1N33T

Structure of the thermus thermophilus 30s ribosomal subunit bound to codon and near-cognate transfer rna anticodon stem-loop mismatched at the second codon position at the a site with paromomycin
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
99
structure length
99
Chain Sequence
b'RNLSALKRHRQSLKRRLRNKAKKSAIKTLSKKAIQLAQEGKAEEALKIMRKAESLIDKAAKGSTLHKNAAARRKSRLMRKVRQLLEAAGAPLIGGGLSA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S RIBOSOMAL RNA
publication title Selection of tRNA by the Ribosome Requires a Transition from an Open to a Closed Form
pubmed doi rcsb
molecule tags Ribosome
total genus 34
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 2002-10-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
T PF01649 Ribosomal_S20p Ribosomal protein S20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.110 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Ribosomal protein S20 1n33T00
5LMUT 4DV0T 4LF4T 2UXBT 2VQFT 4B3MT 2VQET 4DR7T 2E5LT 1IBMT 4JI7T 4DV3T 5IWAT 4JI6T 4LF7T 1IBLT 4X64T 4DV2T 4DR3T 4JI1T 4AQYT 1XNQT 4DR5T 4DV5T 4GKJT 4B3TT 4DR4T 1XMOT 1N33T 4B3RT 4DUZT 4JI0T 4DV4T 5BR8T 4B3ST 4JI4T 2UUBT 3T1YT 4LFCT 4JI3T 2ZM6T 1XNRT 4JYAT 2UXDT 1HNWT 4LF5T 4JI5T 4LFAT 4JV5T 4DV7T 4KHPT 4LFBT 2UU9T 2HHHT 4YHHT 4DUYT 1I94T 1N34T 4LF9T 1N32T 1HNZT 2UUCT 4YY3T 2UUAT 4OX9T 4JI8T 4DV6T 2UXCT 4LF6T 4X62T 1HNXT 4NXNT 4DR6T 1N36T 4DR2T 4K0KT 2F4VT 1HR0T 4DV1T 4X66T 3T1HT 4GKKT 1FJGT 4X65T 1XMQT 4NXMT 5LMNT 1J5ET 4LF8T 1IBKT 4DR1T 4JI2T 3OTOT
chains in the Genus database with same CATH superfamily
2WDVA 3FXEB 1J1JA 2UXBT 2BVLA 3AE2A 4JI6T 1D0ZA 4HN9A 2V8SV 5ABFA 4AQFC 1WLXA 2LKGA 1MNEA 2Z6EA 4UVAB 1E1HB 3P7IA 5BR8T 5AQQB 1AJ3A 3ZT6A 2XAHB 4YTNA 1M7KA 2FUPA 5J1GA 4YTMA 4P0AA 4AKGA 4PJMA 2AXDS 5ABFB 4X20E 4P1NA 2UU9T 3AXJA 5LYJE 4HFIA 4A56A 5L3EB 3O4XE 2FBWA 4EXTA 2UUCT 5HWYA 2YU1A 3UU5A 2V6XA 2Y8DA 4DIDB 4KI0F 2BG9A 4ERRA 1BR0A 3P4SA 5ADXL 2YKSA 4Z8XA 5HEJA 1SHZC 1Y01A 4ZZBA 3B13A 3IHRA 4GK5E 3NRXA 2W4XA 1FJGT 4U31A 2YOEA 4QXHB 1D1BA 2PFVA 2CLYB 3ONLC 4AKRB 1L0VA 4DV0T 5FY0A 4EOZB 4QXBB 2BG9B 4WW0A 3DP7A 4EEBA 4CI3B 4E7ZA 4I43B 3RLFF 1N33T 4DV4T 4B6XA 3QB5A 3PUYF 3Q9DA 1XDOA 3R84B 5DABA 2LSJA 3RIAA 4JI5T 2BBJA 4A97A 2CPTA 2VKDA 3Q5DA 3ZSSA 5AQFB 4DUYT 5L3DB 3VHLA 1HNZT 3MACA 2IC9A 2XQ8A 3UU3A 3VU7H 3LFMA 5TAOA 3PJAJ 3PTRB 2HN1A 2KINB 3P50A 3I0OA 2NW7A 3UFEA 5FY1A 3FZHB 3Q5XA 4ILCA 2M67A 1E7PA 2VL8A 3JC6D 3ZMSB 2DWGA 2K48A 2IHR1 1OEDC 5L4HA 2CBJA 2MBGA 5ABEA 1UX5A 2KLQA 1ZHCA 2RA1A 2B1EA 2UXXB 2WAUA 4U72A 5EK4A 5FXXA 3AVSA 3O1IA 4IREA 3KV4A 4X64T 4YSYA 2I6HA 4QX8B 4AQFA 4JI1T 5JREA 2X9WA 1VRBA 1NENA 3OKQA 2HN2A 4H9QC 2UXNB 1V9DA 3LK42 4HFVA 3SFEA 4LFCT 2WM9A 3UFGA 4HWFA 2ZM6T 5L3FB 2OV9A 2J4GA 5CFBA 4PJJA 5FL0A 4LMKA 2D0TA 4ZI2D 3RGLA 4DV7T 5IYZE 2YN6A 2QVAA 3RH3A 2V7IA 3N2KE 5LJNA 2GK9A 1OEDE 1IZNB 2BZBA 2KSRA 4MHCA 3PURA 4EAHA 3F31A 4I50E 5EK2A 5JDNA 4ZZCA 2UXCT 5JDLA 1YXRA 5LB7B 4NXNT 1VCSA 2VASA 4WNKA 1N36T 3LG7A 4PJLA 4K0KT 4X1IE 3T1HT 2WMOA 1Y64B 4WBNE 3ZMUB 5HCJA 1D1CA 1W0AA 2WWVA 4EB6E 4HFDA 2XAGB 3ETVA 4XZCA 3MK7C 3RPUA 3EVYA 3FZLB 3KBTA 4ISSA 4P09A 3K8PC 2BVMA 4YHJA 3N9OA 3FB2A 4COFA 1UURA 5KMGP 4DR5T 4DV5T 2M6IA 4QHOA 4A98A 1D0YA 5JVDE 4ZHQE 5HXRA 3PDYA 4UV8B 4B3ST 2FJAA 2NTXA 4CN1A 5CJ5A 3VRAA 4BAYB 1HS7A 3EUHA 3HR0A 3OJAA 3B5MA 4ASKA 4KMCA 3ZKRA 2D5UA 4TX5A 4KHZF 2CXFA 1MMDA 2A3DA 5LG4A 1BR4A 2VURA 4TV9E 1D1AA 2L8KA 5JDHA 4JI8T 3F2EA 4ZI3D 4G2AA 2YU2A 3K3QC 2CM0A 2P9BA 1XZYA 4IGUA 5JRCA 4ISTA 4EV6A 1I6ZA 4I0UA 4H9PC 3QC9A 1HF8A 2M6BA 3UTKA 3FZMB 1HCIA 3O1HA 1HX8A 2DI4A 2JIWA 5LGTB 2LRLA 3AE4A 2C5IT 2IDOB 3OTOT 4DMVA 3HL6A 3X1DA 1ZKEA 2LM2A 2WDQA 2N9DA 1WR6A 1Z0PA 5JRCB 4IDOA 4WZXA 3LBXA 1XNQT 4FI5A 1BR1A 3AEFA 4P0BA 4OK0A 1OEDB 2MPKA 3MA9A 3DJBA 5LP6E 1SA0E 3FBLA 1XMOT 3IA3A 2XZEA 4QH5A 2CXDA 5JDQA 2J47A 3CX7B 5L3GB 3I1AA 3RQWA 4JI4T 5JTGA 4UVCB 1XNRT 3N9PA 5JDGA 2ZM8A 1HG5A 5AQIB 3QB5K 4AKHA 3WAJA 2A72A 2QRXA 2A9UA 3GMIA 3LBXB 4HFEA 4ZXLA 1FMVA 2BKNA 1LRZA 4DV6T 2JQ9A 3D0TA 4U33A 2LSKA 3CIRA 4UF0A 4O4LE 1S35A 3QUJA 4H9NC 4ILUA 3K3NA 1KNZA 5JH7E 3MXZA 2DNXA 4O4IE 3F57A 5FP3A 4NUUA 5KXJA 2R6GF 4JI2T 2XUEA 2XPKA 3C64A 5LMUT 3PUWF 4UF0B 4AISA 2IW5B 5ABHA 5KDMC 2XM2A 4ANJA 2H89A 3TLVA 4EYUA 2NP9A 1T8BA 4M1PA 3HA4A 5AQUB 1W9RA 3RIUA 4AIUA 3PE0A 3NRYA 3KVBA 1HFAA 1X9BA 2V7JA 3H3AA 2E9XC 4F8HA 2WCAA 3EAMA 5AQLB 3TLUA 3CVRA 3S4UA 2QA7A 4A5XA 5A1LA 3HKBE 5LNKA 2YDQA 4JUYA 4TV8E 4PNIA 2FJBA 3UU8A 3AVRA 3A5XA 4CQIA 4DO0A 3ANWB 3JADA 4U2ZA 4YT0A 4QKNA 5C8YE 4DBRA 4U7IA 3U78A 4LMLA 5AQTB 2C5JA 4HFHA 2KWIB 2YINA 3N2GE 1MMGA 3L3PA 4KX6A 2E2AA 3N9MA 5JDFA 2X9YA 4PK4A 2V6YB 4DNDA 5IUXA 4BJMA 2HH7A 2WDRA 2V7KA 3PU8A 2VWAA 5JDMA 3IBPA 4BJNA 4TN7B 4AKLA 3JCFA 3M3ZB 3AE5A 3RYFE 1FEWA 4DR1T 3E08A 2VQET 4KUMB 5KX5E 3H3MA 3N9QA 4LF7T 1JNZA 2XTLA 3AA1B 4HWCA 4MALA 2IC6A 2ZM0A 2Q9QD 3OYZA 5IHYA 1FIOA 3LDQB 5H6QB 5LXTE 2NW9A 2AE9A 2LSIA 3SRZA 3W15B 3FZFB 5AQPB 1YD8G 3AAIA 4OYJA 4NUVA 1B7TA 2L3LA 4TWHA 4ZS2A 5HEGA 1VOMA 3I0QA 3ZSTA 4LFAT 5LHIB 5HEHA 3R6NA 1D0XA 1LVKA 3LSVA 3ABVA 2H7VC 4O2AE 5LBMA 3BK9A 3Q5EA 3AEGA 2UUAT 5AQHB 2X66A 3UUXB 5JR9B 3AEBA 3HKEE 5DQVA 5J2UE 2F4VT 3KBUA 3ZMZB 1NEKA 5HXSA 3AAEB 2X51A 3AA7B 3RF1A 5LMNT 2G0UA 3WI3A 5LJMA 3AB3B 3I9WA 3NZQA 1YKHB 2JQKA 2DCFA 4HFBA 2WU2A 4CN6A 1U4QA 5HCMA 3VR9A 4LF4T 4YJ2E 4DR7T 1KEYA 1IBMT 2NW8A 2CRBA 5HYAA 4C90A 3UQ7A 3AA6B 4UIGA 4H9OC 4HGAA 2PTFA 4ZOLE 4B3RT 2XSAA 4DUZT 4HTEA 4JEUB 1IJ6A 3PV0F 3VKHA 1UX4A 2MTQA 2LKHA 2JQHA 3AE9A 2VKOA 3JC6C 2Y48B 1WRDA 2WQYA 2V7LA 4DVDA 4JEHB 2NWBA 3OVUA 3OYXA 5H6RB 4KHPT 3RHWA 2XAFB 4XBFB 5HAXA 4N78D 2W0GA 2E9XB 2JJ9A 5J0ZA 2X68A 3NWIA 3MKDA 3CPZA 2I59A 3FHNA 2I0MA 2LJLA 4EIWA 3KV9A 1GQEA 2X0HA 4DR2T 2EHOD 2JRKA 2X0LB 4YSZA 3RRCA 3O1JA 1OWAA 2CXLA 1Z8UA 4XAXB 3V5UA 3RC3A 2KT9A 3RI5A 1FMWA 3ZCIA 1MIWA 3NZPA 5HXEA 2KWHA 4GK0E 2K24A 3ZPOA 4ZI2C 4I55E 3AEEA 2J62A 3ZMVB 3B57A 1HTJF 3MZKB 4LMJA 2BBHA 4GKJT 3AA0B 1T72A 4CI2B 2NR4A 5LCYA 3ONXA 3M65A 2LHRA 1XDPA 3I9YA 5AFUL 4EZHA 1HNWT 4LF5T 1US7B 3C51A 2XASB 3ONJA 4IL9A 4JV5T 2BKOA 2W61A 1YW0A 3ZMTB 5AQKB 4YHHT 2QYWA 4IDPA 2DLRA 3U3IA 4LF9T 2ZLYA 4IDZA 2CMRA 3EABA 2KMFA 4CXXA 2NTYA 3ZCJA 4HWIB 2V26A 2ACZA 3AE7A 2Y6XA 3UULA 2W66A 5AQVB 5E0OA 3OPCA 4DBQA 3K1SA 4PJNA 2XAQB 2CBIA 4GIWA 2CHOA 2FJDA 3N5LA 3G06A 2MYSA 4CXYA 4AKIA 4IE0A 2WU5A 2VKJA 1IBKT 3FBZA 5C2TA 3AEDA 2K3WA 4PAGA 1YQ3A 2WWUA 3KFWX 5LOVE 5AQNB 5IWAT 1IBLT 1OEDA 4IL4A 2WZIA 3JAFA 4B3TT 3V5SA 3BQKA 3VRBA 4DR4T 5J2TE 4ZI3C 4JI0T 5L2LA 4JBWF 3AAAB 4TWFA 4C91A 3PUSA 1NAFA 4TZ4C 3ZYKA 2E5VA 4GYRA 4JI3T 3BQIA 3CMLA 3IEEA 3J7Yq 5FMNA 1O3XA 5CB4E 3ZJ2A 4ILBA 1ZEEA 5GONE 2XHEB 4L5GA 2LT3A 3UUMA 4CZZB 5JR9C 3VKGA 3NVOA 5JQGE 2KZ7B 3AEAA 3RYHE 3CKDA 2XJ7A 4ZS3A 4X1YE 5AQSB 2VVNA 3TLWA 5FY7A 3P8CD 2HPLA 5FKYA 3ZEFB 1IAPA 3SOLA 2VB6A 1T7SA 3TLTA 4X65T 4PK6A 2IIUA 2XQ4A 3ZC1A 2J1DG 4H9RC 3RYCE 4MBQA 3SWHA 5FNVE 4O2BE 2VKHA 4DV3T 2YDRA 5C3JA 5FXWA 4KP3C 4U2YA 1KNPA 3N9NA 2KXPB 3C4XA 2WP9A 2BG9E 2DL1A 4X1KE 3BQLA 3TKLB 2LSGA 3HKCE 2W67A 2JMKA 5FVLA 1NWMX 4UEMA 2LOPA 5LHGB 4PW8A 3PUAA 2RPAA 3PUZF 4HWHA 4UELA 1DU2A 2LSYA 2HHHT 3ANWA 1UGOA 4OFZA 4F6RC 2XQ6A 2XQYA 5L3CB 3RIFA 4PFPA 2ZMAA 1HG2A 4QXCB 3RKGA 2KNDA 2V6YA 4X62T 4UR9A 4CXWA 2H88A 2PG8A 4YTPA 4BA9A 3EDUA 4DV1T 2BKPA 3JAEA 4Z91A 3GWHA 5F3JA 4GKKT 1CHUA 3AE8A 2K9AA 3Q5WA 5CGMA 2XM1A 3ZN1B 3ZT5A 2CE7A 5HXHA 4OHFA 4IE4A 3ESLA 3L8RA 3C4ZA 3K3OA 1MMAA 4JI7T 5F5WA 3ETUA 5CA0E 2IUBA 2ES0A 4TUYE 1KFYA 1QUUA 4EEDA 2XSBA 2XQ3A 5L3BB 3EDVA 5LG3A 4IE7A 2E8IA 5M4YA 2OA5A 2UXDT 2C0SA 2WMNA 4EGWA 4CN4A 2V5DA 3SS1A 5FXZA 1KNRA 4GYSA 2LOSA 3QNUA 3SFDA 3NBXX 1HX1B 3UU4A 2N2NA 1J5WA 3AXJB 3OBVE 2ZM2A 5JR9A 4YY3T 4U7YA 2DWKA 3C50A 1W09A 2Q9QC 4AXPA 1MMNA 2LHNA 4DR6T 3LJCA 2OLTA 2W00A 5ETWA 1ZP0A 3AECA 1U5PA 2WBLA 3UT5E 3FXDB 3ZLIA 1VCTA 2VL0A 3PJAA 3RC8A 2WY2A 2VQFT 2XAJB 3ZJ1A 3CK6A 4TNWA 3WAKA 2JPFA 4TWDA 5FXVA 1YKEB 2XY8B 3GN5A 4QX7B 1UCUA 5FVKA 3C4WA 2SPCA 3PU3A 5LGUB 4YXDA 1LKXA 5AQJB 3O9XA 5BMVE 2XQ9A 4IDNA 3QK6A 3EI0A 4TNVA 2QGSA 4IHJE 3CQGB 3KVAA 2CWYA 5LBQB 4NPPA 2E9XA 3GN5B 1I94T 3CX8B 1ZV4X 3GA8A 2CWOA 3P4PA 2XQAA 4HKAA 4AI6A 4OX9T 4CI1B 3N2OA 2CCQA 2IMLA 2LRKA 4QWNB 1WYCA 2BDEA 1SUMB 1HR0T 4X66T 2ODVA 3UU6A 3A7MA 2MAWA 1BR2A 4HEAA 2RP4A 3CWZB 4NXMT 2XQ7A 5LHHB 4UVBB 4Q25A 3CX6B 4KBMB 5AQRB 2DHRA 3HI2A 2K5BB 4B3MT 2V5CA 4HE8A 3QOFA 3N9LA 1WYBA 1IJ5A 1MIVA 2X9XA 4U74A 3ZC0A 5AQMB 3P4QA 2BS4A 3CQXC 2WS3A 4G63A 2JQQA 4L0RA 1G8XA 3RKOA 4HFCA 4X5TA 2FJEA 2LEHA 2EHOC 4ILAA 3VR8A 4JYAT 1EZ3A 2LLYA 4ADZA 2CEAA 2XQ5A 1W0BA 2CA5A 3E22E 1H7CA 3ZYLA 3AE6A 3ZN0B 2W63A 5LGNB 3DTOA 1UK5A 2Q9QA 4WBOA 5AQGB 1R8IA 1MNDA 4OYKA 1UUSA 4QH1A 4O8SA 3RRWA 3ZT7A 4ZEYA 2MOZA 5F8PA 2V7MA 3RX6A 1WFDA 3PUXF 1X79A 1J5ET 1M62A 4GOUA 2WSSV 3RIUC 4IIJE 2Q9QB 2LM9A 2IAKA 3P4WA 3AE3A 5HEOA 2H3RA 3KINB 5EK3A 2HPJA 2YK0A 3HKDE 4O4HE 2ODUA 5LA6E 4DV2T 4Z90A 4MLKA 4YSXA 5L4EA 4AQGA 2A2FX 2D2SA 2YDSA 3L09A 2LE8A 3A8YC 5HWXA 1JNRA 2UUBT 2X67A 4EZ4A 1WR0A 1MIYA 2B76A 1WCRA 3PUQA 4E7SA 3UUBA 4LFBT 2V1DB 1N34T 4IDQA 4O4JE 1N32T 4H9SE 1G73A 2D9DA 2NOXA 3TLSA 5L47A 2H7OA 2CLYC 4H63H 5EZYE 1KK7A 4LF6T 1HNXT 4YFSA 2BG9C 3NKZA 1KF6A 5FYMA 3RYIE 3CQCB 4U3CA 2VVSA 2YEVC 3PUVF 4NIQA 4L9IA 1E2AA 3Q2MA 4IT4A 3UUNA 2X9HA 2BS3A 1QSDA 2WB5A 4IE6A 1CUNA 2VK9A 4V1Av 2WZHA 4PFOA 2E5LT 5FL1A 2D0UA 2X0YA 3FZKB 1LVFA 1OXZA 3AE1A 4DR3T 3RQUA 4AQYT 3E0ZA 3C98B 3ZYMA 3PUGA 5ABGA 4I4TE 2L9QA 1T98A 2N1GA 4UV9B 2PBIA 1YQ4A 4K0UA 2EHOA 4FJOA 4YJ3E 3T8OA 1QLBA 1S94A 4IE5A 3T1YT 2BS2A 2JMHA 4UXNB 4WYVA 2W62A 3J9X1 3LK3B 3H37A 3L39A 1SE7A 5AQOB 4EYYR 4DMWA 5HXCA 3LK2B 2EHOB 5HEUA 3IF8B 3EHZA 4MFRA 3KDSE 2W2UA 4HWDA 5DJQC 2C5KT 5DQWA 2E9XD 3UQ4A 3KV5A 2CHNA 4QH4A 1XWMA 4JLEA 4YLHA 4H63V 4J2CA 3KV6A 4ZI7E 3P4RA 2PJQA 5CA1E 2ACXA 1XMQT 1ZOYA 4PK5A 4LF8T 3MJXA
chains in the Genus database with same CATH topology
5LMUT 4DV0T 4LF4T 2UXBT 2VQFT 4B3MT 2VQET 4DR7T 2E5LT 1IBMT 4JI7T 4DV3T 5IWAT 4JI6T 4LF7T 1IBLT 4X64T 4DV2T 4DR3T 4JI1T 4AQYT 1XNQT 4DR5T 4DV5T 4GKJT 4B3TT 4DR4T 1XMOT 1N33T 4B3RT 4DUZT 4JI0T 4DV4T 5BR8T 4B3ST 4JI4T 2UUBT 3T1YT 4LFCT 4JI3T 2ZM6T 1XNRT 4JYAT 2UXDT 1HNWT 4LF5T 4JI5T 4LFAT 4JV5T 4DV7T 4KHPT 4LFBT 2UU9T 2HHHT 4YHHT 4DUYT 1I94T 1N34T 4LF9T 1N32T 1HNZT 2UUCT 4YY3T 2UUAT 4OX9T 4JI8T 4DV6T 2UXCT 4LF6T 4X62T 1HNXT 4NXNT 4DR6T 1N36T 4DR2T 4K0KT 2F4VT 1HR0T 4DV1T 4X66T 3T1HT 4GKKT 1FJGT 4X65T 1XMQT 4NXMT 5LMNT 1J5ET 4LF8T 1IBKT 4DR1T 4JI2T 3OTOT
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5LMU T;  4DV0 T;  4LF4 T;  2UXB T;  2VQF T;  4B3M T;  2VQE T;  4DR7 T;  2E5L T;  1IBM T;  4JI7 T;  4DV3 T;  5IWA T;  4JI6 T;  4LF7 T;  1IBL T;  4X64 T;  4DV2 T;  4DR3 T;  4JI1 T;  4AQY T;  1XNQ T;  4DR5 T;  4DV5 T;  4GKJ T;  4B3T T;  4DR4 T;  1XMO T;  1N33 T;  4B3R T;  4DUZ T;  4JI0 T;  4DV4 T;  5BR8 T;  4B3S T;  4JI4 T;  2UUB T;  3T1Y T;  4LFC T;  4JI3 T;  2ZM6 T;  1XNR T;  4JYA T;  2UXD T;  1HNW T;  4LF5 T;  4JI5 T;  4LFA T;  4JV5 T;  4DV7 T;  4KHP T;  4LFB T;  2UU9 T;  2HHH T;  4YHH T;  4DUY T;  1I94 T;  1N34 T;  4LF9 T;  1N32 T;  1HNZ T;  2UUC T;  4YY3 T;  2UUA T;  4OX9 T;  4JI8 T;  4DV6 T;  2UXC T;  4LF6 T;  4X62 T;  1HNX T;  4NXN T;  4DR6 T;  1N36 T;  4DR2 T;  4K0K T;  2F4V T;  1HR0 T;  4DV1 T;  4X66 T;  3T1H T;  4GKK T;  1FJG T;  4X65 T;  1XMQ T;  4NXM T;  5LMN T;  1J5E T;  4LF8 T;  1IBK T;  4DR1 T;  4JI2 T;  3OTO T; 
#chains in the Genus database with same CATH topology
 2WDV A;  3FXE B;  1J1J A;  2UXB T;  2BVL A;  3AE2 A;  4JI6 T;  1D0Z A;  4HN9 A;  2V8S V;  5ABF A;  4AQF C;  1WLX A;  2LKG A;  1MNE A;  2Z6E A;  4UVA B;  1E1H B;  3P7I A;  5BR8 T;  5AQQ B;  1AJ3 A;  3ZT6 A;  2XAH B;  4YTN A;  1M7K A;  2FUP A;  5J1G A;  4YTM A;  4P0A A;  4AKG A;  4PJM A;  2AXD S;  5ABF B;  4X20 E;  4P1N A;  2UU9 T;  3AXJ A;  5LYJ E;  4HFI A;  4A56 A;  5L3E B;  3O4X E;  2FBW A;  4EXT A;  2UUC T;  5HWY A;  2YU1 A;  3UU5 A;  2V6X A;  2Y8D A;  4DID B;  4KI0 F;  2BG9 A;  4ERR A;  1BR0 A;  3P4S A;  5ADX L;  2YKS A;  4Z8X A;  5HEJ A;  1SHZ C;  1Y01 A;  4ZZB A;  3B13 A;  3IHR A;  4GK5 E;  3NRX A;  2W4X A;  1FJG T;  4U31 A;  2YOE A;  4QXH B;  1D1B A;  2PFV A;  2CLY B;  3ONL C;  4AKR B;  1L0V A;  4DV0 T;  5FY0 A;  4EOZ B;  4QXB B;  2BG9 B;  4WW0 A;  3DP7 A;  4EEB A;  4CI3 B;  4E7Z A;  4I43 B;  3RLF F;  1N33 T;  4DV4 T;  4B6X A;  3QB5 A;  3PUY F;  3Q9D A;  1XDO A;  3R84 B;  5DAB A;  2LSJ A;  3RIA A;  4JI5 T;  2BBJ A;  4A97 A;  2CPT A;  2VKD A;  3Q5D A;  3ZSS A;  5AQF B;  4DUY T;  5L3D B;  3VHL A;  1HNZ T;  3MAC A;  2IC9 A;  2XQ8 A;  3UU3 A;  3VU7 H;  3LFM A;  5TAO A;  3PJA J;  3PTR B;  2HN1 A;  2KIN B;  3P50 A;  3I0O A;  2NW7 A;  3UFE A;  5FY1 A;  3FZH B;  3Q5X A;  4ILC A;  2M67 A;  1E7P A;  2VL8 A;  3JC6 D;  3ZMS B;  2DWG A;  2K48 A;  2IHR 1;  1OED C;  5L4H A;  2CBJ A;  2MBG A;  5ABE A;  1UX5 A;  2KLQ A;  1ZHC A;  2RA1 A;  2B1E A;  2UXX B;  2WAU A;  4U72 A;  5EK4 A;  5FXX A;  3AVS A;  3O1I A;  4IRE A;  3KV4 A;  4X64 T;  4YSY A;  2I6H A;  4QX8 B;  4AQF A;  4JI1 T;  5JRE A;  2X9W A;  1VRB A;  1NEN A;  3OKQ A;  2HN2 A;  4H9Q C;  2UXN B;  1V9D A;  3LK4 2;  4HFV A;  3SFE A;  4LFC T;  2WM9 A;  3UFG A;  4HWF A;  2ZM6 T;  5L3F B;  2OV9 A;  2J4G A;  5CFB A;  4PJJ A;  5FL0 A;  4LMK A;  2D0T A;  4ZI2 D;  3RGL A;  4DV7 T;  5IYZ E;  2YN6 A;  2QVA A;  3RH3 A;  2V7I A;  3N2K E;  5LJN A;  2GK9 A;  1OED E;  1IZN B;  2BZB A;  2KSR A;  4MHC A;  3PUR A;  4EAH A;  3F31 A;  4I50 E;  5EK2 A;  5JDN A;  4ZZC A;  2UXC T;  5JDL A;  1YXR A;  5LB7 B;  4NXN T;  1VCS A;  2VAS A;  4WNK A;  1N36 T;  3LG7 A;  4PJL A;  4K0K T;  4X1I E;  3T1H T;  2WMO A;  1Y64 B;  4WBN E;  3ZMU B;  5HCJ A;  1D1C A;  1W0A A;  2WWV A;  4EB6 E;  4HFD A;  2XAG B;  3ETV A;  4XZC A;  3MK7 C;  3RPU A;  3EVY A;  3FZL B;  3KBT A;  4ISS A;  4P09 A;  3K8P C;  2BVM A;  4YHJ A;  3N9O A;  3FB2 A;  4COF A;  1UUR A;  5KMG P;  4DR5 T;  4DV5 T;  2M6I A;  4QHO A;  4A98 A;  1D0Y A;  5JVD E;  4ZHQ E;  5HXR A;  3PDY A;  4UV8 B;  4B3S T;  2FJA A;  2NTX A;  4CN1 A;  5CJ5 A;  3VRA A;  4BAY B;  1HS7 A;  3EUH A;  3HR0 A;  3OJA A;  3B5M A;  4ASK A;  4KMC A;  3ZKR A;  2D5U A;  4TX5 A;  4KHZ F;  2CXF A;  1MMD A;  2A3D A;  5LG4 A;  1BR4 A;  2VUR A;  4TV9 E;  1D1A A;  2L8K A;  5JDH A;  4JI8 T;  3F2E A;  4ZI3 D;  4G2A A;  2YU2 A;  3K3Q C;  2CM0 A;  2P9B A;  1XZY A;  4IGU A;  5JRC A;  4IST A;  4EV6 A;  1I6Z A;  4I0U A;  4H9P C;  3QC9 A;  1HF8 A;  2M6B A;  3UTK A;  3FZM B;  1HCI A;  3O1H A;  1HX8 A;  2DI4 A;  2JIW A;  5LGT B;  2LRL A;  3AE4 A;  2C5I T;  2IDO B;  3OTO T;  4DMV A;  3HL6 A;  3X1D A;  1ZKE A;  2LM2 A;  2WDQ A;  2N9D A;  1WR6 A;  1Z0P A;  5JRC B;  4IDO A;  4WZX A;  3LBX A;  1XNQ T;  4FI5 A;  1BR1 A;  3AEF A;  4P0B A;  4OK0 A;  1OED B;  2MPK A;  3MA9 A;  3DJB A;  5LP6 E;  1SA0 E;  3FBL A;  1XMO T;  3IA3 A;  2XZE A;  4QH5 A;  2CXD A;  5JDQ A;  2J47 A;  3CX7 B;  5L3G B;  3I1A A;  3RQW A;  4JI4 T;  5JTG A;  4UVC B;  1XNR T;  3N9P A;  5JDG A;  2ZM8 A;  1HG5 A;  5AQI B;  3QB5 K;  4AKH A;  3WAJ A;  2A72 A;  2QRX A;  2A9U A;  3GMI A;  3LBX B;  4HFE A;  4ZXL A;  1FMV A;  2BKN A;  1LRZ A;  4DV6 T;  2JQ9 A;  3D0T A;  4U33 A;  2LSK A;  3CIR A;  4UF0 A;  4O4L E;  1S35 A;  3QUJ A;  4H9N C;  4ILU A;  3K3N A;  1KNZ A;  5JH7 E;  3MXZ A;  2DNX A;  4O4I E;  3F57 A;  5FP3 A;  4NUU A;  5KXJ A;  2R6G F;  4JI2 T;  2XUE A;  2XPK A;  3C64 A;  5LMU T;  3PUW F;  4UF0 B;  4AIS A;  2IW5 B;  5ABH A;  5KDM C;  2XM2 A;  4ANJ A;  2H89 A;  3TLV A;  4EYU A;  2NP9 A;  1T8B A;  4M1P A;  3HA4 A;  5AQU B;  1W9R A;  3RIU A;  4AIU A;  3PE0 A;  3NRY A;  3KVB A;  1HFA A;  1X9B A;  2V7J A;  3H3A A;  2E9X C;  4F8H A;  2WCA A;  3EAM A;  5AQL B;  3TLU A;  3CVR A;  3S4U A;  2QA7 A;  4A5X A;  5A1L A;  3HKB E;  5LNK A;  2YDQ A;  4JUY A;  4TV8 E;  4PNI A;  2FJB A;  3UU8 A;  3AVR A;  3A5X A;  4CQI A;  4DO0 A;  3ANW B;  3JAD A;  4U2Z A;  4YT0 A;  4QKN A;  5C8Y E;  4DBR A;  4U7I A;  3U78 A;  4LML A;  5AQT B;  2C5J A;  4HFH A;  2KWI B;  2YIN A;  3N2G E;  1MMG A;  3L3P A;  4KX6 A;  2E2A A;  3N9M A;  5JDF A;  2X9Y A;  4PK4 A;  2V6Y B;  4DND A;  5IUX A;  4BJM A;  2HH7 A;  2WDR A;  2V7K A;  3PU8 A;  2VWA A;  5JDM A;  3IBP A;  4BJN A;  4TN7 B;  4AKL A;  3JCF A;  3M3Z B;  3AE5 A;  3RYF E;  1FEW A;  4DR1 T;  3E08 A;  2VQE T;  4KUM B;  5KX5 E;  3H3M A;  3N9Q A;  4LF7 T;  1JNZ A;  2XTL A;  3AA1 B;  4HWC A;  4MAL A;  2IC6 A;  2ZM0 A;  2Q9Q D;  3OYZ A;  5IHY A;  1FIO A;  3LDQ B;  5H6Q B;  5LXT E;  2NW9 A;  2AE9 A;  2LSI A;  3SRZ A;  3W15 B;  3FZF B;  5AQP B;  1YD8 G;  3AAI A;  4OYJ A;  4NUV A;  1B7T A;  2L3L A;  4TWH A;  4ZS2 A;  5HEG A;  1VOM A;  3I0Q A;  3ZST A;  4LFA T;  5LHI B;  5HEH A;  3R6N A;  1D0X A;  1LVK A;  3LSV A;  3ABV A;  2H7V C;  4O2A E;  5LBM A;  3BK9 A;  3Q5E A;  3AEG A;  2UUA T;  5AQH B;  2X66 A;  3UUX B;  5JR9 B;  3AEB A;  3HKE E;  5DQV A;  5J2U E;  2F4V T;  3KBU A;  3ZMZ B;  1NEK A;  5HXS A;  3AAE B;  2X51 A;  3AA7 B;  3RF1 A;  5LMN T;  2G0U A;  3WI3 A;  5LJM A;  3AB3 B;  3I9W A;  3NZQ A;  1YKH B;  2JQK A;  2DCF A;  4HFB A;  2WU2 A;  4CN6 A;  1U4Q A;  5HCM A;  3VR9 A;  4LF4 T;  4YJ2 E;  4DR7 T;  1KEY A;  1IBM T;  2NW8 A;  2CRB A;  5HYA A;  4C90 A;  3UQ7 A;  3AA6 B;  4UIG A;  4H9O C;  4HGA A;  2PTF A;  4ZOL E;  4B3R T;  2XSA A;  4DUZ T;  4HTE A;  4JEU B;  1IJ6 A;  3PV0 F;  3VKH A;  1UX4 A;  2MTQ A;  2LKH A;  2JQH A;  3AE9 A;  2VKO A;  3JC6 C;  2Y48 B;  1WRD A;  2WQY A;  2V7L A;  4DVD A;  4JEH B;  2NWB A;  3OVU A;  3OYX A;  5H6R B;  4KHP T;  3RHW A;  2XAF B;  4XBF B;  5HAX A;  4N78 D;  2W0G A;  2E9X B;  2JJ9 A;  5J0Z A;  2X68 A;  3NWI A;  3MKD A;  3CPZ A;  2I59 A;  3FHN A;  2I0M A;  2LJL A;  4EIW A;  3KV9 A;  1GQE A;  2X0H A;  4DR2 T;  2EHO D;  2JRK A;  2X0L B;  4YSZ A;  3RRC A;  3O1J A;  1OWA A;  2CXL A;  1Z8U A;  4XAX B;  3V5U A;  3RC3 A;  2KT9 A;  3RI5 A;  1FMW A;  3ZCI A;  1MIW A;  3NZP A;  5HXE A;  2KWH A;  4GK0 E;  2K24 A;  3ZPO A;  4ZI2 C;  4I55 E;  3AEE A;  2J62 A;  3ZMV B;  3B57 A;  1HTJ F;  3MZK B;  4LMJ A;  2BBH A;  4GKJ T;  3AA0 B;  1T72 A;  4CI2 B;  2NR4 A;  5LCY A;  3ONX A;  3M65 A;  2LHR A;  1XDP A;  3I9Y A;  5AFU L;  4EZH A;  1HNW T;  4LF5 T;  1US7 B;  3C51 A;  2XAS B;  3ONJ A;  4IL9 A;  4JV5 T;  2BKO A;  2W61 A;  1YW0 A;  3ZMT B;  5AQK B;  4YHH T;  2QYW A;  4IDP A;  2DLR A;  3U3I A;  4LF9 T;  2ZLY A;  4IDZ A;  2CMR A;  3EAB A;  2KMF A;  4CXX A;  2NTY A;  3ZCJ A;  4HWI B;  2V26 A;  2ACZ A;  3AE7 A;  2Y6X A;  3UUL A;  2W66 A;  5AQV B;  5E0O A;  3OPC A;  4DBQ A;  3K1S A;  4PJN A;  2XAQ B;  2CBI A;  4GIW A;  2CHO A;  2FJD A;  3N5L A;  3G06 A;  2MYS A;  4CXY A;  4AKI A;  4IE0 A;  2WU5 A;  2VKJ A;  1IBK T;  3FBZ A;  5C2T A;  3AED A;  2K3W A;  4PAG A;  1YQ3 A;  2WWU A;  3KFW X;  5LOV E;  5AQN B;  5IWA T;  1IBL T;  1OED A;  4IL4 A;  2WZI A;  3JAF A;  4B3T T;  3V5S A;  3BQK A;  3VRB A;  4DR4 T;  5J2T E;  4ZI3 C;  4JI0 T;  5L2L A;  4JBW F;  3AAA B;  4TWF A;  4C91 A;  3PUS A;  1NAF A;  4TZ4 C;  3ZYK A;  2E5V A;  4GYR A;  4JI3 T;  3BQI A;  3CML A;  3IEE A;  3J7Y q;  5FMN A;  1O3X A;  5CB4 E;  3ZJ2 A;  4ILB A;  1ZEE A;  5GON E;  2XHE B;  4L5G A;  2LT3 A;  3UUM A;  4CZZ B;  5JR9 C;  3VKG A;  3NVO A;  5JQG E;  2KZ7 B;  3AEA A;  3RYH E;  3CKD A;  2XJ7 A;  4ZS3 A;  4X1Y E;  5AQS B;  2VVN A;  3TLW A;  5FY7 A;  3P8C D;  2HPL A;  5FKY A;  3ZEF B;  1IAP A;  3SOL A;  2VB6 A;  1T7S A;  3TLT A;  4X65 T;  4PK6 A;  2IIU A;  2XQ4 A;  3ZC1 A;  2J1D G;  4H9R C;  3RYC E;  4MBQ A;  3SWH A;  5FNV E;  4O2B E;  2VKH A;  4DV3 T;  2YDR A;  5C3J A;  5FXW A;  4KP3 C;  4U2Y A;  1KNP A;  3N9N A;  2KXP B;  3C4X A;  2WP9 A;  2BG9 E;  2DL1 A;  4X1K E;  3BQL A;  3TKL B;  2LSG A;  3HKC E;  2W67 A;  2JMK A;  5FVL A;  1NWM X;  4UEM A;  2LOP A;  5LHG B;  4PW8 A;  3PUA A;  2RPA A;  3PUZ F;  4HWH A;  4UEL A;  1DU2 A;  2LSY A;  2HHH T;  3ANW A;  1UGO A;  4OFZ A;  4F6R C;  2XQ6 A;  2XQY A;  5L3C B;  3RIF A;  4PFP A;  2ZMA A;  1HG2 A;  4QXC B;  3RKG A;  2KND A;  2V6Y A;  4X62 T;  4UR9 A;  4CXW A;  2H88 A;  2PG8 A;  4YTP A;  4BA9 A;  3EDU A;  4DV1 T;  2BKP A;  3JAE A;  4Z91 A;  3GWH A;  5F3J A;  4GKK T;  1CHU A;  3AE8 A;  2K9A A;  3Q5W A;  5CGM A;  2XM1 A;  3ZN1 B;  3ZT5 A;  2CE7 A;  5HXH A;  4OHF A;  4IE4 A;  3ESL A;  3L8R A;  3C4Z A;  3K3O A;  1MMA A;  4JI7 T;  5F5W A;  3ETU A;  5CA0 E;  2IUB A;  2ES0 A;  4TUY E;  1KFY A;  1QUU A;  4EED A;  2XSB A;  2XQ3 A;  5L3B B;  3EDV A;  5LG3 A;  4IE7 A;  2E8I A;  5M4Y A;  2OA5 A;  2UXD T;  2C0S A;  2WMN A;  4EGW A;  4CN4 A;  2V5D A;  3SS1 A;  5FXZ A;  1KNR A;  4GYS A;  2LOS A;  3QNU A;  3SFD A;  3NBX X;  1HX1 B;  3UU4 A;  2N2N A;  1J5W A;  3AXJ B;  3OBV E;  2ZM2 A;  5JR9 A;  4YY3 T;  4U7Y A;  2DWK A;  3C50 A;  1W09 A;  2Q9Q C;  4AXP A;  1MMN A;  2LHN A;  4DR6 T;  3LJC A;  2OLT A;  2W00 A;  5ETW A;  1ZP0 A;  3AEC A;  1U5P A;  2WBL A;  3UT5 E;  3FXD B;  3ZLI A;  1VCT A;  2VL0 A;  3PJA A;  3RC8 A;  2WY2 A;  2VQF T;  2XAJ B;  3ZJ1 A;  3CK6 A;  4TNW A;  3WAK A;  2JPF A;  4TWD A;  5FXV A;  1YKE B;  2XY8 B;  3GN5 A;  4QX7 B;  1UCU A;  5FVK A;  3C4W A;  2SPC A;  3PU3 A;  5LGU B;  4YXD A;  1LKX A;  5AQJ B;  3O9X A;  5BMV E;  2XQ9 A;  4IDN A;  3QK6 A;  3EI0 A;  4TNV A;  2QGS A;  4IHJ E;  3CQG B;  3KVA A;  2CWY A;  5LBQ B;  4NPP A;  2E9X A;  3GN5 B;  1I94 T;  3CX8 B;  1ZV4 X;  3GA8 A;  2CWO A;  3P4P A;  2XQA A;  4HKA A;  4AI6 A;  4OX9 T;  4CI1 B;  3N2O A;  2CCQ A;  2IML A;  2LRK A;  4QWN B;  1WYC A;  2BDE A;  1SUM B;  1HR0 T;  4X66 T;  2ODV A;  3UU6 A;  3A7M A;  2MAW A;  1BR2 A;  4HEA A;  2RP4 A;  3CWZ B;  4NXM T;  2XQ7 A;  5LHH B;  4UVB B;  4Q25 A;  3CX6 B;  4KBM B;  5AQR B;  2DHR A;  3HI2 A;  2K5B B;  4B3M T;  2V5C A;  4HE8 A;  3QOF A;  3N9L A;  1WYB A;  1IJ5 A;  1MIV A;  2X9X A;  4U74 A;  3ZC0 A;  5AQM B;  3P4Q A;  2BS4 A;  3CQX C;  2WS3 A;  4G63 A;  2JQQ A;  4L0R A;  1G8X A;  3RKO A;  4HFC A;  4X5T A;  2FJE A;  2LEH A;  2EHO C;  4ILA A;  3VR8 A;  4JYA T;  1EZ3 A;  2LLY A;  4ADZ A;  2CEA A;  2XQ5 A;  1W0B A;  2CA5 A;  3E22 E;  1H7C A;  3ZYL A;  3AE6 A;  3ZN0 B;  2W63 A;  5LGN B;  3DTO A;  1UK5 A;  2Q9Q A;  4WBO A;  5AQG B;  1R8I A;  1MND A;  4OYK A;  1UUS A;  4QH1 A;  4O8S A;  3RRW A;  3ZT7 A;  4ZEY A;  2MOZ A;  5F8P A;  2V7M A;  3RX6 A;  1WFD A;  3PUX F;  1X79 A;  1J5E T;  1M62 A;  4GOU A;  2WSS V;  3RIU C;  4IIJ E;  2Q9Q B;  2LM9 A;  2IAK A;  3P4W A;  3AE3 A;  5HEO A;  2H3R A;  3KIN B;  5EK3 A;  2HPJ A;  2YK0 A;  3HKD E;  4O4H E;  2ODU A;  5LA6 E;  4DV2 T;  4Z90 A;  4MLK A;  4YSX A;  5L4E A;  4AQG A;  2A2F X;  2D2S A;  2YDS A;  3L09 A;  2LE8 A;  3A8Y C;  5HWX A;  1JNR A;  2UUB T;  2X67 A;  4EZ4 A;  1WR0 A;  1MIY A;  2B76 A;  1WCR A;  3PUQ A;  4E7S A;  3UUB A;  4LFB T;  2V1D B;  1N34 T;  4IDQ A;  4O4J E;  1N32 T;  4H9S E;  1G73 A;  2D9D A;  2NOX A;  3TLS A;  5L47 A;  2H7O A;  2CLY C;  4H63 H;  5EZY E;  1KK7 A;  4LF6 T;  1HNX T;  4YFS A;  2BG9 C;  3NKZ A;  1KF6 A;  5FYM A;  3RYI E;  3CQC B;  4U3C A;  2VVS A;  2YEV C;  3PUV F;  4NIQ A;  4L9I A;  1E2A A;  3Q2M A;  4IT4 A;  3UUN A;  2X9H A;  2BS3 A;  1QSD A;  2WB5 A;  4IE6 A;  1CUN A;  2VK9 A;  4V1A v;  2WZH A;  4PFO A;  2E5L T;  5FL1 A;  2D0U A;  2X0Y A;  3FZK B;  1LVF A;  1OXZ A;  3AE1 A;  4DR3 T;  3RQU A;  4AQY T;  3E0Z A;  3C98 B;  3ZYM A;  3PUG A;  5ABG A;  4I4T E;  2L9Q A;  1T98 A;  2N1G A;  4UV9 B;  2PBI A;  1YQ4 A;  4K0U A;  2EHO A;  4FJO A;  4YJ3 E;  3T8O A;  1QLB A;  1S94 A;  4IE5 A;  3T1Y T;  2BS2 A;  2JMH A;  4UXN B;  4WYV A;  2W62 A;  3J9X 1;  3LK3 B;  3H37 A;  3L39 A;  1SE7 A;  5AQO B;  4EYY R;  4DMW A;  5HXC A;  3LK2 B;  2EHO B;  5HEU A;  3IF8 B;  3EHZ A;  4MFR A;  3KDS E;  2W2U A;  4HWD A;  5DJQ C;  2C5K T;  5DQW A;  2E9X D;  3UQ4 A;  3KV5 A;  2CHN A;  4QH4 A;  1XWM A;  4JLE A;  4YLH A;  4H63 V;  4J2C A;  3KV6 A;  4ZI7 E;  3P4R A;  2PJQ A;  5CA1 E;  2ACX A;  1XMQ T;  1ZOY A;  4PK5 A;  4LF8 T;  3MJX A; 
#chains in the Genus database with same CATH homology
 5LMU T;  4DV0 T;  4LF4 T;  2UXB T;  2VQF T;  4B3M T;  2VQE T;  4DR7 T;  2E5L T;  1IBM T;  4JI7 T;  4DV3 T;  5IWA T;  4JI6 T;  4LF7 T;  1IBL T;  4X64 T;  4DV2 T;  4DR3 T;  4JI1 T;  4AQY T;  1XNQ T;  4DR5 T;  4DV5 T;  4GKJ T;  4B3T T;  4DR4 T;  1XMO T;  1N33 T;  4B3R T;  4DUZ T;  4JI0 T;  4DV4 T;  5BR8 T;  4B3S T;  4JI4 T;  2UUB T;  3T1Y T;  4LFC T;  4JI3 T;  2ZM6 T;  1XNR T;  4JYA T;  2UXD T;  1HNW T;  4LF5 T;  4JI5 T;  4LFA T;  4JV5 T;  4DV7 T;  4KHP T;  4LFB T;  2UU9 T;  2HHH T;  4YHH T;  4DUY T;  1I94 T;  1N34 T;  4LF9 T;  1N32 T;  1HNZ T;  2UUC T;  4YY3 T;  2UUA T;  4OX9 T;  4JI8 T;  4DV6 T;  2UXC T;  4LF6 T;  4X62 T;  1HNX T;  4NXN T;  4DR6 T;  1N36 T;  4DR2 T;  4K0K T;  2F4V T;  1HR0 T;  4DV1 T;  4X66 T;  3T1H T;  4GKK T;  1FJG T;  4X65 T;  1XMQ T;  4NXM T;  5LMN T;  1J5E T;  4LF8 T;  1IBK T;  4DR1 T;  4JI2 T;  3OTO T; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...