1N33Q

Structure of the thermus thermophilus 30s ribosomal subunit bound to codon and near-cognate transfer rna anticodon stem-loop mismatched at the second codon position at the a site with paromomycin
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
104
structure length
104
Chain Sequence
PKKVLTGVVVSDKMQKTVTVLVERQFPHPLYGKVIKRSKKYLAHDPEEKYKLGDVVEIIESRPISKRKRFRVLRLVESGRMDLVEKYLIRRQNYQSLSKRGGKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Selection of tRNA by the Ribosome Requires a Transition from an Open to a Closed Form
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 16S RIBOSOMAL RNA
total genus 20
structure length 104
sequence length 104
ec nomenclature
pdb deposition date 2002-10-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Q PF00366 Ribosomal_S17 Ribosomal protein S17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 1n33Q00
3S24A 5IP7H 4P72A 1VQ9A 3TRZA 3L2PA 2WAQE 3CMEA 4QGUA 4ALPA 1IXRA 2D0OA 1UE5A 4KHZA 2JA6G 3HOUG 3GDEA 2H5XA 3UDXA 4LF4Q 1VQIA 2Y0SE 3KOJA 4GKKL 4JI6Q 3PGZA 1UE7A 5C44H 4A3IH 1X9NA 1HNXQ 2E2IH 2CQOA 2PQAA 1N34Q 4NXMQ 1NMGA 4YHHL 1PV4A 2C35B 1T9HA 1AH9A 3GTQH 3H3VI 3RZDH 3UE1A 4DV6Q 4OWWB 1PYSB 2UUAL 1R9TH 1JE5A 1WFQA 3TS0A 1K8GA 5H1SE 4UPAA 4LUVA 1Q1BA 4DR5Q 1WCMH 1K3RA 2ID0A 5HGQA 4DV5L 4A3EH 4DR2L 4A3LH 3DM3A 1VQKA 3SGIA 2EXDA 1OXTA 2MO1A 1HR0W 1VQ5A 4LF8L 1FJGQ 4AYBE 4A3DH 1LTLA 4BY1G 4HJ8A 2JE6I 4A3KG 4R4OA 1XMQL 1NMFA 1CKOA 1G291 4NPSA 2ES2A 4DV6L 4YY3Q 3K0XA 3CC2A 3KF6A 4X6AH 4DV1L 2B3GA 4JBJA 2FXQA 3ICEA 2KBNA 1YHAA 4JI8L 3RN2A 4JI6L 3KF6B 4K0KQ 1MKHA 2ZTEA 3EBEA 1TWAH 1L0WA 2ZM6Q 1Z47A 3E9IA 3PCOB 4DV4Q 1IBLL 2B63H 4BY7G 3AFPA 4FDBA 1KQSA 1HNWL 3CP0A 1GD7A 2PMZE 1X65A 1CSQA 1FJGL 1P16A 1YNXA 4IPGA 4A3JH 4JYAL 1O7IA 4TQUS 4POFA 3VDYA 3AEVA 2WB1G 3CW2C 4DAYB 1VQ7A 4B3TL 3CQZH 4PZ6A 3WWVA 1Y1VH 4DR5L 1SLJA 1SRUA 2UUBL 3H3VH 4GOPC 4GOPB 4A3EG 4QL5A 4IOAA 1KXLA 3FKIH 1K9MC 1KHIA 1LM0A 1A0IA 3OYYA 1JJ2A 3PV0A 4QIWE 2WB1E 2UXCQ 1VQ8A 2UXBL 3ULJA 4DV2Q 4JI2Q 3GTGH 5IYCH 3PF5A 2UUCL 4JYAQ 2K50A 1WJJA 4DK6C 4LUOA 1N32Q 1H95A 2E5LQ 1AE2A 1TXYA 2PNHA 3NENA 3UDGA 3PO3H 4OONA 4HIOA 2QGQA 3CMAA 3GTJH 2LSSA 1KC8C 4NB3A 4JI0Q 4IPDA 2AWNA 3RN5A 2WP8J 3L0OA 5M3MG 1ASYA 4P71A 5C0XI 2IHFA 4HJ9A 4DV0Q 2UU9Q 5FLMG 3I4NH 3FP9A 3STBC 3G71A 4LFCQ 1VCIA 2KHIA 1M90C 3CXCA 3AYHB 1PH9A 1Q82C 1GM5A 2JQOA 3TREA 2MO0A 1Y1VG 5FJ8H 2I5HA 4HJ5A 3M4OH 4AQYQ 3J81j 3CCUA 3S15H 3GTPH 1E22A 3FKIG 2A8VA 2I5LX 2R92H 3HOWH 3PUZA 4B3RQ 4A3JG 2VNUD 1HZCA 1XNRL 1N36L 1CSPA 1KL9A 5ELOA 1HH2P 1U0LA 5JJLA 3CCLA 4C3IH 1WOCA 1IYJB 1JJGA 3RR5A 1D7QA 2ALYB 1NTGA 1HZBA 3S17H 3PUYA 3A0JA 1EQQA 2ZJQA 1I6HH 4JI7Q 4YCWA 3J7A5 1N34L 4DR3L 4PG3A 3HOYG 4YHHQ 1V43A 1E1TA 4L5TA 4LF9Q 5EAYA 5M3MH 4JI2L 4EX5A 4IFDJ 2PQAB 4A3KH 5IYBG 1X3GA 1K73C 3CCRA 4P73A 3CF5A 3CCSA 3GD7A 2Y0SG 3KDFA 2QEXA 1FGUA 4HIMA 4L5QA 1L1OA 4RG1A 2AMCB 4JI4Q 1EFWA 4JBMA 3I4MH 4DPGA 5GADC 1K83H 1TWGH 4JBWA 4X66Q 4DV7Q 1X3FA 3F2CA 1YITA 3BZKA 2R93H 1IBKL 2HHHQ 4POGA 3S14H 4DR1Q 2UU9L 5JJKA 1VQHA 1PH8A 3HFZB 3KJOA 1MJCA 3J80i 1S3OA 4JI1L 3MXNB 4XTCS 2E8GA 2K4KA 3D0FA 1Q81C 2UUAQ 3S1NH 3G6EA 3K80C 1PFSA 1L2FA 1E7ZA 3UDFA 2BH2A 1L1OC 1VQMA 2NN6G 3I2ZA 2YU9H 1CKNA 5C4XH 2MNAA 4DV3Q 3HOZH 1YHQA 5HY6A 5LMNW 3F2BA 2LXJA 1HR0L 2E2HH 4JI3Q 4A3CH 2KCMA 4YWLA 4L5RC 4JCVE 3HOVH 1Q8KA 4BA2I 1B70B 4GN3B 4DNIA 1J5EQ 3FHWA 3OTOQ 4WJ4A 3ER0A 2UUBQ 2BA1A 4Y7NH 2D62A 4KI0A 2ZJPA 4DUYL 2I5MX 4LF6L 2RHSB 1OXUA 4GOPA 4BY1H 3S1MH 3F8TA 3KFUA 3HKZG 1XMOL 2VQFQ 1X3EA 4MNOA 2UUCQ 3TQYA 4LNQA 4B3SL 4BBRH 2N3SA 2F52A 1VQ6A 4AH6A 1XPRA 2IT1A 1SR3A 1EIYB 3NBHB 4OWXB 4BA1I 3HKSA 2QA4A 1RL2A 4LF5L 4LF4L 1VQ4A 2F3IA 2ATWA 3K81C 5C44G 1HNZL 4JI0L 1XPUA 4O0AA 3Q8DA 3U50C 1UE1A 2YTVA 2JA5H 1VQNA 4LW1A 4QQBX 3PF4A 1JB7A 1QZHA 1N33L 1YJWA 1VQFA 2BH8A 1B7YB 3D31A 3CPWA 1Q46A 4B3SQ 4JI1Q 1AE3A 1HZAA 1I50H 2Z0SA 4DUYQ 2MQHA 2N8NA 2F4VL 4PZ8A 3PO2H 5C3EG 4LWCA 4OWTB 4LF6Q 3K7UC 4MTNA 3G4SA 1D8LA 2DGYA 2GVBA 4LFBQ 4A3CG 4YWMA 1PHJA 3HOZG 4BXXG 3UE0A 2NVXH 4JOIA 5IYBH 4IPHA 2GN5A 5IP9H 1Q7YC 3KYHC 2JA7G 4H02A 5C0XJ 1QVGA 1KRSA 3PSIA 2F4VQ 1WCMG 3PIPA 1HNZQ 4ME3A 3HOXG 4X64L 1IBLQ 5K36G 3U58A 1X55A 1LYLA 3PUWA 1SROA 3EIVA 1XPOA 1XMOQ 1OTCA 3I4NG 3S1QH 2CKZB 2UXDL 4XIGS 2R7DA 4BBRG 4Y52H 1YJNA 4IJLA 4B3ML 1XNRQ 4X65L 4YY3L 1BVSA 3NELA 1QUQB 1UWVA 2OQ0A 1GVPA 2CWPA 4JI5Q 3CC4A 1L1OB 3GTOH 4LFAQ 1QUQA 5DLQE 4X66L 2R7ZH 4GKJQ 4LFBL 5LMNL 1PVOA 1BKBA 1DGSA 4GLXA 4HJAA 3TS2A 1A8VA 2ZJRA 1EUJA 3KDFB 3W1BA 2YTXA 3CCJA 4QJFA 3PUXA 5IYCG 2VW9A 3RLOA 3RNUA 3T1HQ 2JEBI 2RF4A 4JG2A 5M3FH 2CCZA 3KLWA 3PUVA 4JI4L 1TWCH 4X64Q 1OXVA 2Z6KA 1PH6A 3HOYH 1JJCB 3J80c 2RHQB 3K8AA 1HNXL 3W1GA 2CWAA 1VQAA 5IE8A 4A3BH 2UXDQ 4BXXH 1SE8A 4C2MH 2KHJA 1Q12A 4A3GH 2DUDA 3U4ZA 2CFMA 3ULPA 4DUZL 2KENA 3CC7A 2N49A 1XJVA 4L5SA 5IP9G 2VQEQ 3CAMA 3HKZE 4MZ9A 5M5WH 3DLLA 1IBML 2JA7H 5JEAG 2GVAA 3PO3G 4GKKQ 2WFWA 2B29A 5FJ8G 4OXPA 4AIMA 5LMNQ 4HJ7A 4AQYL 4UP7A 3OW2A 1KD1C 2AWOA 4J15A 1I94Q 4A3LG 3ERSX 2VY3A 1Y14B 5IWAQ 3TEHB 1A62A 4DV3L 1C0AA 4B3RL 5FLMH 1W3SA 4BBSH 1KIXA 4B3MQ 4DR4Q 2ZTDA 4DUZQ 4LFCL 2NVTH 1S72A 1Q86C 5C4JH 4RMFA 3KF8B 2VQEL 4C3JH 1KRTA 4UP9A 4JI5L 2R7ZG 4A3MH 1PH2A 1JMCA 1KAWA 3A5ZB 4NXML 4A3IG 1VQLA 3M4PA 3W5OA 4A3BG 3I56A 4LF7Q 4LF9L 2YTYA 2IHEA 4DV0L 2L15A 2YYZA 4JV5L 1VQJA 2WAQG 1RIPA 1G6PA 3BJUA 4GNXC 4GNXB 2VS1A 1N36Q 3RLFA 3RZOH 2Z6KC 3ZJYC 4IOCA 2R7FA 1CUKA 5M3FG 4IJHA 2JA8H 4OO1G 3K7AH 2JJQA 5E7NA 5JJIA 2VUMG 1UE6A 3PIOA 2Q2UA 1ASZA 1EQRA 1VQGA 1EYGA 4LF8Q 4UY8C 3ULLA 2VL6A 3M4QA 5LMUQ 4A3FG 5IWAL 4HIKA 5J3BA 1QVFA 4AYBG 2HHHL 1YZ6A 4A3GG 3KJPA 2UXBQ 4DV2L 4X62L 4BBSG 4DAMA 2JK8A 1TWHH 4DK3C 5IP7G 5GQOA 4DR6L 4B3TQ 3JC66 4QY7A 3F2DA 1IZ6A 1BBWA 4R4CA 3CCVA 1IBMQ 1N32L 3I7FA 2I0QA 1NE3A 1XTDA 3MEFA 2B63G 2BA0A 3I55A 3LGJA 3CCQA 1PH4A 2ZM6L 4BY7H 4YCUA 4YWKA 2K14A 4P75A 1HNWQ 5C4XG 4LUZA 1PA6A 4C3HH 2PI2E 4R4IA 1C7YA 3M9BA 4DR4L 1PH7A 1BBUA 1FVIA 3M85A 1HJPA 2E5LL 3CD6A 4A93G 5C3EH 2LXKA 4LFAL 2JEAI 4GKJL 1UEBA 3G48A 1HZ9A 1WYDA 4A4IA 5IYDH 2PI2A 4KLKA 4A76A 1YI2A 1S40A 3M3YH 4DV7L 1NJIC 1PYBA 1W2BA 2K52A 2NZOA 2JA9A 3E0EA 2OTLA 1I5FA 1VQPA 4DKAC 2E2JH 4JOIC 5GROA 5BR8L 3I4OA 4DR1L 2UXCL 3E9HA 4GLVB 5GAEC 4JV5Q 1V1QA 3CCEA 4DR6Q 1GO3E 4TVAB 1EIFA 3RLNA 3J81c 1YHBA 2VZAA 1XNQL 1U5KA 2D0PA 4X65Q 1J5EL 4HIDA 3EN2A 2JA8G 2IX0A 2AKWB 1MJEA 2V1CC 3GO5A 4GLAC 5C0XG 4EQ5A 3CPFA 1CKMA 1Y1WG 4LF5Q 2R6GA 5FLXc 1P8LA 4IFDI 1M1KC 2EQSA 3B6YA 4DR3Q 3H0GG 2JA5G 1OXXK 3S2HH 1FL0A 1C9OA 4JI3L 1HR0Q 2A19A 3S16H 3BZCA 5ELNA 1N9WA 3AFQA 1XNQQ 2NVYH 2XGTA 3J7ZC 3OTOL 4APVA 2HIVA 3S1RH 1QZGA 1VQBA 2ASBA 1A63A 3PO2G 4NXNQ 4IPCA 5IYDG 5IY0A 3JAMc 2A1AA 4OO1I 2HT1A 1VS0A 1SMXA 4YCVA 2R92G 1TWFH 1YIJA 4DV5Q 1EWIA 1NY4A 5BR8Q 2NVQH 3HOWG 2K5HA 3J81i 1PH3A 1YEZA 3T1YQ 1NBWA 3M7NA 4UP8A 1E24A 4O2DA 1XMQQ 1CKNB 1MIUA 2HIXA 2NZHA 2Q2IA 2OCEA 2K75A 4R1JA 2YV5A 1V9PA 3U4VA 1I3QH 1WI5A 4DV1Q 1YJ9A 1VQCA 3HOXH 4PMWA 4JI8Q 4JI7L 2VUMH 1E3PA 1VQDA 2K5VA 4K0KL 1J6QA 4DV4L 1K8AC 4LF7L 1X54A 4OX9L 3CCMA 1GKHA 3T1YL 1X56A 3L7ZC 2OTJA 4R4QA 3IRBA 4DR7Q 4A75A 2RCNA 3HOUH 1YVCA 2JA6H 4GNXA 1Q1EA 3JAMi 1Y1WH 4NXNL 2OQKA 2IY5B 3I4MG 3NEMA 5M5XH 1PH1A 5JEAJ 1OXSC 5LMUL 4GS3A 2ZTCA 1IBKQ 5GAHC 1LUZA 4X62Q 5AJ3L 4PZ7A 2IX1A 1QVCA 1G51A 1SN8A 5M5YH 4DR7L 3HOVG 3GTKH 1X6OA 3UDIA 1VQEA 2NN6I 3AQQA 2HQLA 4P74A 4A3MG 4A93H 2KCTA 3BU2A 1JT8A 1B8AA 4GN4B 4IFDG 2MFIA 1YBYA 4KHPL 2XTIA 5GAGC 3GTMH 1N33Q 2Q2HA 5IT9c 1VQOA 2Q2TA 1PH5A 4JC0A 2AHOB 1Z9FA 3T1HL 1N8RC 3GTLH 2EIFA 3F1ZA 4WJ3M 4JBKA 3STBD 4IO9A 2K5NA 1E1OA 4GN5A 4A3FH 4R4TA 1IL2A 1EOVA 3A5UA 4DR2Q 1K0RA 1SFOH 2OWOA 4OX9Q 1I94L 3A74A 2VQFL 3H15A 4A3DG 3H0GH 3S2DH 4KHPQ 5AJ3Q 2N78A 2R93G
chains in the Genus database with same CATH superfamily
3EROA 2OF1A 1WTHA 2WAQE 4ALPA 1IXRA 3OOCA 5IT9L 2A68C 2LS01 2KQ3A 4LF4Q 2SDFA 4XQNA 2YU9B 4JI6Q 5C44H 1UE7A 5FLXL 3S1NB 3MXPA 4XXEA 5FKAC 1R9TH 1BXTA 1WFQA 2F0OA 2E76C 4UPAA 4HCSA 1Q1BA 4LUVA 4DR5Q 2ID0A 4DV5L 4A3LH 1TT2A 1VQKA 1KAAA 4AYBE 4G57A 4A3DH 1KDCA 4HJ8A 4R4OA 2F0HA 1G291 4NPSA 3K0XA 1ET6A 3CC2A 2B3GA 1YHAA 3KBXA 4HEDA 3KF6B 1MKHA 1L0WA 1QB5D 1TWAH 1IBLL 1D2BA 1Z6HA 1HNWL 1P16A 4IPGA 1FR3A 3SHLA 1O7IA 2EYLA 4POFA 3K57A 1PTOD 3K58A 4NP5A 1Y1VH 3T4AC 1VDZA 4GOPB 4GOPC 4H44C 1ESFA 4PMBA 3P20A 3OYYA 1JJ2A 4QIWE 2Q8IB 2UXCQ 3ULJA 4JI2Q 3NQTA 1F2MA 2K50A 1N32Q 2XWBB 3CMAA 4K8IA 3GTJH 3S1QB 1F2ZA 4HR7B 1ICFB 4FP5D 5M3MG 3FP9A 1JE4A 2KHIA 3NTHA 1M90C 3AYHB 2E74C 2QDLA 2MO0A 1Y1VG 3LX0A 2EYPA 4HJ5A 3M4OH 2NVTB 1I4XA 3CCUA 3GTPH 1TY2A 2EXZA 2HDLA 1BCPC 3J7AF 2B8GA 3VYTA 1CSPA 3FPUB 5ELOA 1HH2P 3ITPA 3EQLC 1IW7D 2IWHA 3RR5A 1D7QA 1Y1WB 3R2TA 3C46A 2JA7B 5BN5A 1A3VA 2K05A 3PUYA 2ZJQA 1Q90A 1I6HH 3J7A5 4PG3A 3RZDB 1E1TA 1DOMA 3U9SA 5A35A 4IFDJ 1K73C 2LMCB 3J81L 3CCRA 1HTPA 3CCSA 3KDFA 1J8IA 4L5QA 4RG1A 2AMCB 4JI4Q 4JBMA 4IUNA 3I4MH 1PMRA 1GUWA 1U4RA 2K03A 4G7ZC 4X66Q 1YITA 1RTOA 1X3FA 3BZKA 2CH4W 3IFTA 1II3A 3S14H 4C3HG 2K5WA 3N52A 3GTPB 1SE3A 4IUTA 2ENBA 3QWNA 1JCKB 2QF7A 3QIAA 1BR9A 3G6EA 3K0YA 1E7ZA 3UDFA 2NN6G 1CKNA 3ND8A 4J8QA 5C4XH 4X3SA 1BO0A 1F9PA 4A3IB 5LMNW 2XVSA 1HR0L 2CH4A 4L5RC 4DNIA 3DHQA 4MN3A 4RH6A 4UDUC 2ZJPA 3T51B 1RKNA 2RHSB 1OXUA 3S1MH 3KFUA 3I4MB 2XNAC 2VQFQ 2PMZB 4N8FA 1EIGA 2N3SA 2F52A 4BBRH 5JVG3 1VQ6A 3D3RA 3G7LA 3NBHB 4OWXB 4BA1I 4K6LA 4LF5L 4LF4L 4R8NA 4ZAIA 3Q8DA 3U50C 4XT3B 2YTVA 3A8KE 4A3MB 1VQNA 2JA5B 4QQBX 4BBRB 1JB7A 1QZHA 3CPWA 3TSSA 2NTTA 2Z0SA 1QILA 2FMMA 3M4YA 2FHTA 4PZ8A 4LWCA 2Z9HA 4OWTB 1SEBD 3K7UC 3J7AV 3G4SA 1EU4A 1WTXA 1GXDC 4K5WA 3GTOB 2B2VC 4JOIA 1UAPA 2BOSA 2K32A 3DM1A 3CRKC 3W3AA 3MXGA 3J81E 2G9HD 3NQIA 1WCMG 2PZTA 4DK1A 4ME3A 4TRDA 5LHY1 1IBLQ 3OHXC 2F0LA 1X55A 1LYLA 3PUWA 3EIVA 3S1QH 3I4NG 5T1GA 2EY1A 5IODA 1UWVA 4KN7C 1GVPA 2CWPA 4XT1B 3CC4A 1L1OB 1PYWD 1QUQA 4X66L 4BBSB 5J22A 5LMNL 2KOLA 4RHSA 5JJZA 1BKBA 3QR8A 1GHKA 1L0YB 3KDFB 2EY2A 3HGBA 1S5FD 3RLOA 4JK1C 3ZYYX 2A6HD 5I6YA 3PUVA 4JI4L 2NWGA 1OXVA 3BVMA 3NBIA 1ZEQX 4J1MA 2L9HA 4L8JA 2DJGC 2FINB 2EYOA 1Q12A 2WAQB 4L5SA 1XTCD 3D4WA 5CGKA 3HKZE 1YNND 4MZ9A 5M5WH 1IBML 1SNDA 3PO3G 4GKKQ 2B29A 3PO2B 1MSGA 4G7HC 4AQYL 5KNCA 1EY7A 3OW2A 1KD1C 1C48A 4J15A 2JN4A 1S5BD 1SNCA 5IWAQ 4DV3L 1QE6A 1R9TB 4B3RL 4BBSH 5DAUA 2EJGC 1KIXA 4B3MQ 2ZTDA 1ZYRD 1TS2A 2FFKB 3OW7A 4UP9A 2F0IA 3KLSA 5FK9C 3KLRA 2R7ZG 2JA8B 1JMCA 1KAWA 4NXML 3S2HB 3I56A 4LF7Q 2IHEA 2L15A 4QB4A 4JV5L 1VQJA 1V1OA 1PXUA 3BJUA 4N9PA 4GNXC 4ILWA 2VS1A 2G9DA 3NBHA 1TWHB 2F0WA 1PRTD 1FNWA 1B3AA 2R7FA 1CUKA 4IJHA 5CBEE 3K7AH 5E7NA 2R93B 1STEA 2VUMG 1ASZA 1EQRA 1LT4D 1EYGA 2XWJB 4A3FG 5J3BA 1YZ6A 1ENAA 4DV2L 4LK1C 4DK3C 4DR6L 5HGTA 4B3TQ 3JC66 1BBWA 4R4CA 3I7FA 1IYVA 2BA0A 3CCQA 2ZM6L 4YCUA 2K14A 3W2DA 2IX3A 4Q0FA 5E4XA 2PI2E 4ZLTF 1BBXC 3NTIA 4IUQA 4DR4L 1D5MC 1TS4A 1HA6A 3NTKA 1RDPD 4A93G 3DEOA 1HZ9A 2B2TA 2K04A 2PI2A 4DV7L 3C1EA 2NZOA 5KYLA 4DKAC 1D1KA 2F03A 1SNPA 1LLRD 1V1QA 1K3BC 1EIFA 3I3CA 2VZAA 1AW7A 1I4PA 2J7ZA 3BYTB 3EN2A 1B9NA 1MJEA 2BE5D 5C0XG 4XQJA 1EL0A 4WORA 2R6GA 3K5NA 2KCNA 4DR3Q 5G3LD 2JA5G 4JI3L 2L1BA 1JOKA 2QKIC 1XNQQ 1V1PB 3DWAA 4WJWA 3J7ZC 2HIVA 2AQ2B 1K83B 4NXNQ 5IYDG 2Y0SB 2HT1A 3Q22A 1CQVA 2EY6A 2NVQB 5BR8Q 2B2TC 3MA2B 1PH3A 2PCFB 3AMUA 1MIUA 1MSHA 2VXWA 4CKEA 1PTOF 3H09A 5LL6S 1IKLA 4DV1Q 3TN2A 2JYOA 1C8CA 3HOXH 4JI7L 4K0KL 5BN4A 2I07B 1K8AC 2EYMA 1GKHA 3U9OA 3L7ZC 5EKIA 3IRBA 4R9WA 1YVCA 5IT9E 1Y1WH 2OQKA 5CV4A 2O2LD 3I4MG 5JEAJ 3I8ZA 1G6ZA 2A69C 3BVGA 4FXDA 4X62Q 2BE5C 2IX1A 1PRTF 1QVCA 5M5YH 3HOVG 2RVLA 1VQEA 1EQTA 4A3MG 3I73A 3BU2A 1R4QB 4RFBA 3QG1A 4IFDG 4KHPL 1STGA 2JXMB 2XTIA 2J0TD 1VQOA 5F2DA 3SVMA 1Z9FA 4KD3A 4PQXA 2EIFA 3FVQA 5JEAH 5IIFA 1TIID 1E1OA 3S14B 1IL2A 3A5UA 4DR2Q 1K0RA 3I72A 3H15A 2R93G 5KEEA 5AJ3Q 5GAEC 1K9MC 4C3HB 4RWSC 1UE5A 3GDEA 1R4PB 4R8IA 2EYFA 3FEWX 3OMCA 3PGZA 1JR0D 4RAUC 2E2IH 1VMCA 2PQAA 5JOBA 2G5DA 1T9HA 3R3OA 2L12A 3UE1A 4DV6Q 4C3IG 1BNZA 4NW2A 4CKBA 4F88A 1LTID 2PQEA 1JE5A 5I9PA 3TS0A 1K8GA 1JICA 3URYA 5HGQA 1WTRA 1PZJD 1PTOB 1EY9A 4KD4A 1HR0W 1M8AA 4UHVA 1QOHA 1RTNA 2PW7A 5AFWA 1TVXA 4A3KG 2ES2A 1NMFA 1B50A 2KCCA 1SNQA 1NUCA 2FXQA 2MUYA 1FYCA 3RN2A 4K0KQ 4JI6L 1O7ZA 2ZTEA 2RQXA 2ZM6Q 3E9IA 3AFPA 4FDBA 3CP0A 2PMZE 3P1HA 1FJGL 1CSQA 2OEOA 3TBIB 4A3JH 1KNEA 2EPBA 5EKKA 2WB1G 1VQ7A 1D6EC 3WWVA 1SRUA 3J80E 3CHBD 4IOAA 1F9RA 1KHIA 1LM0A 1EZ8A 1CFMA 3GTGH 3SDZA 1PTOH 1TS3A 2L11A 1WJJA 2LFNA 5CMDA 1H95A 1KDBA 1T5EA 1A15A 4HIOA 2EYHA 3FPPA 5ELDA 3PMFA 4NB3A 3RN5A 1ASYA 2KJXA 3L0OA 4P71A 4DV0Q 5FLMG 2WIIB 1VCIA 4ZKBB 1HFNA 2H1EA 3FKIB 1SMYC 4ODGA 3TREA 1GUOA 1UNSA 3HG9A 3J81j 4OHJA 2B2UC 1Y69U 3SR1A 2R92H 3PUZA 4A3JG 2VNUD 1XWEA 4A3GB 1KL9A 1BDOA 1U0LA 3T56B 3CCLA 4C3IH 5JJLA 2KHSA 1ZKOA 1HZBA 3BVZA 1D5XC 1U4MA 1PZKD 2RCFA 4L5TA 1AFPA 5M3MH 2B8FA 1DM0B 4EX5A 4IQZA 4A3KH 4QCLA 1LTTD 1DJRD 1TWCB 2Y0SG 2QEXA 2EJFC 3MEHA 1BQQT 3IFDA 4JBWA 1U9RA 1IBKL 2B2UA 3MVVA 3HFZB 1EEFD 4XTCS 1LT5D 1ILPA 1SYGA 2K4KA 3D0FA 1Q81C 4G4KA 2UUAQ 3K80C 1PFSA 1L1OC 1VQMA 5D65A 3I2ZA 3UI2A 5HY6A 4A3CH 1GUTA 3F2BA 4ZK9B 3OIPA 5D3IB 4JCVE 1Q8KA 4C1NI 3G6JB 1FD7D 2FJ2A 5C4ZA 1ONLA 4IUVA 4YIJA 4BY1H 3F8TA 1PFNA 1X3EA 1EEID 5I6WA 2UUCQ 4KV6A 5KGUA 4AH6A 4K2KA 4CDDC 1CA6A 5IGBA 1RL2A 4IUPA 1VQ4A 2FMCA 5CV6A 3HOYB 3K81C 4JI0L 4CKCA 1HNZL 2KVMA 1STHA 3PF4A 1PFMA 2BH8A 2VUMB 4C3JG 1AE3A 1B3QA 1I50H 4DUYQ 2MQHA 1XX8A 3PO2H 3D4RA 3TP6A 4P2CB 2DGYA 2GVBA 3AU7A 3A54A 3UE0A 2NVXH 3GTMB 4IPHA 3D6CA 3KYHC 3GTLB 5C0XJ 1QVGA 3K5MA 2F4VQ 3I90A 3L3OC 1XPOA 2DJFC 2CKZB 2UXDL 4BBRG 1YJNA 1W6JA 2N55A 1XNRQ 3NELA 2SEBD 4DK0A 2OQ0A 2AQ1B 1EIHA 2NVXB 5DLQE 4GKJQ 5KRUA 4NKLA 1QNKA 3WDNA 1UEAB 1STYA 4GLXA 4A3DB 3W1BA 5E1FA 2JEBI 4JG2A 5M3FH 4KN4C 3KLWA 1TS5A 3BS1A 4DXFA 1TWCH 2X6GA 1H9KA 1PH6A 3HOYH 3RD4A 2RHQB 3K8AA 3TZDA 3W1GA 2CWAA 1U4LA 1VQAA 3J80c 1HNXL 2F4IA 4CDEC 4IFDH 4A3BB 4KY5A 1B44D 1WTQA 3TP8A 3ULPA 1TU2B 1NR4A 3CC7A 3S2DB 2C5CA 3MTSA 5JEAG 2WFWA 5FJ8G 4BY1B 2HD3A 4AIMA 2F3VA 3T16A 3TEHB 1TWFB 1WVLA 2B2WA 4DR4Q 1K0SA 2F0EA 1S72A 4RMFA 3KF8B 3Q0AA 2VQEL 4C3JH 1KRTA 3GV6A 3MFYA 5T1IA 4KY6A 3OSOA 3A5ZB 1VQLA 2F0QA 1YNNC 2YTYA 4DV0L 4KKSA 1QG7A 2IJ0A 1B4OA 1N36Q 3RZOH 2Z6KC 5M3FG 2B2WC 4OO1G 1DZ1A 2RDHA 1IYUA 4CHTB 4HMJA 4NMZA 1SFOB 5L37A 4UY8C 5IGEA 2HQEA 2VL6A 5LMUQ 5D3DA 5IWAL 4HIKA 4RA8A 1QVFA 4A3GG 3KJPA 2UXBQ 3GTQB 4BBSG 2JK8A 1TWHH 5GQOA 2QEJC 4QY7A 4HCEA 3CCVA 1IBMQ 2E2DC 4X3UA 1N32L 1LTBD 5C4JB 1HNWQ 3I4NB 1ZYRC 4R4IA 1C7YA 3NWSA 2CQAA 1PH7A 4CJ2C 1ML0D 1JC7A 2A6EC 2E5LL 2WINB 5C3EH 4GKJL 1UEBA 3K6OA 4KLKA 2M00A 1YI2A 1NAPA 3M3YH 1NJIC 5ELFA 1Y1VB 4L63B 1A3TA 2OTLA 4A3LG 1VQPA 2E2JH 2UXCL 5GROA 4DR1L 4GLVB 1I4GA 4DR6Q 4FNFA 2M9VA 3RLNA 1YHBA 3S16B 5M5WB 1SYDA 2D0PA 4X65Q 4MHEA 2IX0A 1CHPD 4GLAC 4H7BA 4EQ5A 1CKMA 4E6IA 3B6YA 2A74C 2L55A 2RSNA 3R8BA 3J80L 1OXXK 1C9OA 4K5VA 4ZKCB 3S16H 3BZCA 4CDCC 1N9WA 3AFQA 1PZID 3OTOL 1A63A 1VQBA 2E2JB 4IPCA 3AB9A 3NP8A 4KY7A 5IY0A 3JAMc 2A1AA 4FF3A 2R92G 1TWFH 1EWHA 5K5PA 1NY4A 5C3EB 2D2CC 3M7GA 3T1YQ 2O5JC 5EPJA 1NR2A 1E24A 4O2DA 2HIXA 2NZHA 2Q2IA 1JWMD 2K75A 1EY8A 2YV5A 4DN4M 5KNDA 1YJ9A 5EKLA 1VQCA 5C0XH 2R3ZA 2VUMH 2K5VA 4PMCA 4RGMA 2CW0D 1HHVA 4A75A 3PO3B 4HTHA 4DA2A 3F2UA 4GNXA 4ZQ3A 4NXNL 3HKZB 5C3WA 4U673 5LMUL 4GS3A 1L0XB 2ZTCA 2KA7A 1BCPF 3GTKH 2ZXRA 5DM73 3R93A 4P74A 4A93H 2EYJA 1I4RA 3VYRA 4ZUIA 3D4DA 3KK7A 4OEMB 5GAGC 4PV1C 2Q2HA 5IT9c 2BDNA 1CZGA 1HPCA 1WTPA 1PH5A 5TSSA 3TDQA 2Q2TA 3GTLH 2AHOB 4A93B 4WJ3M 1QWYA 2K01A 1HQRD 4R4TA 1OO9B 3VYUA 1I94L 3A74A 2F0GA 3S2DH 1JB3A 5IP7H 2F0MA 4P72A 3HOUG 4KHZA 4FYDA 3UDXA 1VQIA 4GKKL 3KOJA 3EVQA 1HNXQ 4A3IH 3VYSA 2CQOA 3K59A 1J9OA 1CA5A 1NMGA 1S5DD 2C35B 1AH9A 4H0LC 3GTQH 5A2QL 4FVMA 3DEPA 3MWYW 4JVZA 3J7YW 3NPPA 1CT1D 3MXNA 3LNNA 1Q3LA 1WCMH 4A3EH 4DR2L 4OELB 5CV8A 4OL7A 1VQ5A 4LF8L 1OXTA 3RZOB 3SEBA 1LTLA 2JE6I 3LWEA 3ONAB 2VB2X 5DEHA 4YY3Q 2XIWA 4JW0A 4X6AH 2MJ8A 2E2IB 4JBJA 4HAEA 4ZRZA 2K5QA 3H6MA 3ICEA 2KBNA 4JI8L 4QUFA 1HA5A 5I4DA 3PIP3 4BY7G 1IW7C 2ICEC 1GD7A 1X65A 1EYDA 3DWQA 1CQFA 3Q6SA 4JYAL 4TQUS 4GZYC 3VDYA 4B3TL 4L6TB 3CQZH 1I4HA 4PZ6A 3KUPA 4CJ1B 1MI2A 3H3VH 4X3TA 4A3EG 1KXLA 1MD2D 5COYA 1AZPA 2K7VA 1RODA 3PV0A 2WB1E 4U68A 3GTGB 1VQ8A 2UXBL 4O1NA 4JYAQ 1E0BA 1TKWB 2GA4B 1TXYA 3UDGA 2PNHA 3PO3H 3FMCA 2QGQA 2DNCA 3GTJB 2LSSA 4EVOA 1KNAA 2Z4IA 2AWNA 2WP8J 5C0XI 3I4NH 1FGBD 2DY7A 3EJIA 3STBC 3G71A 4LFCQ 1AP0A 3CXCA 5BN3A 5EGTA 3SE0A 1GM5A 3DXJC 4DNTB 2Q8TA 1ZXTA 3DWPA 5FJ8H 4AQYQ 3S15H 4FXKC 5EPLA 1B1ZA 2A8VA 2I5LX 2R92B 1JORA 4B3RQ 2MHVA 1N36L 1B53A 1JJGA 2PZWA 2Z8LA 1ESRA 1NTGA 2HCIA 3S17H 1EQQA 4KMUC 2VB3X 3Q23A 1TWAB 4LF9Q 3C1FA 5EAYA 3NK9A 3TZUA 1WD0A 5EBDA 1X3GA 5IYBG 4P73A 4K6DA 3OWEB 3CF5A 3GD7A 1EYAA 2F0PA 1L1OA 2CW0C 5KIXA 4RCOA 4DPGA 5GADC 1K83H 4KKUA 1TWGH 4DV7Q 1G8ZD 3F2CA 3MXUA 2R93H 5C4HA 4A3FB 4POGA 3TP7A 2B2YC 4V190 2UU9L 1PH8A 3VA5A 5DNFA 4O42A 3KJOA 3J80i 5FO9B 1S3OA 2X69A 4JI1L 1GUSA 3MXNB 3SK8A 2E8GA 3OWFA 4MIUA 3S1NH 3ERQA 4HSVA 2D5DA 2BH2A 1DONA 2YU9H 2A68D 4DV3Q 3DUZA 1YHQA 2E2HH 2LXJA 4JI3Q 1K28A 1ICWA 4YWLA 2SNMA 4K5XA 1TQOA 4GN3B 1J5EQ 3VR3A 4KI0A 3VA7A 5M3FB 4DUYL 5I2XA 4IN3A 4LF6L 4GOPA 3HOWB 4LNQA 2B2YA 1O78A 1EY4A 1XPRA 4K2LA 2IT1A 1BUVT 1SR3A 1VMPA 2L5TA 1K8OA 2F3IA 2ATWA 1XPUA 1UE1A 2JA5H 4N9TA 4XQQA 1YJWA 1VQFA 3D31A 1B7YB 2OXPA 1DYQA 4ID6A 1Z7TA 2D9UA 1KLGD 4S3SA 3BDLA 4RKLA 4LFBQ 2SOBA 4OGQC 1F77A 1GJXA 5M5XB 5IYBH 4CBVA 1ENCA 1SYEA 2BCOA 2GN5A 5IP9H 1DOLA 4H02A 1QJOA 1KRSA 1T5XD 3PSIA 1PLFA 3PIPA 1HNZQ 3HOXG 1KDAA 3MZ5A 5FOBB 1LTAD 1PTOC 3TP5A 1XMOQ 4Q5VA 3NUCA 4XIGS 3I70A 4IJLA 1NNXA 2B39A 2RSOA 1VF5C 2H4OA 3HRZC 2K5DA 5M5YB 3GTOH 4LFAQ 2R7ZH 1IKMA 1HUNA 1DGSA 1HQMC 4HJAA 2PO4A 1H9MA 1O7LA 2ZJRA 3HOVB 1EUJA 5EJWA 5I2YA 2YTXA 2TSSA 3CCJA 1WTVA 5IYCG 2VW9A 3RNUA 4FF1A 1SSOA 4ABNA 1DOKA 2RF4A 1D1IA 2E75C 2ICIA 2QCPX 3QO2A 4X64Q 4BY7B 3NXWA 5IE8A 1F9SA 2UXDQ 3N6RA 1SE8A 2KENA 1XXGA 2EZVA 2N49A 1XJVA 5IP9G 2RBMA 3CAMA 5FO7B 2JA7H 3DLLA 2GVAA 4OXPA 1JWUD 2IL8A 2KUMA 4ZYSA 1WTOA 2J4XA 2JP1A 4HJ7A 4UP7A 3ERSX 3NE5B 1A62A 1C0AA 5FLMH 5CORA 1SJED 2NVTH 3M4OB 2ZT9C 1D5ZC 1JWSD 5C4JH 2Z4HA 1S5CD 2F0JA 4JI5L 1PH2A 3L9AX 3KF8A 5CBAE 1I3QB 2Q8RE 1NSNS 3BYYB 4LF9L 3IKJA 2YYZA 1IL8A 5ELCA 2WAQG 3A8IE 4K8JA 4HN7A 3ZJYC 4RHRA 2JA8H 1G2SA 4CDFC 5I9OA 1UE6A 2Q2UA 5EQ0A 1AZQA 2M2LA 3ULLA 1B2TA 2A73B 4QIWB 1JQYD 4X62L 1FNUA 1G2TA 3D6WA 2B2VA 5ELBA 3F2DA 1M4VA 5JPNC 1JOOA 1XTDA 3MEFA 4NDXA 3I55A 3LGJA 1STAA 4BY7H 1I6HB 5C4XG 4LUZA 1QNUA 4C3HH 1BCPB 2WB1B 3M9BA 1BBUA 1LT3D 1FVIA 3VR5A 3M85A 3HEJA 2ZXOA 5CC4A 4KHVA 3S17B 4LFAL 2JEAI 3G48A 1WYDA 1EWCA 4F7XA 4F87A 1S40A 1PFBA 1W2BA 3E0EA 4JOIC 5J39A 1CK1A 3CCEA 4TVAB 1RF2D 1XNQL 4OO1H 5NUCA 3X3NA 4HIDA 2JA8G 2AKWB 2V1CC 3GO5A 4ZCKA 3S1RB 4LF5Q 3CPFA 2EE1A 4IFDI 2EQSA 3H0GG 1I6VC 2K33A 3S2HH 1FL0A 1HR0Q 3BDOA 4WRDA 1LACA 1EFID 1EY5A 1Y8OB 5C5MA 1EQVA 2HCCA 2XGTA 5CR3A 3S1RH 1X3PA 1O80A 4OO1I 3K5OA 1SMXA 2HDMA 3HOWG 2K5HA 2SNSA 1MGSA 3M7NA 4DGZA 2OT2A 1XMQQ 1CKNB 3KLSX 3SK4A 1HXYD 1HCZA 1U4PA 1V9PA 3U4VA 2JA6B 3GQBA 4LAAA 1MBYA 5KNBA 5JVH3 1G91A 1E3PA 1VQDA 5C3XA 1J6QA 4DV4L 4LF7L 2WKDA 1GUGA 4OX9L 4FO2A 1F2LA 1X3QA 3CCMA 1KABA 2K6AA 3QOJA 2OTJA 3CRLC 4DR7Q 2RCNA 3HOUH 2JA6H 1Q1EA 4N8X1 2IPKD 4B9WA 2IY5B 1PH1A 3A8JE 5FLXE 4DXGA 3VR2A 4IUUA 1IBKQ 4DF7A 1XYIA 2MPMA 1G51A 1SN8A 3V2TA 4QUCA 4DR7L 1Y8PB 2PW5A 3UDIA 4FF4A 2NN6I 1KLUD 1WCMB 2HQLA 4Z9CB 2E2HB 1S5ED 4TSSA 4KJOA 1H9SB 5E4WC 2RKSA 1B8AA 2F0FA 1AEXA 5G3LF 2I46A 2MFIA 1WD1A 3MC0B 1N33Q 3T13A 3TMEA 2TMPA 3H91A 1SDFA 4JC0A 1N8RC 3T1HL 3VR4A 4RCNA 3F1ZA 3SXHA 3IAYA 3STBD 4A3FH 1EOVA 1SFOH 1SBBB 4KHPQ 3SK6A 2K28A 2N78A 4DAPA 5CV7A 3S24A 2RDFA 1SNOA 2HUGA 1VQ9A 3L2PA 4C56C 3CMEA 3TRZA 4QGUA 2D0OA 2JA6G 2PPBC 2H5XA 2MGSA 3MHBA 2Y0SE 1CHQD 2PYKA 1X9NA 4NXMQ 1N34Q 1DD2A 1UUPA 4YHHL 1PV4A 4C3JB 3H3VI 3RZDH 5IOCA 4OWWB 1PYSB 2UUAL 4B9XA 5LL6X 1V1PA 5DM63 5H1SE 3OIQA 1KTKA 1K3RA 4OIKA 3PQIA 2A6ED 3DM3A 1DCZA 2EXDA 1GOZA 2DNEA 2MO1A 1HFGA 3SGIA 1FJGQ 4BS9A 4BY1G 1LV9A 1XMQL 1CKOA 4DV6L 1EYCA 2R7ZB 3KF6A 2KEEA 1E2ZA 4DV1L 1YNJC 1I50B 4F8MA 4RGOS 3EBEA 1EZ6A 4DV4Q 2B63H 1Z47A 3PCOB 4UAIA 1KQSA 5IGGA 4PNYA 4ZUJA 1YNXA 3H0GB 1LABA 2EDGA 4I7AA 4KJNA 3AEVA 4DAYB 3CW2C 5KYIA 1EY0A 4WFN3 1RJTA 1ILQA 4DR5L 1SLJA 4ME5A 2UUBL 3K5LA 1GUNA 2L4NA 1CI3M 4QL5A 3FKIH 4Y7NB 1A0IA 1V8QA 1YNJD 4DV2Q 4TKOB 4IURA 5IYCH 3PF5A 2UUCL 1MHWC 5CV5A 1LT6D 2XSCA 4J6HA 3V05A 2NVYB 4DK6C 4X3KA 4LUOA 2E5LQ 1AE2A 1AN8A 3NENA 5C6AA 1S4ZA 1RD9D 4OONA 3MFGA 2KEDA 2NYZD 1KC8C 3QJYA 3HOXB 4JI0Q 4IPDA 2IHFA 4HJ9A 2UU9Q 2WACA 4RGNA 4EGVA 1PH9A 1Q82C 1H9SA 2AUKA 3GV3A 1O7YA 2JQOA 3GTKB 2I5HA 4QMGA 3SK5A 3JAML 4A3EB 5ELEA 1E22A 3FKIG 3S1MB 1K8MA 1SYFA 3HS0C 3HOWH 1HZCA 1XNRL 2WV6D 1WOCA 1IYJB 2ALYB 3EFXD 5C4XB 4JPBW 3A0JA 3T53B 1I4QA 4YCWA 4JI7Q 1N34L 4DR3L 2NN6H 2B63B 3HOYG 4C2MB 3GP7A 1V43A 4YHHQ 4K14A 4JI2L 2NTSA 2PQAB 4EQPA 1FGUA 4HIMA 1EFWA 3E6ZX 2RDGA 3I91A 4AYBB 2AUJD 1Q8IA 2BDOA 2HHHQ 4MTKA 1CM9A 5A2QE 4DR1Q 5JJKA 1VQHA 3A7AB 4B08A 1MJCA 1H9JA 1A3UA 4FF2A 2CVRA 1L2FA 1VF7A 1PDQA 4M8AA 3E5SA 2MNAA 3HOZH 1LO5D 1EOTA 1GHJA 3HZXA 2KCMA 3BZDB 3HOVH 4BA2I 1B70B 2A69D 3FHWA 2F0KA 3OTOQ 4WJ4A 3ER0A 3O13A 2UUBQ 2BA1A 4Y7NH 2D62A 2I5MX 3A7LA 4XYOA 3HKZG 1XMOL 4MNOA 2EY5A 4RGTA 3TQYA 1F9QA 3OPOA 4DAYA 4B3SL 2CHBD 3K7AB 1SYCA 4A3KB 4V0BA 5JPMC 1EIYB 3HKSA 2QA4A 4CJ0B 3C3LA 5C44G 3QB3A 4O0AA 3H3VC 1PRTB 1LTRD 4LMQD 4LW1A 1N33L 4DFAA 4C3IB 1Q46A 4B3SQ 4JI1Q 2PZUA 2X6LA 1LTGD 1HZAA 2NZ1D 2N8NA 2F4VL 3OMGA 5C3EG 1F2YA 1ET9A 2AQ3B 1SXTA 4LF6Q 4MTNA 3Q24A 1TWGB 1D8LA 4A3CG 4YWMA 1PHJA 3HOZG 2A6HC 4BXXG 4C1NK 1BOSA 1SE4A 1Q7YC 3LWUA 2JA7G 2NUCA 1E2VA 4DU9A 4X64L 1HUMA 1HRJA 2QDBA 1SMYD 5K36G 3U58A 1SROA 1OTCA 1QCBD 2R7DA 4Y52H 1NCVA 4I7ZC 4B3ML 4X65L 5CYUA 4YY3L 1BVSA 5J1ZA 1QUQB 1X32A 4JI5Q 1SYBA 3I4LA 4KTAA 4LFBL 3A55A 1PVOA 2NBFA 3S15B 3CU7A 3M3YB 3TS2A 1A8VA 1ENFA 4QJFA 3PUXA 1EY6A 3T1HQ 5IGFA 4A3JB 2CCZA 2F0VA 5JAVA 5C44B 1HTLD 1IHZA 2N88A 2DY8A 2Z6KA 1JJCB 5IGDA 4QF4A 2XRQD 2F0SA 5K36H 4A3BH 4BXXH 4C2MH 2KHJA 1EU3A 3NWTA 4A3GH 1STNA 2DUDA 2CFMA 3U4ZA 4DUZL 1SE2A 1BF4A 2VQEQ 2R61A 3WOFA 3KBGA 5LMNQ 2AWOA 4HMIA 2O5IC 1I94Q 2VY3A 1Y14B 2Z6BA 3HOUB 3ND9A 1W3SA 2O4XA 5ISRA 4DUZQ 4LFCL 1Q86C 3CQZB 5FO8B 3S9WA 4A3MH 4A3IG 3M4PA 4H13C 3W5OA 2F0DA 4A3BG 3HP3A 2JSOA 2IW3A 1RIPA 1G6PA 2XRSD 4GNXB 3FRPB 2RA4A 2A5HA 4RKBA 3RLFA 3X3MA 4IOCA 4IALA 1BCPD 2JJQA 5JJIA 3PIOA 1B9MA 3RMHA 1VQGA 4LF8Q 4KK7A 1TY0A 3M4QA 5EPKA 5EBCA 2NB0A 4AYBG 2HHHL 4DAMA 5M9OA 5IP7G 3E0JA 1A2TA 1IZ6A 2KECA 3NSWA 1FNVA 2I0QA 1NE3A 2QW7A 5C5LA 2B63G 1PH4A 3EA6A 4YWKA 3JAME 4P75A 2EVBA 4DNRB 1PA6A 1WTWA 5M3MB 4IZ8A 1HJPA 3CD6A 2LXKA 1SJHD 2C9OA 5IYDH 4A4IA 4XDXA 3QOLA 4A76A 5E3FA 1LTSD 1PYBA 2K52A 3BG3A 2JA9A 3PIO3 1I5FA 5BR8L 1A2UA 1PRTC 3I4OA 3E9HA 4EQOA 4JV5Q 4G7OC 3IL8A 4EQNA 1GO3E 4LJZC 3J81c 1U5KA 3HOZB 2F0NA 1J5EL 1Y1WG 3P75A 2EOTA 5FLXc 1P8LA 1STBA 1M1KC 2PNRC 4KKTA 5D14A 3VR6A 2A19A 2LY7A 1Y8NB 5ELNA 1JOQA 3BDCA 5CV9A 2NVYH 1CZWA 1QZGA 2ASBA 4APVA 3PO2G 1VS0A 4YCVA 1YIJA 4DV5Q 1EWIA 2Z1CA 2P5ZX 2NVQH 3E3XA 2K1BA 3J81i 1YEZA 4CGYB 1NBWA 4UP8A 3WOEA 1TR5A 4ULLA 2EJMA 2OCEA 1DXMA 1CTMA 4HSPA 4R1JA 1I3QH 1WI5A 4PMWA 4JI8Q 2ZXPA 1SAPA 1C4QA 1X54A 4OIJA 3T1YL 1A6XA 1X56A 2DN8A 4R4QA 3MAQA 3JAMi 1H9RA 3FDTA 4FXGC 1RHPA 3NEMA 5M5XH 1OXSC 1SNMA 3H94A 2QILA 5GAHC 2WKCA 5HURA 1LUZA 3DMUA 5AJ3L 1RCVD 3CKIB 3R2IA 4I65A 4PZ7A 3C2PA 3RUZA 5IGCA 1X6OA 2F0TA 3AQQA 4XYQA 1E2WA 3V96A 2KCTA 1JT8A 4GN4B 2L0CA 2F1MA 3D8GA 2MP1A 1YBYA 2XN9C 3GTMH 2V4DA 3A56A 2LKVA 2F3WA 2F0UA 3NHHA 4JBKA 4IO9A 2K5NA 4GN5A 4BWGB 4DAVA 2OWOA 3P7JA 4OX9Q 1W6KA 2VQFL 4A3DG 3H0GH 4M1UB
chains in the Genus database with same CATH topology
3S24A 5IP7H 4P72A 1VQ9A 3TRZA 3L2PA 2WAQE 3CMEA 4QGUA 4ALPA 1IXRA 2D0OA 1UE5A 4KHZA 2JA6G 3HOUG 3GDEA 2H5XA 3UDXA 4LF4Q 1VQIA 2Y0SE 3KOJA 4GKKL 4JI6Q 3PGZA 1UE7A 5C44H 4A3IH 1X9NA 1HNXQ 2E2IH 2CQOA 2PQAA 1N34Q 4NXMQ 1NMGA 4YHHL 1PV4A 2C35B 1T9HA 1AH9A 3GTQH 3H3VI 3RZDH 3UE1A 4DV6Q 4OWWB 1PYSB 2UUAL 1R9TH 1JE5A 1WFQA 3TS0A 1K8GA 5H1SE 4UPAA 4LUVA 1Q1BA 4DR5Q 1WCMH 1K3RA 2ID0A 5HGQA 4DV5L 4A3EH 4DR2L 4A3LH 3DM3A 1VQKA 3SGIA 2EXDA 1OXTA 2MO1A 1HR0W 1VQ5A 4LF8L 1FJGQ 4AYBE 4A3DH 1LTLA 4BY1G 4HJ8A 2JE6I 4A3KG 4R4OA 1XMQL 1NMFA 1CKOA 1G291 4NPSA 2ES2A 4DV6L 4YY3Q 3K0XA 3CC2A 3KF6A 4X6AH 4DV1L 2B3GA 4JBJA 2FXQA 3ICEA 2KBNA 1YHAA 4JI8L 3RN2A 4JI6L 3KF6B 4K0KQ 1MKHA 2ZTEA 3EBEA 1TWAH 1L0WA 2ZM6Q 1Z47A 3E9IA 3PCOB 4DV4Q 1IBLL 2B63H 4BY7G 3AFPA 4FDBA 1KQSA 1HNWL 3CP0A 1GD7A 2PMZE 1X65A 1CSQA 1FJGL 1P16A 1YNXA 4IPGA 4A3JH 4JYAL 1O7IA 4TQUS 4POFA 3VDYA 3AEVA 2WB1G 3CW2C 4DAYB 1VQ7A 4B3TL 3CQZH 4PZ6A 3WWVA 1Y1VH 4DR5L 1SLJA 1SRUA 2UUBL 3H3VH 4GOPC 4GOPB 4A3EG 4QL5A 4IOAA 1KXLA 3FKIH 1K9MC 1KHIA 1LM0A 1A0IA 3OYYA 1JJ2A 3PV0A 4QIWE 2WB1E 2UXCQ 1VQ8A 2UXBL 3ULJA 4DV2Q 4JI2Q 3GTGH 5IYCH 3PF5A 2UUCL 4JYAQ 2K50A 1WJJA 4DK6C 4LUOA 1N32Q 1H95A 2E5LQ 1AE2A 1TXYA 2PNHA 3NENA 3UDGA 3PO3H 4OONA 4HIOA 2QGQA 3CMAA 3GTJH 2LSSA 1KC8C 4NB3A 4JI0Q 4IPDA 2AWNA 3RN5A 2WP8J 3L0OA 5M3MG 1ASYA 4P71A 5C0XI 2IHFA 4HJ9A 4DV0Q 2UU9Q 5FLMG 3I4NH 3FP9A 3STBC 3G71A 4LFCQ 1VCIA 2KHIA 1M90C 3CXCA 3AYHB 1PH9A 1Q82C 1GM5A 2JQOA 3TREA 2MO0A 1Y1VG 5FJ8H 2I5HA 4HJ5A 3M4OH 4AQYQ 3J81j 3CCUA 3S15H 3GTPH 1E22A 3FKIG 2A8VA 2I5LX 2R92H 3HOWH 3PUZA 4B3RQ 4A3JG 2VNUD 1HZCA 1XNRL 1N36L 1CSPA 1KL9A 5ELOA 1HH2P 1U0LA 5JJLA 3CCLA 4C3IH 1WOCA 1IYJB 1JJGA 3RR5A 1D7QA 2ALYB 1NTGA 1HZBA 3S17H 3PUYA 3A0JA 1EQQA 2ZJQA 1I6HH 4JI7Q 4YCWA 3J7A5 1N34L 4DR3L 4PG3A 3HOYG 4YHHQ 1V43A 1E1TA 4L5TA 4LF9Q 5EAYA 5M3MH 4JI2L 4EX5A 4IFDJ 2PQAB 4A3KH 5IYBG 1X3GA 1K73C 3CCRA 4P73A 3CF5A 3CCSA 3GD7A 2Y0SG 3KDFA 2QEXA 1FGUA 4HIMA 4L5QA 1L1OA 4RG1A 2AMCB 4JI4Q 1EFWA 4JBMA 3I4MH 4DPGA 5GADC 1K83H 1TWGH 4JBWA 4X66Q 4DV7Q 1X3FA 3F2CA 1YITA 3BZKA 2R93H 1IBKL 2HHHQ 4POGA 3S14H 4DR1Q 2UU9L 5JJKA 1VQHA 1PH8A 3HFZB 3KJOA 1MJCA 3J80i 1S3OA 4JI1L 3MXNB 4XTCS 2E8GA 2K4KA 3D0FA 1Q81C 2UUAQ 3S1NH 3G6EA 3K80C 1PFSA 1L2FA 1E7ZA 3UDFA 2BH2A 1L1OC 1VQMA 2NN6G 3I2ZA 2YU9H 1CKNA 5C4XH 2MNAA 4DV3Q 3HOZH 1YHQA 5HY6A 5LMNW 3F2BA 2LXJA 1HR0L 2E2HH 4JI3Q 4A3CH 2KCMA 4YWLA 4L5RC 4JCVE 3HOVH 1Q8KA 4BA2I 1B70B 4GN3B 4DNIA 1J5EQ 3FHWA 3OTOQ 4WJ4A 3ER0A 2UUBQ 2BA1A 4Y7NH 2D62A 4KI0A 2ZJPA 4DUYL 2I5MX 4LF6L 2RHSB 1OXUA 4GOPA 4BY1H 3S1MH 3F8TA 3KFUA 3HKZG 1XMOL 2VQFQ 1X3EA 4MNOA 2UUCQ 3TQYA 4LNQA 4B3SL 4BBRH 2N3SA 2F52A 1VQ6A 4AH6A 1XPRA 2IT1A 1SR3A 1EIYB 3NBHB 4OWXB 4BA1I 3HKSA 2QA4A 1RL2A 4LF5L 4LF4L 1VQ4A 2F3IA 2ATWA 3K81C 5C44G 1HNZL 4JI0L 1XPUA 4O0AA 3Q8DA 3U50C 1UE1A 2YTVA 2JA5H 1VQNA 4LW1A 4QQBX 3PF4A 1JB7A 1QZHA 1N33L 1YJWA 1VQFA 2BH8A 1B7YB 3D31A 3CPWA 1Q46A 4B3SQ 4JI1Q 1AE3A 1HZAA 1I50H 2Z0SA 4DUYQ 2MQHA 2N8NA 2F4VL 4PZ8A 3PO2H 5C3EG 4LWCA 4OWTB 4LF6Q 3K7UC 4MTNA 3G4SA 1D8LA 2DGYA 2GVBA 4LFBQ 4A3CG 4YWMA 1PHJA 3HOZG 4BXXG 3UE0A 2NVXH 4JOIA 5IYBH 4IPHA 2GN5A 5IP9H 1Q7YC 3KYHC 2JA7G 4H02A 5C0XJ 1QVGA 1KRSA 3PSIA 2F4VQ 1WCMG 3PIPA 1HNZQ 4ME3A 3HOXG 4X64L 1IBLQ 5K36G 3U58A 1X55A 1LYLA 3PUWA 1SROA 3EIVA 1XPOA 1XMOQ 1OTCA 3I4NG 3S1QH 2CKZB 2UXDL 4XIGS 2R7DA 4BBRG 4Y52H 1YJNA 4IJLA 4B3ML 1XNRQ 4X65L 4YY3L 1BVSA 3NELA 1QUQB 1UWVA 2OQ0A 1GVPA 2CWPA 4JI5Q 3CC4A 1L1OB 3GTOH 4LFAQ 1QUQA 5DLQE 4X66L 2R7ZH 4GKJQ 4LFBL 5LMNL 1PVOA 1BKBA 1DGSA 4GLXA 4HJAA 3TS2A 1A8VA 2ZJRA 1EUJA 3KDFB 3W1BA 2YTXA 3CCJA 4QJFA 3PUXA 5IYCG 2VW9A 3RLOA 3RNUA 3T1HQ 2JEBI 2RF4A 4JG2A 5M3FH 2CCZA 3KLWA 3PUVA 4JI4L 1TWCH 4X64Q 1OXVA 2Z6KA 1PH6A 3HOYH 1JJCB 3J80c 2RHQB 3K8AA 1HNXL 3W1GA 2CWAA 1VQAA 5IE8A 4A3BH 2UXDQ 4BXXH 1SE8A 4C2MH 2KHJA 1Q12A 4A3GH 2DUDA 3U4ZA 2CFMA 3ULPA 4DUZL 2KENA 3CC7A 2N49A 1XJVA 4L5SA 5IP9G 2VQEQ 3CAMA 3HKZE 4MZ9A 5M5WH 3DLLA 1IBML 2JA7H 5JEAG 2GVAA 3PO3G 4GKKQ 2WFWA 2B29A 5FJ8G 4OXPA 4AIMA 5LMNQ 4HJ7A 4AQYL 4UP7A 3OW2A 1KD1C 2AWOA 4J15A 1I94Q 4A3LG 3ERSX 2VY3A 1Y14B 5IWAQ 3TEHB 1A62A 4DV3L 1C0AA 4B3RL 5FLMH 1W3SA 4BBSH 1KIXA 4B3MQ 4DR4Q 2ZTDA 4DUZQ 4LFCL 2NVTH 1S72A 1Q86C 5C4JH 4RMFA 3KF8B 2VQEL 4C3JH 1KRTA 4UP9A 4JI5L 2R7ZG 4A3MH 1PH2A 1JMCA 1KAWA 3A5ZB 4NXML 4A3IG 1VQLA 3M4PA 3W5OA 4A3BG 3I56A 4LF7Q 4LF9L 2YTYA 2IHEA 4DV0L 2L15A 2YYZA 4JV5L 1VQJA 2WAQG 1RIPA 1G6PA 3BJUA 4GNXC 4GNXB 2VS1A 1N36Q 3RLFA 3RZOH 2Z6KC 3ZJYC 4IOCA 2R7FA 1CUKA 5M3FG 4IJHA 2JA8H 4OO1G 3K7AH 2JJQA 5E7NA 5JJIA 2VUMG 1UE6A 3PIOA 2Q2UA 1ASZA 1EQRA 1VQGA 1EYGA 4LF8Q 4UY8C 3ULLA 2VL6A 3M4QA 5LMUQ 4A3FG 5IWAL 4HIKA 5J3BA 1QVFA 4AYBG 2HHHL 1YZ6A 4A3GG 3KJPA 2UXBQ 4DV2L 4X62L 4BBSG 4DAMA 2JK8A 1TWHH 4DK3C 5IP7G 5GQOA 4DR6L 4B3TQ 3JC66 4QY7A 3F2DA 1IZ6A 1BBWA 4R4CA 3CCVA 1IBMQ 1N32L 3I7FA 2I0QA 1NE3A 1XTDA 3MEFA 2B63G 2BA0A 3I55A 3LGJA 3CCQA 1PH4A 2ZM6L 4BY7H 4YCUA 4YWKA 2K14A 4P75A 1HNWQ 5C4XG 4LUZA 1PA6A 4C3HH 2PI2E 4R4IA 1C7YA 3M9BA 4DR4L 1PH7A 1BBUA 1FVIA 3M85A 1HJPA 2E5LL 3CD6A 4A93G 5C3EH 2LXKA 4LFAL 2JEAI 4GKJL 1UEBA 3G48A 1HZ9A 1WYDA 4A4IA 5IYDH 2PI2A 4KLKA 4A76A 1YI2A 1S40A 3M3YH 4DV7L 1NJIC 1PYBA 1W2BA 2K52A 2NZOA 2JA9A 3E0EA 2OTLA 1I5FA 1VQPA 4DKAC 2E2JH 4JOIC 5GROA 5BR8L 3I4OA 4DR1L 2UXCL 3E9HA 4GLVB 5GAEC 4JV5Q 1V1QA 3CCEA 4DR6Q 1GO3E 4TVAB 1EIFA 3RLNA 3J81c 1YHBA 2VZAA 1XNQL 1U5KA 2D0PA 4X65Q 1J5EL 4HIDA 3EN2A 2JA8G 2IX0A 2AKWB 1MJEA 2V1CC 3GO5A 4GLAC 5C0XG 4EQ5A 3CPFA 1CKMA 1Y1WG 4LF5Q 2R6GA 5FLXc 1P8LA 4IFDI 1M1KC 2EQSA 3B6YA 4DR3Q 3H0GG 2JA5G 1OXXK 3S2HH 1FL0A 1C9OA 4JI3L 1HR0Q 2A19A 3S16H 3BZCA 5ELNA 1N9WA 3AFQA 1XNQQ 2NVYH 2XGTA 3J7ZC 3OTOL 4APVA 2HIVA 3S1RH 1QZGA 1VQBA 2ASBA 1A63A 3PO2G 4NXNQ 4IPCA 5IYDG 5IY0A 3JAMc 2A1AA 4OO1I 2HT1A 1VS0A 1SMXA 4YCVA 2R92G 1TWFH 1YIJA 4DV5Q 1EWIA 1NY4A 5BR8Q 2NVQH 3HOWG 2K5HA 3J81i 1PH3A 1YEZA 3T1YQ 1NBWA 3M7NA 4UP8A 1E24A 4O2DA 1XMQQ 1CKNB 1MIUA 2HIXA 2NZHA 2Q2IA 2OCEA 2K75A 4R1JA 2YV5A 1V9PA 3U4VA 1I3QH 1WI5A 4DV1Q 1YJ9A 1VQCA 3HOXH 4PMWA 4JI8Q 4JI7L 2VUMH 1E3PA 1VQDA 2K5VA 4K0KL 1J6QA 4DV4L 1K8AC 4LF7L 1X54A 4OX9L 3CCMA 1GKHA 3T1YL 1X56A 3L7ZC 2OTJA 4R4QA 3IRBA 4DR7Q 4A75A 2RCNA 3HOUH 1YVCA 2JA6H 4GNXA 1Q1EA 3JAMi 1Y1WH 4NXNL 2OQKA 2IY5B 3I4MG 3NEMA 5M5XH 1PH1A 5JEAJ 1OXSC 5LMUL 4GS3A 2ZTCA 1IBKQ 5GAHC 1LUZA 4X62Q 5AJ3L 4PZ7A 2IX1A 1QVCA 1G51A 1SN8A 5M5YH 4DR7L 3HOVG 3GTKH 1X6OA 3UDIA 1VQEA 2NN6I 3AQQA 2HQLA 4P74A 4A3MG 4A93H 2KCTA 3BU2A 1JT8A 1B8AA 4GN4B 4IFDG 2MFIA 1YBYA 4KHPL 2XTIA 5GAGC 3GTMH 1N33Q 2Q2HA 5IT9c 1VQOA 2Q2TA 1PH5A 4JC0A 2AHOB 1Z9FA 3T1HL 1N8RC 3GTLH 2EIFA 3F1ZA 4WJ3M 4JBKA 3STBD 4IO9A 2K5NA 1E1OA 4GN5A 4A3FH 4R4TA 1IL2A 1EOVA 3A5UA 4DR2Q 1K0RA 1SFOH 2OWOA 4OX9Q 1I94L 3A74A 2VQFL 3H15A 4A3DG 3H0GH 3S2DH 4KHPQ 5AJ3Q 2N78A 2R93G
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3S24 A;  5IP7 H;  4P72 A;  1VQ9 A;  3TRZ A;  3L2P A;  2WAQ E;  3CME A;  4QGU A;  4ALP A;  1IXR A;  2D0O A;  1UE5 A;  4KHZ A;  2JA6 G;  3HOU G;  3GDE A;  2H5X A;  3UDX A;  4LF4 Q;  1VQI A;  2Y0S E;  3KOJ A;  4GKK L;  4JI6 Q;  3PGZ A;  1UE7 A;  5C44 H;  4A3I H;  1X9N A;  1HNX Q;  2E2I H;  2CQO A;  2PQA A;  1N34 Q;  4NXM Q;  1NMG A;  4YHH L;  1PV4 A;  2C35 B;  1T9H A;  1AH9 A;  3GTQ H;  3H3V I;  3RZD H;  3UE1 A;  4DV6 Q;  4OWW B;  1PYS B;  2UUA L;  1R9T H;  1JE5 A;  1WFQ A;  3TS0 A;  1K8G A;  5H1S E;  4UPA A;  4LUV A;  1Q1B A;  4DR5 Q;  1WCM H;  1K3R A;  2ID0 A;  5HGQ A;  4DV5 L;  4A3E H;  4DR2 L;  4A3L H;  3DM3 A;  1VQK A;  3SGI A;  2EXD A;  1OXT A;  2MO1 A;  1HR0 W;  1VQ5 A;  4LF8 L;  1FJG Q;  4AYB E;  4A3D H;  1LTL A;  4BY1 G;  4HJ8 A;  2JE6 I;  4A3K G;  4R4O A;  1XMQ L;  1NMF A;  1CKO A;  1G29 1;  4NPS A;  2ES2 A;  4DV6 L;  4YY3 Q;  3K0X A;  3CC2 A;  3KF6 A;  4X6A H;  4DV1 L;  2B3G A;  4JBJ A;  2FXQ A;  3ICE A;  2KBN A;  1YHA A;  4JI8 L;  3RN2 A;  4JI6 L;  3KF6 B;  4K0K Q;  1MKH A;  2ZTE A;  3EBE A;  1TWA H;  1L0W A;  2ZM6 Q;  1Z47 A;  3E9I A;  3PCO B;  4DV4 Q;  1IBL L;  2B63 H;  4BY7 G;  3AFP A;  4FDB A;  1KQS A;  1HNW L;  3CP0 A;  1GD7 A;  2PMZ E;  1X65 A;  1CSQ A;  1FJG L;  1P16 A;  1YNX A;  4IPG A;  4A3J H;  4JYA L;  1O7I A;  4TQU S;  4POF A;  3VDY A;  3AEV A;  2WB1 G;  3CW2 C;  4DAY B;  1VQ7 A;  4B3T L;  3CQZ H;  4PZ6 A;  3WWV A;  1Y1V H;  4DR5 L;  1SLJ A;  1SRU A;  2UUB L;  3H3V H;  4GOP C;  4GOP B;  4A3E G;  4QL5 A;  4IOA A;  1KXL A;  3FKI H;  1K9M C;  1KHI A;  1LM0 A;  1A0I A;  3OYY A;  1JJ2 A;  3PV0 A;  4QIW E;  2WB1 E;  2UXC Q;  1VQ8 A;  2UXB L;  3ULJ A;  4DV2 Q;  4JI2 Q;  3GTG H;  5IYC H;  3PF5 A;  2UUC L;  4JYA Q;  2K50 A;  1WJJ A;  4DK6 C;  4LUO A;  1N32 Q;  1H95 A;  2E5L Q;  1AE2 A;  1TXY A;  2PNH A;  3NEN A;  3UDG A;  3PO3 H;  4OON A;  4HIO A;  2QGQ A;  3CMA A;  3GTJ H;  2LSS A;  1KC8 C;  4NB3 A;  4JI0 Q;  4IPD A;  2AWN A;  3RN5 A;  2WP8 J;  3L0O A;  5M3M G;  1ASY A;  4P71 A;  5C0X I;  2IHF A;  4HJ9 A;  4DV0 Q;  2UU9 Q;  5FLM G;  3I4N H;  3FP9 A;  3STB C;  3G71 A;  4LFC Q;  1VCI A;  2KHI A;  1M90 C;  3CXC A;  3AYH B;  1PH9 A;  1Q82 C;  1GM5 A;  2JQO A;  3TRE A;  2MO0 A;  1Y1V G;  5FJ8 H;  2I5H A;  4HJ5 A;  3M4O H;  4AQY Q;  3J81 j;  3CCU A;  3S15 H;  3GTP H;  1E22 A;  3FKI G;  2A8V A;  2I5L X;  2R92 H;  3HOW H;  3PUZ A;  4B3R Q;  4A3J G;  2VNU D;  1HZC A;  1XNR L;  1N36 L;  1CSP A;  1KL9 A;  5ELO A;  1HH2 P;  1U0L A;  5JJL A;  3CCL A;  4C3I H;  1WOC A;  1IYJ B;  1JJG A;  3RR5 A;  1D7Q A;  2ALY B;  1NTG A;  1HZB A;  3S17 H;  3PUY A;  3A0J A;  1EQQ A;  2ZJQ A;  1I6H H;  4JI7 Q;  4YCW A;  3J7A 5;  1N34 L;  4DR3 L;  4PG3 A;  3HOY G;  4YHH Q;  1V43 A;  1E1T A;  4L5T A;  4LF9 Q;  5EAY A;  5M3M H;  4JI2 L;  4EX5 A;  4IFD J;  2PQA B;  4A3K H;  5IYB G;  1X3G A;  1K73 C;  3CCR A;  4P73 A;  3CF5 A;  3CCS A;  3GD7 A;  2Y0S G;  3KDF A;  2QEX A;  1FGU A;  4HIM A;  4L5Q A;  1L1O A;  4RG1 A;  2AMC B;  4JI4 Q;  1EFW A;  4JBM A;  3I4M H;  4DPG A;  5GAD C;  1K83 H;  1TWG H;  4JBW A;  4X66 Q;  4DV7 Q;  1X3F A;  3F2C A;  1YIT A;  3BZK A;  2R93 H;  1IBK L;  2HHH Q;  4POG A;  3S14 H;  4DR1 Q;  2UU9 L;  5JJK A;  1VQH A;  1PH8 A;  3HFZ B;  3KJO A;  1MJC A;  3J80 i;  1S3O A;  4JI1 L;  3MXN B;  4XTC S;  2E8G A;  2K4K A;  3D0F A;  1Q81 C;  2UUA Q;  3S1N H;  3G6E A;  3K80 C;  1PFS A;  1L2F A;  1E7Z A;  3UDF A;  2BH2 A;  1L1O C;  1VQM A;  2NN6 G;  3I2Z A;  2YU9 H;  1CKN A;  5C4X H;  2MNA A;  4DV3 Q;  3HOZ H;  1YHQ A;  5HY6 A;  5LMN W;  3F2B A;  2LXJ A;  1HR0 L;  2E2H H;  4JI3 Q;  4A3C H;  2KCM A;  4YWL A;  4L5R C;  4JCV E;  3HOV H;  1Q8K A;  4BA2 I;  1B70 B;  4GN3 B;  4DNI A;  1J5E Q;  3FHW A;  3OTO Q;  4WJ4 A;  3ER0 A;  2UUB Q;  2BA1 A;  4Y7N H;  2D62 A;  4KI0 A;  2ZJP A;  4DUY L;  2I5M X;  4LF6 L;  2RHS B;  1OXU A;  4GOP A;  4BY1 H;  3S1M H;  3F8T A;  3KFU A;  3HKZ G;  1XMO L;  2VQF Q;  1X3E A;  4MNO A;  2UUC Q;  3TQY A;  4LNQ A;  4B3S L;  4BBR H;  2N3S A;  2F52 A;  1VQ6 A;  4AH6 A;  1XPR A;  2IT1 A;  1SR3 A;  1EIY B;  3NBH B;  4OWX B;  4BA1 I;  3HKS A;  2QA4 A;  1RL2 A;  4LF5 L;  4LF4 L;  1VQ4 A;  2F3I A;  2ATW A;  3K81 C;  5C44 G;  1HNZ L;  4JI0 L;  1XPU A;  4O0A A;  3Q8D A;  3U50 C;  1UE1 A;  2YTV A;  2JA5 H;  1VQN A;  4LW1 A;  4QQB X;  3PF4 A;  1JB7 A;  1QZH A;  1N33 L;  1YJW A;  1VQF A;  2BH8 A;  1B7Y B;  3D31 A;  3CPW A;  1Q46 A;  4B3S Q;  4JI1 Q;  1AE3 A;  1HZA A;  1I50 H;  2Z0S A;  4DUY Q;  2MQH A;  2N8N A;  2F4V L;  4PZ8 A;  3PO2 H;  5C3E G;  4LWC A;  4OWT B;  4LF6 Q;  3K7U C;  4MTN A;  3G4S A;  1D8L A;  2DGY A;  2GVB A;  4LFB Q;  4A3C G;  4YWM A;  1PHJ A;  3HOZ G;  4BXX G;  3UE0 A;  2NVX H;  4JOI A;  5IYB H;  4IPH A;  2GN5 A;  5IP9 H;  1Q7Y C;  3KYH C;  2JA7 G;  4H02 A;  5C0X J;  1QVG A;  1KRS A;  3PSI A;  2F4V Q;  1WCM G;  3PIP A;  1HNZ Q;  4ME3 A;  3HOX G;  4X64 L;  1IBL Q;  5K36 G;  3U58 A;  1X55 A;  1LYL A;  3PUW A;  1SRO A;  3EIV A;  1XPO A;  1XMO Q;  1OTC A;  3I4N G;  3S1Q H;  2CKZ B;  2UXD L;  4XIG S;  2R7D A;  4BBR G;  4Y52 H;  1YJN A;  4IJL A;  4B3M L;  1XNR Q;  4X65 L;  4YY3 L;  1BVS A;  3NEL A;  1QUQ B;  1UWV A;  2OQ0 A;  1GVP A;  2CWP A;  4JI5 Q;  3CC4 A;  1L1O B;  3GTO H;  4LFA Q;  1QUQ A;  5DLQ E;  4X66 L;  2R7Z H;  4GKJ Q;  4LFB L;  5LMN L;  1PVO A;  1BKB A;  1DGS A;  4GLX A;  4HJA A;  3TS2 A;  1A8V A;  2ZJR A;  1EUJ A;  3KDF B;  3W1B A;  2YTX A;  3CCJ A;  4QJF A;  3PUX A;  5IYC G;  2VW9 A;  3RLO A;  3RNU A;  3T1H Q;  2JEB I;  2RF4 A;  4JG2 A;  5M3F H;  2CCZ A;  3KLW A;  3PUV A;  4JI4 L;  1TWC H;  4X64 Q;  1OXV A;  2Z6K A;  1PH6 A;  3HOY H;  1JJC B;  3J80 c;  2RHQ B;  3K8A A;  1HNX L;  3W1G A;  2CWA A;  1VQA A;  5IE8 A;  4A3B H;  2UXD Q;  4BXX H;  1SE8 A;  4C2M H;  2KHJ A;  1Q12 A;  4A3G H;  2DUD A;  3U4Z A;  2CFM A;  3ULP A;  4DUZ L;  2KEN A;  3CC7 A;  2N49 A;  1XJV A;  4L5S A;  5IP9 G;  2VQE Q;  3CAM A;  3HKZ E;  4MZ9 A;  5M5W H;  3DLL A;  1IBM L;  2JA7 H;  5JEA G;  2GVA A;  3PO3 G;  4GKK Q;  2WFW A;  2B29 A;  5FJ8 G;  4OXP A;  4AIM A;  5LMN Q;  4HJ7 A;  4AQY L;  4UP7 A;  3OW2 A;  1KD1 C;  2AWO A;  4J15 A;  1I94 Q;  4A3L G;  3ERS X;  2VY3 A;  1Y14 B;  5IWA Q;  3TEH B;  1A62 A;  4DV3 L;  1C0A A;  4B3R L;  5FLM H;  1W3S A;  4BBS H;  1KIX A;  4B3M Q;  4DR4 Q;  2ZTD A;  4DUZ Q;  4LFC L;  2NVT H;  1S72 A;  1Q86 C;  5C4J H;  4RMF A;  3KF8 B;  2VQE L;  4C3J H;  1KRT A;  4UP9 A;  4JI5 L;  2R7Z G;  4A3M H;  1PH2 A;  1JMC A;  1KAW A;  3A5Z B;  4NXM L;  4A3I G;  1VQL A;  3M4P A;  3W5O A;  4A3B G;  3I56 A;  4LF7 Q;  4LF9 L;  2YTY A;  2IHE A;  4DV0 L;  2L15 A;  2YYZ A;  4JV5 L;  1VQJ A;  2WAQ G;  1RIP A;  1G6P A;  3BJU A;  4GNX C;  4GNX B;  2VS1 A;  1N36 Q;  3RLF A;  3RZO H;  2Z6K C;  3ZJY C;  4IOC A;  2R7F A;  1CUK A;  5M3F G;  4IJH A;  2JA8 H;  4OO1 G;  3K7A H;  2JJQ A;  5E7N A;  5JJI A;  2VUM G;  1UE6 A;  3PIO A;  2Q2U A;  1ASZ A;  1EQR A;  1VQG A;  1EYG A;  4LF8 Q;  4UY8 C;  3ULL A;  2VL6 A;  3M4Q A;  5LMU Q;  4A3F G;  5IWA L;  4HIK A;  5J3B A;  1QVF A;  4AYB G;  2HHH L;  1YZ6 A;  4A3G G;  3KJP A;  2UXB Q;  4DV2 L;  4X62 L;  4BBS G;  4DAM A;  2JK8 A;  1TWH H;  4DK3 C;  5IP7 G;  5GQO A;  4DR6 L;  4B3T Q;  3JC6 6;  4QY7 A;  3F2D A;  1IZ6 A;  1BBW A;  4R4C A;  3CCV A;  1IBM Q;  1N32 L;  3I7F A;  2I0Q A;  1NE3 A;  1XTD A;  3MEF A;  2B63 G;  2BA0 A;  3I55 A;  3LGJ A;  3CCQ A;  1PH4 A;  2ZM6 L;  4BY7 H;  4YCU A;  4YWK A;  2K14 A;  4P75 A;  1HNW Q;  5C4X G;  4LUZ A;  1PA6 A;  4C3H H;  2PI2 E;  4R4I A;  1C7Y A;  3M9B A;  4DR4 L;  1PH7 A;  1BBU A;  1FVI A;  3M85 A;  1HJP A;  2E5L L;  3CD6 A;  4A93 G;  5C3E H;  2LXK A;  4LFA L;  2JEA I;  4GKJ L;  1UEB A;  3G48 A;  1HZ9 A;  1WYD A;  4A4I A;  5IYD H;  2PI2 A;  4KLK A;  4A76 A;  1YI2 A;  1S40 A;  3M3Y H;  4DV7 L;  1NJI C;  1PYB A;  1W2B A;  2K52 A;  2NZO A;  2JA9 A;  3E0E A;  2OTL A;  1I5F A;  1VQP A;  4DKA C;  2E2J H;  4JOI C;  5GRO A;  5BR8 L;  3I4O A;  4DR1 L;  2UXC L;  3E9H A;  4GLV B;  5GAE C;  4JV5 Q;  1V1Q A;  3CCE A;  4DR6 Q;  1GO3 E;  4TVA B;  1EIF A;  3RLN A;  3J81 c;  1YHB A;  2VZA A;  1XNQ L;  1U5K A;  2D0P A;  4X65 Q;  1J5E L;  4HID A;  3EN2 A;  2JA8 G;  2IX0 A;  2AKW B;  1MJE A;  2V1C C;  3GO5 A;  4GLA C;  5C0X G;  4EQ5 A;  3CPF A;  1CKM A;  1Y1W G;  4LF5 Q;  2R6G A;  5FLX c;  1P8L A;  4IFD I;  1M1K C;  2EQS A;  3B6Y A;  4DR3 Q;  3H0G G;  2JA5 G;  1OXX K;  3S2H H;  1FL0 A;  1C9O A;  4JI3 L;  1HR0 Q;  2A19 A;  3S16 H;  3BZC A;  5ELN A;  1N9W A;  3AFQ A;  1XNQ Q;  2NVY H;  2XGT A;  3J7Z C;  3OTO L;  4APV A;  2HIV A;  3S1R H;  1QZG A;  1VQB A;  2ASB A;  1A63 A;  3PO2 G;  4NXN Q;  4IPC A;  5IYD G;  5IY0 A;  3JAM c;  2A1A A;  4OO1 I;  2HT1 A;  1VS0 A;  1SMX A;  4YCV A;  2R92 G;  1TWF H;  1YIJ A;  4DV5 Q;  1EWI A;  1NY4 A;  5BR8 Q;  2NVQ H;  3HOW G;  2K5H A;  3J81 i;  1PH3 A;  1YEZ A;  3T1Y Q;  1NBW A;  3M7N A;  4UP8 A;  1E24 A;  4O2D A;  1XMQ Q;  1CKN B;  1MIU A;  2HIX A;  2NZH A;  2Q2I A;  2OCE A;  2K75 A;  4R1J A;  2YV5 A;  1V9P A;  3U4V A;  1I3Q H;  1WI5 A;  4DV1 Q;  1YJ9 A;  1VQC A;  3HOX H;  4PMW A;  4JI8 Q;  4JI7 L;  2VUM H;  1E3P A;  1VQD A;  2K5V A;  4K0K L;  1J6Q A;  4DV4 L;  1K8A C;  4LF7 L;  1X54 A;  4OX9 L;  3CCM A;  1GKH A;  3T1Y L;  1X56 A;  3L7Z C;  2OTJ A;  4R4Q A;  3IRB A;  4DR7 Q;  4A75 A;  2RCN A;  3HOU H;  1YVC A;  2JA6 H;  4GNX A;  1Q1E A;  3JAM i;  1Y1W H;  4NXN L;  2OQK A;  2IY5 B;  3I4M G;  3NEM A;  5M5X H;  1PH1 A;  5JEA J;  1OXS C;  5LMU L;  4GS3 A;  2ZTC A;  1IBK Q;  5GAH C;  1LUZ A;  4X62 Q;  5AJ3 L;  4PZ7 A;  2IX1 A;  1QVC A;  1G51 A;  1SN8 A;  5M5Y H;  4DR7 L;  3HOV G;  3GTK H;  1X6O A;  3UDI A;  1VQE A;  2NN6 I;  3AQQ A;  2HQL A;  4P74 A;  4A3M G;  4A93 H;  2KCT A;  3BU2 A;  1JT8 A;  1B8A A;  4GN4 B;  4IFD G;  2MFI A;  1YBY A;  4KHP L;  2XTI A;  5GAG C;  3GTM H;  1N33 Q;  2Q2H A;  5IT9 c;  1VQO A;  2Q2T A;  1PH5 A;  4JC0 A;  2AHO B;  1Z9F A;  3T1H L;  1N8R C;  3GTL H;  2EIF A;  3F1Z A;  4WJ3 M;  4JBK A;  3STB D;  4IO9 A;  2K5N A;  1E1O A;  4GN5 A;  4A3F H;  4R4T A;  1IL2 A;  1EOV A;  3A5U A;  4DR2 Q;  1K0R A;  1SFO H;  2OWO A;  4OX9 Q;  1I94 L;  3A74 A;  2VQF L;  3H15 A;  4A3D G;  3H0G H;  3S2D H;  4KHP Q;  5AJ3 Q;  2N78 A;  2R93 G; 
#chains in the Genus database with same CATH topology
 3ERO A;  2OF1 A;  1WTH A;  2WAQ E;  4ALP A;  1IXR A;  3OOC A;  5IT9 L;  2A68 C;  2LS0 1;  2KQ3 A;  4LF4 Q;  2SDF A;  4XQN A;  2YU9 B;  4JI6 Q;  5C44 H;  1UE7 A;  5FLX L;  3S1N B;  3MXP A;  4XXE A;  5FKA C;  1R9T H;  1BXT A;  1WFQ A;  2F0O A;  2E76 C;  4UPA A;  4HCS A;  1Q1B A;  4LUV A;  4DR5 Q;  2ID0 A;  4DV5 L;  4A3L H;  1TT2 A;  1VQK A;  1KAA A;  4AYB E;  4G57 A;  4A3D H;  1KDC A;  4HJ8 A;  4R4O A;  2F0H A;  1G29 1;  4NPS A;  3K0X A;  1ET6 A;  3CC2 A;  2B3G A;  1YHA A;  3KBX A;  4HED A;  3KF6 B;  1MKH A;  1L0W A;  1QB5 D;  1TWA H;  1IBL L;  1D2B A;  1Z6H A;  1HNW L;  1P16 A;  4IPG A;  1FR3 A;  3SHL A;  1O7I A;  2EYL A;  4POF A;  3K57 A;  1PTO D;  3K58 A;  4NP5 A;  1Y1V H;  3T4A C;  1VDZ A;  4GOP B;  4GOP C;  4H44 C;  1ESF A;  4PMB A;  3P20 A;  3OYY A;  1JJ2 A;  4QIW E;  2Q8I B;  2UXC Q;  3ULJ A;  4JI2 Q;  3NQT A;  1F2M A;  2K50 A;  1N32 Q;  2XWB B;  3CMA A;  4K8I A;  3GTJ H;  3S1Q B;  1F2Z A;  4HR7 B;  1ICF B;  4FP5 D;  5M3M G;  3FP9 A;  1JE4 A;  2KHI A;  3NTH A;  1M90 C;  3AYH B;  2E74 C;  2QDL A;  2MO0 A;  1Y1V G;  3LX0 A;  2EYP A;  4HJ5 A;  3M4O H;  2NVT B;  1I4X A;  3CCU A;  3GTP H;  1TY2 A;  2EXZ A;  2HDL A;  1BCP C;  3J7A F;  2B8G A;  3VYT A;  1CSP A;  3FPU B;  5ELO A;  1HH2 P;  3ITP A;  3EQL C;  1IW7 D;  2IWH A;  3RR5 A;  1D7Q A;  1Y1W B;  3R2T A;  3C46 A;  2JA7 B;  5BN5 A;  1A3V A;  2K05 A;  3PUY A;  2ZJQ A;  1Q90 A;  1I6H H;  3J7A 5;  4PG3 A;  3RZD B;  1E1T A;  1DOM A;  3U9S A;  5A35 A;  4IFD J;  1K73 C;  2LMC B;  3J81 L;  3CCR A;  1HTP A;  3CCS A;  3KDF A;  1J8I A;  4L5Q A;  4RG1 A;  2AMC B;  4JI4 Q;  4JBM A;  4IUN A;  3I4M H;  1PMR A;  1GUW A;  1U4R A;  2K03 A;  4G7Z C;  4X66 Q;  1YIT A;  1RTO A;  1X3F A;  3BZK A;  2CH4 W;  3IFT A;  1II3 A;  3S14 H;  4C3H G;  2K5W A;  3N52 A;  3GTP B;  1SE3 A;  4IUT A;  2ENB A;  3QWN A;  1JCK B;  2QF7 A;  3QIA A;  1BR9 A;  3G6E A;  3K0Y A;  1E7Z A;  3UDF A;  2NN6 G;  1CKN A;  3ND8 A;  4J8Q A;  5C4X H;  4X3S A;  1BO0 A;  1F9P A;  4A3I B;  5LMN W;  2XVS A;  1HR0 L;  2CH4 A;  4L5R C;  4DNI A;  3DHQ A;  4MN3 A;  4RH6 A;  4UDU C;  2ZJP A;  3T51 B;  1RKN A;  2RHS B;  1OXU A;  3S1M H;  3KFU A;  3I4M B;  2XNA C;  2VQF Q;  2PMZ B;  4N8F A;  1EIG A;  2N3S A;  2F52 A;  4BBR H;  5JVG 3;  1VQ6 A;  3D3R A;  3G7L A;  3NBH B;  4OWX B;  4BA1 I;  4K6L A;  4LF5 L;  4LF4 L;  4R8N A;  4ZAI A;  3Q8D A;  3U50 C;  4XT3 B;  2YTV A;  3A8K E;  4A3M B;  1VQN A;  2JA5 B;  4QQB X;  4BBR B;  1JB7 A;  1QZH A;  3CPW A;  3TSS A;  2NTT A;  2Z0S A;  1QIL A;  2FMM A;  3M4Y A;  2FHT A;  4PZ8 A;  4LWC A;  2Z9H A;  4OWT B;  1SEB D;  3K7U C;  3J7A V;  3G4S A;  1EU4 A;  1WTX A;  1GXD C;  4K5W A;  3GTO B;  2B2V C;  4JOI A;  1UAP A;  2BOS A;  2K32 A;  3DM1 A;  3CRK C;  3W3A A;  3MXG A;  3J81 E;  2G9H D;  3NQI A;  1WCM G;  2PZT A;  4DK1 A;  4ME3 A;  4TRD A;  5LHY 1;  1IBL Q;  3OHX C;  2F0L A;  1X55 A;  1LYL A;  3PUW A;  3EIV A;  3S1Q H;  3I4N G;  5T1G A;  2EY1 A;  5IOD A;  1UWV A;  4KN7 C;  1GVP A;  2CWP A;  4XT1 B;  3CC4 A;  1L1O B;  1PYW D;  1QUQ A;  4X66 L;  4BBS B;  5J22 A;  5LMN L;  2KOL A;  4RHS A;  5JJZ A;  1BKB A;  3QR8 A;  1GHK A;  1L0Y B;  3KDF B;  2EY2 A;  3HGB A;  1S5F D;  3RLO A;  4JK1 C;  3ZYY X;  2A6H D;  5I6Y A;  3PUV A;  4JI4 L;  2NWG A;  1OXV A;  3BVM A;  3NBI A;  1ZEQ X;  4J1M A;  2L9H A;  4L8J A;  2DJG C;  2FIN B;  2EYO A;  1Q12 A;  2WAQ B;  4L5S A;  1XTC D;  3D4W A;  5CGK A;  3HKZ E;  1YNN D;  4MZ9 A;  5M5W H;  1IBM L;  1SND A;  3PO3 G;  4GKK Q;  2B29 A;  3PO2 B;  1MSG A;  4G7H C;  4AQY L;  5KNC A;  1EY7 A;  3OW2 A;  1KD1 C;  1C48 A;  4J15 A;  2JN4 A;  1S5B D;  1SNC A;  5IWA Q;  4DV3 L;  1QE6 A;  1R9T B;  4B3R L;  4BBS H;  5DAU A;  2EJG C;  1KIX A;  4B3M Q;  2ZTD A;  1ZYR D;  1TS2 A;  2FFK B;  3OW7 A;  4UP9 A;  2F0I A;  3KLS A;  5FK9 C;  3KLR A;  2R7Z G;  2JA8 B;  1JMC A;  1KAW A;  4NXM L;  3S2H B;  3I56 A;  4LF7 Q;  2IHE A;  2L15 A;  4QB4 A;  4JV5 L;  1VQJ A;  1V1O A;  1PXU A;  3BJU A;  4N9P A;  4GNX C;  4ILW A;  2VS1 A;  2G9D A;  3NBH A;  1TWH B;  2F0W A;  1PRT D;  1FNW A;  1B3A A;  2R7F A;  1CUK A;  4IJH A;  5CBE E;  3K7A H;  5E7N A;  2R93 B;  1STE A;  2VUM G;  1ASZ A;  1EQR A;  1LT4 D;  1EYG A;  2XWJ B;  4A3F G;  5J3B A;  1YZ6 A;  1ENA A;  4DV2 L;  4LK1 C;  4DK3 C;  4DR6 L;  5HGT A;  4B3T Q;  3JC6 6;  1BBW A;  4R4C A;  3I7F A;  1IYV A;  2BA0 A;  3CCQ A;  2ZM6 L;  4YCU A;  2K14 A;  3W2D A;  2IX3 A;  4Q0F A;  5E4X A;  2PI2 E;  4ZLT F;  1BBX C;  3NTI A;  4IUQ A;  4DR4 L;  1D5M C;  1TS4 A;  1HA6 A;  3NTK A;  1RDP D;  4A93 G;  3DEO A;  1HZ9 A;  2B2T A;  2K04 A;  2PI2 A;  4DV7 L;  3C1E A;  2NZO A;  5KYL A;  4DKA C;  1D1K A;  2F03 A;  1SNP A;  1LLR D;  1V1Q A;  1K3B C;  1EIF A;  3I3C A;  2VZA A;  1AW7 A;  1I4P A;  2J7Z A;  3BYT B;  3EN2 A;  1B9N A;  1MJE A;  2BE5 D;  5C0X G;  4XQJ A;  1EL0 A;  4WOR A;  2R6G A;  3K5N A;  2KCN A;  4DR3 Q;  5G3L D;  2JA5 G;  4JI3 L;  2L1B A;  1JOK A;  2QKI C;  1XNQ Q;  1V1P B;  3DWA A;  4WJW A;  3J7Z C;  2HIV A;  2AQ2 B;  1K83 B;  4NXN Q;  5IYD G;  2Y0S B;  2HT1 A;  3Q22 A;  1CQV A;  2EY6 A;  2NVQ B;  5BR8 Q;  2B2T C;  3MA2 B;  1PH3 A;  2PCF B;  3AMU A;  1MIU A;  1MSH A;  2VXW A;  4CKE A;  1PTO F;  3H09 A;  5LL6 S;  1IKL A;  4DV1 Q;  3TN2 A;  2JYO A;  1C8C A;  3HOX H;  4JI7 L;  4K0K L;  5BN4 A;  2I07 B;  1K8A C;  2EYM A;  1GKH A;  3U9O A;  3L7Z C;  5EKI A;  3IRB A;  4R9W A;  1YVC A;  5IT9 E;  1Y1W H;  2OQK A;  5CV4 A;  2O2L D;  3I4M G;  5JEA J;  3I8Z A;  1G6Z A;  2A69 C;  3BVG A;  4FXD A;  4X62 Q;  2BE5 C;  2IX1 A;  1PRT F;  1QVC A;  5M5Y H;  3HOV G;  2RVL A;  1VQE A;  1EQT A;  4A3M G;  3I73 A;  3BU2 A;  1R4Q B;  4RFB A;  3QG1 A;  4IFD G;  4KHP L;  1STG A;  2JXM B;  2XTI A;  2J0T D;  1VQO A;  5F2D A;  3SVM A;  1Z9F A;  4KD3 A;  4PQX A;  2EIF A;  3FVQ A;  5JEA H;  5IIF A;  1TII D;  1E1O A;  3S14 B;  1IL2 A;  3A5U A;  4DR2 Q;  1K0R A;  3I72 A;  3H15 A;  2R93 G;  5KEE A;  5AJ3 Q;  5GAE C;  1K9M C;  4C3H B;  4RWS C;  1UE5 A;  3GDE A;  1R4P B;  4R8I A;  2EYF A;  3FEW X;  3OMC A;  3PGZ A;  1JR0 D;  4RAU C;  2E2I H;  1VMC A;  2PQA A;  5JOB A;  2G5D A;  1T9H A;  3R3O A;  2L12 A;  3UE1 A;  4DV6 Q;  4C3I G;  1BNZ A;  4NW2 A;  4CKB A;  4F88 A;  1LTI D;  2PQE A;  1JE5 A;  5I9P A;  3TS0 A;  1K8G A;  1JIC A;  3URY A;  5HGQ A;  1WTR A;  1PZJ D;  1PTO B;  1EY9 A;  4KD4 A;  1HR0 W;  1M8A A;  4UHV A;  1QOH A;  1RTN A;  2PW7 A;  5AFW A;  1TVX A;  4A3K G;  2ES2 A;  1NMF A;  1B50 A;  2KCC A;  1SNQ A;  1NUC A;  2FXQ A;  2MUY A;  1FYC A;  3RN2 A;  4K0K Q;  4JI6 L;  1O7Z A;  2ZTE A;  2RQX A;  2ZM6 Q;  3E9I A;  3AFP A;  4FDB A;  3CP0 A;  2PMZ E;  3P1H A;  1FJG L;  1CSQ A;  2OEO A;  3TBI B;  4A3J H;  1KNE A;  2EPB A;  5EKK A;  2WB1 G;  1VQ7 A;  1D6E C;  3WWV A;  1SRU A;  3J80 E;  3CHB D;  4IOA A;  1F9R A;  1KHI A;  1LM0 A;  1EZ8 A;  1CFM A;  3GTG H;  3SDZ A;  1PTO H;  1TS3 A;  2L11 A;  1WJJ A;  2LFN A;  5CMD A;  1H95 A;  1KDB A;  1T5E A;  1A15 A;  4HIO A;  2EYH A;  3FPP A;  5ELD A;  3PMF A;  4NB3 A;  3RN5 A;  1ASY A;  2KJX A;  3L0O A;  4P71 A;  4DV0 Q;  5FLM G;  2WII B;  1VCI A;  4ZKB B;  1HFN A;  2H1E A;  3FKI B;  1SMY C;  4ODG A;  3TRE A;  1GUO A;  1UNS A;  3HG9 A;  3J81 j;  4OHJ A;  2B2U C;  1Y69 U;  3SR1 A;  2R92 H;  3PUZ A;  4A3J G;  2VNU D;  1XWE A;  4A3G B;  1KL9 A;  1BDO A;  1U0L A;  3T56 B;  3CCL A;  4C3I H;  5JJL A;  2KHS A;  1ZKO A;  1HZB A;  3BVZ A;  1D5X C;  1U4M A;  1PZK D;  2RCF A;  4L5T A;  1AFP A;  5M3M H;  2B8F A;  1DM0 B;  4EX5 A;  4IQZ A;  4A3K H;  4QCL A;  1LTT D;  1DJR D;  1TWC B;  2Y0S G;  2QEX A;  2EJF C;  3MEH A;  1BQQ T;  3IFD A;  4JBW A;  1U9R A;  1IBK L;  2B2U A;  3MVV A;  3HFZ B;  1EEF D;  4XTC S;  1LT5 D;  1ILP A;  1SYG A;  2K4K A;  3D0F A;  1Q81 C;  4G4K A;  2UUA Q;  3K80 C;  1PFS A;  1L1O C;  1VQM A;  5D65 A;  3I2Z A;  3UI2 A;  5HY6 A;  4A3C H;  1GUT A;  3F2B A;  4ZK9 B;  3OIP A;  5D3I B;  4JCV E;  1Q8K A;  4C1N I;  3G6J B;  1FD7 D;  2FJ2 A;  5C4Z A;  1ONL A;  4IUV A;  4YIJ A;  4BY1 H;  3F8T A;  1PFN A;  1X3E A;  1EEI D;  5I6W A;  2UUC Q;  4KV6 A;  5KGU A;  4AH6 A;  4K2K A;  4CDD C;  1CA6 A;  5IGB A;  1RL2 A;  4IUP A;  1VQ4 A;  2FMC A;  5CV6 A;  3HOY B;  3K81 C;  4JI0 L;  4CKC A;  1HNZ L;  2KVM A;  1STH A;  3PF4 A;  1PFM A;  2BH8 A;  2VUM B;  4C3J G;  1AE3 A;  1B3Q A;  1I50 H;  4DUY Q;  2MQH A;  1XX8 A;  3PO2 H;  3D4R A;  3TP6 A;  4P2C B;  2DGY A;  2GVB A;  3AU7 A;  3A54 A;  3UE0 A;  2NVX H;  3GTM B;  4IPH A;  3D6C A;  3KYH C;  3GTL B;  5C0X J;  1QVG A;  3K5M A;  2F4V Q;  3I90 A;  3L3O C;  1XPO A;  2DJF C;  2CKZ B;  2UXD L;  4BBR G;  1YJN A;  1W6J A;  2N55 A;  1XNR Q;  3NEL A;  2SEB D;  4DK0 A;  2OQ0 A;  2AQ1 B;  1EIH A;  2NVX B;  5DLQ E;  4GKJ Q;  5KRU A;  4NKL A;  1QNK A;  3WDN A;  1UEA B;  1STY A;  4GLX A;  4A3D B;  3W1B A;  5E1F A;  2JEB I;  4JG2 A;  5M3F H;  4KN4 C;  3KLW A;  1TS5 A;  3BS1 A;  4DXF A;  1TWC H;  2X6G A;  1H9K A;  1PH6 A;  3HOY H;  3RD4 A;  2RHQ B;  3K8A A;  3TZD A;  3W1G A;  2CWA A;  1U4L A;  1VQA A;  3J80 c;  1HNX L;  2F4I A;  4CDE C;  4IFD H;  4A3B B;  4KY5 A;  1B44 D;  1WTQ A;  3TP8 A;  3ULP A;  1TU2 B;  1NR4 A;  3CC7 A;  3S2D B;  2C5C A;  3MTS A;  5JEA G;  2WFW A;  5FJ8 G;  4BY1 B;  2HD3 A;  4AIM A;  2F3V A;  3T16 A;  3TEH B;  1TWF B;  1WVL A;  2B2W A;  4DR4 Q;  1K0S A;  2F0E A;  1S72 A;  4RMF A;  3KF8 B;  3Q0A A;  2VQE L;  4C3J H;  1KRT A;  3GV6 A;  3MFY A;  5T1I A;  4KY6 A;  3OSO A;  3A5Z B;  1VQL A;  2F0Q A;  1YNN C;  2YTY A;  4DV0 L;  4KKS A;  1QG7 A;  2IJ0 A;  1B4O A;  1N36 Q;  3RZO H;  2Z6K C;  5M3F G;  2B2W C;  4OO1 G;  1DZ1 A;  2RDH A;  1IYU A;  4CHT B;  4HMJ A;  4NMZ A;  1SFO B;  5L37 A;  4UY8 C;  5IGE A;  2HQE A;  2VL6 A;  5LMU Q;  5D3D A;  5IWA L;  4HIK A;  4RA8 A;  1QVF A;  4A3G G;  3KJP A;  2UXB Q;  3GTQ B;  4BBS G;  2JK8 A;  1TWH H;  5GQO A;  2QEJ C;  4QY7 A;  4HCE A;  3CCV A;  1IBM Q;  2E2D C;  4X3U A;  1N32 L;  1LTB D;  5C4J B;  1HNW Q;  3I4N B;  1ZYR C;  4R4I A;  1C7Y A;  3NWS A;  2CQA A;  1PH7 A;  4CJ2 C;  1ML0 D;  1JC7 A;  2A6E C;  2E5L L;  2WIN B;  5C3E H;  4GKJ L;  1UEB A;  3K6O A;  4KLK A;  2M00 A;  1YI2 A;  1NAP A;  3M3Y H;  1NJI C;  5ELF A;  1Y1V B;  4L63 B;  1A3T A;  2OTL A;  4A3L G;  1VQP A;  2E2J H;  2UXC L;  5GRO A;  4DR1 L;  4GLV B;  1I4G A;  4DR6 Q;  4FNF A;  2M9V A;  3RLN A;  1YHB A;  3S16 B;  5M5W B;  1SYD A;  2D0P A;  4X65 Q;  4MHE A;  2IX0 A;  1CHP D;  4GLA C;  4H7B A;  4EQ5 A;  1CKM A;  4E6I A;  3B6Y A;  2A74 C;  2L55 A;  2RSN A;  3R8B A;  3J80 L;  1OXX K;  1C9O A;  4K5V A;  4ZKC B;  3S16 H;  3BZC A;  4CDC C;  1N9W A;  3AFQ A;  1PZI D;  3OTO L;  1A63 A;  1VQB A;  2E2J B;  4IPC A;  3AB9 A;  3NP8 A;  4KY7 A;  5IY0 A;  3JAM c;  2A1A A;  4FF3 A;  2R92 G;  1TWF H;  1EWH A;  5K5P A;  1NY4 A;  5C3E B;  2D2C C;  3M7G A;  3T1Y Q;  2O5J C;  5EPJ A;  1NR2 A;  1E24 A;  4O2D A;  2HIX A;  2NZH A;  2Q2I A;  1JWM D;  2K75 A;  1EY8 A;  2YV5 A;  4DN4 M;  5KND A;  1YJ9 A;  5EKL A;  1VQC A;  5C0X H;  2R3Z A;  2VUM H;  2K5V A;  4PMC A;  4RGM A;  2CW0 D;  1HHV A;  4A75 A;  3PO3 B;  4HTH A;  4DA2 A;  3F2U A;  4GNX A;  4ZQ3 A;  4NXN L;  3HKZ B;  5C3W A;  4U67 3;  5LMU L;  4GS3 A;  1L0X B;  2ZTC A;  2KA7 A;  1BCP F;  3GTK H;  2ZXR A;  5DM7 3;  3R93 A;  4P74 A;  4A93 H;  2EYJ A;  1I4R A;  3VYR A;  4ZUI A;  3D4D A;  3KK7 A;  4OEM B;  5GAG C;  4PV1 C;  2Q2H A;  5IT9 c;  2BDN A;  1CZG A;  1HPC A;  1WTP A;  1PH5 A;  5TSS A;  3TDQ A;  2Q2T A;  3GTL H;  2AHO B;  4A93 B;  4WJ3 M;  1QWY A;  2K01 A;  1HQR D;  4R4T A;  1OO9 B;  3VYU A;  1I94 L;  3A74 A;  2F0G A;  3S2D H;  1JB3 A;  5IP7 H;  2F0M A;  4P72 A;  3HOU G;  4KHZ A;  4FYD A;  3UDX A;  1VQI A;  4GKK L;  3KOJ A;  3EVQ A;  1HNX Q;  4A3I H;  3VYS A;  2CQO A;  3K59 A;  1J9O A;  1CA5 A;  1NMG A;  1S5D D;  2C35 B;  1AH9 A;  4H0L C;  3GTQ H;  5A2Q L;  4FVM A;  3DEP A;  3MWY W;  4JVZ A;  3J7Y W;  3NPP A;  1CT1 D;  3MXN A;  3LNN A;  1Q3L A;  1WCM H;  4A3E H;  4DR2 L;  4OEL B;  5CV8 A;  4OL7 A;  1VQ5 A;  4LF8 L;  1OXT A;  3RZO B;  3SEB A;  1LTL A;  2JE6 I;  3LWE A;  3ONA B;  2VB2 X;  5DEH A;  4YY3 Q;  2XIW A;  4JW0 A;  4X6A H;  2MJ8 A;  2E2I B;  4JBJ A;  4HAE A;  4ZRZ A;  2K5Q A;  3H6M A;  3ICE A;  2KBN A;  4JI8 L;  4QUF A;  1HA5 A;  5I4D A;  3PIP 3;  4BY7 G;  1IW7 C;  2ICE C;  1GD7 A;  1X65 A;  1EYD A;  3DWQ A;  1CQF A;  3Q6S A;  4JYA L;  4TQU S;  4GZY C;  3VDY A;  4B3T L;  4L6T B;  3CQZ H;  1I4H A;  4PZ6 A;  3KUP A;  4CJ1 B;  1MI2 A;  3H3V H;  4X3T A;  4A3E G;  1KXL A;  1MD2 D;  5COY A;  1AZP A;  2K7V A;  1ROD A;  3PV0 A;  2WB1 E;  4U68 A;  3GTG B;  1VQ8 A;  2UXB L;  4O1N A;  4JYA Q;  1E0B A;  1TKW B;  2GA4 B;  1TXY A;  3UDG A;  2PNH A;  3PO3 H;  3FMC A;  2QGQ A;  2DNC A;  3GTJ B;  2LSS A;  4EVO A;  1KNA A;  2Z4I A;  2AWN A;  2WP8 J;  5C0X I;  3I4N H;  1FGB D;  2DY7 A;  3EJI A;  3STB C;  3G71 A;  4LFC Q;  1AP0 A;  3CXC A;  5BN3 A;  5EGT A;  3SE0 A;  1GM5 A;  3DXJ C;  4DNT B;  2Q8T A;  1ZXT A;  3DWP A;  5FJ8 H;  4AQY Q;  3S15 H;  4FXK C;  5EPL A;  1B1Z A;  2A8V A;  2I5L X;  2R92 B;  1JOR A;  4B3R Q;  2MHV A;  1N36 L;  1B53 A;  1JJG A;  2PZW A;  2Z8L A;  1ESR A;  1NTG A;  2HCI A;  3S17 H;  1EQQ A;  4KMU C;  2VB3 X;  3Q23 A;  1TWA B;  4LF9 Q;  3C1F A;  5EAY A;  3NK9 A;  3TZU A;  1WD0 A;  5EBD A;  1X3G A;  5IYB G;  4P73 A;  4K6D A;  3OWE B;  3CF5 A;  3GD7 A;  1EYA A;  2F0P A;  1L1O A;  2CW0 C;  5KIX A;  4RCO A;  4DPG A;  5GAD C;  1K83 H;  4KKU A;  1TWG H;  4DV7 Q;  1G8Z D;  3F2C A;  3MXU A;  2R93 H;  5C4H A;  4A3F B;  4POG A;  3TP7 A;  2B2Y C;  4V19 0;  2UU9 L;  1PH8 A;  3VA5 A;  5DNF A;  4O42 A;  3KJO A;  3J80 i;  5FO9 B;  1S3O A;  2X69 A;  4JI1 L;  1GUS A;  3MXN B;  3SK8 A;  2E8G A;  3OWF A;  4MIU A;  3S1N H;  3ERQ A;  4HSV A;  2D5D A;  2BH2 A;  1DON A;  2YU9 H;  2A68 D;  4DV3 Q;  3DUZ A;  1YHQ A;  2E2H H;  2LXJ A;  4JI3 Q;  1K28 A;  1ICW A;  4YWL A;  2SNM A;  4K5X A;  1TQO A;  4GN3 B;  1J5E Q;  3VR3 A;  4KI0 A;  3VA7 A;  5M3F B;  4DUY L;  5I2X A;  4IN3 A;  4LF6 L;  4GOP A;  3HOW B;  4LNQ A;  2B2Y A;  1O78 A;  1EY4 A;  1XPR A;  4K2L A;  2IT1 A;  1BUV T;  1SR3 A;  1VMP A;  2L5T A;  1K8O A;  2F3I A;  2ATW A;  1XPU A;  1UE1 A;  2JA5 H;  4N9T A;  4XQQ A;  1YJW A;  1VQF A;  3D31 A;  1B7Y B;  2OXP A;  1DYQ A;  4ID6 A;  1Z7T A;  2D9U A;  1KLG D;  4S3S A;  3BDL A;  4RKL A;  4LFB Q;  2SOB A;  4OGQ C;  1F77 A;  1GJX A;  5M5X B;  5IYB H;  4CBV A;  1ENC A;  1SYE A;  2BCO A;  2GN5 A;  5IP9 H;  1DOL A;  4H02 A;  1QJO A;  1KRS A;  1T5X D;  3PSI A;  1PLF A;  3PIP A;  1HNZ Q;  3HOX G;  1KDA A;  3MZ5 A;  5FOB B;  1LTA D;  1PTO C;  3TP5 A;  1XMO Q;  4Q5V A;  3NUC A;  4XIG S;  3I70 A;  4IJL A;  1NNX A;  2B39 A;  2RSO A;  1VF5 C;  2H4O A;  3HRZ C;  2K5D A;  5M5Y B;  3GTO H;  4LFA Q;  2R7Z H;  1IKM A;  1HUN A;  1DGS A;  1HQM C;  4HJA A;  2PO4 A;  1H9M A;  1O7L A;  2ZJR A;  3HOV B;  1EUJ A;  5EJW A;  5I2Y A;  2YTX A;  2TSS A;  3CCJ A;  1WTV A;  5IYC G;  2VW9 A;  3RNU A;  4FF1 A;  1SSO A;  4ABN A;  1DOK A;  2RF4 A;  1D1I A;  2E75 C;  2ICI A;  2QCP X;  3QO2 A;  4X64 Q;  4BY7 B;  3NXW A;  5IE8 A;  1F9S A;  2UXD Q;  3N6R A;  1SE8 A;  2KEN A;  1XXG A;  2EZV A;  2N49 A;  1XJV A;  5IP9 G;  2RBM A;  3CAM A;  5FO7 B;  2JA7 H;  3DLL A;  2GVA A;  4OXP A;  1JWU D;  2IL8 A;  2KUM A;  4ZYS A;  1WTO A;  2J4X A;  2JP1 A;  4HJ7 A;  4UP7 A;  3ERS X;  3NE5 B;  1A62 A;  1C0A A;  5FLM H;  5COR A;  1SJE D;  2NVT H;  3M4O B;  2ZT9 C;  1D5Z C;  1JWS D;  5C4J H;  2Z4H A;  1S5C D;  2F0J A;  4JI5 L;  1PH2 A;  3L9A X;  3KF8 A;  5CBA E;  1I3Q B;  2Q8R E;  1NSN S;  3BYY B;  4LF9 L;  3IKJ A;  2YYZ A;  1IL8 A;  5ELC A;  2WAQ G;  3A8I E;  4K8J A;  4HN7 A;  3ZJY C;  4RHR A;  2JA8 H;  1G2S A;  4CDF C;  5I9O A;  1UE6 A;  2Q2U A;  5EQ0 A;  1AZQ A;  2M2L A;  3ULL A;  1B2T A;  2A73 B;  4QIW B;  1JQY D;  4X62 L;  1FNU A;  1G2T A;  3D6W A;  2B2V A;  5ELB A;  3F2D A;  1M4V A;  5JPN C;  1JOO A;  1XTD A;  3MEF A;  4NDX A;  3I55 A;  3LGJ A;  1STA A;  4BY7 H;  1I6H B;  5C4X G;  4LUZ A;  1QNU A;  4C3H H;  1BCP B;  2WB1 B;  3M9B A;  1BBU A;  1LT3 D;  1FVI A;  3VR5 A;  3M85 A;  3HEJ A;  2ZXO A;  5CC4 A;  4KHV A;  3S17 B;  4LFA L;  2JEA I;  3G48 A;  1WYD A;  1EWC A;  4F7X A;  4F87 A;  1S40 A;  1PFB A;  1W2B A;  3E0E A;  4JOI C;  5J39 A;  1CK1 A;  3CCE A;  4TVA B;  1RF2 D;  1XNQ L;  4OO1 H;  5NUC A;  3X3N A;  4HID A;  2JA8 G;  2AKW B;  2V1C C;  3GO5 A;  4ZCK A;  3S1R B;  4LF5 Q;  3CPF A;  2EE1 A;  4IFD I;  2EQS A;  3H0G G;  1I6V C;  2K33 A;  3S2H H;  1FL0 A;  1HR0 Q;  3BDO A;  4WRD A;  1LAC A;  1EFI D;  1EY5 A;  1Y8O B;  5C5M A;  1EQV A;  2HCC A;  2XGT A;  5CR3 A;  3S1R H;  1X3P A;  1O80 A;  4OO1 I;  3K5O A;  1SMX A;  2HDM A;  3HOW G;  2K5H A;  2SNS A;  1MGS A;  3M7N A;  4DGZ A;  2OT2 A;  1XMQ Q;  1CKN B;  3KLS X;  3SK4 A;  1HXY D;  1HCZ A;  1U4P A;  1V9P A;  3U4V A;  2JA6 B;  3GQB A;  4LAA A;  1MBY A;  5KNB A;  5JVH 3;  1G91 A;  1E3P A;  1VQD A;  5C3X A;  1J6Q A;  4DV4 L;  4LF7 L;  2WKD A;  1GUG A;  4OX9 L;  4FO2 A;  1F2L A;  1X3Q A;  3CCM A;  1KAB A;  2K6A A;  3QOJ A;  2OTJ A;  3CRL C;  4DR7 Q;  2RCN A;  3HOU H;  2JA6 H;  1Q1E A;  4N8X 1;  2IPK D;  4B9W A;  2IY5 B;  1PH1 A;  3A8J E;  5FLX E;  4DXG A;  3VR2 A;  4IUU A;  1IBK Q;  4DF7 A;  1XYI A;  2MPM A;  1G51 A;  1SN8 A;  3V2T A;  4QUC A;  4DR7 L;  1Y8P B;  2PW5 A;  3UDI A;  4FF4 A;  2NN6 I;  1KLU D;  1WCM B;  2HQL A;  4Z9C B;  2E2H B;  1S5E D;  4TSS A;  4KJO A;  1H9S B;  5E4W C;  2RKS A;  1B8A A;  2F0F A;  1AEX A;  5G3L F;  2I46 A;  2MFI A;  1WD1 A;  3MC0 B;  1N33 Q;  3T13 A;  3TME A;  2TMP A;  3H91 A;  1SDF A;  4JC0 A;  1N8R C;  3T1H L;  3VR4 A;  4RCN A;  3F1Z A;  3SXH A;  3IAY A;  3STB D;  4A3F H;  1EOV A;  1SFO H;  1SBB B;  4KHP Q;  3SK6 A;  2K28 A;  2N78 A;  4DAP A;  5CV7 A;  3S24 A;  2RDF A;  1SNO A;  2HUG A;  1VQ9 A;  3L2P A;  4C56 C;  3CME A;  3TRZ A;  4QGU A;  2D0O A;  2JA6 G;  2PPB C;  2H5X A;  2MGS A;  3MHB A;  2Y0S E;  1CHQ D;  2PYK A;  1X9N A;  4NXM Q;  1N34 Q;  1DD2 A;  1UUP A;  4YHH L;  1PV4 A;  4C3J B;  3H3V I;  3RZD H;  5IOC A;  4OWW B;  1PYS B;  2UUA L;  4B9X A;  5LL6 X;  1V1P A;  5DM6 3;  5H1S E;  3OIQ A;  1KTK A;  1K3R A;  4OIK A;  3PQI A;  2A6E D;  3DM3 A;  1DCZ A;  2EXD A;  1GOZ A;  2DNE A;  2MO1 A;  1HFG A;  3SGI A;  1FJG Q;  4BS9 A;  4BY1 G;  1LV9 A;  1XMQ L;  1CKO A;  4DV6 L;  1EYC A;  2R7Z B;  3KF6 A;  2KEE A;  1E2Z A;  4DV1 L;  1YNJ C;  1I50 B;  4F8M A;  4RGO S;  3EBE A;  1EZ6 A;  4DV4 Q;  2B63 H;  1Z47 A;  3PCO B;  4UAI A;  1KQS A;  5IGG A;  4PNY A;  4ZUJ A;  1YNX A;  3H0G B;  1LAB A;  2EDG A;  4I7A A;  4KJN A;  3AEV A;  4DAY B;  3CW2 C;  5KYI A;  1EY0 A;  4WFN 3;  1RJT A;  1ILQ A;  4DR5 L;  1SLJ A;  4ME5 A;  2UUB L;  3K5L A;  1GUN A;  2L4N A;  1CI3 M;  4QL5 A;  3FKI H;  4Y7N B;  1A0I A;  1V8Q A;  1YNJ D;  4DV2 Q;  4TKO B;  4IUR A;  5IYC H;  3PF5 A;  2UUC L;  1MHW C;  5CV5 A;  1LT6 D;  2XSC A;  4J6H A;  3V05 A;  2NVY B;  4DK6 C;  4X3K A;  4LUO A;  2E5L Q;  1AE2 A;  1AN8 A;  3NEN A;  5C6A A;  1S4Z A;  1RD9 D;  4OON A;  3MFG A;  2KED A;  2NYZ D;  1KC8 C;  3QJY A;  3HOX B;  4JI0 Q;  4IPD A;  2IHF A;  4HJ9 A;  2UU9 Q;  2WAC A;  4RGN A;  4EGV A;  1PH9 A;  1Q82 C;  1H9S A;  2AUK A;  3GV3 A;  1O7Y A;  2JQO A;  3GTK B;  2I5H A;  4QMG A;  3SK5 A;  3JAM L;  4A3E B;  5ELE A;  1E22 A;  3FKI G;  3S1M B;  1K8M A;  1SYF A;  3HS0 C;  3HOW H;  1HZC A;  1XNR L;  2WV6 D;  1WOC A;  1IYJ B;  2ALY B;  3EFX D;  5C4X B;  4JPB W;  3A0J A;  3T53 B;  1I4Q A;  4YCW A;  4JI7 Q;  1N34 L;  4DR3 L;  2NN6 H;  2B63 B;  3HOY G;  4C2M B;  3GP7 A;  1V43 A;  4YHH Q;  4K14 A;  4JI2 L;  2NTS A;  2PQA B;  4EQP A;  1FGU A;  4HIM A;  1EFW A;  3E6Z X;  2RDG A;  3I91 A;  4AYB B;  2AUJ D;  1Q8I A;  2BDO A;  2HHH Q;  4MTK A;  1CM9 A;  5A2Q E;  4DR1 Q;  5JJK A;  1VQH A;  3A7A B;  4B08 A;  1MJC A;  1H9J A;  1A3U A;  4FF2 A;  2CVR A;  1L2F A;  1VF7 A;  1PDQ A;  4M8A A;  3E5S A;  2MNA A;  3HOZ H;  1LO5 D;  1EOT A;  1GHJ A;  3HZX A;  2KCM A;  3BZD B;  3HOV H;  4BA2 I;  1B70 B;  2A69 D;  3FHW A;  2F0K A;  3OTO Q;  4WJ4 A;  3ER0 A;  3O13 A;  2UUB Q;  2BA1 A;  4Y7N H;  2D62 A;  2I5M X;  3A7L A;  4XYO A;  3HKZ G;  1XMO L;  4MNO A;  2EY5 A;  4RGT A;  3TQY A;  1F9Q A;  3OPO A;  4DAY A;  4B3S L;  2CHB D;  3K7A B;  1SYC A;  4A3K B;  4V0B A;  5JPM C;  1EIY B;  3HKS A;  2QA4 A;  4CJ0 B;  3C3L A;  5C44 G;  3QB3 A;  4O0A A;  3H3V C;  1PRT B;  1LTR D;  4LMQ D;  4LW1 A;  1N33 L;  4DFA A;  4C3I B;  1Q46 A;  4B3S Q;  4JI1 Q;  2PZU A;  2X6L A;  1LTG D;  1HZA A;  2NZ1 D;  2N8N A;  2F4V L;  3OMG A;  5C3E G;  1F2Y A;  1ET9 A;  2AQ3 B;  1SXT A;  4LF6 Q;  4MTN A;  3Q24 A;  1TWG B;  1D8L A;  4A3C G;  4YWM A;  1PHJ A;  3HOZ G;  2A6H C;  4BXX G;  4C1N K;  1BOS A;  1SE4 A;  1Q7Y C;  3LWU A;  2JA7 G;  2NUC A;  1E2V A;  4DU9 A;  4X64 L;  1HUM A;  1HRJ A;  2QDB A;  1SMY D;  5K36 G;  3U58 A;  1SRO A;  1OTC A;  1QCB D;  2R7D A;  4Y52 H;  1NCV A;  4I7Z C;  4B3M L;  4X65 L;  5CYU A;  4YY3 L;  1BVS A;  5J1Z A;  1QUQ B;  1X32 A;  4JI5 Q;  1SYB A;  3I4L A;  4KTA A;  4LFB L;  3A55 A;  1PVO A;  2NBF A;  3S15 B;  3CU7 A;  3M3Y B;  3TS2 A;  1A8V A;  1ENF A;  4QJF A;  3PUX A;  1EY6 A;  3T1H Q;  5IGF A;  4A3J B;  2CCZ A;  2F0V A;  5JAV A;  5C44 B;  1HTL D;  1IHZ A;  2N88 A;  2DY8 A;  2Z6K A;  1JJC B;  5IGD A;  4QF4 A;  2XRQ D;  2F0S A;  5K36 H;  4A3B H;  4BXX H;  4C2M H;  2KHJ A;  1EU3 A;  3NWT A;  4A3G H;  1STN A;  2DUD A;  2CFM A;  3U4Z A;  4DUZ L;  1SE2 A;  1BF4 A;  2VQE Q;  2R61 A;  3WOF A;  3KBG A;  5LMN Q;  2AWO A;  4HMI A;  2O5I C;  1I94 Q;  2VY3 A;  1Y14 B;  2Z6B A;  3HOU B;  3ND9 A;  1W3S A;  2O4X A;  5ISR A;  4DUZ Q;  4LFC L;  1Q86 C;  3CQZ B;  5FO8 B;  3S9W A;  4A3M H;  4A3I G;  3M4P A;  4H13 C;  3W5O A;  2F0D A;  4A3B G;  3HP3 A;  2JSO A;  2IW3 A;  1RIP A;  1G6P A;  2XRS D;  4GNX B;  3FRP B;  2RA4 A;  2A5H A;  4RKB A;  3RLF A;  3X3M A;  4IOC A;  4IAL A;  1BCP D;  2JJQ A;  5JJI A;  3PIO A;  1B9M A;  3RMH A;  1VQG A;  4LF8 Q;  4KK7 A;  1TY0 A;  3M4Q A;  5EPK A;  5EBC A;  2NB0 A;  4AYB G;  2HHH L;  4DAM A;  5M9O A;  5IP7 G;  3E0J A;  1A2T A;  1IZ6 A;  2KEC A;  3NSW A;  1FNV A;  2I0Q A;  1NE3 A;  2QW7 A;  5C5L A;  2B63 G;  1PH4 A;  3EA6 A;  4YWK A;  3JAM E;  4P75 A;  2EVB A;  4DNR B;  1PA6 A;  1WTW A;  5M3M B;  4IZ8 A;  1HJP A;  3CD6 A;  2LXK A;  1SJH D;  2C9O A;  5IYD H;  4A4I A;  4XDX A;  3QOL A;  4A76 A;  5E3F A;  1LTS D;  1PYB A;  2K52 A;  3BG3 A;  2JA9 A;  3PIO 3;  1I5F A;  5BR8 L;  1A2U A;  1PRT C;  3I4O A;  3E9H A;  4EQO A;  4JV5 Q;  4G7O C;  3IL8 A;  4EQN A;  1GO3 E;  4LJZ C;  3J81 c;  1U5K A;  3HOZ B;  2F0N A;  1J5E L;  1Y1W G;  3P75 A;  2EOT A;  5FLX c;  1P8L A;  1STB A;  1M1K C;  2PNR C;  4KKT A;  5D14 A;  3VR6 A;  2A19 A;  2LY7 A;  1Y8N B;  5ELN A;  1JOQ A;  3BDC A;  5CV9 A;  2NVY H;  1CZW A;  1QZG A;  2ASB A;  4APV A;  3PO2 G;  1VS0 A;  4YCV A;  1YIJ A;  4DV5 Q;  1EWI A;  2Z1C A;  2P5Z X;  2NVQ H;  3E3X A;  2K1B A;  3J81 i;  1YEZ A;  4CGY B;  1NBW A;  4UP8 A;  3WOE A;  1TR5 A;  4ULL A;  2EJM A;  2OCE A;  1DXM A;  1CTM A;  4HSP A;  4R1J A;  1I3Q H;  1WI5 A;  4PMW A;  4JI8 Q;  2ZXP A;  1SAP A;  1C4Q A;  1X54 A;  4OIJ A;  3T1Y L;  1A6X A;  1X56 A;  2DN8 A;  4R4Q A;  3MAQ A;  3JAM i;  1H9R A;  3FDT A;  4FXG C;  1RHP A;  3NEM A;  5M5X H;  1OXS C;  1SNM A;  3H94 A;  2QIL A;  5GAH C;  2WKC A;  5HUR A;  1LUZ A;  3DMU A;  5AJ3 L;  1RCV D;  3CKI B;  3R2I A;  4I65 A;  4PZ7 A;  3C2P A;  3RUZ A;  5IGC A;  1X6O A;  2F0T A;  3AQQ A;  4XYQ A;  1E2W A;  3V96 A;  2KCT A;  1JT8 A;  4GN4 B;  2L0C A;  2F1M A;  3D8G A;  2MP1 A;  1YBY A;  2XN9 C;  3GTM H;  2V4D A;  3A56 A;  2LKV A;  2F3W A;  2F0U A;  3NHH A;  4JBK A;  4IO9 A;  2K5N A;  4GN5 A;  4BWG B;  4DAV A;  2OWO A;  3P7J A;  4OX9 Q;  1W6K A;  2VQF L;  4A3D G;  3H0G H;  4M1U B; 
#chains in the Genus database with same CATH homology
 3S24 A;  5IP7 H;  4P72 A;  1VQ9 A;  3TRZ A;  3L2P A;  2WAQ E;  3CME A;  4QGU A;  4ALP A;  1IXR A;  2D0O A;  1UE5 A;  4KHZ A;  2JA6 G;  3HOU G;  3GDE A;  2H5X A;  3UDX A;  4LF4 Q;  1VQI A;  2Y0S E;  3KOJ A;  4GKK L;  4JI6 Q;  3PGZ A;  1UE7 A;  5C44 H;  4A3I H;  1X9N A;  1HNX Q;  2E2I H;  2CQO A;  2PQA A;  1N34 Q;  4NXM Q;  1NMG A;  4YHH L;  1PV4 A;  2C35 B;  1T9H A;  1AH9 A;  3GTQ H;  3H3V I;  3RZD H;  3UE1 A;  4DV6 Q;  4OWW B;  1PYS B;  2UUA L;  1R9T H;  1JE5 A;  1WFQ A;  3TS0 A;  1K8G A;  5H1S E;  4UPA A;  4LUV A;  1Q1B A;  4DR5 Q;  1WCM H;  1K3R A;  2ID0 A;  5HGQ A;  4DV5 L;  4A3E H;  4DR2 L;  4A3L H;  3DM3 A;  1VQK A;  3SGI A;  2EXD A;  1OXT A;  2MO1 A;  1HR0 W;  1VQ5 A;  4LF8 L;  1FJG Q;  4AYB E;  4A3D H;  1LTL A;  4BY1 G;  4HJ8 A;  2JE6 I;  4A3K G;  4R4O A;  1XMQ L;  1NMF A;  1CKO A;  1G29 1;  4NPS A;  2ES2 A;  4DV6 L;  4YY3 Q;  3K0X A;  3CC2 A;  3KF6 A;  4X6A H;  4DV1 L;  2B3G A;  4JBJ A;  2FXQ A;  3ICE A;  2KBN A;  1YHA A;  4JI8 L;  3RN2 A;  4JI6 L;  3KF6 B;  4K0K Q;  1MKH A;  2ZTE A;  3EBE A;  1TWA H;  1L0W A;  2ZM6 Q;  1Z47 A;  3E9I A;  3PCO B;  4DV4 Q;  1IBL L;  2B63 H;  4BY7 G;  3AFP A;  4FDB A;  1KQS A;  1HNW L;  3CP0 A;  1GD7 A;  2PMZ E;  1X65 A;  1CSQ A;  1FJG L;  1P16 A;  1YNX A;  4IPG A;  4A3J H;  4JYA L;  1O7I A;  4TQU S;  4POF A;  3VDY A;  3AEV A;  2WB1 G;  3CW2 C;  4DAY B;  1VQ7 A;  4B3T L;  3CQZ H;  4PZ6 A;  3WWV A;  1Y1V H;  4DR5 L;  1SLJ A;  1SRU A;  2UUB L;  3H3V H;  4GOP C;  4GOP B;  4A3E G;  4QL5 A;  4IOA A;  1KXL A;  3FKI H;  1K9M C;  1KHI A;  1LM0 A;  1A0I A;  3OYY A;  1JJ2 A;  3PV0 A;  4QIW E;  2WB1 E;  2UXC Q;  1VQ8 A;  2UXB L;  3ULJ A;  4DV2 Q;  4JI2 Q;  3GTG H;  5IYC H;  3PF5 A;  2UUC L;  4JYA Q;  2K50 A;  1WJJ A;  4DK6 C;  4LUO A;  1N32 Q;  1H95 A;  2E5L Q;  1AE2 A;  1TXY A;  2PNH A;  3NEN A;  3UDG A;  3PO3 H;  4OON A;  4HIO A;  2QGQ A;  3CMA A;  3GTJ H;  2LSS A;  1KC8 C;  4NB3 A;  4JI0 Q;  4IPD A;  2AWN A;  3RN5 A;  2WP8 J;  3L0O A;  5M3M G;  1ASY A;  4P71 A;  5C0X I;  2IHF A;  4HJ9 A;  4DV0 Q;  2UU9 Q;  5FLM G;  3I4N H;  3FP9 A;  3STB C;  3G71 A;  4LFC Q;  1VCI A;  2KHI A;  1M90 C;  3CXC A;  3AYH B;  1PH9 A;  1Q82 C;  1GM5 A;  2JQO A;  3TRE A;  2MO0 A;  1Y1V G;  5FJ8 H;  2I5H A;  4HJ5 A;  3M4O H;  4AQY Q;  3J81 j;  3CCU A;  3S15 H;  3GTP H;  1E22 A;  3FKI G;  2A8V A;  2I5L X;  2R92 H;  3HOW H;  3PUZ A;  4B3R Q;  4A3J G;  2VNU D;  1HZC A;  1XNR L;  1N36 L;  1CSP A;  1KL9 A;  5ELO A;  1HH2 P;  1U0L A;  5JJL A;  3CCL A;  4C3I H;  1WOC A;  1IYJ B;  1JJG A;  3RR5 A;  1D7Q A;  2ALY B;  1NTG A;  1HZB A;  3S17 H;  3PUY A;  3A0J A;  1EQQ A;  2ZJQ A;  1I6H H;  4JI7 Q;  4YCW A;  3J7A 5;  1N34 L;  4DR3 L;  4PG3 A;  3HOY G;  4YHH Q;  1V43 A;  1E1T A;  4L5T A;  4LF9 Q;  5EAY A;  5M3M H;  4JI2 L;  4EX5 A;  4IFD J;  2PQA B;  4A3K H;  5IYB G;  1X3G A;  1K73 C;  3CCR A;  4P73 A;  3CF5 A;  3CCS A;  3GD7 A;  2Y0S G;  3KDF A;  2QEX A;  1FGU A;  4HIM A;  4L5Q A;  1L1O A;  4RG1 A;  2AMC B;  4JI4 Q;  1EFW A;  4JBM A;  3I4M H;  4DPG A;  5GAD C;  1K83 H;  1TWG H;  4JBW A;  4X66 Q;  4DV7 Q;  1X3F A;  3F2C A;  1YIT A;  3BZK A;  2R93 H;  1IBK L;  2HHH Q;  4POG A;  3S14 H;  4DR1 Q;  2UU9 L;  5JJK A;  1VQH A;  1PH8 A;  3HFZ B;  3KJO A;  1MJC A;  3J80 i;  1S3O A;  4JI1 L;  3MXN B;  4XTC S;  2E8G A;  2K4K A;  3D0F A;  1Q81 C;  2UUA Q;  3S1N H;  3G6E A;  3K80 C;  1PFS A;  1L2F A;  1E7Z A;  3UDF A;  2BH2 A;  1L1O C;  1VQM A;  2NN6 G;  3I2Z A;  2YU9 H;  1CKN A;  5C4X H;  2MNA A;  4DV3 Q;  3HOZ H;  1YHQ A;  5HY6 A;  5LMN W;  3F2B A;  2LXJ A;  1HR0 L;  2E2H H;  4JI3 Q;  4A3C H;  2KCM A;  4YWL A;  4L5R C;  4JCV E;  3HOV H;  1Q8K A;  4BA2 I;  1B70 B;  4GN3 B;  4DNI A;  1J5E Q;  3FHW A;  3OTO Q;  4WJ4 A;  3ER0 A;  2UUB Q;  2BA1 A;  4Y7N H;  2D62 A;  4KI0 A;  2ZJP A;  4DUY L;  2I5M X;  4LF6 L;  2RHS B;  1OXU A;  4GOP A;  4BY1 H;  3S1M H;  3F8T A;  3KFU A;  3HKZ G;  1XMO L;  2VQF Q;  1X3E A;  4MNO A;  2UUC Q;  3TQY A;  4LNQ A;  4B3S L;  4BBR H;  2N3S A;  2F52 A;  1VQ6 A;  4AH6 A;  1XPR A;  2IT1 A;  1SR3 A;  1EIY B;  3NBH B;  4OWX B;  4BA1 I;  3HKS A;  2QA4 A;  1RL2 A;  4LF5 L;  4LF4 L;  1VQ4 A;  2F3I A;  2ATW A;  3K81 C;  5C44 G;  1HNZ L;  4JI0 L;  1XPU A;  4O0A A;  3Q8D A;  3U50 C;  1UE1 A;  2YTV A;  2JA5 H;  1VQN A;  4LW1 A;  4QQB X;  3PF4 A;  1JB7 A;  1QZH A;  1N33 L;  1YJW A;  1VQF A;  2BH8 A;  1B7Y B;  3D31 A;  3CPW A;  1Q46 A;  4B3S Q;  4JI1 Q;  1AE3 A;  1HZA A;  1I50 H;  2Z0S A;  4DUY Q;  2MQH A;  2N8N A;  2F4V L;  4PZ8 A;  3PO2 H;  5C3E G;  4LWC A;  4OWT B;  4LF6 Q;  3K7U C;  4MTN A;  3G4S A;  1D8L A;  2DGY A;  2GVB A;  4LFB Q;  4A3C G;  4YWM A;  1PHJ A;  3HOZ G;  4BXX G;  3UE0 A;  2NVX H;  4JOI A;  5IYB H;  4IPH A;  2GN5 A;  5IP9 H;  1Q7Y C;  3KYH C;  2JA7 G;  4H02 A;  5C0X J;  1QVG A;  1KRS A;  3PSI A;  2F4V Q;  1WCM G;  3PIP A;  1HNZ Q;  4ME3 A;  3HOX G;  4X64 L;  1IBL Q;  5K36 G;  3U58 A;  1X55 A;  1LYL A;  3PUW A;  1SRO A;  3EIV A;  1XPO A;  1XMO Q;  1OTC A;  3I4N G;  3S1Q H;  2CKZ B;  2UXD L;  4XIG S;  2R7D A;  4BBR G;  4Y52 H;  1YJN A;  4IJL A;  4B3M L;  1XNR Q;  4X65 L;  4YY3 L;  1BVS A;  3NEL A;  1QUQ B;  1UWV A;  2OQ0 A;  1GVP A;  2CWP A;  4JI5 Q;  3CC4 A;  1L1O B;  3GTO H;  4LFA Q;  1QUQ A;  5DLQ E;  4X66 L;  2R7Z H;  4GKJ Q;  4LFB L;  5LMN L;  1PVO A;  1BKB A;  1DGS A;  4GLX A;  4HJA A;  3TS2 A;  1A8V A;  2ZJR A;  1EUJ A;  3KDF B;  3W1B A;  2YTX A;  3CCJ A;  4QJF A;  3PUX A;  5IYC G;  2VW9 A;  3RLO A;  3RNU A;  3T1H Q;  2JEB I;  2RF4 A;  4JG2 A;  5M3F H;  2CCZ A;  3KLW A;  3PUV A;  4JI4 L;  1TWC H;  4X64 Q;  1OXV A;  2Z6K A;  1PH6 A;  3HOY H;  1JJC B;  3J80 c;  2RHQ B;  3K8A A;  1HNX L;  3W1G A;  2CWA A;  1VQA A;  5IE8 A;  4A3B H;  2UXD Q;  4BXX H;  1SE8 A;  4C2M H;  2KHJ A;  1Q12 A;  4A3G H;  2DUD A;  3U4Z A;  2CFM A;  3ULP A;  4DUZ L;  2KEN A;  3CC7 A;  2N49 A;  1XJV A;  4L5S A;  5IP9 G;  2VQE Q;  3CAM A;  3HKZ E;  4MZ9 A;  5M5W H;  3DLL A;  1IBM L;  2JA7 H;  5JEA G;  2GVA A;  3PO3 G;  4GKK Q;  2WFW A;  2B29 A;  5FJ8 G;  4OXP A;  4AIM A;  5LMN Q;  4HJ7 A;  4AQY L;  4UP7 A;  3OW2 A;  1KD1 C;  2AWO A;  4J15 A;  1I94 Q;  4A3L G;  3ERS X;  2VY3 A;  1Y14 B;  5IWA Q;  3TEH B;  1A62 A;  4DV3 L;  1C0A A;  4B3R L;  5FLM H;  1W3S A;  4BBS H;  1KIX A;  4B3M Q;  4DR4 Q;  2ZTD A;  4DUZ Q;  4LFC L;  2NVT H;  1S72 A;  1Q86 C;  5C4J H;  4RMF A;  3KF8 B;  2VQE L;  4C3J H;  1KRT A;  4UP9 A;  4JI5 L;  2R7Z G;  4A3M H;  1PH2 A;  1JMC A;  1KAW A;  3A5Z B;  4NXM L;  4A3I G;  1VQL A;  3M4P A;  3W5O A;  4A3B G;  3I56 A;  4LF7 Q;  4LF9 L;  2YTY A;  2IHE A;  4DV0 L;  2L15 A;  2YYZ A;  4JV5 L;  1VQJ A;  2WAQ G;  1RIP A;  1G6P A;  3BJU A;  4GNX C;  4GNX B;  2VS1 A;  1N36 Q;  3RLF A;  3RZO H;  2Z6K C;  3ZJY C;  4IOC A;  2R7F A;  1CUK A;  5M3F G;  4IJH A;  2JA8 H;  4OO1 G;  3K7A H;  2JJQ A;  5E7N A;  5JJI A;  2VUM G;  1UE6 A;  3PIO A;  2Q2U A;  1ASZ A;  1EQR A;  1VQG A;  1EYG A;  4LF8 Q;  4UY8 C;  3ULL A;  2VL6 A;  3M4Q A;  5LMU Q;  4A3F G;  5IWA L;  4HIK A;  5J3B A;  1QVF A;  4AYB G;  2HHH L;  1YZ6 A;  4A3G G;  3KJP A;  2UXB Q;  4DV2 L;  4X62 L;  4BBS G;  4DAM A;  2JK8 A;  1TWH H;  4DK3 C;  5IP7 G;  5GQO A;  4DR6 L;  4B3T Q;  3JC6 6;  4QY7 A;  3F2D A;  1IZ6 A;  1BBW A;  4R4C A;  3CCV A;  1IBM Q;  1N32 L;  3I7F A;  2I0Q A;  1NE3 A;  1XTD A;  3MEF A;  2B63 G;  2BA0 A;  3I55 A;  3LGJ A;  3CCQ A;  1PH4 A;  2ZM6 L;  4BY7 H;  4YCU A;  4YWK A;  2K14 A;  4P75 A;  1HNW Q;  5C4X G;  4LUZ A;  1PA6 A;  4C3H H;  2PI2 E;  4R4I A;  1C7Y A;  3M9B A;  4DR4 L;  1PH7 A;  1BBU A;  1FVI A;  3M85 A;  1HJP A;  2E5L L;  3CD6 A;  4A93 G;  5C3E H;  2LXK A;  4LFA L;  2JEA I;  4GKJ L;  1UEB A;  3G48 A;  1HZ9 A;  1WYD A;  4A4I A;  5IYD H;  2PI2 A;  4KLK A;  4A76 A;  1YI2 A;  1S40 A;  3M3Y H;  4DV7 L;  1NJI C;  1PYB A;  1W2B A;  2K52 A;  2NZO A;  2JA9 A;  3E0E A;  2OTL A;  1I5F A;  1VQP A;  4DKA C;  2E2J H;  4JOI C;  5GRO A;  5BR8 L;  3I4O A;  4DR1 L;  2UXC L;  3E9H A;  4GLV B;  5GAE C;  4JV5 Q;  1V1Q A;  3CCE A;  4DR6 Q;  1GO3 E;  4TVA B;  1EIF A;  3RLN A;  3J81 c;  1YHB A;  2VZA A;  1XNQ L;  1U5K A;  2D0P A;  4X65 Q;  1J5E L;  4HID A;  3EN2 A;  2JA8 G;  2IX0 A;  2AKW B;  1MJE A;  2V1C C;  3GO5 A;  4GLA C;  5C0X G;  4EQ5 A;  3CPF A;  1CKM A;  1Y1W G;  4LF5 Q;  2R6G A;  5FLX c;  1P8L A;  4IFD I;  1M1K C;  2EQS A;  3B6Y A;  4DR3 Q;  3H0G G;  2JA5 G;  1OXX K;  3S2H H;  1FL0 A;  1C9O A;  4JI3 L;  1HR0 Q;  2A19 A;  3S16 H;  3BZC A;  5ELN A;  1N9W A;  3AFQ A;  1XNQ Q;  2NVY H;  2XGT A;  3J7Z C;  3OTO L;  4APV A;  2HIV A;  3S1R H;  1QZG A;  1VQB A;  2ASB A;  1A63 A;  3PO2 G;  4NXN Q;  4IPC A;  5IYD G;  5IY0 A;  3JAM c;  2A1A A;  4OO1 I;  2HT1 A;  1VS0 A;  1SMX A;  4YCV A;  2R92 G;  1TWF H;  1YIJ A;  4DV5 Q;  1EWI A;  1NY4 A;  5BR8 Q;  2NVQ H;  3HOW G;  2K5H A;  3J81 i;  1PH3 A;  1YEZ A;  3T1Y Q;  1NBW A;  3M7N A;  4UP8 A;  1E24 A;  4O2D A;  1XMQ Q;  1CKN B;  1MIU A;  2HIX A;  2NZH A;  2Q2I A;  2OCE A;  2K75 A;  4R1J A;  2YV5 A;  1V9P A;  3U4V A;  1I3Q H;  1WI5 A;  4DV1 Q;  1YJ9 A;  1VQC A;  3HOX H;  4PMW A;  4JI8 Q;  4JI7 L;  2VUM H;  1E3P A;  1VQD A;  2K5V A;  4K0K L;  1J6Q A;  4DV4 L;  1K8A C;  4LF7 L;  1X54 A;  4OX9 L;  3CCM A;  1GKH A;  3T1Y L;  1X56 A;  3L7Z C;  2OTJ A;  4R4Q A;  3IRB A;  4DR7 Q;  4A75 A;  2RCN A;  3HOU H;  1YVC A;  2JA6 H;  4GNX A;  1Q1E A;  3JAM i;  1Y1W H;  4NXN L;  2OQK A;  2IY5 B;  3I4M G;  3NEM A;  5M5X H;  1PH1 A;  5JEA J;  1OXS C;  5LMU L;  4GS3 A;  2ZTC A;  1IBK Q;  5GAH C;  1LUZ A;  4X62 Q;  5AJ3 L;  4PZ7 A;  2IX1 A;  1QVC A;  1G51 A;  1SN8 A;  5M5Y H;  4DR7 L;  3HOV G;  3GTK H;  1X6O A;  3UDI A;  1VQE A;  2NN6 I;  3AQQ A;  2HQL A;  4P74 A;  4A3M G;  4A93 H;  2KCT A;  3BU2 A;  1JT8 A;  1B8A A;  4GN4 B;  4IFD G;  2MFI A;  1YBY A;  4KHP L;  2XTI A;  5GAG C;  3GTM H;  1N33 Q;  2Q2H A;  5IT9 c;  1VQO A;  2Q2T A;  1PH5 A;  4JC0 A;  2AHO B;  1Z9F A;  3T1H L;  1N8R C;  3GTL H;  2EIF A;  3F1Z A;  4WJ3 M;  4JBK A;  3STB D;  4IO9 A;  2K5N A;  1E1O A;  4GN5 A;  4A3F H;  4R4T A;  1IL2 A;  1EOV A;  3A5U A;  4DR2 Q;  1K0R A;  1SFO H;  2OWO A;  4OX9 Q;  1I94 L;  3A74 A;  2VQF L;  3H15 A;  4A3D G;  3H0G H;  3S2D H;  4KHP Q;  5AJ3 Q;  2N78 A;  2R93 G; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...