1N33T

Structure of the thermus thermophilus 30s ribosomal subunit bound to codon and near-cognate transfer rna anticodon stem-loop mismatched at the second codon position at the a site with paromomycin
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
99
structure length
99
Chain Sequence
b'RNLSALKRHRQSLKRRLRNKAKKSAIKTLSKKAIQLAQEGKAEEALKIMRKAESLIDKAAKGSTLHKNAAARRKSRLMRKVRQLLEAAGAPLIGGGLSA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S RIBOSOMAL RNA
publication title Selection of tRNA by the Ribosome Requires a Transition from an Open to a Closed Form
pubmed doi rcsb
molecule tags Ribosome
total genus 34
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 2002-10-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
T PF01649 Ribosomal_S20p Ribosomal protein S20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.110 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Ribosomal protein S20 1n33T00
4LF7T 4B3MT 2UXDT 4LF8T 4LF4T 5BR8T 1N33T 2ZM6T 4LF9T 4DV6T 4X62T 4DUZT 4JI5T 3T1YT 5IWAT 4X64T 4JI1T 5LMNT 4JI0T 4B3ST 4GKKT 4DR6T 4DV4T 2UUAT 2F4VT 1J5ET 4JI6T 1N34T 4DV7T 4B3RT 2UXCT 4X66T 4LFAT 4JYAT 4DR5T 4KHPT 4AQYT 4K0KT 1HNWT 3OTOT 4JI4T 4YHHT 4DV5T 4GKJT 4B3TT 1XNRT 1HR0T 4DR4T 1IBLT 2UU9T 4LFBT 4JI7T 4DV1T 4DV3T 1XMQT 2HHHT 2UXBT 1XMOT 4LF6T 4JI3T 4DR1T 4LF5T 4DV2T 4DUYT 1IBKT 2E5LT 1N36T 4DR2T 4X65T 4LFCT 2UUCT 4YY3T 1N32T 5LMUT 4DV0T 1IBMT 4DR7T 1FJGT 4DR3T 3T1HT 4JI8T 2UUBT 2VQET 2VQFT 4JV5T 4JI2T 4OX9T 1HNXT 4NXMT 4NXNT 1XNQT 1HNZT 1I94T
chains in the Genus database with same CATH superfamily
2AE9A 5JVDE 1VCTA 2Q9QB 4UV8B 1JNRA 4FJOA 1WR6A 3UULA 4TUYE 2WY2A 4QHOA 4A98A 2XZEA 4EB6E 4X64T 4TWHA 4CXXA 2LSYA 1G8XA 5HEOA 2CHNA 3ZMTB 3QB5A 3RYCE 4DV4T 3PTRB 5JREA 2JPFA 4X1YE 5HCMA 5J1GA 2VVSA 4QWNB 3J9X1 4LMLA 4X1KE 1Y01A 5JDLA 2LKGA 3UU4A 4HWIB 3PDYA 3AE7A 1XWMA 2X66A 4AQFA 3ONJA 2CBIA 3CK6A 4I0UA 2WU5A 2IW5B 4DR4T 4I4TE 5ETWA 3CX6B 4UIGA 2JMHA 2PTFA 2CA5A 4WW0A 2B1EA 1LRZA 3UUBA 2LLYA 2XQ6A 3GN5B 3ZMUB 1DU2A 4NPPA 2WWVA 2LOPA 2IHR1 5LGTB 2KINB 1U4QA 1HCIA 5FMNA 2UUBT 4OHFA 5FNVE 3Q2MA 5FYMA 2Y6XA 2NW8A 4GYRA 4WBOA 2H3RA 2ZMAA 3PUYF 3CQXC 4IDPA 2V6YA 3FXDB 1QSDA 2QYWA 5JH7E 2YDRA 5J2TE 3D0TA 1N33T 1WCRA 3SOLA 4DUZT 1W0AA 1WRDA 1AJ3A 4Q25A 1YKHB 2HN1A 3F2EA 1OEDA 4AKRB 1D1BA 4HFDA 3ZSTA 2BZBA 4ADZA 5L3GB 4HFVA 3JAFA 4JI6T 2JQKA 5AQGB 1UUSA 3O1JA 3RGLA 4U74A 4TV8E 3VKGA 2J62A 1LVFA 4U7YA 5CB4E 4AQYT 2BVLA 1X9BA 2V1DB 2Q9QA 3KFWX 5JDFA 2XQYA 1D0YA 3KINB 3KV4A 2OA5A 4YSYA 3V5UA 5KXJA 4ZI2D 1W0BA 4MLKA 4LMJA 4HTEA 2K3WA 2WBLA 4K0UA 3ZYKA 5EK2A 2H89A 3CIRA 2W63A 4LF6T 1SHZC 4AISA 4BJNA 1MIVA 3AEAA 3P4QA 5C8YE 3QUJA 4TN7B 2UXNB 3ZPOA 2YK0A 5JDHA 1HNXT 3LDQB 2R6GF 3EVYA 4HWFA 3IEEA 3RC8A 2HPJA 4HE8A 1NEKA 3Q5XA 2Y8DA 2WS3A 2KLQA 3UT5E 5CGMA 2NTXA 3AVSA 4A56A 5LYJE 5AFUL 5LBMA 4H9QC 3AE5A 3GN5A 4PJJA 4IE0A 1FEWA 2CEAA 3P4SA 4YSXA 2KWHA 4TNVA 2NW7A 3OBVE 4IE6A 3NWIA 1M62A 2EHOD 5LOVE 3Q5WA 3A8YC 3AE4A 4LMKA 5HEGA 3EHZA 4CN4A 2HPLA 3B5MA 5HEHA 2N9DA 3RIAA 4OYJA 3OPCA 5KDMC 3ZC1A 1XMOT 4HEAA 1CUNA 1BR1A 4ZEYA 4TX5A 4LFCT 3K3OA 3FZLB 3ONXA 2W62A 3AA7B 5HWYA 2I6HA 4GK5E 4C90A 5JDNA 2BS4A 3N9LA 5F8PA 5FP3A 4TNWA 2VQET 4JV5T 4JLEA 5AQPB 4PNIA 3QNUA 3HKBE 1XDPA 3ABVA 2J47A 4MFRA 1D1AA 3UFGA 2LJLA 3PUXF 2X0LB 4O8SA 4ZOLE 3M65A 5DJQC 4O4HE 3L39A 1HS7A 2CLYB 2X67A 1HFAA 3RRCA 3SRZA 2JQ9A 3E0ZA 4UV9B 3AA6B 2DWKA 4X1IE 4EXTA 5FXZA 5AQNB 4U31A 5H6RB 3CQGB 5LNKA 5FL0A 5KX5E 3C4XA 3BQLA 4MALA 4B3RT 4JEUB 3PV0F 4JYAT 4DR5T 3JADA 2YOEA 4HWDA 4AXPA 1EZ3A 3EUHA 3J7Yq 2JQHA 4YHJA 3ZN0B 5IUXA 4UXNB 4QXHB 3IA3A 4QX7B 2JQQA 4PW8A 3AE3A 1HX8A 5AQIB 3OJAA 4ZHQE 4ZXLA 4EYUA 4PFOA 1MNDA 3CX7B 4KX6A 2W00A 4JI3T 3RHWA 4ERRA 2W66A 3F31A 4EEDA 3R84B 1LVKA 3PUQA 4AI6A 4DBQA 4X65T 1E2AA 4EOZB 5IHYA 5CJ5A 3RX6A 4HKAA 3VU7H 2X0YA 1ZP0A 2P9BA 4E7ZA 5FVKA 3ETVA 2XUEA 3CVRA 1HTJF 4OFZA 1UK5A 5IWAT 4PK6A 1WLXA 5JR9C 4WNKA 4EYYR 2ODUA 2JJ9A 1LKXA 3ZMSB 5ABFB 5AQMB 2XQ4A 4GKKT 2YDQA 4KHZF 3WI3A 4DV7T 3K3QC 4ASKA 4AQGA 4PAGA 4UELA 3HI2A 3HR0A 3C51A 3UU5A 1I6ZA 5J0ZA 3U78A 2MAWA 2E8IA 4IDOA 1MNEA 2ODVA 3BQIA 5DQVA 2OV9A 2WAUA 2YN6A 1KNPA 3JC6C 3ZCIA 1YQ3A 2W4XA 2HHHT 3CQCB 2PBIA 3MXZA 2YU1A 5HXEA 1N36T 1FMWA 2FJBA 3I1AA 2DL1A 5AQLB 1FJGT 2LEHA 3RC3A 2XAHB 5JRCB 3T1HT 2XQ7A 5AQFB 3RF1A 1KFYA 2GK9A 1US7B 4DMWA 2KWIB 4CI3B 2Q9QD 1YW0A 5BMVE 2NTYA 3Q5EA 3U3IA 2L3LA 4CXWA 5C2TA 3SFEA 1B7TA 1UX5A 3FZKB 5LCYA 2YEVC 2WMOA 2YU2A 2VURA 4YTMA 2BBJA 3X1DA 3RI5A 4F6RC 2K48A 3N2KE 2WSSV 4HFIA 4XAXB 2FBWA 2H7VC 1T7SA 4I55E 4QX8B 4LFAT 3AE8A 1QLBA 3HKDE 3EAMA 1HNWT 3N9QA 3F57A 3AEDA 4YFSA 3TLWA 5AQTB 3UU3A 2I59A 2V7LA 3PUGA 3R6NA 3O9XA 2LM2A 3Q5DA 3TLVA 3BK9A 4B6XA 3QB5K 3GA8A 2ACZA 5ABFA 2WWUA 3AA0B 3K8PC 1IBKT 2BBHA 4NUUA 3ZT5A 5LG3A 4C91A 3LJCA 2X68A 2QRXA 1MIYA 2IAKA 2K5BB 3LBXB 4TV9E 3MZKB 3FHNA 4DR7T 4UF0B 5FVLA 2XTLA 1ZV4X 4PJNA 1NWMX 4IDQA 1J1JA 5LB7B 2A2FX 3ZN1B 1U5PA 5L2LA 2H88A 2E9XC 4CN1A 2V7IA 4EEBA 5BR8T 4H9NC 1T8BA 4H9SE 2CWYA 4QH4A 4AKGA 5LGUB 4KP3C 3NZQA 5JRCA 4BAYB 1HG2A 2LHRA 2JIWA 2CHOA 3ZSSA 3VRAA 2VWAA 4X66T 3CPZA 4JEHB 4ILUA 2SPCA 4IE4A 2A9UA 2IC9A 2LOSA 3ZCJA 4J2CA 2IC6A 2Z6EA 3P4PA 4DIDB 3C98B 1NENA 3GMIA 4X20E 5HEJA 3SS1A 5L47A 3N9PA 3NKZA 3RIUA 3UTKA 3N2GE 1ZKEA 2KMFA 3FBLA 2V6XA 4Z90A 3HL6A 2KZ7B 3RLFF 5L3BB 5LBQB 3TLUA 5AQJB 3H3AA 4XZCA 5GONE 4H63H 4ZI2C 5FXWA 1T72A 4EIWA 4JUYA 3TLSA 5E0OA 4G2AA 3DTOA 3HKEE 5JDMA 2LRLA 4JI5T 4ZI7E 2KSRA 2M6IA 2W0GA 2A3DA 3ZJ2A 5ABGA 2XAQB 3LBXA 5L3FB 4UF0A 3CMLA 1OEDE 3P7IA 3UU6A 2VL0A 5LXTE 2XQAA 4HFBA 2DLRA 4A97A 4CXYA 1O3XA 2NP9A 2X9WA 4CI1B 3K1SA 5JDGA 4HWHA 5LHHB 3WAJA 5HXHA 4DV1T 1SUMB 4O4LE 5TAOA 3NRXA 4IREA 1WFDA 2KNDA 2M67A 3CX8B 3FBZA 2V7KA 3AEGA 5LHIB 2NWBA 3JAEA 4HN9A 2MTQA 3AB3B 3RQWA 3ZKRA 4P0AA 4PJMA 3ZT6A 2EHOC 3K3NA 4U2YA 3TLTA 4ILCA 3FZMB 4ILAA 5A1LA 2C0SA 2UXXB 2CE7A 3V5SA 2Y48B 2YKSA 2BG9C 1JNZA 3I9WA 3RYHE 4AIUA 2RPAA 3FZHB 4AKIA 2FJAA 2XJ7A 2ZM2A 1E7PA 1UX4A 5FY7A 2XAGB 2VKDA 4XBFB 3P4WA 1YQ4A 1XDOA 2XSAA 3C4ZA 2X9HA 2NR4A 2BG9B 4GKJT 2J4GA 2C5KT 3MA9A 4LFBT 3N9MA 3AAEB 4U7IA 2WDVA 2V26A 3L3PA 3O1IA 1HG5A 4P0BA 4PK5A 2JRKA 1E1HB 2NOXA 1QUUA 2XPKA 4P1NA 2DHRA 4CI2B 5LA6E 2ES0A 5FY1A 2CXDA 4YJ2E 3AE2A 3B57A 3OYZA 1W9RA 4QKNA 1HF8A 2ACXA 4L5GA 4I50E 3RKGA 2LM9A 4IE7A 2WDQA 3SFDA 3SWHA 2UXDT 4JBWF 2W61A 2CRBA 5CA1E 4JI0T 2DNXA 3AE6A 3PJAA 4ZS3A 2XQ5A 3ZLIA 4IL4A 5FKYA 2ZLYA 3RQUA 2VB6A 4DR6T 2V5CA 3W15B 4ILBA 3RRWA 4PFPA 2LSJA 4I43B 4AQFC 4EGWA 3OTOT 1IZNB 2X9XA 3FXEB 3ZYLA 2N1GA 3ZJ1A 1XNRT 1IBLT 3LK3B 3JCFA 5M4YA 2UU9T 4DMVA 5CA0E 4KI0F 4EAHA 4YT0A 1Y64B 3AECA 4Z8XA 2XM1A 3PU8A 4ZI3C 4YTPA 1XZYA 2DCFA 3KV6A 5EK3A 4PK4A 5JR9B 4O2BE 4O2AE 2C5JA 3LSVA 2CPTA 1KEYA 4GIWA 2DWGA 5FXVA 2BG9A 1VOMA 4H9OC 3PU3A 5ABHA 3LFMA 1D1CA 1W09A 4U33A 1MMGA 4H9RC 1VCSA 2V8SV 4YLHA 4IT4A 2BKOA 3EI0A 4HGAA 1VRBA 2G0UA 1OEDC 1ZHCA 1L0VA 2PG8A 2XQ8A 2HH7A 2VKHA 2D0TA 4M1PA 5KMGP 3ESLA 3PUWF 3UQ4A 2LKHA 3NRYA 2UXCT 3KDSE 4CN6A 2CXLA 5H6QB 2WCAA 1ZEEA 1G73A 3VRBA 4UVCB 4JI4T 4YSZA 2QVAA 4DV5T 4ZZCA 3KV5A 2IUBA 2XY8B 4B3TT 3AAIA 4UEMA 5HXSA 2D2SA 2M6BA 4DR1T 3PE0A 4E7SA 4IDNA 2E5LT 1BR0A 3IHRA 2XHEB 1N32T 5AQKB 2LSKA 4HFCA 3L8RA 4L9IA 3NZPA 5JQGE 1YD8G 2PJQA 1J5WA 4EZHA 4IL9A 4OX9T 3P50A 3CWZB 3AEBA 3RKOA 2BVMA 2WDRA 1Z8UA 2XASB 3M3ZB 4DNDA 3MK7C 3A5XA 4B3MT 5F5WA 1WYBA 1Z0PA 1V9DA 4AKHA 3QOFA 3H3MA 4GK0E 1SE7A 1MMAA 1KNRA 5JR9A 4UVAB 2B76A 2XM2A 3L09A 4B3ST 3AVRA 3EDVA 2X9YA 3AEEA 2V5DA 1FIOA 3VKHA 2E9XD 4U72A 1OXZA 1S94A 3UUXB 4K0KT 2V7JA 2K9AA 3T8OA 1XMQT 2UXBT 4V1Av 3UUMA 2E9XB 2QGSA 3GWHA 3I0OA 2XAJB 4YY3T 4DV0T 2IDOB 3PUVF 1WYCA 4X5TA 4QXBB 4HFHA 4JI8T 2XAFB 4ISTA 2VQFT 1X79A 4NIQA 1ZOYA 3TKLB 5FL1A 3AA1B 4QH5A 1BR4A 3PUSA 1UURA 5J2UE 3AXJB 1BR2A 4YJ3E 5LHGB 2WP9A 4LF8T 2K24A 4NUVA 5EZYE 1UGOA 4X62T 5FXXA 4CZZB 4P09A 5AQVB 3ANWB 1R8IA 4WZXA 3AAAB 3ONLC 3UQ7A 3KV9A 3PJAJ 3DJBA 2UUAT 1N34T 4ANJA 3FB2A 2IMLA 4HWCA 1CHUA 4MHCA 4U2ZA 2PFVA 4FI5A 5DABA 2ZM0A 5AQQB 2MOZA 2CBJA 2XSBA 3KBTA 2LT3A 2DI4A 4DO0A 5F3JA 4H63V 2X51A 5ADXL 5LGNB 4BA9A 1SA0E 2I0MA 5HAXA 2WM9A 2LSGA 3MACA 1MMNA 4DUYT 1FMVA 2RP4A 3ZMVB 4IIJE 1OWAA 4YXDA 4DR3T 3B13A 2WB5A 3C50A 2FJDA 4EV6A 5AQRB 4WYVA 2KT9A 3A7MA 3AEFA 2L9QA 3ZEFB 3WAKA 2WMNA 1I94T 2C5IT 3H37A 4LF9T 4DV6T 2E9XA 3RYFE 5LG4A 2L8KA 3UFEA 4WBNE 2OLTA 4HFEA 5AQHB 2CM0A 1M7KA 5L4EA 1NAFA 4IDZA 2VL8A 3UU8A 3S4UA 2W2UA 2A72A 2QA7A 2F4VT 4UR9A 1HX1B 4U3CA 1IJ5A 1D0ZA 1MIWA 1MMDA 3QK6A 3AXJA 3MJXA 2CLYC 2CCQA 4IGUA 3OYXA 4EZ4A 2EHOB 2WZIA 1IAPA 3ZYMA 3AE1A 3MKDA 4JI7T 3LK42 1D0XA 4DV3T 3ANWA 4KUMB 1S35A 4LF5T 3VR8A 4L0RA 3PUAA 1KF6A 3C64A 2VK9A 4YTNA 2D5UA 4NXMT 4N78D 3I0QA 2CWOA 4NXNT 2BS2A 4QXCB 2V7MA 5JDQA 4LF7T 2MYSA 3IBPA 4LF4T 4H9PC 4KMCA 2FJEA 2NW9A 5LMNT 5L3EB 2CMRA 4UVBB 5HYAA 5L3DB 3NBXX 2LHNA 1KNZA 3I9YA 3RYIE 5LJMA 2D0UA 4CQIA 5IYZE 3E22E 4PJLA 3N5LA 4AKLA 2H7OA 4KHPT 4IE5A 3KVBA 2MBGA 2D9DA 1KK7A 2JMKA 4ZS2A 2MPKA 2WU2A 3O1HA 3UUNA 4BJMA 3C4WA 3HKCE 3CKDA 4IHJE 3OKQA 2ZM8A 2CXFA 3EDUA 3LG7A 3P4RA 2BKNA 2RA1A 2E2AA 1GQEA 4GYSA 4DR2T 2J1DG 3N9NA 2UUCT 2W67A 1YKEB 5LMUT 1IBMT 3IF8B 3O4XE 3KBUA 4MBQA 2BDEA 2XQ3A 3LK2B 4Z91A 1IJ6A 4TWFA 2WQYA 2E5VA 5C3JA 4TZ4C 2BS3A 3EABA 4JI2T 3FZFB 5HXRA 2X0HA 2EHOA 3QC9A 3BQKA 1XNQT 1WR0A 3ZMZB 4ZI3D 4TWDA 2ZM6T 3P8CD 4O4IE 3T1YT 5JTGA 2LSIA 3N9OA 5LP6E 1UCUA 4JI1T 3G06A 5EK4A 3JC6D 3ZT7A 2KXPB 5HCJA 2IIUA 2AXDS 3N2OA 3RPUA 3Q9DA 1J5ET 2VASA 5FY0A 3KVAA 1H7CA 2HN2A 2XQ9A 3ETUA 2YDSA 3AE9A 5LJNA 4YHHT 2N2NA 3ZC0A 4GOUA 5HXCA 4DBRA 1HR0T 3RH3A 2V6YB 4KBMB 2BKPA 3OVUA 3RIUC 5L3CB 1T98A 4COFA 2Q9QC 4DV2T 4ISSA 3HA4A 5AQSB 5CFBA 3PUZF 4OYKA 2FUPA 4ZZBA 4O4JE 3NVOA 3VHLA 5HEUA 1YXRA 3VR9A 4F8HA 1OEDB 5HWXA 5L4HA 3E08A 2VKJA 3DP7A 5ABEA 3RIFA 4OK0A 2VVNA 2VKOA 4A5XA 2WZHA 3PURA 4QH1A 4DVDA 2LE8A 2YINA 5DQWA 2LRKA 5AQUB 4G63A 2BG9E 1HNZT 5AQOB
chains in the Genus database with same CATH topology
4LF7T 4B3MT 2UXDT 4LF8T 4LF4T 5BR8T 1N33T 2ZM6T 4LF9T 4DV6T 4X62T 4DUZT 4JI5T 3T1YT 5IWAT 4X64T 4JI1T 5LMNT 4JI0T 4B3ST 4GKKT 4DR6T 4DV4T 2UUAT 2F4VT 1J5ET 4JI6T 1N34T 4DV7T 4B3RT 2UXCT 4X66T 4LFAT 4JYAT 4DR5T 4KHPT 4AQYT 4K0KT 1HNWT 3OTOT 4JI4T 4YHHT 4DV5T 4GKJT 4B3TT 1XNRT 1HR0T 4DR4T 1IBLT 2UU9T 4LFBT 4JI7T 4DV1T 4DV3T 1XMQT 2HHHT 2UXBT 1XMOT 4LF6T 4JI3T 4DR1T 4LF5T 4DV2T 4DUYT 1IBKT 2E5LT 1N36T 4DR2T 4X65T 4LFCT 2UUCT 4YY3T 1N32T 5LMUT 4DV0T 1IBMT 4DR7T 1FJGT 4DR3T 3T1HT 4JI8T 2UUBT 2VQET 2VQFT 4JV5T 4JI2T 4OX9T 1HNXT 4NXMT 4NXNT 1XNQT 1HNZT 1I94T
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4LF7 T;  4B3M T;  2UXD T;  4LF8 T;  4LF4 T;  5BR8 T;  1N33 T;  2ZM6 T;  4LF9 T;  4DV6 T;  4X62 T;  4DUZ T;  4JI5 T;  3T1Y T;  5IWA T;  4X64 T;  4JI1 T;  5LMN T;  4JI0 T;  4B3S T;  4GKK T;  4DR6 T;  4DV4 T;  2UUA T;  2F4V T;  1J5E T;  4JI6 T;  1N34 T;  4DV7 T;  4B3R T;  2UXC T;  4X66 T;  4LFA T;  4JYA T;  4DR5 T;  4KHP T;  4AQY T;  4K0K T;  1HNW T;  3OTO T;  4JI4 T;  4YHH T;  4DV5 T;  4GKJ T;  4B3T T;  1XNR T;  1HR0 T;  4DR4 T;  1IBL T;  2UU9 T;  4LFB T;  4JI7 T;  4DV1 T;  4DV3 T;  1XMQ T;  2HHH T;  2UXB T;  1XMO T;  4LF6 T;  4JI3 T;  4DR1 T;  4LF5 T;  4DV2 T;  4DUY T;  1IBK T;  2E5L T;  1N36 T;  4DR2 T;  4X65 T;  4LFC T;  2UUC T;  4YY3 T;  1N32 T;  5LMU T;  4DV0 T;  1IBM T;  4DR7 T;  1FJG T;  4DR3 T;  3T1H T;  4JI8 T;  2UUB T;  2VQE T;  2VQF T;  4JV5 T;  4JI2 T;  4OX9 T;  1HNX T;  4NXM T;  4NXN T;  1XNQ T;  1HNZ T;  1I94 T; 
#chains in the Genus database with same CATH topology
 2AE9 A;  5JVD E;  1VCT A;  2Q9Q B;  4UV8 B;  1JNR A;  4FJO A;  1WR6 A;  3UUL A;  4TUY E;  2WY2 A;  4QHO A;  4A98 A;  2XZE A;  4EB6 E;  4X64 T;  4TWH A;  4CXX A;  2LSY A;  1G8X A;  5HEO A;  2CHN A;  3ZMT B;  3QB5 A;  3RYC E;  4DV4 T;  3PTR B;  5JRE A;  2JPF A;  4X1Y E;  5HCM A;  5J1G A;  2VVS A;  4QWN B;  3J9X 1;  4LML A;  4X1K E;  1Y01 A;  5JDL A;  2LKG A;  3UU4 A;  4HWI B;  3PDY A;  3AE7 A;  1XWM A;  2X66 A;  4AQF A;  3ONJ A;  2CBI A;  3CK6 A;  4I0U A;  2WU5 A;  2IW5 B;  4DR4 T;  4I4T E;  5ETW A;  3CX6 B;  4UIG A;  2JMH A;  2PTF A;  2CA5 A;  4WW0 A;  2B1E A;  1LRZ A;  3UUB A;  2LLY A;  2XQ6 A;  3GN5 B;  3ZMU B;  1DU2 A;  4NPP A;  2WWV A;  2LOP A;  2IHR 1;  5LGT B;  2KIN B;  1U4Q A;  1HCI A;  5FMN A;  2UUB T;  4OHF A;  5FNV E;  3Q2M A;  5FYM A;  2Y6X A;  2NW8 A;  4GYR A;  4WBO A;  2H3R A;  2ZMA A;  3PUY F;  3CQX C;  4IDP A;  2V6Y A;  3FXD B;  1QSD A;  2QYW A;  5JH7 E;  2YDR A;  5J2T E;  3D0T A;  1N33 T;  1WCR A;  3SOL A;  4DUZ T;  1W0A A;  1WRD A;  1AJ3 A;  4Q25 A;  1YKH B;  2HN1 A;  3F2E A;  1OED A;  4AKR B;  1D1B A;  4HFD A;  3ZST A;  2BZB A;  4ADZ A;  5L3G B;  4HFV A;  3JAF A;  4JI6 T;  2JQK A;  5AQG B;  1UUS A;  3O1J A;  3RGL A;  4U74 A;  4TV8 E;  3VKG A;  2J62 A;  1LVF A;  4U7Y A;  5CB4 E;  4AQY T;  2BVL A;  1X9B A;  2V1D B;  2Q9Q A;  3KFW X;  5JDF A;  2XQY A;  1D0Y A;  3KIN B;  3KV4 A;  2OA5 A;  4YSY A;  3V5U A;  5KXJ A;  4ZI2 D;  1W0B A;  4MLK A;  4LMJ A;  4HTE A;  2K3W A;  2WBL A;  4K0U A;  3ZYK A;  5EK2 A;  2H89 A;  3CIR A;  2W63 A;  4LF6 T;  1SHZ C;  4AIS A;  4BJN A;  1MIV A;  3AEA A;  3P4Q A;  5C8Y E;  3QUJ A;  4TN7 B;  2UXN B;  3ZPO A;  2YK0 A;  5JDH A;  1HNX T;  3LDQ B;  2R6G F;  3EVY A;  4HWF A;  3IEE A;  3RC8 A;  2HPJ A;  4HE8 A;  1NEK A;  3Q5X A;  2Y8D A;  2WS3 A;  2KLQ A;  3UT5 E;  5CGM A;  2NTX A;  3AVS A;  4A56 A;  5LYJ E;  5AFU L;  5LBM A;  4H9Q C;  3AE5 A;  3GN5 A;  4PJJ A;  4IE0 A;  1FEW A;  2CEA A;  3P4S A;  4YSX A;  2KWH A;  4TNV A;  2NW7 A;  3OBV E;  4IE6 A;  3NWI A;  1M62 A;  2EHO D;  5LOV E;  3Q5W A;  3A8Y C;  3AE4 A;  4LMK A;  5HEG A;  3EHZ A;  4CN4 A;  2HPL A;  3B5M A;  5HEH A;  2N9D A;  3RIA A;  4OYJ A;  3OPC A;  5KDM C;  3ZC1 A;  1XMO T;  4HEA A;  1CUN A;  1BR1 A;  4ZEY A;  4TX5 A;  4LFC T;  3K3O A;  3FZL B;  3ONX A;  2W62 A;  3AA7 B;  5HWY A;  2I6H A;  4GK5 E;  4C90 A;  5JDN A;  2BS4 A;  3N9L A;  5F8P A;  5FP3 A;  4TNW A;  2VQE T;  4JV5 T;  4JLE A;  5AQP B;  4PNI A;  3QNU A;  3HKB E;  1XDP A;  3ABV A;  2J47 A;  4MFR A;  1D1A A;  3UFG A;  2LJL A;  3PUX F;  2X0L B;  4O8S A;  4ZOL E;  3M65 A;  5DJQ C;  4O4H E;  3L39 A;  1HS7 A;  2CLY B;  2X67 A;  1HFA A;  3RRC A;  3SRZ A;  2JQ9 A;  3E0Z A;  4UV9 B;  3AA6 B;  2DWK A;  4X1I E;  4EXT A;  5FXZ A;  5AQN B;  4U31 A;  5H6R B;  3CQG B;  5LNK A;  5FL0 A;  5KX5 E;  3C4X A;  3BQL A;  4MAL A;  4B3R T;  4JEU B;  3PV0 F;  4JYA T;  4DR5 T;  3JAD A;  2YOE A;  4HWD A;  4AXP A;  1EZ3 A;  3EUH A;  3J7Y q;  2JQH A;  4YHJ A;  3ZN0 B;  5IUX A;  4UXN B;  4QXH B;  3IA3 A;  4QX7 B;  2JQQ A;  4PW8 A;  3AE3 A;  1HX8 A;  5AQI B;  3OJA A;  4ZHQ E;  4ZXL A;  4EYU A;  4PFO A;  1MND A;  3CX7 B;  4KX6 A;  2W00 A;  4JI3 T;  3RHW A;  4ERR A;  2W66 A;  3F31 A;  4EED A;  3R84 B;  1LVK A;  3PUQ A;  4AI6 A;  4DBQ A;  4X65 T;  1E2A A;  4EOZ B;  5IHY A;  5CJ5 A;  3RX6 A;  4HKA A;  3VU7 H;  2X0Y A;  1ZP0 A;  2P9B A;  4E7Z A;  5FVK A;  3ETV A;  2XUE A;  3CVR A;  1HTJ F;  4OFZ A;  1UK5 A;  5IWA T;  4PK6 A;  1WLX A;  5JR9 C;  4WNK A;  4EYY R;  2ODU A;  2JJ9 A;  1LKX A;  3ZMS B;  5ABF B;  5AQM B;  2XQ4 A;  4GKK T;  2YDQ A;  4KHZ F;  3WI3 A;  4DV7 T;  3K3Q C;  4ASK A;  4AQG A;  4PAG A;  4UEL A;  3HI2 A;  3HR0 A;  3C51 A;  3UU5 A;  1I6Z A;  5J0Z A;  3U78 A;  2MAW A;  2E8I A;  4IDO A;  1MNE A;  2ODV A;  3BQI A;  5DQV A;  2OV9 A;  2WAU A;  2YN6 A;  1KNP A;  3JC6 C;  3ZCI A;  1YQ3 A;  2W4X A;  2HHH T;  3CQC B;  2PBI A;  3MXZ A;  2YU1 A;  5HXE A;  1N36 T;  1FMW A;  2FJB A;  3I1A A;  2DL1 A;  5AQL B;  1FJG T;  2LEH A;  3RC3 A;  2XAH B;  5JRC B;  3T1H T;  2XQ7 A;  5AQF B;  3RF1 A;  1KFY A;  2GK9 A;  1US7 B;  4DMW A;  2KWI B;  4CI3 B;  2Q9Q D;  1YW0 A;  5BMV E;  2NTY A;  3Q5E A;  3U3I A;  2L3L A;  4CXW A;  5C2T A;  3SFE A;  1B7T A;  1UX5 A;  3FZK B;  5LCY A;  2YEV C;  2WMO A;  2YU2 A;  2VUR A;  4YTM A;  2BBJ A;  3X1D A;  3RI5 A;  4F6R C;  2K48 A;  3N2K E;  2WSS V;  4HFI A;  4XAX B;  2FBW A;  2H7V C;  1T7S A;  4I55 E;  4QX8 B;  4LFA T;  3AE8 A;  1QLB A;  3HKD E;  3EAM A;  1HNW T;  3N9Q A;  3F57 A;  3AED A;  4YFS A;  3TLW A;  5AQT B;  3UU3 A;  2I59 A;  2V7L A;  3PUG A;  3R6N A;  3O9X A;  2LM2 A;  3Q5D A;  3TLV A;  3BK9 A;  4B6X A;  3QB5 K;  3GA8 A;  2ACZ A;  5ABF A;  2WWU A;  3AA0 B;  3K8P C;  1IBK T;  2BBH A;  4NUU A;  3ZT5 A;  5LG3 A;  4C91 A;  3LJC A;  2X68 A;  2QRX A;  1MIY A;  2IAK A;  2K5B B;  3LBX B;  4TV9 E;  3MZK B;  3FHN A;  4DR7 T;  4UF0 B;  5FVL A;  2XTL A;  1ZV4 X;  4PJN A;  1NWM X;  4IDQ A;  1J1J A;  5LB7 B;  2A2F X;  3ZN1 B;  1U5P A;  5L2L A;  2H88 A;  2E9X C;  4CN1 A;  2V7I A;  4EEB A;  5BR8 T;  4H9N C;  1T8B A;  4H9S E;  2CWY A;  4QH4 A;  4AKG A;  5LGU B;  4KP3 C;  3NZQ A;  5JRC A;  4BAY B;  1HG2 A;  2LHR A;  2JIW A;  2CHO A;  3ZSS A;  3VRA A;  2VWA A;  4X66 T;  3CPZ A;  4JEH B;  4ILU A;  2SPC A;  4IE4 A;  2A9U A;  2IC9 A;  2LOS A;  3ZCJ A;  4J2C A;  2IC6 A;  2Z6E A;  3P4P A;  4DID B;  3C98 B;  1NEN A;  3GMI A;  4X20 E;  5HEJ A;  3SS1 A;  5L47 A;  3N9P A;  3NKZ A;  3RIU A;  3UTK A;  3N2G E;  1ZKE A;  2KMF A;  3FBL A;  2V6X A;  4Z90 A;  3HL6 A;  2KZ7 B;  3RLF F;  5L3B B;  5LBQ B;  3TLU A;  5AQJ B;  3H3A A;  4XZC A;  5GON E;  4H63 H;  4ZI2 C;  5FXW A;  1T72 A;  4EIW A;  4JUY A;  3TLS A;  5E0O A;  4G2A A;  3DTO A;  3HKE E;  5JDM A;  2LRL A;  4JI5 T;  4ZI7 E;  2KSR A;  2M6I A;  2W0G A;  2A3D A;  3ZJ2 A;  5ABG A;  2XAQ B;  3LBX A;  5L3F B;  4UF0 A;  3CML A;  1OED E;  3P7I A;  3UU6 A;  2VL0 A;  5LXT E;  2XQA A;  4HFB A;  2DLR A;  4A97 A;  4CXY A;  1O3X A;  2NP9 A;  2X9W A;  4CI1 B;  3K1S A;  5JDG A;  4HWH A;  5LHH B;  3WAJ A;  5HXH A;  4DV1 T;  1SUM B;  4O4L E;  5TAO A;  3NRX A;  4IRE A;  1WFD A;  2KND A;  2M67 A;  3CX8 B;  3FBZ A;  2V7K A;  3AEG A;  5LHI B;  2NWB A;  3JAE A;  4HN9 A;  2MTQ A;  3AB3 B;  3RQW A;  3ZKR A;  4P0A A;  4PJM A;  3ZT6 A;  2EHO C;  3K3N A;  4U2Y A;  3TLT A;  4ILC A;  3FZM B;  4ILA A;  5A1L A;  2C0S A;  2UXX B;  2CE7 A;  3V5S A;  2Y48 B;  2YKS A;  2BG9 C;  1JNZ A;  3I9W A;  3RYH E;  4AIU A;  2RPA A;  3FZH B;  4AKI A;  2FJA A;  2XJ7 A;  2ZM2 A;  1E7P A;  1UX4 A;  5FY7 A;  2XAG B;  2VKD A;  4XBF B;  3P4W A;  1YQ4 A;  1XDO A;  2XSA A;  3C4Z A;  2X9H A;  2NR4 A;  2BG9 B;  4GKJ T;  2J4G A;  2C5K T;  3MA9 A;  4LFB T;  3N9M A;  3AAE B;  4U7I A;  2WDV A;  2V26 A;  3L3P A;  3O1I A;  1HG5 A;  4P0B A;  4PK5 A;  2JRK A;  1E1H B;  2NOX A;  1QUU A;  2XPK A;  4P1N A;  2DHR A;  4CI2 B;  5LA6 E;  2ES0 A;  5FY1 A;  2CXD A;  4YJ2 E;  3AE2 A;  3B57 A;  3OYZ A;  1W9R A;  4QKN A;  1HF8 A;  2ACX A;  4L5G A;  4I50 E;  3RKG A;  2LM9 A;  4IE7 A;  2WDQ A;  3SFD A;  3SWH A;  2UXD T;  4JBW F;  2W61 A;  2CRB A;  5CA1 E;  4JI0 T;  2DNX A;  3AE6 A;  3PJA A;  4ZS3 A;  2XQ5 A;  3ZLI A;  4IL4 A;  5FKY A;  2ZLY A;  3RQU A;  2VB6 A;  4DR6 T;  2V5C A;  3W15 B;  4ILB A;  3RRW A;  4PFP A;  2LSJ A;  4I43 B;  4AQF C;  4EGW A;  3OTO T;  1IZN B;  2X9X A;  3FXE B;  3ZYL A;  2N1G A;  3ZJ1 A;  1XNR T;  1IBL T;  3LK3 B;  3JCF A;  5M4Y A;  2UU9 T;  4DMV A;  5CA0 E;  4KI0 F;  4EAH A;  4YT0 A;  1Y64 B;  3AEC A;  4Z8X A;  2XM1 A;  3PU8 A;  4ZI3 C;  4YTP A;  1XZY A;  2DCF A;  3KV6 A;  5EK3 A;  4PK4 A;  5JR9 B;  4O2B E;  4O2A E;  2C5J A;  3LSV A;  2CPT A;  1KEY A;  4GIW A;  2DWG A;  5FXV A;  2BG9 A;  1VOM A;  4H9O C;  3PU3 A;  5ABH A;  3LFM A;  1D1C A;  1W09 A;  4U33 A;  1MMG A;  4H9R C;  1VCS A;  2V8S V;  4YLH A;  4IT4 A;  2BKO A;  3EI0 A;  4HGA A;  1VRB A;  2G0U A;  1OED C;  1ZHC A;  1L0V A;  2PG8 A;  2XQ8 A;  2HH7 A;  2VKH A;  2D0T A;  4M1P A;  5KMG P;  3ESL A;  3PUW F;  3UQ4 A;  2LKH A;  3NRY A;  2UXC T;  3KDS E;  4CN6 A;  2CXL A;  5H6Q B;  2WCA A;  1ZEE A;  1G73 A;  3VRB A;  4UVC B;  4JI4 T;  4YSZ A;  2QVA A;  4DV5 T;  4ZZC A;  3KV5 A;  2IUB A;  2XY8 B;  4B3T T;  3AAI A;  4UEM A;  5HXS A;  2D2S A;  2M6B A;  4DR1 T;  3PE0 A;  4E7S A;  4IDN A;  2E5L T;  1BR0 A;  3IHR A;  2XHE B;  1N32 T;  5AQK B;  2LSK A;  4HFC A;  3L8R A;  4L9I A;  3NZP A;  5JQG E;  1YD8 G;  2PJQ A;  1J5W A;  4EZH A;  4IL9 A;  4OX9 T;  3P50 A;  3CWZ B;  3AEB A;  3RKO A;  2BVM A;  2WDR A;  1Z8U A;  2XAS B;  3M3Z B;  4DND A;  3MK7 C;  3A5X A;  4B3M T;  5F5W A;  1WYB A;  1Z0P A;  1V9D A;  4AKH A;  3QOF A;  3H3M A;  4GK0 E;  1SE7 A;  1MMA A;  1KNR A;  5JR9 A;  4UVA B;  2B76 A;  2XM2 A;  3L09 A;  4B3S T;  3AVR A;  3EDV A;  2X9Y A;  3AEE A;  2V5D A;  1FIO A;  3VKH A;  2E9X D;  4U72 A;  1OXZ A;  1S94 A;  3UUX B;  4K0K T;  2V7J A;  2K9A A;  3T8O A;  1XMQ T;  2UXB T;  4V1A v;  3UUM A;  2E9X B;  2QGS A;  3GWH A;  3I0O A;  2XAJ B;  4YY3 T;  4DV0 T;  2IDO B;  3PUV F;  1WYC A;  4X5T A;  4QXB B;  4HFH A;  4JI8 T;  2XAF B;  4IST A;  2VQF T;  1X79 A;  4NIQ A;  1ZOY A;  3TKL B;  5FL1 A;  3AA1 B;  4QH5 A;  1BR4 A;  3PUS A;  1UUR A;  5J2U E;  3AXJ B;  1BR2 A;  4YJ3 E;  5LHG B;  2WP9 A;  4LF8 T;  2K24 A;  4NUV A;  5EZY E;  1UGO A;  4X62 T;  5FXX A;  4CZZ B;  4P09 A;  5AQV B;  3ANW B;  1R8I A;  4WZX A;  3AAA B;  3ONL C;  3UQ7 A;  3KV9 A;  3PJA J;  3DJB A;  2UUA T;  1N34 T;  4ANJ A;  3FB2 A;  2IML A;  4HWC A;  1CHU A;  4MHC A;  4U2Z A;  2PFV A;  4FI5 A;  5DAB A;  2ZM0 A;  5AQQ B;  2MOZ A;  2CBJ A;  2XSB A;  3KBT A;  2LT3 A;  2DI4 A;  4DO0 A;  5F3J A;  4H63 V;  2X51 A;  5ADX L;  5LGN B;  4BA9 A;  1SA0 E;  2I0M A;  5HAX A;  2WM9 A;  2LSG A;  3MAC A;  1MMN A;  4DUY T;  1FMV A;  2RP4 A;  3ZMV B;  4IIJ E;  1OWA A;  4YXD A;  4DR3 T;  3B13 A;  2WB5 A;  3C50 A;  2FJD A;  4EV6 A;  5AQR B;  4WYV A;  2KT9 A;  3A7M A;  3AEF A;  2L9Q A;  3ZEF B;  3WAK A;  2WMN A;  1I94 T;  2C5I T;  3H37 A;  4LF9 T;  4DV6 T;  2E9X A;  3RYF E;  5LG4 A;  2L8K A;  3UFE A;  4WBN E;  2OLT A;  4HFE A;  5AQH B;  2CM0 A;  1M7K A;  5L4E A;  1NAF A;  4IDZ A;  2VL8 A;  3UU8 A;  3S4U A;  2W2U A;  2A72 A;  2QA7 A;  2F4V T;  4UR9 A;  1HX1 B;  4U3C A;  1IJ5 A;  1D0Z A;  1MIW A;  1MMD A;  3QK6 A;  3AXJ A;  3MJX A;  2CLY C;  2CCQ A;  4IGU A;  3OYX A;  4EZ4 A;  2EHO B;  2WZI A;  1IAP A;  3ZYM A;  3AE1 A;  3MKD A;  4JI7 T;  3LK4 2;  1D0X A;  4DV3 T;  3ANW A;  4KUM B;  1S35 A;  4LF5 T;  3VR8 A;  4L0R A;  3PUA A;  1KF6 A;  3C64 A;  2VK9 A;  4YTN A;  2D5U A;  4NXM T;  4N78 D;  3I0Q A;  2CWO A;  4NXN T;  2BS2 A;  4QXC B;  2V7M A;  5JDQ A;  4LF7 T;  2MYS A;  3IBP A;  4LF4 T;  4H9P C;  4KMC A;  2FJE A;  2NW9 A;  5LMN T;  5L3E B;  2CMR A;  4UVB B;  5HYA A;  5L3D B;  3NBX X;  2LHN A;  1KNZ A;  3I9Y A;  3RYI E;  5LJM A;  2D0U A;  4CQI A;  5IYZ E;  3E22 E;  4PJL A;  3N5L A;  4AKL A;  2H7O A;  4KHP T;  4IE5 A;  3KVB A;  2MBG A;  2D9D A;  1KK7 A;  2JMK A;  4ZS2 A;  2MPK A;  2WU2 A;  3O1H A;  3UUN A;  4BJM A;  3C4W A;  3HKC E;  3CKD A;  4IHJ E;  3OKQ A;  2ZM8 A;  2CXF A;  3EDU A;  3LG7 A;  3P4R A;  2BKN A;  2RA1 A;  2E2A A;  1GQE A;  4GYS A;  4DR2 T;  2J1D G;  3N9N A;  2UUC T;  2W67 A;  1YKE B;  5LMU T;  1IBM T;  3IF8 B;  3O4X E;  3KBU A;  4MBQ A;  2BDE A;  2XQ3 A;  3LK2 B;  4Z91 A;  1IJ6 A;  4TWF A;  2WQY A;  2E5V A;  5C3J A;  4TZ4 C;  2BS3 A;  3EAB A;  4JI2 T;  3FZF B;  5HXR A;  2X0H A;  2EHO A;  3QC9 A;  3BQK A;  1XNQ T;  1WR0 A;  3ZMZ B;  4ZI3 D;  4TWD A;  2ZM6 T;  3P8C D;  4O4I E;  3T1Y T;  5JTG A;  2LSI A;  3N9O A;  5LP6 E;  1UCU A;  4JI1 T;  3G06 A;  5EK4 A;  3JC6 D;  3ZT7 A;  2KXP B;  5HCJ A;  2IIU A;  2AXD S;  3N2O A;  3RPU A;  3Q9D A;  1J5E T;  2VAS A;  5FY0 A;  3KVA A;  1H7C A;  2HN2 A;  2XQ9 A;  3ETU A;  2YDS A;  3AE9 A;  5LJN A;  4YHH T;  2N2N A;  3ZC0 A;  4GOU A;  5HXC A;  4DBR A;  1HR0 T;  3RH3 A;  2V6Y B;  4KBM B;  2BKP A;  3OVU A;  3RIU C;  5L3C B;  1T98 A;  4COF A;  2Q9Q C;  4DV2 T;  4ISS A;  3HA4 A;  5AQS B;  5CFB A;  3PUZ F;  4OYK A;  2FUP A;  4ZZB A;  4O4J E;  3NVO A;  3VHL A;  5HEU A;  1YXR A;  3VR9 A;  4F8H A;  1OED B;  5HWX A;  5L4H A;  3E08 A;  2VKJ A;  3DP7 A;  5ABE A;  3RIF A;  4OK0 A;  2VVN A;  2VKO A;  4A5X A;  2WZH A;  3PUR A;  4QH1 A;  4DVD A;  2LE8 A;  2YIN A;  5DQW A;  2LRK A;  5AQU B;  4G63 A;  2BG9 E;  1HNZ T;  5AQO B; 
#chains in the Genus database with same CATH homology
 4LF7 T;  4B3M T;  2UXD T;  4LF8 T;  4LF4 T;  5BR8 T;  1N33 T;  2ZM6 T;  4LF9 T;  4DV6 T;  4X62 T;  4DUZ T;  4JI5 T;  3T1Y T;  5IWA T;  4X64 T;  4JI1 T;  5LMN T;  4JI0 T;  4B3S T;  4GKK T;  4DR6 T;  4DV4 T;  2UUA T;  2F4V T;  1J5E T;  4JI6 T;  1N34 T;  4DV7 T;  4B3R T;  2UXC T;  4X66 T;  4LFA T;  4JYA T;  4DR5 T;  4KHP T;  4AQY T;  4K0K T;  1HNW T;  3OTO T;  4JI4 T;  4YHH T;  4DV5 T;  4GKJ T;  4B3T T;  1XNR T;  1HR0 T;  4DR4 T;  1IBL T;  2UU9 T;  4LFB T;  4JI7 T;  4DV1 T;  4DV3 T;  1XMQ T;  2HHH T;  2UXB T;  1XMO T;  4LF6 T;  4JI3 T;  4DR1 T;  4LF5 T;  4DV2 T;  4DUY T;  1IBK T;  2E5L T;  1N36 T;  4DR2 T;  4X65 T;  4LFC T;  2UUC T;  4YY3 T;  1N32 T;  5LMU T;  4DV0 T;  1IBM T;  4DR7 T;  1FJG T;  4DR3 T;  3T1H T;  4JI8 T;  2UUB T;  2VQE T;  2VQF T;  4JV5 T;  4JI2 T;  4OX9 T;  1HNX T;  4NXM T;  4NXN T;  1XNQ T;  1HNZ T;  1I94 T; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...