB 4DR6L 2IX0A 2JYOA 4RKBA 4ZKBB 3RLFA 2LS01 4AIMA 2MPMA 3CCRA 4L63B 2MJ8A 2A19A 5I6WA 2WB1G 1LTRD 3GV3A 2CFMA 2VQFQ 3N52A 4FF3A 3CD6A 1YNND 2KUMA 3TBIB 3GO5A 1AE3A 2HCCA 1TWAH 4A3MH 3J81L 4DNTB 3KYHC 1FJGL 1IZ6A 3CPWA 1BCPD 3UDXA 1VQEA 1XNRQ 3K5NA 3TDQA 5IYBG 4ZQ3A 1ASYA 3BDLA 5IYBH 1NNXA 4A3IG 3D4DA 3HZXA 3A7AB 3KBGA 4UAIA 5FO7B 3BVZA 4NXNQ 1BKBA 1D5XC 1T9HA 1EU4A 5IY0A 3KBXA 1CHPD 2PNHA 1JWUD 4P75A 3MA2B 3S14H 3UI2A 1F2YA 3VA7A 2NZ1D 2F3VA 1TKWB 1BF4A 1XNQQ 4DGZA 2N49A 4ME3A 4X65L 2UUBQ 3K8AA 4UP7A 2K33A 3JAMc 2F03A 4HIOA 3MFYA 2NN6I 2F3IA 5F2DA 3CW2C 1YHBA 1N32Q 5E4XA 4JI7L 3GTQH 3HKZB 5CV8A 3ZYYX 2N78A 3MEHA 2F0NA 4H7BA 4FVMA 4K0KQ 3NQIA 3GTLB 1BCPB 1GUSA 1PRTF 4K5WA 3EBEA 4DV7L 3J7A5 1DD2A 5A35A 1DJRD 3KK7A 3SEBA 5C0XJ 2QEXA 5JJZA 1HHVA 5I2YA 4B3RQ 1EIYB 2IPKD 5D14A 2ZXPA 4TQUS 1CA6A 4CKCA 1KIXA 4JG2A 4HMJA 2M00A 5KRUA 5J1ZA 1LLRD
chains in the Genus database with same CATH topology
4H02A 2ZM6L 2JEAI 1XMOL 3S2DH 1VCIA 1VQ5A 5C3EH 1HNWQ 4GOPB 3CAMA 3NEMA 1S72A 4DR6Q 1CUKA 2DUDA 1QZHA 1YJ9A 4A75A 3CPFA 4JI0L 4GKJL 5H1SE 4B3ML 2K4KA 4DR7Q 2HQLA 1Q81C 1VQJA 1B7YB 2CQOA 5LMUQ 4HJ9A 5IWAQ 4POGA 5HY6A 2UXBQ 1PH7A 2KCMA 2BA1A 1YHQA 3FP9A 4UP9A 1CKNA 3M7NA 2OTLA 1HZCA 3HOZH 1A63A 4A3CH 2WAQE 4R1JA 1Q46A 4GNXA 2PI2A 2RF4A 1KC8C 3S1QH 1OXXK 4QJFA 1BBUA 1UE5A 1PH3A 1VQCA 1VQ9A 3AQQA 3E0EA 1S3OA 3S17H 3ULLA 4PZ7A 2YYZA 1FJGQ 4DV0L 5IT9c 1QUQB 1K3RA 3OTOQ 4HIKA 1ASZA 2QA4A 4A3LG 4OXPA 4L5TA 1WJJA 2R93G 2BH2A 4DR5L 1VQMA 1K8GA 4L5RC 4GOPC 4OX9Q 1IL2A 5C44G 4A3KG 2JE6I 2NZOA 1VQBA 4X62Q 3GD7A 1NE3A 1IBKL 4NXMQ 2VUMG 4QQBX 5C44H 4A3KH 1OXSC 1K8AC 1WCMH 4JI3Q 3J81j 4A3FG 1X65A 4R4QA 4GOPA 3KF8B 4YHHL 5IP7G 4DNIA 3RR5A 1PH5A 2HT1A 3PO3G 5C4XG 4OWWB 3G71A 1LYLA 1PH1A 4PZ6A 1RIPA 1PH2A 1N36Q 1IXRA 1JB7A 3HOYH 2AWNA 3ULJA 5C4XH 3H3VH 2CWPA 1QVGA 1D7QA 3A5UA 3UE0A 4C3JH 2UU9L 1Q86C 3CC2A 1TWFH 2WAQG 4DAMA 1VQLA 2NVTH 1SROA 3GTJH 1VQ7A 3BU2A 4X64Q 5M3FG 3CF5A 4LF9L 2K5HA 2OQKA 3G6EA 3CC7A 1YJNA 5M5WH 4X65Q 1QVCA 3CMAA 2LXKA 4DV5L 5M3FH 1EIFA 2PQAB 3M4OH 4POFA 1HNXQ 4A3IH 1QZGA 3G4SA 2UXCL 4IOCA 4JI4L 3A74A 2AWOA 1N34Q 4Y52H 1KQSA 1QUQA 3S2HH 3GTGH 3TREA 1M1KC 3EIVA 1HH2P 1VQFA 3IRBA 1EOVA 3RZOH 1GKHA 3F1ZA 4MTNA 2VW9A 4HIDA 4DV1Q 4JI7Q 4LF7L 4LF6L 1QVFA 2A8VA 5BR8Q 2KHJA 3H0GG 2DGYA 4YY3Q 2MO1A 2XTIA 2Z0SA 2F4VL 2UXDL 1KHIA 4KHZA 2NZHA 4AYBG 3J80c 4DV2L 3PUWA 2UUCQ 3K80C 1XMQL 5IYDG 2Q2IA 4R4IA 3VDYA 4BBSH 2Q2UA 2E5LL 4BXXG 4DV7Q 4X66Q 1GO3E 4DV6Q 3CCQA 4IO9A 1E3PA 1TWHH 1VQHA 3GDEA 1PH4A 1HR0Q 2NVQH 3HOUH 3GTMH 4BXXH 1XNRL 3ICEA 3K0XA 5ELNA 3OYYA 3PUZA 3L7ZC 4BA1I 5C0XI 3ERSX 1HNZQ 4GLXA 2FXQA 2CCZA 1L0WA 2UUAL 4AH6A 1XPUA 3PUYA 2R92H 1MJCA 4GS3A 1XTDA 3PF4A 1JJCB 2JA5H 1PYBA 2OWOA 4B3TQ 4P73A 2ASBA 2Z6KA 2PQAA 4NXNL 4IFDI 2ZJPA 2ZM6Q 2R7FA 3DM3A 1JE5A 3KOJA 4IPGA 5LMNQ 3KDFB 4A3BG 1JT8A 1NMGA 2IT1A 4JI8L 1EQRA 2JA8G 3JAMi 5DLQE 3AFQA 4JI0Q 4B3MQ 4NPSA 2JA7G 2JEBI 1SFOH 2B29A 1EFWA 1E1TA 2JA8H 3PO2G 3G48A 1MKHA 1H95A 1AE2A 3A5ZB 1YITA 4KHPL 1YI2A 3CC4A 3D31A 2E8GA 3HKZE 5ELOA 4DR4L 2HIVA 1X55A 4DV4L 4B3SL 3L0OA 1X9NA 5JJIA 1X56A 5C0XG 2BA0A 1N9WA 5JEAJ 1UEBA 4JI2L 1FL0A 1D8LA 2PI2E 3BJUA 4BY1G 2KENA 4DR1L 3L2PA 5GAHC 1PVOA 3TS2A 1MJEA 2AMCB 4PMWA 1N8RC 3TQYA 1CSQA 4DV0Q 1AH9A 1WI5A 4BY1H 1N32L 4A4IA 2K5NA 4YCVA 2JQOA 1Q1EA 4P71A 4IFDG 4LFBL 4JV5L 1MIUA 4DR5Q 3S1RH 5JJLA 5EAYA 1VQAA 1KL9A 5IYCG 4DR3L 1Q1BA 4EX5A 1CKOA 2NVXH 4K0KL 2ID0A 1IBKQ 4JI6L 2ZTCA 3W1BA 5IYCH 3S1NH 2K52A 3LGJA 4OWTB 2OCEA 4HJAA 3TS0A 1SR3A 3I56A 2IHFA 2V1CC 5FJ8G 3F2BA 4HJ7A 1X3EA 1NY4A 2KHIA 1V43A 1VQ4A 4LFAL 2B3GA 3E9HA 3NBHB 1L2FA 2YTYA 5FJ8H 3RLOA 1WOCA 1B70B 3K7UC 2LSSA 1G51A 3HKZG 2GVAA 2UU9Q 4LF4L 4GN5A 3J7ZC 4A3LH 1UE7A 1KRSA 2R93H 1GD7A 3TEHB 3PF5A 3STBD 3S16H 4UY8C 4GKKL 2YTXA 3ZJYC 2ZJQA 4KI0A 1TWGH 1K9MC 1Q8KA 3I2ZA 1B8AA 4L5SA 5GROA 2YV5A 4RG1A 4AYBE 2VUMH 1A0IA 5IE8A 2I5HA 1R9TH 4JI4Q 2AKWB 4O0AA 2IX1A 4DR7L 4A3FH 1KRTA 2E2HH 4LW1A 4TVAB 5IP7H 1EUJA 3M4PA 3PO3H 5LMUL 4A3JG 2HHHL 5K36G 4IJLA 1K73C 3KF6B 2UXBL 1OXUA 1YZ6A 4LF7Q 4LF6Q 5C4JH 1PH9A 4A3JH 1X3FA 2Q2HA 4Y7NH 3PGZA 3U58A 3T1YL 4LF5L 2D62A 4A3MG 3I4NG 2UXDQ 4LF8Q 4UPAA 1X54A 3K7AH 1SE8A 4DV2Q 3OW2A 1C7YA 1E7ZA 4ALPA 1XMQQ 1N33L 4O2DA 4JOIC 4MZ9A 5GAEC 1SLJA 3GTKH 3I4NH 1U5KA 3A0JA 3HOVG 4JI1Q 1DGSA 5LMNW 4GLVB 5IP9G 3CCUA 2VY3A 3UDFA 2OTJA 1E1OA 3WWVA 1BBWA 2D0OA 2R7ZG 1VQPA 1C0AA 5IP9H 4OX9L 1CKMA 3KLWA 2R7ZH 2B63G 2VQFL 1UWVA 2GVBA 4P72A 4LFCQ 1JMCA 4A76A 4NXML 1Y1VG 1SN8A 2OQ0A 1YIJA 1XPRA 1I5FA 4DUZL 4JI5L 3CP0A 3H0GH 2B63H 1Q82C 4A3GG 1KXLA 4WJ4A 1I3QH 2BH8A 3MEFA 1Y1VH 4DK3C 2L15A 4IJHA 1G291 5IYDH 1JJGA 3NENA 3CCLA 3MXNB 1RL2A 4JI8Q 1IBML 5FLXc 2C35B 3FHWA 4R4TA 3KJOA 3KF6A 1X6OA 4IPDA 4X64L 5HGQA 3PUXA 1PH8A 2EQSA 2PMZE 3K81C 3EN2A 4IOAA 3NELA 4BY7G 3I7FA 4YWKA 1I94L 4DR4Q 1YEZA 4B3SQ 4DPGA 1YJWA 3RNUA 1HNXL 3T1HL 4JBWA 4DUYL 3RLNA 5M5YH 1XMOQ 3S1MH 4BBRG 1YVCA 2Q2TA 2ES2A 4JI2Q 3J81c 1L1OB 4DR1Q 3PUVA 1SMXA 3BZCA 1PYSB 2GN5A 4GKJQ 4BBRH 4A3BH 4JYAL 4APVA 1GM5A 4C2MH 4QGUA 4LFBQ 1XNQL 4JV5Q 1U0LA 4XTCS 1EYGA 4KLKA 4YY3L 2JA7H 2Y0SE 1CKNB 4IPHA 4MNOA 2E2JH 1Z9FA 2UUBL 3GTPH 3PO2H 2K50A 2UUCL 2CKZB 2KBNA 3AYHB 1M90C 5JJKA 4GNXB 4LUZA 3U4VA 3W1GA 2EXDA 4IPCA 4NB3A 3STBC 2ZJRA 5FLMG 4JI6Q 4QL5A 3S24A 4DV3L 1P8LA 4HJ5A 3JC66 4AQYL 4DV6L 2JA6G 4GKKQ 1VS0A 3W5OA 1HR0L 4DR2L 1OXVA 1VQKA 3B6YA 2YU9H 2MNAA 4J15A 3F8TA 3RN2A 4YWLA 2JA6H 4LFAQ 1K0RA 1IBLL 3I4MG 1LUZA 3U4ZA 3HKSA 3U50C 3M3YH 2HIXA 2R7DA 3CMEA 4OWXB 1PV4A 3HOWG 3KJPA 5JEAG 3I4MH 3SGIA 3BZKA 1VQIA 1L1OC 2MQHA 2ALYB 4JBJA 5E7NA 4B3TL 5C3EG 2WB1E 4IFDJ 1X3GA 3CCJA 1UE1A 1J6QA 1WFQA 2WFWA 4YCWA 5AJ3L 3RZDH 1EQQA 4BA2I 2QGQA 5LMNL 3UDGA 4A93G 1GVPA 4GN3B 1VQOA 3KDFA 1J5EL 2E2IH 4A3EG 1VQDA 5GQOA 1W2BA 1L1OA 4YHHQ 1E22A 3TRZA 2YTVA 3CCEA 4A93H 2VQEL 1JJ2A 3ER0A 3I4OA 4P74A 4A3EH 4GNXC 4B3RL 2JA9A 1PHJA 3HOZG 2I5LX 2HHHQ 2Y0SG 3AFPA 2VNUD 1OTCA 4A3CG 4UP8A 1LTLA 4JBKA 1YHAA 2RHQB 3KFUA 4OO1I 1C9OA 2A1AA 2IY5B 3H3VI 3UE1A 2ZTDA 1HZBA 1I6HH 4LF9Q 1NTGA 1A8VA 1NMFA 2ZTEA 4R4OA 3PIPA 3T1YQ 4LF5Q 2JK8A 4DV5Q 3PIOA 2IHEA 1N33Q 2D0PA 3DLLA 1HNWL 4L5QA 4DR6L 3HOXG 2IX0A 1A62A 2UXCQ 1BVSA 3GTLH 3RLFA 3HOXH 4AIMA 1XPOA 5IWAL 1HR0W 3CCRA 1KAWA 1TWCH 2A19A 4DAYB 1E24A 4A3DG 2WB1G 2NVYH 2CFMA 2JJQA 3HFZB 2RHSB 1KD1C 1WCMG 2VQFQ 3CD6A 3RN5A 3CQZH 2F4VQ 1V9PA 4A3DH 4DUZQ 3GO5A 1AE3A 1Y1WG 4JI5Q 4LNQA 3CCVA 1LM0A 3HOYG 1TWAH 4A3MH 2E5LQ 1OXTA 3E9IA 3PSIA 4C3HH 3AEVA 4JBMA 4OO1G 1Y1WH 1WYDA 3KYHC 1FJGL 2MO0A 3ULPA 1IZ6A 1FGUA 4GLAC 3OTOL 3CPWA 2N3SA 3UDXA 1IBMQ 1VQEA 3HOVH 1XNRQ 4JOIA 5GADC 3CXCA 5IYBG 5GAGC 1Y14B 3F2DA 2K75A 3S15H 4JC0A 2UUAQ 1ASYA 1VQNA 2I0QA 3M85A 4X62L 4GN4B 5IYBH 4HJ8A 4A3IG 1I94Q 2KCTA 4JI3L 4NXNQ 1NJIC 2H5XA 3T1HQ 1BKBA 5M3MG 4DUYQ 1T9HA 4A3GH 1PFSA 2VZAA 4JCVE 1XJVA 4R4CA 1W3SA 3PCOB 2MFIA 5IY0A 1N36L 1VQGA 2PNHA 2XGTA 1Q7YC 4P75A 5M3MH 3M9BA 3S14H 4JYAQ 4WJ3M 3UDIA 2F52A 4C3IH 2ATWA 1P16A 2AHOB 1K83H 1XNQQ 4KHPQ 2N49A 1G6PA 4ME3A 4BBSG 2WP8J 4X65L 4DKAC 1S40A 1PA6A 1UE6A 2R6GA 2I5MX 3K8AA 4UP7A 2UUBQ 4LF8L 3JAMc 1VQ6A 4DV4Q 4HIOA 4LUVA 1NBWA 2N8NA 2NN6I 4BY7H 1FVIA 3HOUG 4FDBA 2F3IA 5J3BA 2LXJA 4DV3Q 1N34L 4YCUA 4JI1L 3FKIG 4EQ5A 3I55A 4AQYQ 4X6AH 1I50H 1SRUA 4XIGS 3J80i 4DR2Q 1PH6A 2R92G 3CW2C 2RCNA 3FKIH 1YHBA 3Q8DA 1N32Q 1IYJB 2CWAA 1HZAA 2Z6KC 3PV0A 4DV1L 1IBLQ 4QY7A 5BR8L 4JI7L 3GTQH 2JA5G 1Z47A 5M5XH 4LFCL 2N78A 1CSPA 2VL6A 1V1QA 2K5VA 3H15A 4DK6C 3CCMA 1HJPA 4DR3Q 4K0KQ 1YNXA 1VQ8A 5AJ3Q 1YBYA 3CCSA 3EBEA 4OONA 4X66L 4DV7L 1J5EQ 1Q12A 3J7A5 5FLMH 3M4QA 4RMFA 5C0XJ 4LWCA 2QEXA 2VQEQ 1HNZL 3F2CA 2NN6G 4HIMA 4B3RQ 1EIYB 1HZ9A 2VS1A 4YWMA 4TQUS 3D0FA 3J81i 4LF4Q 1TXYA 4PG3A 2EIFA 4QIWE 1KIXA 4JG2A 4PZ8A 3GTOH 2K14A 3HOWH 4LUOA 1O7IA 1EWIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4H02 A;  2ZM6 L;  2JEA I;  1XMO L;  3S2D H;  1VCI A;  1VQ5 A;  5C3E H;  1HNW Q;  4GOP B;  3CAM A;  3NEM A;  1S72 A;  4DR6 Q;  1CUK A;  2DUD A;  1QZH A;  1YJ9 A;  4A75 A;  3CPF A;  4JI0 L;  4GKJ L;  5H1S E;  4B3M L;  2K4K A;  4DR7 Q;  2HQL A;  1Q81 C;  1VQJ A;  1B7Y B;  2CQO A;  5LMU Q;  4HJ9 A;  5IWA Q;  4POG A;  5HY6 A;  2UXB Q;  1PH7 A;  2KCM A;  2BA1 A;  1YHQ A;  3FP9 A;  4UP9 A;  1CKN A;  3M7N A;  2OTL A;  1HZC A;  3HOZ H;  1A63 A;  4A3C H;  2WAQ E;  4R1J A;  1Q46 A;  4GNX A;  2PI2 A;  2RF4 A;  1KC8 C;  3S1Q H;  1OXX K;  4QJF A;  1BBU A;  1UE5 A;  1PH3 A;  1VQC A;  1VQ9 A;  3AQQ A;  3E0E A;  1S3O A;  3S17 H;  3ULL A;  4PZ7 A;  2YYZ A;  1FJG Q;  4DV0 L;  5IT9 c;  1QUQ B;  1K3R A;  3OTO Q;  4HIK A;  1ASZ A;  2QA4 A;  4A3L G;  4OXP A;  4L5T A;  1WJJ A;  2R93 G;  2BH2 A;  4DR5 L;  1VQM A;  1K8G A;  4L5R C;  4GOP C;  4OX9 Q;  1IL2 A;  5C44 G;  4A3K G;  2JE6 I;  2NZO A;  1VQB A;  4X62 Q;  3GD7 A;  1NE3 A;  1IBK L;  4NXM Q;  2VUM G;  4QQB X;  5C44 H;  4A3K H;  1OXS C;  1K8A C;  1WCM H;  4JI3 Q;  3J81 j;  4A3F G;  1X65 A;  4R4Q A;  4GOP A;  3KF8 B;  4YHH L;  5IP7 G;  4DNI A;  3RR5 A;  1PH5 A;  2HT1 A;  3PO3 G;  5C4X G;  4OWW B;  3G71 A;  1LYL A;  1PH1 A;  4PZ6 A;  1RIP A;  1PH2 A;  1N36 Q;  1IXR A;  1JB7 A;  3HOY H;  2AWN A;  3ULJ A;  5C4X H;  3H3V H;  2CWP A;  1QVG A;  1D7Q A;  3A5U A;  3UE0 A;  4C3J H;  2UU9 L;  1Q86 C;  3CC2 A;  1TWF H;  2WAQ G;  4DAM A;  1VQL A;  2NVT H;  1SRO A;  3GTJ H;  1VQ7 A;  3BU2 A;  4X64 Q;  5M3F G;  3CF5 A;  4LF9 L;  2K5H A;  2OQK A;  3G6E A;  3CC7 A;  1YJN A;  5M5W H;  4X65 Q;  1QVC A;  3CMA A;  2LXK A;  4DV5 L;  5M3F H;  1EIF A;  2PQA B;  3M4O H;  4POF A;  1HNX Q;  4A3I H;  1QZG A;  3G4S A;  2UXC L;  4IOC A;  4JI4 L;  3A74 A;  2AWO A;  1N34 Q;  4Y52 H;  1KQS A;  1QUQ A;  3S2H H;  3GTG H;  3TRE A;  1M1K C;  3EIV A;  1HH2 P;  1VQF A;  3IRB A;  1EOV A;  3RZO H;  1GKH A;  3F1Z A;  4MTN A;  2VW9 A;  4HID A;  4DV1 Q;  4JI7 Q;  4LF7 L;  4LF6 L;  1QVF A;  2A8V A;  5BR8 Q;  2KHJ A;  3H0G G;  2DGY A;  4YY3 Q;  2MO1 A;  2XTI A;  2Z0S A;  2F4V L;  2UXD L;  1KHI A;  4KHZ A;  2NZH A;  4AYB G;  3J80 c;  4DV2 L;  3PUW A;  2UUC Q;  3K80 C;  1XMQ L;  5IYD G;  2Q2I A;  4R4I A;  3VDY A;  4BBS H;  2Q2U A;  2E5L L;  4BXX G;  4DV7 Q;  4X66 Q;  1GO3 E;  4DV6 Q;  3CCQ A;  4IO9 A;  1E3P A;  1TWH H;  1VQH A;  3GDE A;  1PH4 A;  1HR0 Q;  2NVQ H;  3HOU H;  3GTM H;  4BXX H;  1XNR L;  3ICE A;  3K0X A;  5ELN A;  3OYY A;  3PUZ A;  3L7Z C;  4BA1 I;  5C0X I;  3ERS X;  1HNZ Q;  4GLX A;  2FXQ A;  2CCZ A;  1L0W A;  2UUA L;  4AH6 A;  1XPU A;  3PUY A;  2R92 H;  1MJC A;  4GS3 A;  1XTD A;  3PF4 A;  1JJC B;  2JA5 H;  1PYB A;  2OWO A;  4B3T Q;  4P73 A;  2ASB A;  2Z6K A;  2PQA A;  4NXN L;  4IFD I;  2ZJP A;  2ZM6 Q;  2R7F A;  3DM3 A;  1JE5 A;  3KOJ A;  4IPG A;  5LMN Q;  3KDF B;  4A3B G;  1JT8 A;  1NMG A;  2IT1 A;  4JI8 L;  1EQR A;  2JA8 G;  3JAM i;  5DLQ E;  3AFQ A;  4JI0 Q;  4B3M Q;  4NPS A;  2JA7 G;  2JEB I;  1SFO H;  2B29 A;  1EFW A;  1E1T A;  2JA8 H;  3PO2 G;  3G48 A;  1MKH A;  1H95 A;  1AE2 A;  3A5Z B;  1YIT A;  4KHP L;  1YI2 A;  3CC4 A;  3D31 A;  2E8G A;  3HKZ E;  5ELO A;  4DR4 L;  2HIV A;  1X55 A;  4DV4 L;  4B3S L;  3L0O A;  1X9N A;  5JJI A;  1X56 A;  5C0X G;  2BA0 A;  1N9W A;  5JEA J;  1UEB A;  4JI2 L;  1FL0 A;  1D8L A;  2PI2 E;  3BJU A;  4BY1 G;  2KEN A;  4DR1 L;  3L2P A;  5GAH C;  1PVO A;  3TS2 A;  1MJE A;  2AMC B;  4PMW A;  1N8R C;  3TQY A;  1CSQ A;  4DV0 Q;  1AH9 A;  1WI5 A;  4BY1 H;  1N32 L;  4A4I A;  2K5N A;  4YCV A;  2JQO A;  1Q1E A;  4P71 A;  4IFD G;  4LFB L;  4JV5 L;  1MIU A;  4DR5 Q;  3S1R H;  5JJL A;  5EAY A;  1VQA A;  1KL9 A;  5IYC G;  4DR3 L;  1Q1B A;  4EX5 A;  1CKO A;  2NVX H;  4K0K L;  2ID0 A;  1IBK Q;  4JI6 L;  2ZTC A;  3W1B A;  5IYC H;  3S1N H;  2K52 A;  3LGJ A;  4OWT B;  2OCE A;  4HJA A;  3TS0 A;  1SR3 A;  3I56 A;  2IHF A;  2V1C C;  5FJ8 G;  3F2B A;  4HJ7 A;  1X3E A;  1NY4 A;  2KHI A;  1V43 A;  1VQ4 A;  4LFA L;  2B3G A;  3E9H A;  3NBH B;  1L2F A;  2YTY A;  5FJ8 H;  3RLO A;  1WOC A;  1B70 B;  3K7U C;  2LSS A;  1G51 A;  3HKZ G;  2GVA A;  2UU9 Q;  4LF4 L;  4GN5 A;  3J7Z C;  4A3L H;  1UE7 A;  1KRS A;  2R93 H;  1GD7 A;  3TEH B;  3PF5 A;  3STB D;  3S16 H;  4UY8 C;  4GKK L;  2YTX A;  3ZJY C;  2ZJQ A;  4KI0 A;  1TWG H;  1K9M C;  1Q8K A;  3I2Z A;  1B8A A;  4L5S A;  5GRO A;  2YV5 A;  4RG1 A;  4AYB E;  2VUM H;  1A0I A;  5IE8 A;  2I5H A;  1R9T H;  4JI4 Q;  2AKW B;  4O0A A;  2IX1 A;  4DR7 L;  4A3F H;  1KRT A;  2E2H H;  4LW1 A;  4TVA B;  5IP7 H;  1EUJ A;  3M4P A;  3PO3 H;  5LMU L;  4A3J G;  2HHH L;  5K36 G;  4IJL A;  1K73 C;  3KF6 B;  2UXB L;  1OXU A;  1YZ6 A;  4LF7 Q;  4LF6 Q;  5C4J H;  1PH9 A;  4A3J H;  1X3F A;  2Q2H A;  4Y7N H;  3PGZ A;  3U58 A;  3T1Y L;  4LF5 L;  2D62 A;  4A3M G;  3I4N G;  2UXD Q;  4LF8 Q;  4UPA A;  1X54 A;  3K7A H;  1SE8 A;  4DV2 Q;  3OW2 A;  1C7Y A;  1E7Z A;  4ALP A;  1XMQ Q;  1N33 L;  4O2D A;  4JOI C;  4MZ9 A;  5GAE C;  1SLJ A;  3GTK H;  3I4N H;  1U5K A;  3A0J A;  3HOV G;  4JI1 Q;  1DGS A;  5LMN W;  4GLV B;  5IP9 G;  3CCU A;  2VY3 A;  3UDF A;  2OTJ A;  1E1O A;  3WWV A;  1BBW A;  2D0O A;  2R7Z G;  1VQP A;  1C0A A;  5IP9 H;  4OX9 L;  1CKM A;  3KLW A;  2R7Z H;  2B63 G;  2VQF L;  1UWV A;  2GVB A;  4P72 A;  4LFC Q;  1JMC A;  4A76 A;  4NXM L;  1Y1V G;  1SN8 A;  2OQ0 A;  1YIJ A;  1XPR A;  1I5F A;  4DUZ L;  4JI5 L;  3CP0 A;  3H0G H;  2B63 H;  1Q82 C;  4A3G G;  1KXL A;  4WJ4 A;  1I3Q H;  2BH8 A;  3MEF A;  1Y1V H;  4DK3 C;  2L15 A;  4IJH A;  1G29 1;  5IYD H;  1JJG A;  3NEN A;  3CCL A;  3MXN B;  1RL2 A;  4JI8 Q;  1IBM L;  5FLX c;  2C35 B;  3FHW A;  4R4T A;  3KJO A;  3KF6 A;  1X6O A;  4IPD A;  4X64 L;  5HGQ A;  3PUX A;  1PH8 A;  2EQS A;  2PMZ E;  3K81 C;  3EN2 A;  4IOA A;  3NEL A;  4BY7 G;  3I7F A;  4YWK A;  1I94 L;  4DR4 Q;  1YEZ A;  4B3S Q;  4DPG A;  1YJW A;  3RNU A;  1HNX L;  3T1H L;  4JBW A;  4DUY L;  3RLN A;  5M5Y H;  1XMO Q;  3S1M H;  4BBR G;  1YVC A;  2Q2T A;  2ES2 A;  4JI2 Q;  3J81 c;  1L1O B;  4DR1 Q;  3PUV A;  1SMX A;  3BZC A;  1PYS B;  2GN5 A;  4GKJ Q;  4BBR H;  4A3B H;  4JYA L;  4APV A;  1GM5 A;  4C2M H;  4QGU A;  4LFB Q;  1XNQ L;  4JV5 Q;  1U0L A;  4XTC S;  1EYG A;  4KLK A;  4YY3 L;  2JA7 H;  2Y0S E;  1CKN B;  4IPH A;  4MNO A;  2E2J H;  1Z9F A;  2UUB L;  3GTP H;  3PO2 H;  2K50 A;  2UUC L;  2CKZ B;  2KBN A;  3AYH B;  1M90 C;  5JJK A;  4GNX B;  4LUZ A;  3U4V A;  3W1G A;  2EXD A;  4IPC A;  4NB3 A;  3STB C;  2ZJR A;  5FLM G;  4JI6 Q;  4QL5 A;  3S24 A;  4DV3 L;  1P8L A;  4HJ5 A;  3JC6 6;  4AQY L;  4DV6 L;  2JA6 G;  4GKK Q;  1VS0 A;  3W5O A;  1HR0 L;  4DR2 L;  1OXV A;  1VQK A;  3B6Y A;  2YU9 H;  2MNA A;  4J15 A;  3F8T A;  3RN2 A;  4YWL A;  2JA6 H;  4LFA Q;  1K0R A;  1IBL L;  3I4M G;  1LUZ A;  3U4Z A;  3HKS A;  3U50 C;  3M3Y H;  2HIX A;  2R7D A;  3CME A;  4OWX B;  1PV4 A;  3HOW G;  3KJP A;  5JEA G;  3I4M H;  3SGI A;  3BZK A;  1VQI A;  1L1O C;  2MQH A;  2ALY B;  4JBJ A;  5E7N A;  4B3T L;  5C3E G;  2WB1 E;  4IFD J;  1X3G A;  3CCJ A;  1UE1 A;  1J6Q A;  1WFQ A;  2WFW A;  4YCW A;  5AJ3 L;  3RZD H;  1EQQ A;  4BA2 I;  2QGQ A;  5LMN L;  3UDG A;  4A93 G;  1GVP A;  4GN3 B;  1VQO A;  3KDF A;  1J5E L;  2E2I H;  4A3E G;  1VQD A;  5GQO A;  1W2B A;  1L1O A;  4YHH Q;  1E22 A;  3TRZ A;  2YTV A;  3CCE A;  4A93 H;  2VQE L;  1JJ2 A;  3ER0 A;  3I4O A;  4P74 A;  4A3E H;  4GNX C;  4B3R L;  2JA9 A;  1PHJ A;  3HOZ G;  2I5L X;  2HHH Q;  2Y0S G;  3AFP A;  2VNU D;  1OTC A;  4A3C G;  4UP8 A;  1LTL A;  4JBK A;  1YHA A;  2RHQ B;  3KFU A;  4OO1 I;  1C9O A;  2A1A A;  2IY5 B;  3H3V I;  3UE1 A;  2ZTD A;  1HZB A;  1I6H H;  4LF9 Q;  1NTG A;  1A8V A;  1NMF A;  2ZTE A;  4R4O A;  3PIP A;  3T1Y Q;  4LF5 Q;  2JK8 A;  4DV5 Q;  3PIO A;  2IHE A;  1N33 Q;  2D0P A;  3DLL A;  1HNW L;  4L5Q A;  4DR6 L;  3HOX G;  2IX0 A;  1A62 A;  2UXC Q;  1BVS A;  3GTL H;  3RLF A;  3HOX H;  4AIM A;  1XPO A;  5IWA L;  1HR0 W;  3CCR A;  1KAW A;  1TWC H;  2A19 A;  4DAY B;  1E24 A;  4A3D G;  2WB1 G;  2NVY H;  2CFM A;  2JJQ A;  3HFZ B;  2RHS B;  1KD1 C;  1WCM G;  2VQF Q;  3CD6 A;  3RN5 A;  3CQZ H;  2F4V Q;  1V9P A;  4A3D H;  4DUZ Q;  3GO5 A;  1AE3 A;  1Y1W G;  4JI5 Q;  4LNQ A;  3CCV A;  1LM0 A;  3HOY G;  1TWA H;  4A3M H;  2E5L Q;  1OXT A;  3E9I A;  3PSI A;  4C3H H;  3AEV A;  4JBM A;  4OO1 G;  1Y1W H;  1WYD A;  3KYH C;  1FJG L;  2MO0 A;  3ULP A;  1IZ6 A;  1FGU A;  4GLA C;  3OTO L;  3CPW A;  2N3S A;  3UDX A;  1IBM Q;  1VQE A;  3HOV H;  1XNR Q;  4JOI A;  5GAD C;  3CXC A;  5IYB G;  5GAG C;  1Y14 B;  3F2D A;  2K75 A;  3S15 H;  4JC0 A;  2UUA Q;  1ASY A;  1VQN A;  2I0Q A;  3M85 A;  4X62 L;  4GN4 B;  5IYB H;  4HJ8 A;  4A3I G;  1I94 Q;  2KCT A;  4JI3 L;  4NXN Q;  1NJI C;  2H5X A;  3T1H Q;  1BKB A;  5M3M G;  4DUY Q;  1T9H A;  4A3G H;  1PFS A;  2VZA A;  4JCV E;  1XJV A;  4R4C A;  1W3S A;  3PCO B;  2MFI A;  5IY0 A;  1N36 L;  1VQG A;  2PNH A;  2XGT A;  1Q7Y C;  4P75 A;  5M3M H;  3M9B A;  3S14 H;  4JYA Q;  4WJ3 M;  3UDI A;  2F52 A;  4C3I H;  2ATW A;  1P16 A;  2AHO B;  1K83 H;  1XNQ Q;  4KHP Q;  2N49 A;  1G6P A;  4ME3 A;  4BBS G;  2WP8 J;  4X65 L;  4DKA C;  1S40 A;  1PA6 A;  1UE6 A;  2R6G A;  2I5M X;  3K8A A;  4UP7 A;  2UUB Q;  4LF8 L;  3JAM c;  1VQ6 A;  4DV4 Q;  4HIO A;  4LUV A;  1NBW A;  2N8N A;  2NN6 I;  4BY7 H;  1FVI A;  3HOU G;  4FDB A;  2F3I A;  5J3B A;  2LXJ A;  4DV3 Q;  1N34 L;  4YCU A;  4JI1 L;  3FKI G;  4EQ5 A;  3I55 A;  4AQY Q;  4X6A H;  1I50 H;  1SRU A;  4XIG S;  3J80 i;  4DR2 Q;  1PH6 A;  2R92 G;  3CW2 C;  2RCN A;  3FKI H;  1YHB A;  3Q8D A;  1N32 Q;  1IYJ B;  2CWA A;  1HZA A;  2Z6K C;  3PV0 A;  4DV1 L;  1IBL Q;  4QY7 A;  5BR8 L;  4JI7 L;  3GTQ H;  2JA5 G;  1Z47 A;  5M5X H;  4LFC L;  2N78 A;  1CSP A;  2VL6 A;  1V1Q A;  2K5V A;  3H15 A;  4DK6 C;  3CCM A;  1HJP A;  4DR3 Q;  4K0K Q;  1YNX A;  1VQ8 A;  5AJ3 Q;  1YBY A;  3CCS A;  3EBE A;  4OON A;  4X66 L;  4DV7 L;  1J5E Q;  1Q12 A;  3J7A 5;  5FLM H;  3M4Q A;  4RMF A;  5C0X J;  4LWC A;  2QEX A;  2VQE Q;  1HNZ L;  3F2C A;  2NN6 G;  4HIM A;  4B3R Q;  1EIY B;  1HZ9 A;  2VS1 A;  4YWM A;  4TQU S;  3D0F A;  3J81 i;  4LF4 Q;  1TXY A;  4PG3 A;  2EIF A;  4QIW E;  1KIX A;  4JG2 A;  4PZ8 A;  3GTO H;  2K14 A;  3HOW H;  4LUO A;  1O7I A;  1EWI A; 
#chains in the Genus database with same CATH topology
 1MHW C;  1F9P A;  1YNN C;  1VQ5 A;  2I46 A;  5COY A;  2G9D A;  4A75 A;  3J7Y W;  1KLG D;  1B7Y B;  3DXJ C;  2CQO A;  5HY6 A;  1BCP C;  2QIL A;  3VYR A;  2KCM A;  2R3Z A;  5FOB B;  1SE2 A;  2BA1 A;  4OHJ A;  1YHQ A;  2WAQ E;  1Y1V B;  1K28 A;  2F0J A;  3QG1 A;  1D5Z C;  1G2S A;  3K0Y A;  1UE5 A;  1PH3 A;  3NHH A;  3AQQ A;  2YYZ A;  1DOM A;  5HUR A;  3DEP A;  3U9O A;  3IL8 A;  1SYC A;  1K83 B;  4HIK A;  5KIX A;  5E3F A;  4J8Q A;  3I8Z A;  4RAU C;  3A54 A;  3K5L A;  4CDE C;  3JAM L;  1WTX A;  2NZO A;  3QWN A;  2QCP X;  1SYG A;  3GD7 A;  1K8A C;  1WCM H;  3G6J B;  2QF7 A;  3SR1 A;  4BBR B;  3PO3 G;  2NTS A;  4QMG A;  5ELF A;  1RIP A;  2FHT A;  4ZKC B;  1JB7 A;  3ULJ A;  4F88 A;  5CV7 A;  4RCN A;  2WAQ G;  5M9O A;  1VQL A;  3GTJ H;  1X3P A;  5M3F G;  1Q3L A;  1PYW D;  1E2V A;  1EQV A;  2HDM A;  2OQK A;  4S3S A;  1YJN A;  1PDQ A;  2E75 C;  4DV5 L;  3CMA A;  5M3F H;  1ZXT A;  1EIF A;  2XWB B;  3M4O H;  1HNX Q;  1QZG A;  2YU9 B;  2UXC L;  4RHR A;  4IOC A;  1KQS A;  1M1K C;  3IRB A;  2PMZ B;  2L1B A;  4MTN A;  1QVF A;  4LF7 L;  5BR8 Q;  4H13 C;  3H0G G;  4WFN 3;  1AP0 A;  1PZJ D;  2MO1 A;  4YY3 Q;  2F4V L;  5C6A A;  3X3M A;  1QNK A;  2Q2I A;  1U4R A;  4KN7 C;  4RHS A;  4EGV A;  4DFA A;  2FMC A;  4IO9 A;  3GTM H;  5C0X I;  4BA1 I;  3HOZ B;  2DN8 A;  2FXQ A;  1I6H B;  2M9V A;  1L0W A;  1VF7 A;  3PUY A;  1XTD A;  1JJC B;  2OWO A;  1JWS D;  1JOR A;  2ZJP A;  3IFT A;  1HQM C;  3KDF B;  2BCO A;  1NMG A;  1D6E C;  2IT1 A;  3V2T A;  1TII D;  1TWC B;  5DLQ E;  3AFQ A;  4B3M Q;  4NPS A;  1EFW A;  1H95 A;  3G48 A;  3SHL A;  1HUM A;  3A5Z B;  4I7A A;  4A3D B;  4DXF A;  1QNU A;  2NN6 H;  3KUP A;  3AMU A;  3D31 A;  5ELO A;  3HKZ E;  5JJI A;  4C3H B;  3I72 A;  3H94 A;  1VDZ A;  4EVO A;  2KOL A;  4PMW A;  1N8R C;  1RKN A;  1CSQ A;  1PTO F;  3TQY A;  1ESF A;  4A4I A;  4IFD G;  4LFB L;  5G3L F;  4DR5 Q;  3PQI A;  4IFD H;  5EAY A;  3MC0 B;  4A3G B;  2B2U A;  1FR3 A;  5EKK A;  4OWT B;  3TS0 A;  1JOK A;  4FF2 A;  4C3I B;  1J8I A;  1WOC A;  3ND9 A;  3HKZ G;  1BUV T;  2GVA A;  4A3L H;  1MI2 A;  4BBS B;  1GD7 A;  3TEH B;  3STB D;  4UY8 C;  4KI0 A;  2MGS A;  1Q8K A;  1TVX A;  1B8A A;  3HOU B;  1Y8N B;  2NVQ B;  1STB A;  4RG1 A;  5IE8 A;  1F2M A;  2I5H A;  4JI4 Q;  1K8O A;  2AKW B;  4IUP A;  4LW1 A;  5IP7 H;  3OMC A;  4IZ8 A;  5CGK A;  3KF6 B;  4HMI A;  2EJF C;  2JA5 B;  1TS2 A;  1PH9 A;  4Y7N H;  2KA7 A;  1O7Z A;  1HFN A;  4EQO A;  4DV2 Q;  3OW2 A;  1N33 L;  2FJ2 A;  3A0J A;  1BOS A;  4JI1 Q;  3CCU A;  3NXW A;  5JPM C;  1BBW A;  1VQP A;  1C0A A;  2B2Y A;  3NPP A;  1RTN A;  2EYJ A;  3BYY B;  3NTI A;  4G4K A;  3A55 A;  2I07 B;  2A74 C;  4LFC Q;  1UWV A;  1EEF D;  1YNJ D;  2EVB A;  1JMC A;  1Y1V G;  5IGD A;  4NXM L;  5C3E B;  1CTM A;  4JI5 L;  2XWJ B;  3FVQ A;  3R2T A;  1I3Q H;  5EBC A;  3MEF A;  1Y1V H;  3KF8 A;  5EPJ A;  4IJH A;  3DHQ A;  3SVM A;  3CCL A;  1LTB D;  1B4O A;  4PMC A;  3MXN B;  1RL2 A;  3TZD A;  5IYD H;  1IBM L;  1BQQ T;  2MP1 A;  1K3B C;  2FFK B;  4X64 L;  1A3U A;  3IFD A;  5ELE A;  2PMZ E;  3NEL A;  1O7Y A;  4YWK A;  2HUG A;  4B3S Q;  2PPB C;  2HQE A;  3Q23 A;  3TN2 A;  4IUN A;  4DA2 A;  4NP5 A;  5IGE A;  1XMO Q;  3S1M H;  4BBR G;  2ES2 A;  2GN5 A;  4GKJ Q;  4BBR H;  4A3B H;  2VB2 X;  4APV A;  1GM5 A;  4C2M H;  3S16 B;  3C3L A;  4KMU C;  5C44 B;  1SNQ A;  2K50 A;  5JJK A;  3AYH B;  4HAE A;  4GNX B;  2JSO A;  1R9T B;  5EBD A;  4IPC A;  3STB C;  4CJ1 B;  2ZJR A;  4QL5 A;  4A3F B;  4DV3 L;  5C4X B;  5C0X H;  3W5O A;  4C3J B;  1F2L A;  1OO9 B;  1W6J A;  2YU9 H;  5E4W C;  2MNA A;  2KED A;  4KHV A;  2F0M A;  1IBL L;  4DF7 A;  3MXG A;  3HKS A;  2M2L A;  2EYF A;  1V1P B;  3KJP A;  2MQH A;  1HTP A;  2B2W A;  3CCJ A;  1STE A;  4BA2 I;  3UDG A;  4GN3 B;  1VQO A;  2PNR C;  3GTP H;  1L1O A;  1FNU A;  1PLF A;  1JJ2 A;  2KCN A;  3ER0 A;  4GNX C;  2JA9 A;  3HOZ G;  2VNU D;  3I70 A;  1OTC A;  4UP8 A;  4A3C G;  2RHQ B;  2IY5 B;  1C9O A;  5T1G A;  3H3V I;  3UE1 A;  2ZTD A;  1HZB A;  4WOR A;  4CKB A;  1I6H H;  5LL6 S;  1WTW A;  4G57 A;  4ZRZ A;  3T1Y Q;  4U68 A;  1SNP A;  1YNJ C;  3MHB A;  4CDC C;  1HNW L;  1JOO A;  4BS9 A;  1LTG D;  4RGM A;  4X3K A;  1PZK D;  4B9W A;  4DAY B;  1TWC H;  2HCI A;  1IKM A;  4A3D G;  4FXG C;  4KY6 A;  4MHE A;  5D3I B;  2JJQ A;  3Q22 A;  3HFZ B;  3CQZ H;  4A3D H;  4C3H G;  3DM1 A;  4DUZ Q;  3CCV A;  1B53 A;  1LM0 A;  4HCS A;  3HOY G;  2E5L Q;  1OXT A;  3PSI A;  4C3H H;  3AEV A;  4JBM A;  1WYD A;  1TS3 A;  4X3T A;  4LMQ D;  3NBH A;  1G2T A;  1CQV A;  4JOI A;  4HED A;  3CXC A;  3F2D A;  1Y14 B;  4FXD A;  2UUA Q;  1VQN A;  2I0Q A;  4R8N A;  3SE0 A;  4X62 L;  4OEL B;  4HJ8 A;  1I94 Q;  4JI3 L;  2H5X A;  3T1H Q;  4DUY Q;  4A3G H;  1PFS A;  2VZA A;  4C56 C;  1KLU D;  1N36 L;  1VQG A;  1WTQ A;  1Q7Y C;  3M3Y B;  4C3I G;  3S1R B;  4JYA Q;  3TME A;  3LWE A;  3C1F A;  4C3I H;  1CZW A;  1G6P A;  4BBS G;  4DKA C;  1S40 A;  1UE6 A;  2R6G A;  2I5M X;  2E2I B;  1U4L A;  3BVM A;  3BDO A;  4BY7 H;  3SK4 A;  3HOU G;  4FDB A;  2LXJ A;  1CZG A;  2PZT A;  4EQ5 A;  1UUP A;  4X6A H;  3ERO A;  5A2Q E;  1PH6 A;  2RCN A;  1IYJ B;  1HZA A;  2Z6K C;  4DV1 L;  1CT1 D;  3QOL A;  2JA5 G;  1TWG B;  1SJE D;  3E3X A;  4FXK C;  1T5E A;  2CH4 W;  4DR3 Q;  2J4X A;  5CBA E;  2K6A A;  5AJ3 Q;  3K58 A;  3Q0A A;  4X66 L;  4KKS A;  2QDL A;  5CBE E;  1SEB D;  1HNZ L;  4G7O C;  2JP1 A;  5L37 A;  4HIM A;  2VS1 A;  5IIF A;  4YWM A;  3D0F A;  4LF4 Q;  3FEW X;  1TXY A;  4XQN A;  2C9O A;  3HOW H;  4DXG A;  5K5P A;  4GKK Q;  2Z8L A;  1VCI A;  5C3E H;  4GOP B;  2QKI C;  4DR6 Q;  1CUK A;  2DUD A;  3CPF A;  1ENC A;  2K4K A;  5TSS A;  1BBX C;  4DR7 Q;  1VQJ A;  2Q8T A;  4J6H A;  4POG A;  3HRZ C;  3EFX D;  3SXH A;  3VR3 A;  3H0G B;  4UP9 A;  1CKN A;  3Q24 A;  3OHX C;  2B63 B;  1A63 A;  2F0T A;  2OXP A;  4KD4 A;  4R1J A;  1Q46 A;  2RF4 A;  4RFB A;  1KC8 C;  1STY A;  1EYA A;  4HTH A;  3QR8 A;  1VQ9 A;  3E0E A;  2DNE A;  2RDF A;  4PZ7 A;  5CR3 A;  1FJG Q;  4DV0 L;  2F0F A;  4G7H C;  4WJW A;  4MTK A;  2AUK A;  3VR6 A;  1EWC A;  4KJO A;  1ASZ A;  5FK9 C;  2B2T C;  4L5T A;  1WJJ A;  4PNY A;  4L5R C;  2EXZ A;  4GOP C;  1B1Z A;  2F0V A;  3MVV A;  5C44 G;  1VQB A;  1IBK L;  2VUM G;  3BDC A;  5DM7 3;  5C44 H;  4A3F G;  1IL8 A;  1EU3 A;  1RF2 D;  1X65 A;  5C4X G;  3RR5 A;  4F7X A;  4C3J G;  2AQ1 B;  1PH2 A;  1Y8P B;  2AWN A;  5C4X H;  1ILP A;  5M5X B;  2CWP A;  3WOF A;  1QVG A;  3A5U A;  4C3J H;  3H3V H;  3CC2 A;  2E2J B;  4KTA A;  1TWF H;  4DAM A;  1HRJ A;  5JOB A;  1B9N A;  3CF5 A;  3DWQ A;  4LF9 L;  3I4L A;  4V0B A;  5M5W H;  4X65 Q;  1QVC A;  1U4M A;  2SDF A;  2PQA B;  2ENB A;  4POF A;  4A3I H;  1A6X A;  3G4S A;  3NBI A;  4Y52 H;  3GTG H;  5CV6 A;  3VA5 A;  1QJO A;  4LK1 C;  1GKH A;  1EIG A;  2XSC A;  3F1Z A;  1LO5 D;  2A8V A;  4JI7 Q;  4LF6 L;  4XQJ A;  1ET9 A;  3I73 A;  2KHJ A;  2A6E D;  3VYS A;  2XTI A;  1NUC A;  3DMU A;  2UXD L;  1KHI A;  2NZH A;  4AYB G;  3J80 c;  2UUC Q;  3PUW A;  2G9H D;  3OMG A;  1TT2 A;  4A93 B;  4O1N A;  4DK1 A;  3OWF A;  4DV7 Q;  1H9J A;  5EKI A;  1HR0 Q;  2XRS D;  1XNR L;  1Q90 A;  3K0X A;  3OYY A;  3L7Z C;  3MTS A;  3QB3 A;  3ITP A;  4AH6 A;  1XPU A;  4JVZ A;  1MJC A;  5DNF A;  1G91 A;  4NXN L;  4IFD I;  3G7L A;  5EQ0 A;  2QW7 A;  5D65 A;  2SEB D;  1STN A;  3KOJ A;  1JE5 A;  5LMN Q;  3HOX B;  1JT8 A;  3QOJ A;  4N9P A;  2JEB I;  3I3C A;  3TP8 A;  1E1T A;  4I65 A;  1MKH A;  2B8F A;  1TS4 A;  3C46 A;  1YI2 A;  2E8G A;  4F87 A;  1X55 A;  3L0O A;  1X9N A;  2VB3 X;  1STG A;  2K32 A;  2PCF B;  3AB9 A;  3I91 A;  5KYI A;  1X56 A;  1Y1W B;  3MAQ A;  4H0L C;  3T16 A;  5CV9 A;  3BJU A;  1D8L A;  2PI2 E;  4JI2 L;  2F0U A;  4DR1 L;  1PVO A;  3L2P A;  2EY1 A;  1MJE A;  4MIU A;  3S15 B;  4HR7 B;  1N32 L;  5CV4 A;  2A68 D;  4JV5 L;  3A8J E;  4QB4 A;  3S1R H;  3GQB A;  4N8F A;  5A2Q L;  1VQA A;  3R8B A;  4YIJ A;  1EY9 A;  1K8M A;  1CKO A;  1II3 A;  2F3W A;  4K0K L;  1RD9 D;  2ID0 A;  1SDF A;  2ZTC A;  4ILW A;  5M3M B;  3LGJ A;  3RZO B;  2IHF A;  1X3E A;  1EYC A;  4E6I A;  1VQ4 A;  2B3G A;  3E9H A;  4OEM B;  1EY6 A;  1L2F A;  1A2T A;  4IUR A;  2LSS A;  1Y8O B;  4CGY B;  3J80 L;  3PF5 A;  2A6E C;  2YTX A;  2ZJQ A;  1EOT A;  1TWG H;  1K9M C;  2ZXR A;  1I50 B;  3LX0 A;  5GRO A;  4MN3 A;  4RWS C;  4R8I A;  1ICF B;  2IX1 A;  1KRT A;  3PO3 H;  3M4P A;  1S5F D;  2O5J C;  5K36 G;  3H6M A;  1OXU A;  1A3T A;  4LF7 Q;  5BN5 A;  2LFN A;  1X3F A;  2Q2H A;  1HA5 A;  3MXU A;  3BG3 A;  4LF5 L;  4LF8 Q;  4UPA A;  1SE8 A;  4ALP A;  3WDN A;  1U5K A;  1BO0 A;  4NMZ A;  3HOV G;  2K7V A;  5LMN W;  1GUT A;  3FPU B;  3OIP A;  2D0O A;  2WAC A;  3T56 B;  4IAL A;  1V1O A;  3GTO B;  1I4P A;  3KLW A;  2NWG A;  2B63 G;  4P72 A;  2F0E A;  3IAY A;  4A76 A;  3S2D B;  1XPR A;  2EYL A;  3CP0 A;  3H0G H;  2B63 H;  2KJX A;  1ZYR D;  1JJG A;  1G29 1;  4ID6 A;  3NEN A;  3T51 B;  1WTR A;  1TY2 A;  5FLX c;  2C35 B;  1PRT B;  3FHW A;  1WTH A;  3KJO A;  3KF6 A;  1X6O A;  4IPD A;  5HGQ A;  4IOA A;  1PFB A;  2A68 C;  3K81 C;  1PH8 A;  2NVX B;  4PMB A;  3S1Q B;  3S1N B;  4K2K A;  4IN3 A;  1PFM A;  4KV6 A;  1HNX L;  3S17 B;  1KDA A;  1YVC A;  4KN4 C;  3TP6 A;  2R93 B;  3VYU A;  4QGU A;  4LFB Q;  5CMD A;  4KLK A;  4YY3 L;  4MNO A;  4A3K B;  5KNB A;  2E2J H;  2XVS A;  1O80 A;  2EY5 A;  1PRT C;  5FLM G;  3S24 A;  3HOY B;  4B08 A;  1RTO A;  1SE4 A;  4AQY L;  3MXN A;  3OWE B;  4DR2 L;  2LY7 A;  2CW0 D;  2RDG A;  1VQK A;  4XXE A;  3F8T A;  2NVT B;  5C5M A;  3CKI B;  1LUZ A;  1SMY C;  2TSS A;  3OW7 A;  3U50 C;  2EJG C;  2R7D A;  5KYL A;  3TP7 A;  5JEA G;  2A73 B;  3K7A B;  3BZK A;  2Q8R E;  2ALY B;  4LAA A;  3NTK A;  4NKL A;  1UE1 A;  1H9S A;  4A93 G;  1VMC A;  3H09 A;  1J5E L;  3TRZ A;  1VQD A;  4YHH Q;  4JPB W;  1E22 A;  4PV1 C;  4C1N K;  4CDD C;  2OT2 A;  1JWM D;  4CHT B;  4A93 H;  5KNC A;  4L6T B;  2VQE L;  1TU2 B;  3I4O A;  1UNS A;  1LT4 D;  3AFP A;  1C48 A;  5HGT A;  2H4O A;  3KFU A;  2K5W A;  2A1A A;  2XNA C;  3PIP A;  1A8V A;  4R4O A;  4RGT A;  3PIO A;  2WIN B;  4OIJ A;  1XWE A;  1N33 Q;  1TWH B;  2N55 A;  3HOX G;  2B39 A;  1ZYR C;  3GTL H;  3OIQ A;  3HOX H;  3A56 A;  5IWA L;  1V1P A;  5BN4 A;  1DCZ A;  1E24 A;  2RHS B;  1S5C D;  1ZKO A;  1EFI D;  3NTH A;  1IYU A;  1E2Z A;  1Y1W G;  4JI5 Q;  4LNQ A;  4FNF A;  3D3R A;  1Y1W H;  5G3L D;  1O78 A;  1SFO B;  1CK1 A;  2MO0 A;  4CBV A;  3ULP A;  1G8Z D;  1FGU A;  2F0D A;  4GLA C;  3OTO L;  2N3S A;  1JIC A;  1IBM Q;  2E76 C;  2JA7 B;  1WTO A;  1S4Z A;  2K5Q A;  1IW7 D;  1B2T A;  5GAG C;  1EY4 A;  2K75 A;  3S15 H;  4JC0 A;  3P75 A;  5C4Z A;  3M85 A;  1HTL D;  5IT9 E;  2HDL A;  1AZQ A;  4DN4 M;  5JAV A;  1NJI C;  5M3M G;  5KGU A;  3PCO B;  5IOD A;  1Y69 U;  3J7A V;  2XGT A;  5M3M H;  4QF4 A;  3OOC A;  2CW0 C;  3PIO 3;  1TR5 A;  1GUO A;  2F52 A;  1P16 A;  1L0X B;  1K83 H;  4KHP Q;  4KJN A;  1L0Y B;  2WP8 J;  1AFP A;  1PA6 A;  4DV4 Q;  1I6V C;  1GOZ A;  5J3B A;  4DV3 Q;  1VMP A;  2X6G A;  4YCU A;  4JI1 L;  1N34 L;  3I55 A;  1RCV D;  1A2U A;  1I50 H;  4XIG S;  3J80 i;  2ZT9 C;  2R92 G;  3Q8D A;  2CWA A;  4R9W A;  1IBL Q;  4QY7 A;  2K04 A;  1I4H A;  2RKS A;  1Z47 A;  4LFC L;  3H15 A;  2K5V A;  2ZXO A;  1XYI A;  1E0B A;  2VUM B;  4K14 A;  1ILQ A;  1VQ8 A;  1GXD C;  3P1H A;  1YBY A;  2E2H B;  3CCS A;  2EE1 A;  4OON A;  1ZEQ X;  3BZD B;  3KLR A;  3LNN A;  4RMF A;  4LWC A;  2FIN B;  5C4J B;  3E0J A;  1XXG A;  3WOE A;  2V4D A;  5J22 A;  1HZ9 A;  4PG3 A;  3GTO H;  3EVQ A;  4LUO A;  1O7I A;  2ZM6 L;  2JEA I;  1XMO L;  3S2D H;  3QIA A;  4FO2 A;  1HNW Q;  1NR2 A;  1QZH A;  4FF1 A;  3TP5 A;  4JI0 L;  4GKJ L;  2HQL A;  2L5T A;  2R7Z B;  4IUT A;  4HJ9 A;  5LMU Q;  2B2U C;  4CJ0 B;  2UXB Q;  1PH7 A;  5JVH 3;  2J7Z A;  1A3V A;  3HOZ H;  1IW7 C;  3RUZ A;  4A3C H;  4AYB B;  2PI2 A;  3D8G A;  3S1Q H;  1MGS A;  1J9O A;  4QJF A;  4TKO B;  1MSG A;  1BBU A;  1VQC A;  4K2L A;  3S14 B;  3LWU A;  3S17 H;  1AZP A;  5IT9 c;  1QUQ B;  2PZU A;  2QA4 A;  5AFW A;  4OXP A;  4IUV A;  1EY5 A;  2R93 G;  2K28 A;  2MUY A;  1K8G A;  1T5X D;  3P7J A;  4OX9 Q;  1IL2 A;  4A3K G;  1H9R A;  2JE6 I;  4X62 Q;  1NE3 A;  4ZCK A;  4K8I A;  1S5B D;  4A3K H;  4JI3 Q;  4R4Q A;  1EWH A;  4GOP A;  3KF8 B;  4DNI A;  4XDX A;  4KY5 A;  3OSO A;  3VR2 A;  1RHP A;  3G71 A;  1LYL A;  4OIK A;  3GTQ B;  4PZ6 A;  1N36 Q;  1I4R A;  2F0Q A;  1IXR A;  3HOY H;  1D5M C;  3UE0 A;  2L4N A;  3V05 A;  2UU9 L;  1CQF A;  2NVT H;  1SRO A;  3BU2 A;  1RJT A;  3EJI A;  2E74 C;  2K5H A;  1HQR D;  1F9S A;  2LXK A;  4IUQ A;  3S9W A;  1QCB D;  1F77 A;  4RGO S;  1DZ1 A;  2KEC A;  2B2Y C;  4K8J A;  2JA6 B;  3A74 A;  3EIV A;  1HH2 P;  1VQF A;  1EOV A;  3I4M B;  2VW9 A;  4HID A;  4DV1 Q;  1S5E D;  4ABN A;  5CC4 A;  2DGY A;  3CRK C;  2WKD A;  2Z0S A;  1RDP D;  3VR4 A;  1XMQ L;  3SK5 A;  1M8A A;  4BBS H;  2E5L L;  1QOH A;  2CQA A;  2L0C A;  3K6O A;  4DAV A;  5C4H A;  1QWY A;  2J0T D;  1HUN A;  4X66 Q;  1AW7 A;  1GO3 E;  4DV6 Q;  3CCQ A;  1I4G A;  1E3P A;  1TWH H;  1VQH A;  2Z4H A;  3GDE A;  4P2C B;  1PH4 A;  2NVQ H;  3HOU H;  5FO8 B;  5ELN A;  1HNZ Q;  3PUZ A;  1GUG A;  2CCZ A;  2Y0S B;  3ERS X;  4GLX A;  1KAA A;  2UUA L;  2XRQ D;  4X3S A;  3R93 A;  2NTT A;  1A15 A;  2JA5 H;  1PYB A;  1PFN A;  4B3T Q;  5DM6 3;  2EY6 A;  2PQA A;  1SAP A;  2G5D A;  4WRD A;  2R7F A;  3DM3 A;  4IPG A;  2XIW A;  4PQX A;  5IT9 L;  2DJF C;  4RCO A;  4JI8 L;  1MD2 D;  1X32 A;  2EYH A;  3J80 E;  2NVY B;  5EPK A;  2JA7 G;  1HCZ A;  1SFO H;  2O4X A;  3PO2 G;  5C3W A;  1AE2 A;  2RDH A;  3MWY W;  1YIT A;  3CC4 A;  1LT6 D;  1WCM B;  4DR4 L;  2KCC A;  2HIV A;  4FF4 A;  4ULL A;  2BDN A;  2Z1C A;  5JEA J;  3O13 A;  3HP3 A;  3HOV B;  3TS2 A;  2AUJ D;  1C8C A;  4DV0 Q;  1AH9 A;  3GTJ B;  2B2W C;  2K5N A;  4YCV A;  2JQO A;  1Q1E A;  4P71 A;  1VF5 C;  1ENA A;  1MIU A;  4RA8 A;  1JE4 A;  1BCP F;  5EJW A;  3H91 A;  4DR3 L;  4EX5 A;  1IBK Q;  2HD3 A;  4JI6 L;  3W1B A;  2DNC A;  1B44 D;  2L11 A;  1SR3 A;  1UAP A;  2V1C C;  3F2B A;  4HJ7 A;  5ELC A;  1NY4 A;  4BWG B;  2KHI A;  1EYD A;  4LFA L;  2IL8 A;  3NBH B;  2YTY A;  3RLO A;  1B70 B;  3K7U C;  4LF4 L;  3W3A A;  2IW3 A;  3J7Z C;  1DYQ A;  3T4A C;  1U9R A;  2IJ0 A;  3S16 H;  4GKK L;  3TZU A;  3I2Z A;  1STH A;  1EY8 A;  1B50 A;  1DON A;  4L5S A;  2F0G A;  4AYB E;  2VUM H;  3FKI B;  1R9T H;  1STA A;  4O0A A;  4DR7 L;  4A3F H;  2E2H H;  4TVA B;  3VR5 A;  1EUJ A;  2HHH L;  4KK7 A;  3NWS A;  4IJL A;  1K73 C;  2EOT A;  2B2V C;  2O5I C;  1JC7 A;  4ZK9 B;  4LF6 Q;  5C4J H;  1QE6 A;  3PGZ A;  2VXW A;  5C3X A;  2D62 A;  4A3M G;  2UXD Q;  1X54 A;  3X3N A;  2X6L A;  4V19 0;  4JOI C;  2RBM A;  1SLJ A;  1LAB A;  1DGS A;  1SBB B;  3ERQ A;  2VY3 A;  2OTJ A;  1E1O A;  3J7A F;  2R7Z G;  5EGT A;  2RSO A;  5C5L A;  3RMH A;  4X3U A;  2R7Z H;  2VQF L;  4OGQ C;  2JN4 A;  1I5F A;  4WJ4 A;  1EY0 A;  2P5Z X;  4UHV A;  2ICI A;  2L15 A;  1CHQ D;  2LKV A;  2NBF A;  5JPN C;  2KVM A;  5I2X A;  4HSV A;  3DUZ A;  2EQS A;  3EN2 A;  3NUC A;  1WD1 A;  5CV5 A;  3A8I E;  3I7F A;  5E1F A;  4XYO A;  4LJZ C;  1YJW A;  3GP7 A;  3RNU A;  3R2I A;  4JBW A;  3V96 A;  5D3D A;  3M7G A;  2PO4 A;  4JI2 Q;  1IHZ A;  4DR1 Q;  3PUV A;  1B3Q A;  2NB0 A;  3BZC A;  1ENF A;  3QO2 A;  4QIW B;  1H9K A;  1XNQ L;  4JV5 Q;  1DOL A;  1U0L A;  2AQ2 B;  1EYG A;  1JCK B;  2Y0S E;  1CKN B;  4IPH A;  2UUB L;  1Z9F A;  2UUC L;  1SYF A;  2CKZ B;  1M90 C;  2A6H D;  5FLX E;  1LTT D;  4NB3 A;  1LT5 D;  5ISR A;  4HJ5 A;  1P8L A;  2JA6 G;  1HR0 L;  2RA4 A;  4ZAI A;  5I9P A;  4L8J A;  1U4P A;  3RN2 A;  2JA6 H;  2IX3 A;  1K0R A;  3I4M G;  4Y7N B;  1EL0 A;  4RGN A;  1K0S A;  3NP8 A;  3M3Y H;  3I90 A;  3CME A;  1PV4 A;  2EY2 A;  3I4M H;  1DOK A;  1VQI A;  4JBJ A;  1TY0 A;  1X3G A;  2K01 A;  1D2B A;  1F9R A;  1WFQ A;  4RH6 A;  2WFW A;  1EQQ A;  3S2H B;  2QGQ A;  5LMN L;  1GVP A;  1HPC A;  3KDF A;  2E2I H;  3BYT B;  5GQO A;  1W2B A;  3CCE A;  4ZYS A;  5ELD A;  4B3R L;  1PHJ A;  3FPP A;  2I5L X;  2Y0S G;  3NE5 B;  4O42 A;  1LTL A;  2BE5 D;  1BXT A;  1MBY A;  1YHA A;  2OEO A;  3GV6 A;  4ZUJ A;  2GA4 B;  3BVG A;  1D1K A;  4DNR B;  1PRT D;  1SND A;  1SNO A;  1I3Q B;  1NTG A;  2ZTE A;  4LF5 Q;  4DV5 Q;  3D4R A;  1E2W A;  3SK6 A;  2Z6B A;  2D0P A;  4XT3 B;  4L5Q A;  1A62 A;  2UXC Q;  1BVS A;  1CFM A;  2EJM A;  1SMY D;  1XPO A;  2R92 B;  4U67 3;  1HR0 W;  1LTI D;  1KAW A;  2NVY H;  5K36 H;  1GJX A;  1KD1 C;  1WCM G;  3RN5 A;  2F4V Q;  1V9P A;  3S1M B;  1SNC A;  5IGC A;  3F2U A;  3E6Z X;  3HG9 A;  4CJ2 C;  4A3B B;  3E9I A;  2TMP A;  4OO1 G;  4FYD A;  1FD7 D;  4C2M B;  4JW0 A;  2JA8 B;  3R3O A;  4OO1 H;  3HOV H;  2Z9H A;  4TRD A;  4EQN A;  1EEI D;  5GAD C;  1PZI D;  2RQX A;  2EYP A;  1BNZ A;  3AU7 A;  4GN4 B;  1ESR A;  2KCT A;  5COR A;  2A6H C;  1KDC A;  4JCV E;  1XJV A;  1WD0 A;  4BY1 B;  4R4C A;  1W3S A;  2MFI A;  2F0L A;  5DEH A;  1QIL A;  1GHK A;  3M9B A;  3URY A;  3K5M A;  3UDI A;  4WJ3 M;  2C5C A;  3A7L A;  2ATW A;  2AHO B;  4KKU A;  5EPL A;  2SNM A;  1SYB A;  1TQO A;  3HS0 C;  3C2P A;  4LF8 L;  1VQ6 A;  3GTP B;  4LUV A;  3HGB A;  1NBW A;  2N8N A;  1CM9 A;  3HEJ A;  1FVI A;  3KLS X;  3ND8 A;  3TSS A;  3FKI G;  4AQY Q;  1ROD A;  1SE3 A;  3ONA B;  1SRU A;  4DR2 Q;  5FO9 B;  1KTK A;  3FKI H;  2NYZ D;  3PV0 A;  4Z9C B;  2RSN A;  5BR8 L;  3T13 A;  1LT3 D;  5M5X H;  1CSP A;  2VL6 A;  1ONL A;  2WII B;  1V1Q A;  2BE5 C;  4DK6 C;  3CCM A;  1HJP A;  3N6R A;  1YNX A;  1NR4 A;  4ODG A;  3W2D A;  5EKL A;  1Q12 A;  1EQT A;  1J5E Q;  1AEX A;  2AQ3 B;  4ZLT F;  5FLM H;  3M4Q A;  1UEA B;  3A8K E;  1FYC A;  2VQE Q;  1W6K A;  1SJH D;  4A3J B;  3F2C A;  1ET6 A;  1MSH A;  1DXM A;  2NN6 G;  4JK1 C;  3CQZ B;  1WTV A;  1F2Z A;  2X69 A;  3J81 i;  1FGB D;  4Q5V A;  4QIW E;  2EIF A;  4PZ8 A;  2K14 A;  3I4N B;  3GTK B;  3IKJ A;  1EWI A;  5I9O A;  5JEA H;  4H02 A;  3CAM A;  3NEM A;  3L3O C;  1S72 A;  4FP5 D;  3L9A X;  1B3A A;  1YJ9 A;  1LTS D;  5H1S E;  4B3M L;  1Q81 C;  1JR0 D;  5IWA Q;  1TS5 A;  1HXY D;  2QDB A;  4DU9 A;  3FP9 A;  3M7N A;  2OTL A;  1HZC A;  2N88 A;  4K5V A;  5DAU A;  2F0H A;  4Q0F A;  4GNX A;  2RVL A;  1Q8I A;  4H44 C;  1ML0 D;  1OXX K;  5IGF A;  5LL6 X;  1ICW A;  1NAP A;  3EA6 A;  1S3O A;  2EDG A;  3ULL A;  5FLX L;  2OF1 A;  1K3R A;  3OTO Q;  3DWP A;  4A3L G;  2EPB A;  2BH2 A;  1FNW A;  1PXU A;  4DAP A;  5I6Y A;  4DR5 L;  1VQM A;  1JQY D;  4BY7 B;  1GUN A;  4K5X A;  4HN7 A;  5M5Y B;  1G6Z A;  4NXM Q;  4QQB X;  1SSO A;  1OXS C;  1PTO D;  2IWH A;  2QEJ C;  5I4D A;  3J81 j;  5LHY 1;  1JOQ A;  3K5O A;  4YHH L;  5IP7 G;  1Z7T A;  1PH5 A;  2HT1 A;  3NWT A;  4OWW B;  2F0S A;  5CYU A;  1LTA D;  1PH1 A;  2EZV A;  1M4V A;  4ZUI A;  4IQZ A;  1D7Q A;  1SYE A;  1Q86 C;  3PO2 B;  1HA6 A;  1H9M A;  5JVG 3;  4I7Z C;  2Q8I B;  1VQ7 A;  4X64 Q;  3G6E A;  3CC7 A;  2RCF A;  3K57 A;  5IOC A;  1B9M A;  3KLS A;  1LV9 A;  4CKE A;  1WTP A;  4JI4 L;  2AWO A;  1N34 Q;  3S2H H;  1QUQ A;  3TRE A;  3PIP 3;  1EZ6 A;  3RZO H;  3VYT A;  4DAY A;  1D1I A;  2O2L D;  3HOW B;  2F0W A;  2E2D C;  1O7L A;  3RZD B;  1CI3 M;  4KHZ A;  4DV2 L;  3K80 C;  5IYD G;  4R4I A;  3VDY A;  2Q2U A;  4EQP A;  3MFG A;  2A69 D;  4A3E B;  2F0K A;  2PW5 A;  4BXX G;  4XYQ A;  1EZ8 A;  1QG7 A;  4BXX H;  3ICE A;  5BN3 A;  2R92 H;  1PTO B;  1AN8 A;  1CA5 A;  4GS3 A;  3PF4 A;  2PQE A;  4P73 A;  4DK0 A;  5KND A;  2Z6K A;  2ASB A;  2BOS A;  4G7Z C;  2K5D A;  2BDO A;  2ZM6 Q;  1H9S B;  4KD3 A;  1NCV A;  4A3B G;  4XQQ A;  4NDX A;  1BDO A;  1EQR A;  3JAM i;  2JA8 G;  2PYK A;  4JI0 Q;  2F0P A;  2B29 A;  2JA8 H;  4KHP L;  2WB1 B;  2K03 A;  2F1M A;  4XT1 B;  1S5D D;  3MXP A;  3MZ5 A;  1TWA B;  4DV4 L;  4A3M B;  4B3S L;  5C0X G;  2BA0 A;  1N9W A;  2F0I A;  3NSW A;  1UEB A;  1FL0 A;  4BY1 G;  1PTO C;  2KEN A;  2XN9 C;  5GAH C;  2FMM A;  2AMC B;  1TWF B;  3EQL C;  1WI5 A;  4BY1 H;  4N8X 1;  2PW7 A;  5M5W B;  5JJL A;  3J81 E;  1KL9 A;  4C1N I;  5IYC G;  4A3I B;  1Q1B A;  2NVX H;  1SYD A;  4KY7 A;  1KDB A;  5IYC H;  3GTG B;  3S1N H;  2K52 A;  2OCE A;  4HJA A;  3D4W A;  3I56 A;  2JXM B;  2DY7 A;  4K6L A;  5FJ8 G;  3T53 B;  1V43 A;  3RD4 A;  3C1E A;  5FJ8 H;  2UU9 Q;  1NSN S;  1G51 A;  4GN5 A;  2PZW A;  1UE7 A;  1KRS A;  3H3V C;  2CVR A;  2KHS A;  4HCE A;  2R93 H;  1V8Q A;  2SNS A;  5T1I A;  1QB5 D;  3ZJY C;  2B2T A;  2LMC B;  2KEE A;  2YV5 A;  1A0I A;  1HFG A;  2F4I A;  1IKL A;  2A5H A;  2A69 C;  3K59 A;  1GHJ A;  5LMU L;  4A3J G;  2K05 A;  2UXB L;  2SOB A;  2L55 A;  1YZ6 A;  3CHB D;  1DM0 B;  4A3J H;  4CDF C;  3BS1 A;  3U58 A;  3T1Y L;  3FDT A;  3I4N G;  5ELB A;  3K7A H;  1C7Y A;  5IGG A;  1E7Z A;  2B2V A;  3FRP B;  1XMQ Q;  4O2D A;  2L12 A;  4MZ9 A;  5GAE C;  3GTK H;  3I4N H;  2CHB D;  3QJY A;  3NK9 A;  4GLV B;  5IP9 G;  2DY8 A;  3NQT A;  1KNE A;  3UDF A;  3WWV A;  5IP9 H;  1BR9 A;  1X3Q A;  4NW2 A;  4OX9 L;  1CKM A;  1XTC D;  2GVB A;  1Z6H A;  2B8G A;  3CU7 A;  1SN8 A;  2OQ0 A;  1YIJ A;  4A3G G;  1KXL A;  4DUZ L;  1Q82 C;  3CRL C;  5J39 A;  2BH8 A;  2MHV A;  4DK3 C;  1WVL A;  1PMR A;  2D9U A;  4UDU C;  5NUC A;  1GUW A;  3M4Y A;  4JI8 Q;  2F0O A;  4R4T A;  4GZY C;  2NUC A;  3PUX A;  3FMC A;  1EY7 A;  4BY7 G;  1I94 L;  4DR4 Q;  1YEZ A;  4ME5 A;  4TSS A;  1R4Q B;  3SK8 A;  4DPG A;  1LAC A;  3T1H L;  4DUY L;  2KQ3 A;  3RLN A;  5M5Y H;  3E5S A;  1SNM A;  2Q2T A;  2H1E A;  3J81 c;  1L1O B;  2D5D A;  1SMX A;  3D6C A;  1PYS B;  4QCL A;  1FNV A;  4JYA L;  4M1U B;  2DJG C;  4XTC S;  1C4Q A;  2JA7 H;  3PO2 H;  1KNA A;  1R4P B;  2KBN A;  4LUZ A;  3U4V A;  3W1G A;  2EXD A;  2K1B A;  4JI6 Q;  3OPO A;  3P20 A;  1IYV A;  3SDZ A;  3JC6 6;  3PO3 B;  4DV6 L;  1VS0 A;  4OL7 A;  2L9H A;  1I4X A;  1OXV A;  1XX8 A;  3B6Y A;  4J15 A;  2EYO A;  3DEO A;  3Q6S A;  4YWL A;  3JAM E;  4LFA Q;  3U4Z A;  1EIH A;  3U9S A;  4J1M A;  2WAQ B;  2HIX A;  3HOW G;  4OWX B;  5M3F B;  1KAB A;  3SGI A;  2R61 A;  1L1O C;  5IGB A;  4K6D A;  5E7N A;  3M4O B;  4B3T L;  2WV6 D;  5KEE A;  5C3E G;  2WB1 E;  5FKA C;  4IFD J;  1J6Q A;  1SXT A;  4YCW A;  4N9T A;  5AJ3 L;  3RZD H;  3DWA A;  4B9X A;  2EYM A;  1JB3 A;  4F8M A;  4M8A A;  4RKL A;  4A3E G;  2YTV A;  4A3E H;  4P74 A;  2HHH Q;  2ICE C;  4JBK A;  1I4Q A;  4OO1 I;  3PMF A;  4IUU A;  3D6W A;  4QUC A;  4QUF A;  1F9Q A;  2Z4I A;  4LF9 Q;  1NMF A;  2JK8 A;  1PTO H;  2WKC A;  2CH4 A;  2IHE A;  4KKT A;  3DLL A;  2D2C C;  4HSP A;  3GTM B;  4DR6 L;  2IX0 A;  2JYO A;  4RKB A;  4ZKB B;  3RLF A;  2LS0 1;  4AIM A;  2MPM A;  3CCR A;  4L63 B;  2MJ8 A;  2A19 A;  5I6W A;  2WB1 G;  1LTR D;  3GV3 A;  2CFM A;  2VQF Q;  3N52 A;  4FF3 A;  3CD6 A;  1YNN D;  2KUM A;  3TBI B;  3GO5 A;  1AE3 A;  2HCC A;  1TWA H;  4A3M H;  3J81 L;  4DNT B;  3KYH C;  1FJG L;  1IZ6 A;  3CPW A;  1BCP D;  3UDX A;  1VQE A;  1XNR Q;  3K5N A;  3TDQ A;  5IYB G;  4ZQ3 A;  1ASY A;  3BDL A;  5IYB H;  1NNX A;  4A3I G;  3D4D A;  3HZX A;  3A7A B;  3KBG A;  4UAI A;  5FO7 B;  3BVZ A;  4NXN Q;  1BKB A;  1D5X C;  1T9H A;  1EU4 A;  5IY0 A;  3KBX A;  1CHP D;  2PNH A;  1JWU D;  4P75 A;  3MA2 B;  3S14 H;  3UI2 A;  1F2Y A;  3VA7 A;  2NZ1 D;  2F3V A;  1TKW B;  1BF4 A;  1XNQ Q;  4DGZ A;  2N49 A;  4ME3 A;  4X65 L;  2UUB Q;  3K8A A;  4UP7 A;  2K33 A;  3JAM c;  2F03 A;  4HIO A;  3MFY A;  2NN6 I;  2F3I A;  5F2D A;  3CW2 C;  1YHB A;  1N32 Q;  5E4X A;  4JI7 L;  3GTQ H;  3HKZ B;  5CV8 A;  3ZYY X;  2N78 A;  3MEH A;  2F0N A;  4H7B A;  4FVM A;  4K0K Q;  3NQI A;  3GTL B;  1BCP B;  1GUS A;  1PRT F;  4K5W A;  3EBE A;  4DV7 L;  3J7A 5;  1DD2 A;  5A35 A;  1DJR D;  3KK7 A;  3SEB A;  5C0X J;  2QEX A;  5JJZ A;  1HHV A;  5I2Y A;  4B3R Q;  1EIY B;  2IPK D;  5D14 A;  2ZXP A;  4TQU S;  1CA6 A;  4CKC A;  1KIX A;  4JG2 A;  4HMJ A;  2M00 A;  5KRU A;  5J1Z A;  1LLR D; 
#chains in the Genus database with same CATH homology
 4H02 A;  2ZM6 L;  2JEA I;  1XMO L;  3S2D H;  1VCI A;  1VQ5 A;  5C3E H;  1HNW Q;  4GOP B;  3CAM A;  3NEM A;  1S72 A;  4DR6 Q;  1CUK A;  2DUD A;  1QZH A;  1YJ9 A;  4A75 A;  3CPF A;  4JI0 L;  4GKJ L;  5H1S E;  4B3M L;  2K4K A;  4DR7 Q;  2HQL A;  1Q81 C;  1VQJ A;  1B7Y B;  2CQO A;  5LMU Q;  4HJ9 A;  5IWA Q;  4POG A;  5HY6 A;  2UXB Q;  1PH7 A;  2KCM A;  2BA1 A;  1YHQ A;  3FP9 A;  4UP9 A;  1CKN A;  3M7N A;  2OTL A;  1HZC A;  3HOZ H;  1A63 A;  4A3C H;  2WAQ E;  4R1J A;  1Q46 A;  4GNX A;  2PI2 A;  2RF4 A;  1KC8 C;  3S1Q H;  1OXX K;  4QJF A;  1BBU A;  1UE5 A;  1PH3 A;  1VQC A;  1VQ9 A;  3AQQ A;  3E0E A;  1S3O A;  3S17 H;  3ULL A;  4PZ7 A;  2YYZ A;  1FJG Q;  4DV0 L;  5IT9 c;  1QUQ B;  1K3R A;  3OTO Q;  4HIK A;  1ASZ A;  2QA4 A;  4A3L G;  4OXP A;  4L5T A;  1WJJ A;  2R93 G;  2BH2 A;  4DR5 L;  1VQM A;  1K8G A;  4L5R C;  4GOP C;  4OX9 Q;  1IL2 A;  5C44 G;  4A3K G;  2JE6 I;  2NZO A;  1VQB A;  4X62 Q;  3GD7 A;  1NE3 A;  1IBK L;  4NXM Q;  2VUM G;  4QQB X;  5C44 H;  4A3K H;  1OXS C;  1K8A C;  1WCM H;  4JI3 Q;  3J81 j;  4A3F G;  1X65 A;  4R4Q A;  4GOP A;  3KF8 B;  4YHH L;  5IP7 G;  4DNI A;  3RR5 A;  1PH5 A;  2HT1 A;  3PO3 G;  5C4X G;  4OWW B;  3G71 A;  1LYL A;  1PH1 A;  4PZ6 A;  1RIP A;  1PH2 A;  1N36 Q;  1IXR A;  1JB7 A;  3HOY H;  2AWN A;  3ULJ A;  5C4X H;  3H3V H;  2CWP A;  1QVG A;  1D7Q A;  3A5U A;  3UE0 A;  4C3J H;  2UU9 L;  1Q86 C;  3CC2 A;  1TWF H;  2WAQ G;  4DAM A;  1VQL A;  2NVT H;  1SRO A;  3GTJ H;  1VQ7 A;  3BU2 A;  4X64 Q;  5M3F G;  3CF5 A;  4LF9 L;  2K5H A;  2OQK A;  3G6E A;  3CC7 A;  1YJN A;  5M5W H;  4X65 Q;  1QVC A;  3CMA A;  2LXK A;  4DV5 L;  5M3F H;  1EIF A;  2PQA B;  3M4O H;  4POF A;  1HNX Q;  4A3I H;  1QZG A;  3G4S A;  2UXC L;  4IOC A;  4JI4 L;  3A74 A;  2AWO A;  1N34 Q;  4Y52 H;  1KQS A;  1QUQ A;  3S2H H;  3GTG H;  3TRE A;  1M1K C;  3EIV A;  1HH2 P;  1VQF A;  3IRB A;  1EOV A;  3RZO H;  1GKH A;  3F1Z A;  4MTN A;  2VW9 A;  4HID A;  4DV1 Q;  4JI7 Q;  4LF7 L;  4LF6 L;  1QVF A;  2A8V A;  5BR8 Q;  2KHJ A;  3H0G G;  2DGY A;  4YY3 Q;  2MO1 A;  2XTI A;  2Z0S A;  2F4V L;  2UXD L;  1KHI A;  4KHZ A;  2NZH A;  4AYB G;  3J80 c;  4DV2 L;  3PUW A;  2UUC Q;  3K80 C;  1XMQ L;  5IYD G;  2Q2I A;  4R4I A;  3VDY A;  4BBS H;  2Q2U A;  2E5L L;  4BXX G;  4DV7 Q;  4X66 Q;  1GO3 E;  4DV6 Q;  3CCQ A;  4IO9 A;  1E3P A;  1TWH H;  1VQH A;  3GDE A;  1PH4 A;  1HR0 Q;  2NVQ H;  3HOU H;  3GTM H;  4BXX H;  1XNR L;  3ICE A;  3K0X A;  5ELN A;  3OYY A;  3PUZ A;  3L7Z C;  4BA1 I;  5C0X I;  3ERS X;  1HNZ Q;  4GLX A;  2FXQ A;  2CCZ A;  1L0W A;  2UUA L;  4AH6 A;  1XPU A;  3PUY A;  2R92 H;  1MJC A;  4GS3 A;  1XTD A;  3PF4 A;  1JJC B;  2JA5 H;  1PYB A;  2OWO A;  4B3T Q;  4P73 A;  2ASB A;  2Z6K A;  2PQA A;  4NXN L;  4IFD I;  2ZJP A;  2ZM6 Q;  2R7F A;  3DM3 A;  1JE5 A;  3KOJ A;  4IPG A;  5LMN Q;  3KDF B;  4A3B G;  1JT8 A;  1NMG A;  2IT1 A;  4JI8 L;  1EQR A;  2JA8 G;  3JAM i;  5DLQ E;  3AFQ A;  4JI0 Q;  4B3M Q;  4NPS A;  2JA7 G;  2JEB I;  1SFO H;  2B29 A;  1EFW A;  1E1T A;  2JA8 H;  3PO2 G;  3G48 A;  1MKH A;  1H95 A;  1AE2 A;  3A5Z B;  1YIT A;  4KHP L;  1YI2 A;  3CC4 A;  3D31 A;  2E8G A;  3HKZ E;  5ELO A;  4DR4 L;  2HIV A;  1X55 A;  4DV4 L;  4B3S L;  3L0O A;  1X9N A;  5JJI A;  1X56 A;  5C0X G;  2BA0 A;  1N9W A;  5JEA J;  1UEB A;  4JI2 L;  1FL0 A;  1D8L A;  2PI2 E;  3BJU A;  4BY1 G;  2KEN A;  4DR1 L;  3L2P A;  5GAH C;  1PVO A;  3TS2 A;  1MJE A;  2AMC B;  4PMW A;  1N8R C;  3TQY A;  1CSQ A;  4DV0 Q;  1AH9 A;  1WI5 A;  4BY1 H;  1N32 L;  4A4I A;  2K5N A;  4YCV A;  2JQO A;  1Q1E A;  4P71 A;  4IFD G;  4LFB L;  4JV5 L;  1MIU A;  4DR5 Q;  3S1R H;  5JJL A;  5EAY A;  1VQA A;  1KL9 A;  5IYC G;  4DR3 L;  1Q1B A;  4EX5 A;  1CKO A;  2NVX H;  4K0K L;  2ID0 A;  1IBK Q;  4JI6 L;  2ZTC A;  3W1B A;  5IYC H;  3S1N H;  2K52 A;  3LGJ A;  4OWT B;  2OCE A;  4HJA A;  3TS0 A;  1SR3 A;  3I56 A;  2IHF A;  2V1C C;  5FJ8 G;  3F2B A;  4HJ7 A;  1X3E A;  1NY4 A;  2KHI A;  1V43 A;  1VQ4 A;  4LFA L;  2B3G A;  3E9H A;  3NBH B;  1L2F A;  2YTY A;  5FJ8 H;  3RLO A;  1WOC A;  1B70 B;  3K7U C;  2LSS A;  1G51 A;  3HKZ G;  2GVA A;  2UU9 Q;  4LF4 L;  4GN5 A;  3J7Z C;  4A3L H;  1UE7 A;  1KRS A;  2R93 H;  1GD7 A;  3TEH B;  3PF5 A;  3STB D;  3S16 H;  4UY8 C;  4GKK L;  2YTX A;  3ZJY C;  2ZJQ A;  4KI0 A;  1TWG H;  1K9M C;  1Q8K A;  3I2Z A;  1B8A A;  4L5S A;  5GRO A;  2YV5 A;  4RG1 A;  4AYB E;  2VUM H;  1A0I A;  5IE8 A;  2I5H A;  1R9T H;  4JI4 Q;  2AKW B;  4O0A A;  2IX1 A;  4DR7 L;  4A3F H;  1KRT A;  2E2H H;  4LW1 A;  4TVA B;  5IP7 H;  1EUJ A;  3M4P A;  3PO3 H;  5LMU L;  4A3J G;  2HHH L;  5K36 G;  4IJL A;  1K73 C;  3KF6 B;  2UXB L;  1OXU A;  1YZ6 A;  4LF7 Q;  4LF6 Q;  5C4J H;  1PH9 A;  4A3J H;  1X3F A;  2Q2H A;  4Y7N H;  3PGZ A;  3U58 A;  3T1Y L;  4LF5 L;  2D62 A;  4A3M G;  3I4N G;  2UXD Q;  4LF8 Q;  4UPA A;  1X54 A;  3K7A H;  1SE8 A;  4DV2 Q;  3OW2 A;  1C7Y A;  1E7Z A;  4ALP A;  1XMQ Q;  1N33 L;  4O2D A;  4JOI C;  4MZ9 A;  5GAE C;  1SLJ A;  3GTK H;  3I4N H;  1U5K A;  3A0J A;  3HOV G;  4JI1 Q;  1DGS A;  5LMN W;  4GLV B;  5IP9 G;  3CCU A;  2VY3 A;  3UDF A;  2OTJ A;  1E1O A;  3WWV A;  1BBW A;  2D0O A;  2R7Z G;  1VQP A;  1C0A A;  5IP9 H;  4OX9 L;  1CKM A;  3KLW A;  2R7Z H;  2B63 G;  2VQF L;  1UWV A;  2GVB A;  4P72 A;  4LFC Q;  1JMC A;  4A76 A;  4NXM L;  1Y1V G;  1SN8 A;  2OQ0 A;  1YIJ A;  1XPR A;  1I5F A;  4DUZ L;  4JI5 L;  3CP0 A;  3H0G H;  2B63 H;  1Q82 C;  4A3G G;  1KXL A;  4WJ4 A;  1I3Q H;  2BH8 A;  3MEF A;  1Y1V H;  4DK3 C;  2L15 A;  4IJH A;  1G29 1;  5IYD H;  1JJG A;  3NEN A;  3CCL A;  3MXN B;  1RL2 A;  4JI8 Q;  1IBM L;  5FLX c;  2C35 B;  3FHW A;  4R4T A;  3KJO A;  3KF6 A;  1X6O A;  4IPD A;  4X64 L;  5HGQ A;  3PUX A;  1PH8 A;  2EQS A;  2PMZ E;  3K81 C;  3EN2 A;  4IOA A;  3NEL A;  4BY7 G;  3I7F A;  4YWK A;  1I94 L;  4DR4 Q;  1YEZ A;  4B3S Q;  4DPG A;  1YJW A;  3RNU A;  1HNX L;  3T1H L;  4JBW A;  4DUY L;  3RLN A;  5M5Y H;  1XMO Q;  3S1M H;  4BBR G;  1YVC A;  2Q2T A;  2ES2 A;  4JI2 Q;  3J81 c;  1L1O B;  4DR1 Q;  3PUV A;  1SMX A;  3BZC A;  1PYS B;  2GN5 A;  4GKJ Q;  4BBR H;  4A3B H;  4JYA L;  4APV A;  1GM5 A;  4C2M H;  4QGU A;  4LFB Q;  1XNQ L;  4JV5 Q;  1U0L A;  4XTC S;  1EYG A;  4KLK A;  4YY3 L;  2JA7 H;  2Y0S E;  1CKN B;  4IPH A;  4MNO A;  2E2J H;  1Z9F A;  2UUB L;  3GTP H;  3PO2 H;  2K50 A;  2UUC L;  2CKZ B;  2KBN A;  3AYH B;  1M90 C;  5JJK A;  4GNX B;  4LUZ A;  3U4V A;  3W1G A;  2EXD A;  4IPC A;  4NB3 A;  3STB C;  2ZJR A;  5FLM G;  4JI6 Q;  4QL5 A;  3S24 A;  4DV3 L;  1P8L A;  4HJ5 A;  3JC6 6;  4AQY L;  4DV6 L;  2JA6 G;  4GKK Q;  1VS0 A;  3W5O A;  1HR0 L;  4DR2 L;  1OXV A;  1VQK A;  3B6Y A;  2YU9 H;  2MNA A;  4J15 A;  3F8T A;  3RN2 A;  4YWL A;  2JA6 H;  4LFA Q;  1K0R A;  1IBL L;  3I4M G;  1LUZ A;  3U4Z A;  3HKS A;  3U50 C;  3M3Y H;  2HIX A;  2R7D A;  3CME A;  4OWX B;  1PV4 A;  3HOW G;  3KJP A;  5JEA G;  3I4M H;  3SGI A;  3BZK A;  1VQI A;  1L1O C;  2MQH A;  2ALY B;  4JBJ A;  5E7N A;  4B3T L;  5C3E G;  2WB1 E;  4IFD J;  1X3G A;  3CCJ A;  1UE1 A;  1J6Q A;  1WFQ A;  2WFW A;  4YCW A;  5AJ3 L;  3RZD H;  1EQQ A;  4BA2 I;  2QGQ A;  5LMN L;  3UDG A;  4A93 G;  1GVP A;  4GN3 B;  1VQO A;  3KDF A;  1J5E L;  2E2I H;  4A3E G;  1VQD A;  5GQO A;  1W2B A;  1L1O A;  4YHH Q;  1E22 A;  3TRZ A;  2YTV A;  3CCE A;  4A93 H;  2VQE L;  1JJ2 A;  3ER0 A;  3I4O A;  4P74 A;  4A3E H;  4GNX C;  4B3R L;  2JA9 A;  1PHJ A;  3HOZ G;  2I5L X;  2HHH Q;  2Y0S G;  3AFP A;  2VNU D;  1OTC A;  4A3C G;  4UP8 A;  1LTL A;  4JBK A;  1YHA A;  2RHQ B;  3KFU A;  4OO1 I;  1C9O A;  2A1A A;  2IY5 B;  3H3V I;  3UE1 A;  2ZTD A;  1HZB A;  1I6H H;  4LF9 Q;  1NTG A;  1A8V A;  1NMF A;  2ZTE A;  4R4O A;  3PIP A;  3T1Y Q;  4LF5 Q;  2JK8 A;  4DV5 Q;  3PIO A;  2IHE A;  1N33 Q;  2D0P A;  3DLL A;  1HNW L;  4L5Q A;  4DR6 L;  3HOX G;  2IX0 A;  1A62 A;  2UXC Q;  1BVS A;  3GTL H;  3RLF A;  3HOX H;  4AIM A;  1XPO A;  5IWA L;  1HR0 W;  3CCR A;  1KAW A;  1TWC H;  2A19 A;  4DAY B;  1E24 A;  4A3D G;  2WB1 G;  2NVY H;  2CFM A;  2JJQ A;  3HFZ B;  2RHS B;  1KD1 C;  1WCM G;  2VQF Q;  3CD6 A;  3RN5 A;  3CQZ H;  2F4V Q;  1V9P A;  4A3D H;  4DUZ Q;  3GO5 A;  1AE3 A;  1Y1W G;  4JI5 Q;  4LNQ A;  3CCV A;  1LM0 A;  3HOY G;  1TWA H;  4A3M H;  2E5L Q;  1OXT A;  3E9I A;  3PSI A;  4C3H H;  3AEV A;  4JBM A;  4OO1 G;  1Y1W H;  1WYD A;  3KYH C;  1FJG L;  2MO0 A;  3ULP A;  1IZ6 A;  1FGU A;  4GLA C;  3OTO L;  3CPW A;  2N3S A;  3UDX A;  1IBM Q;  1VQE A;  3HOV H;  1XNR Q;  4JOI A;  5GAD C;  3CXC A;  5IYB G;  5GAG C;  1Y14 B;  3F2D A;  2K75 A;  3S15 H;  4JC0 A;  2UUA Q;  1ASY A;  1VQN A;  2I0Q A;  3M85 A;  4X62 L;  4GN4 B;  5IYB H;  4HJ8 A;  4A3I G;  1I94 Q;  2KCT A;  4JI3 L;  4NXN Q;  1NJI C;  2H5X A;  3T1H Q;  1BKB A;  5M3M G;  4DUY Q;  1T9H A;  4A3G H;  1PFS A;  2VZA A;  4JCV E;  1XJV A;  4R4C A;  1W3S A;  3PCO B;  2MFI A;  5IY0 A;  1N36 L;  1VQG A;  2PNH A;  2XGT A;  1Q7Y C;  4P75 A;  5M3M H;  3M9B A;  3S14 H;  4JYA Q;  4WJ3 M;  3UDI A;  2F52 A;  4C3I H;  2ATW A;  1P16 A;  2AHO B;  1K83 H;  1XNQ Q;  4KHP Q;  2N49 A;  1G6P A;  4ME3 A;  4BBS G;  2WP8 J;  4X65 L;  4DKA C;  1S40 A;  1PA6 A;  1UE6 A;  2R6G A;  2I5M X;  3K8A A;  4UP7 A;  2UUB Q;  4LF8 L;  3JAM c;  1VQ6 A;  4DV4 Q;  4HIO A;  4LUV A;  1NBW A;  2N8N A;  2NN6 I;  4BY7 H;  1FVI A;  3HOU G;  4FDB A;  2F3I A;  5J3B A;  2LXJ A;  4DV3 Q;  1N34 L;  4YCU A;  4JI1 L;  3FKI G;  4EQ5 A;  3I55 A;  4AQY Q;  4X6A H;  1I50 H;  1SRU A;  4XIG S;  3J80 i;  4DR2 Q;  1PH6 A;  2R92 G;  3CW2 C;  2RCN A;  3FKI H;  1YHB A;  3Q8D A;  1N32 Q;  1IYJ B;  2CWA A;  1HZA A;  2Z6K C;  3PV0 A;  4DV1 L;  1IBL Q;  4QY7 A;  5BR8 L;  4JI7 L;  3GTQ H;  2JA5 G;  1Z47 A;  5M5X H;  4LFC L;  2N78 A;  1CSP A;  2VL6 A;  1V1Q A;  2K5V A;  3H15 A;  4DK6 C;  3CCM A;  1HJP A;  4DR3 Q;  4K0K Q;  1YNX A;  1VQ8 A;  5AJ3 Q;  1YBY A;  3CCS A;  3EBE A;  4OON A;  4X66 L;  4DV7 L;  1J5E Q;  1Q12 A;  3J7A 5;  5FLM H;  3M4Q A;  4RMF A;  5C0X J;  4LWC A;  2QEX A;  2VQE Q;  1HNZ L;  3F2C A;  2NN6 G;  4HIM A;  4B3R Q;  1EIY B;  1HZ9 A;  2VS1 A;  4YWM A;  4TQU S;  3D0F A;  3J81 i;  4LF4 Q;  1TXY A;  4PG3 A;  2EIF A;  4QIW E;  1KIX A;  4JG2 A;  4PZ8 A;  3GTO H;  2K14 A;  3HOW H;  4LUO A;  1O7I A;  1EWI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...