1N33T

Structure of the thermus thermophilus 30s ribosomal subunit bound to codon and near-cognate transfer rna anticodon stem-loop mismatched at the second codon position at the a site with paromomycin
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
99
structure length
99
Chain Sequence
RNLSALKRHRQSLKRRLRNKAKKSAIKTLSKKAIQLAQEGKAEEALKIMRKAESLIDKAAKGSTLHKNAAARRKSRLMRKVRQLLEAAGAPLIGGGLSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Selection of tRNA by the Ribosome Requires a Transition from an Open to a Closed Form
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 16S RIBOSOMAL RNA
total genus 34
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 2002-10-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
T PF01649 Ribosomal_S20p Ribosomal protein S20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.110 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Ribosomal protein S20 1n33T00
4OX9T 1N33T 5IWAT 4LF4T 4KHPT 4DV5T 1IBLT 2UUAT 3T1HT 1XNRT 4JI6T 3T1YT 4GKJT 4B3MT 1HR0T 4B3ST 4AQYT 1HNWT 4LF9T 4B3TT 4DUYT 4JYAT 4DR4T 4DR3T 4LF5T 4LF8T 1XMOT 4NXNT 1IBMT 4JI7T 4DV0T 4GKKT 4LFAT 4K0KT 4DR1T 4DR5T 4DV1T 4LF7T 1N32T 4JI5T 2VQFT 1FJGT 4YHHT 4B3RT 4DR7T 4NXMT 4DV6T 3OTOT 4DV3T 2UUBT 1XMQT 4DV7T 4X62T 4JI4T 4LFCT 2E5LT 4DR2T 4JI8T 2VQET 4LFBT 4JI2T 5LMNT 4JI3T 5BR8T 2ZM6T 4X65T 1HNZT 2F4VT 4YY3T 4DUZT 2HHHT 4X66T 1XNQT 1N36T 2UXBT 2UXDT 2UUCT 1HNXT 4DV4T 1J5ET 4JI0T 2UU9T 4DR6T 5LMUT 4LF6T 4JI1T 4JV5T 1N34T 1IBKT 4DV2T 2UXCT 1I94T 4X64T
chains in the Genus database with same CATH superfamily
2EHOD 4H9QC 3PUAA 4OYJA 4OX9T 1MMDA 1ZOYA 2JMHA 4A97A 3FBLA 2IDOB 2XSBA 4JEHB 4AQFA 2V6YA 1OEDE 1WCRA 3UT5E 1IBLT 3HI2A 5EK4A 3FBZA 1WR6A 2XQYA 2PG8A 5EK2A 2QGSA 3HL6A 4U31A 2N9DA 2ZM8A 3PDYA 4QHOA 2KSRA 4GYSA 3VU7H 4BJMA 1E7PA 5AQVB 5JDQA 5LG4A 1HFAA 1T8BA 2LM9A 3KINB 2YU2A 2YK0A 3LG7A 3K3NA 3H3MA 4AKLA 4HE8A 3N9NA 3AA7B 5ABHA 2UXXB 2N2NA 3AA6B 5AQJB 2X0LB 3EHZA 5BMVE 2MYSA 2K3WA 4AISA 3Q5EA 2B1EA 2C0SA 1YQ4A 3A7MA 3PJAA 5LNKA 2DLRA 3MKDA 1T98A 4KP3C 3HKEE 4G2AA 2L3LA 5LB7B 1IAPA 1UGOA 3NKZA 4U74A 2LRKA 3CKDA 4TNWA 5LOVE 4PAGA 5LA6E 4X20E 3ZJ2A 3ZMTB 4P1NA 3HA4A 5LBMA 3ZEFB 2YKSA 3RX6A 2IUBA 3HKBE 2W66A 4NPPA 1NEKA 2B76A 2CMRA 5HXSA 4JYAT 2RP4A 2X0HA 3FXEB 3LBXA 5L4EA 1FIOA 1WR0A 2ODUA 2W00A 5AQIB 4LF8T 3S4UA 1XMOT 5KX5E 2JQQA 3C4XA 4NXNT 3IA3A 4XZCA 1X79A 1XZYA 4OHFA 3RQUA 2J47A 2WY2A 3RYFE 4ILBA 2D5UA 2N1GA 3AE7A 4DV0T 1BR4A 4ASKA 3ZYKA 5L2LA 1ZV4X 3L39A 4PW8A 4U2ZA 4EAHA 1QUUA 4CQIA 2CXLA 3ANWA 2YINA 4UVCB 3CVRA 4GYRA 1NWMX 2BS2A 5AQSB 3D0TA 4DR1T 2H7OA 2H89A 1MIWA 4DR5T 2WQYA 2L8KA 3FB2A 3KBUA 2LEHA 5HAXA 1O3XA 4U72A 4LF7T 3GN5B 3Q2MA 5F8PA 2E2AA 4IGUA 2DI4A 3ZMZB 3FZMB 5EZYE 4ISTA 2WU2A 5LHHB 2HPLA 3MZKB 1OWAA 2ODVA 2DWGA 2BBHA 3JADA 4QXCB 3RC3A 5LJMA 5C2TA 2IC6A 5LJNA 4DR7T 3U3IA 4TUYE 2WM9A 2H7VC 3AA1B 3AECA 3N5LA 3RIUA 4DVDA 1HX8A 2RA1A 3AAAB 4HWCA 4CI3B 3OTOT 2Q9QC 3AE5A 3A5XA 3VR9A 3QUJA 4UF0B 2K5BB 4IHJE 2L9QA 3JC6D 2ZM0A 4GOUA 4IE6A 2ES0A 3AXJA 5HEGA 4AQGA 4DIDB 1W09A 2E9XC 3ONJA 4HFHA 4OYKA 1KNPA 3R6NA 2CPTA 3B57A 5AFUL 2IIUA 2XQAA 4IREA 2XJ7A 4X62T 4ILCA 2PBIA 3UUNA 2E5LT 1D1AA 4IDQA 1YW0A 2CEAA 5AQNB 2VQET 3KV9A 3TLVA 2BVLA 5FY0A 2WS3A 2CHOA 1UX5A 2HN1A 4QH1A 5BR8T 2J1DG 4TX5A 2XQ4A 1NENA 2V6YB 5DJQC 5LXTE 2ZM6T 1HTJF 5HEJA 4X65T 3IEEA 1HNZT 3NRYA 3PUQA 3ZKRA 5J0ZA 3A8YC 2CCQA 3N9OA 2E9XA 5LBQB 4L9IA 3RI5A 2HHHT 4IE7A 2MOZA 5JQGE 2J62A 2X51A 2UXNB 2DWKA 2W0GA 3MA9A 5FKYA 4ZI3C 5IHYA 2SPCA 3N9LA 2ACZA 2KT9A 2V7KA 3GMIA 4IDPA 5FY7A 5A1LA 3VR8A 3F31A 2YN6A 5JDGA 4YT0A 2IMLA 1X9BA 3BQIA 1E1HB 5L3DB 3Q5WA 4AXPA 3VKGA 5GONE 3CQXC 3HKCE 3Q5XA 4GK0E 3CX6B 4Z8XA 5H6RB 2BBJA 3PV0F 4KBMB 3TLSA 2UXCT 1I94T 2E9XB 5FYMA 3ZMUB 5AQQB 3PJAJ 1YXRA 5JVDE 2CBIA 2XHEB 4AKHA 1WYBA 4DV5T 4TV8E 3AEDA 1WRDA 3C4WA 3P4WA 2D0TA 2WWVA 3AEGA 2BKNA 5FXZA 1LVFA 4ZHQE 4QXHB 2Q9QB 1N32T 4UF0A 2A3DA 1US7B 4P0AA 3T1HT 3DJBA 4EZHA 5ADXL 1OXZA 4NUVA 4WW0A 1LVKA 5KMGP 4JI6T 1MNEA 2LSIA 3AVRA 4TN7B 1UK5A 3P4PA 1HR0T 3PE0A 2HPJA 3P50A 4ZS2A 4U7YA 3W15B 1BR1A 5ABGA 4BA9A 4HFCA 4O4LE 3SFEA 3C98B 4EGWA 3PURA 2WDRA 4YHJA 4EOZB 1KF6A 4HN9A 4LF9T 5AQUB 3ZN1B 4DUYT 2WWUA 2X68A 4A98A 4HFEA 3UU5A 1G8XA 4KUMB 5DABA 2KMFA 3SRZA 5FNVE 5JTGA 4ZI3D 2KWHA 3RIFA 2PJQA 4QWNB 3CK6A 3ZC1A 4DR4T 3O1HA 2A9UA 5CB4E 4E7ZA 3IBPA 4I43B 1J1JA 2JQ9A 3AEEA 1UUSA 4IL9A 1BR0A 4O8SA 3VHLA 5IUXA 1VOMA 3RYIE 1I6ZA 1Z8UA 3KBTA 1W0AA 2EHOA 3O1IA 2H88A 3CX8B 3AB3B 3CPZA 4KX6A 2NR4A 3AVSA 1T72A 4OK0A 3JAEA 4CN1A 3WI3A 1MNDA 5IYZE 3AE6A 3RYHE 3RLFF 2C5JA 4PK4A 3SWHA 3ZC0A 4G63A 1H7CA 3RPUA 4X1YE 1SUMB 2X66A 3HKDE 4ERRA 2C5IT 2WAUA 4IE4A 4OFZA 2IW5B 4HGAA 1GQEA 3M3ZB 4CXWA 1SHZC 5L47A 4N78D 2IAKA 3HR0A 4DO0A 5ETWA 2KINB 5FMNA 3UQ4A 1FJGT 2XM2A 2GK9A 1S35A 2XTLA 4ILAA 5AQPB 4P09A 2P9BA 4ADZA 4UELA 4YFSA 3RH3A 1VCSA 1DU2A 1W0BA 4HKAA 2LSJA 2NW9A 4H9NC 3QNUA 4NXMT 3NRXA 4IL4A 2CE7A 2MAWA 2X9HA 2CRBA 3N9PA 3N9QA 4H9SE 4JLEA 3B5MA 4UV9B 5HEOA 2W61A 2ACXA 4YSZA 5HXEA 2JQKA 2LHRA 2DNXA 4COFA 5M4YA 3WAJA 2UUBT 4EYUA 2FBWA 4I55E 2LJLA 2BKOA 2YEVC 3E0ZA 4ISSA 2OA5A 4JI4T 3L3PA 3UU4A 2KXPB 3P7IA 4QKNA 5JRCA 2MTQA 2VB6A 3CMLA 5AQTB 4O4IE 1YQ3A 4LFBT 4DNDA 4O4HE 3GN5A 3P4RA 2Z6EA 2VKDA 4L0RA 2WZIA 2CXDA 4ZZBA 1D0YA 5JDHA 4UVAB 1Z0PA 2CBJA 2FUPA 2LSKA 1M7KA 2PFVA 2DHRA 2V26A 3CQGB 3EDUA 5FVKA 3TKLB 4DUZT 3ANWB 2CWYA 2XQ3A 3PUVF 2KLQA 4LMKA 4X66T 5LGNB 1OEDA 2D2SA 4PFPA 5LYJE 2I6HA 4PJLA 3J7Yq 3ZMVB 1ZEEA 2UUCT 3AE2A 2M67A 1ZP0A 2CLYC 2YDRA 4ZXLA 1YD8G 1HG5A 2VK9A 2WSSV 3K3OA 3KV5A 4U3CA 1YKEB 4ZI7E 1FEWA 1D1CA 4JI1T 3FZLB 3F2EA 1IBKT 5HXCA 4EIWA 4M1PA 3AE8A 3ONLC 5AQHB 4X1IE 4X64T 2XQ6A 3I0OA 1D0ZA 1J5WA 3ZN0B 4A5XA 4QH4A 5FL1A 1VCTA 4P0BA 4UXNB 2YOEA 3NZQA 2JQHA 4KHPT 1HX1B 4Z91A 4CN6A 4H63H 4Q25A 5LGUB 3QOFA 2W4XA 2I0MA 2BZBA 2I59A 2WMNA 3PU3A 2XQ9A 3KV4A 4HEAA 3RQWA 3UU6A 5DQVA 3LK42 2MPKA 5AQMB 2M6IA 5JDFA 2OLTA 4KHZF 4EZ4A 2WCAA 3RKOA 3LJCA 2V5CA 4JEUB 3T1YT 4GKJT 2NP9A 1HG2A 2WBLA 4B3MT 1SE7A 3NVOA 2A2FX 2M6BA 2W67A 3C64A 3JCFA 2XAQB 1JNRA 2KNDA 3PUZF 1S94A 4WYVA 5HCJA 5ABFA 2RPAA 1MIVA 3OJAA 2WMOA 4YXDA 1XDOA 5LHGB 5C3JA 4B3TT 4XAXB 3TLTA 2VL8A 3B13A 2AXDS 2XAJB 5TAOA 2NTYA 4MBQA 3CX7B 2LOPA 4UR9A 2PTFA 1WYCA 2R6GF 3RKGA 3ZSTA 5CA0E 2X9YA 3ONXA 2A72A 1MMNA 2CA5A 4PK5A 5HXRA 3LBXB 4U7IA 3LK3B 3ZJ1A 3DP7A 5AQGB 3ZCIA 2DCFA 5C8YE 5JH7E 3AE9A 2XAGB 4EYYR 4H63V 5HXHA 1CUNA 2BG9C 3UFEA 4YJ3E 4QX8B 5HEUA 2XAFB 4QXBB 1KNZA 5LGTB 3JC6C 4YJ2E 3ZT6A 4LFAT 1JNZA 3ETUA 5JDLA 4K0KT 2LT3A 2X9WA 3TLUA 1E2AA 2FJBA 2JMKA 2VL0A 2YDSA 2QYWA 4HFVA 4IIJE 4TV9E 2FJDA 4H9PC 3ESLA 5H6QB 3OYXA 2HN2A 3PTRB 3UQ7A 3P4SA 4PK6A 4UV8B 4EXTA 5AQFB 2VVSA 4UEMA 2QVAA 1UURA 1HF8A 2NTXA 2V7IA 2VASA 1T7SA 2XAHB 1FMWA 3QC9A 3PU8A 4HWHA 5CJ5A 4YHHT 4B3RT 2CXFA 3EVYA 5F5WA 3VRBA 4B6XA 3IHRA 3AAIA 3J9X1 1XWMA 3UUXB 5FXXA 3PUWF 4DV6T 1OEDB 2VKJA 3EUHA 5AQLB 2LSYA 4YLHA 4TWFA 4PJNA 3AEFA 4HWIB 3U78A 5L3BB 3BQLA 4X5TA 3RC8A 3RIUC 4O2AE 1Y01A 2VVNA 5ABEA 2E5VA 1KFYA 1YKHB 3QB5A 3KDSE 3FZHB 4FI5A 4H9OC 3QK6A 5EK3A 5J2TE 4DV7T 4AKGA 4QX7B 2Y8DA 1R8IA 5FY1A 4C91A 4F6RC 2CM0A 5CA1E 5AQRB 4JI8T 1IZNB 1QLBA 1BR2A 3UUMA 4F8HA 4JI2T 4HWFA 3NWIA 2X67A 3FZKB 3NZPA 5LMNT 2BS4A 1UX4A 2V8SV 2QRXA 3RYCE 5J2UE 3H37A 2LHNA 2XUEA 2ZMAA 4ZEYA 5FP3A 3QB5K 1KEYA 4MFRA 3ZLIA 2W2UA 2FJEA 1WLXA 4C90A 4GIWA 3AEAA 4YY3T 3L09A 2CLYB 2CWOA 4H9RC 4ZI2D 3OPCA 1N36T 2UXBT 3EAMA 2H3RA 5LG3A 4IDZA 3AA0B 3CIRA 5L4HA 4K0UA 4UIGA 4X1KE 4BAYB 2XSAA 2V7MA 2BKPA 4ZOLE 5KXJA 3FZFB 3K1SA 2C5KT 3FHNA 4EB6E 4DBRA 4JUYA 3F57A 2XPKA 1J5ET 2UU9T 3C50A 3T8OA 3PUXF 4JI0T 3Q9DA 3UUBA 2EHOB 4DR6T 2NW8A 5HYAA 2Y48B 2IHR1 2OV9A 1XDPA 3CWZB 2WDQA 4I4TE 1IJ6A 4NUUA 2WB5A 4DMVA 3O9XA 4JV5T 4WZXA 2VKHA 5HWXA 4DV2T 2WU5A 4AKIA 2BG9A 1B7TA 2LOSA 1U5PA 1Y64B 3E22E 4HFIA 1N33T 4U2YA 2LSGA 2X0YA 5IWAT 2W63A 4LF4T 3UU3A 5HWYA 2MBGA 2QA7A 1MMGA 3V5SA 4AIUA 3C4ZA 2XQ5A 2UUAT 4CI2B 2NW7A 3ZYMA 3WAKA 3LK2B 2ZLYA 2VKOA 3JAFA 3RRWA 4CXXA 3ZCJA 1XNRT 2WZHA 5CFBA 2LLYA 2WDVA 3OYZA 4PJJA 4MALA 3VKHA 2E8IA 3DTOA 3ZYLA 5FXVA 1QSDA 4PNIA 4A56A 4EEBA 5LHIB 2AE9A 1KNRA 3OVUA 4NIQA 5J1GA 4B3ST 3Q5DA 5JREA 4HFDA 4IE0A 3ABVA 3I9WA 3KV6A 3LSVA 2V7JA 2VURA 5FL0A 1EZ3A 2W62A 3SS1A 5F3JA 4YTPA 4IT4A 5L3CB 2EHOC 4AQFC 4LMJA 5JR9B 1HNWT 4V1Av 2Q9QA 3AAEB 4XBFB 4HWDA 5L3EB 1D1BA 4U33A 1MIYA 1ZKEA 4IDOA 3I1AA 4KI0F 2BG9B 3GWHA 1AJ3A 2LKHA 3H3AA 3N2KE 3AXJB 4ILUA 4O2BE 4TWDA 2K24A 4ZS3A 5AQOB 5HEHA 4E7SA 4YTNA 4I0UA 4TNVA 1WFDA 4DR3T 1VRBA 4AKRB 4LF5T 5KDMC 3CQCB 2XQ7A 3GA8A 4DMWA 4DBQA 3FXDB 3OBVE 2BG9E 3BQKA 3I9YA 3I0QA 2IC9A 3M65A 4HFBA 4QH5A 3UU8A 1IBMT 5JR9C 2KZ7B 2X9XA 4JI7T 2BDEA 2Q9QD 3PUSA 2J4GA 4ZZCA 2LM2A 4FJOA 5L3GB 5JRCB 3RRCA 2V5DA 3EI0A 4GKKT 3RHWA 4WBNE 2E9XD 3EDVA 4TWHA 3ZPOA 3N9MA 1IJ5A 3O1JA 5JDNA 1W9RA 4ANJA 2ZM2A 4IDNA 3SOLA 3BK9A 3KVBA 2K48A 2XASB 3KVAA 4YSYA 2FJAA 3RIAA 4DV1T 4WNKA 4IE5A 2WP9A 1OEDC 1SA0E 3ETVA 4KMCA 5HCMA 5CGMA 5LP6E 2LRLA 1MMAA 4LMLA 4JI5T 3ZT7A 2YDQA 2YU1A 4CXYA 2VQFT 1G73A 2NWBA 2D0UA 2XM1A 1CHUA 1D0XA 1M62A 3OKQA 2VWAA 3G06A 3MACA 1L0VA 2XQ8A 3V5UA 3TLWA 1U4QA 2Y6XA 3LDQB 2BVMA 4CN4A 4WBOA 2NOXA 4UVBB 4YSXA 4ZI2C 2XZEA 5FVLA 5FXWA 4CZZB 4DV3T 2G0UA 3KFWX 3O4XE 2HH7A 1XMQT 3UFGA 2XY8B 3P8CD 2V7LA 4Z90A 3PUGA 4MLKA 3N2OA 2LE8A 3ZSSA 3ZMSB 2K9AA 4I50E 4LFCT 4PJMA 4DR2T 3UULA 4AQYT 4BJNA 1HCIA 5L3FB 1UCUA 3RGLA 2JJ9A 3R84B 3VRAA 3MJXA 3NBXX 4YTMA 4EV6A 4JI3T 4TZ4C 4HTEA 2JPFA 3MXZA 2DL1A 3ZT5A 4GK5E 3PUYF 3N2GE 2V1DB 2LKGA 3K8PC 4CI1B 1V9DA 3RF1A 5E0OA 1XNQT 4J2CA 3K3QC 5AQKB 3AE4A 5JR9A 4AI6A 1NAFA 4JBWF 1ZHCA 2V6XA 3P4QA 2UXDT 2JIWA 1LKXA 2D9DA 2BS3A 1HNXT 1HS7A 4DV4T 2CHNA 2JRKA 3AEBA 5DQWA 3AE3A 3EABA 5LCYA 3SFDA 3X1DA 5ABFB 2F4VT 5LMUT 3AE1A 3MK7C 5JDMA 4LF6T 1FMVA 3LFMA 1KK7A 3IF8B 4PFOA 3UTKA 4EEDA 3C51A 2KWIB 1N34T 3L8RA 4L5GA 1LRZA 3E08A 4O4JE 4MHCA
chains in the Genus database with same CATH topology
4OX9T 1N33T 5IWAT 4LF4T 4KHPT 4DV5T 1IBLT 2UUAT 3T1HT 1XNRT 4JI6T 3T1YT 4GKJT 4B3MT 1HR0T 4B3ST 4AQYT 1HNWT 4LF9T 4B3TT 4DUYT 4JYAT 4DR4T 4DR3T 4LF5T 4LF8T 1XMOT 4NXNT 1IBMT 4JI7T 4DV0T 4GKKT 4LFAT 4K0KT 4DR1T 4DR5T 4DV1T 4LF7T 1N32T 4JI5T 2VQFT 1FJGT 4YHHT 4B3RT 4DR7T 4NXMT 4DV6T 3OTOT 4DV3T 2UUBT 1XMQT 4DV7T 4X62T 4JI4T 4LFCT 2E5LT 4DR2T 4JI8T 2VQET 4LFBT 4JI2T 5LMNT 4JI3T 5BR8T 2ZM6T 4X65T 1HNZT 2F4VT 4YY3T 4DUZT 2HHHT 4X66T 1XNQT 1N36T 2UXBT 2UXDT 2UUCT 1HNXT 4DV4T 1J5ET 4JI0T 2UU9T 4DR6T 5LMUT 4LF6T 4JI1T 4JV5T 1N34T 1IBKT 4DV2T 2UXCT 1I94T 4X64T
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4OX9 T;  1N33 T;  5IWA T;  4LF4 T;  4KHP T;  4DV5 T;  1IBL T;  2UUA T;  3T1H T;  1XNR T;  4JI6 T;  3T1Y T;  4GKJ T;  4B3M T;  1HR0 T;  4B3S T;  4AQY T;  1HNW T;  4LF9 T;  4B3T T;  4DUY T;  4JYA T;  4DR4 T;  4DR3 T;  4LF5 T;  4LF8 T;  1XMO T;  4NXN T;  1IBM T;  4JI7 T;  4DV0 T;  4GKK T;  4LFA T;  4K0K T;  4DR1 T;  4DR5 T;  4DV1 T;  4LF7 T;  1N32 T;  4JI5 T;  2VQF T;  1FJG T;  4YHH T;  4B3R T;  4DR7 T;  4NXM T;  4DV6 T;  3OTO T;  4DV3 T;  2UUB T;  1XMQ T;  4DV7 T;  4X62 T;  4JI4 T;  4LFC T;  2E5L T;  4DR2 T;  4JI8 T;  2VQE T;  4LFB T;  4JI2 T;  5LMN T;  4JI3 T;  5BR8 T;  2ZM6 T;  4X65 T;  1HNZ T;  2F4V T;  4YY3 T;  4DUZ T;  2HHH T;  4X66 T;  1XNQ T;  1N36 T;  2UXB T;  2UXD T;  2UUC T;  1HNX T;  4DV4 T;  1J5E T;  4JI0 T;  2UU9 T;  4DR6 T;  5LMU T;  4LF6 T;  4JI1 T;  4JV5 T;  1N34 T;  1IBK T;  4DV2 T;  2UXC T;  1I94 T;  4X64 T; 
#chains in the Genus database with same CATH topology
 2EHO D;  4H9Q C;  3PUA A;  4OYJ A;  4OX9 T;  1MMD A;  1ZOY A;  2JMH A;  4A97 A;  3FBL A;  2IDO B;  2XSB A;  4JEH B;  4AQF A;  2V6Y A;  1OED E;  1WCR A;  3UT5 E;  1IBL T;  3HI2 A;  5EK4 A;  3FBZ A;  1WR6 A;  2XQY A;  2PG8 A;  5EK2 A;  2QGS A;  3HL6 A;  4U31 A;  2N9D A;  2ZM8 A;  3PDY A;  4QHO A;  2KSR A;  4GYS A;  3VU7 H;  4BJM A;  1E7P A;  5AQV B;  5JDQ A;  5LG4 A;  1HFA A;  1T8B A;  2LM9 A;  3KIN B;  2YU2 A;  2YK0 A;  3LG7 A;  3K3N A;  3H3M A;  4AKL A;  4HE8 A;  3N9N A;  3AA7 B;  5ABH A;  2UXX B;  2N2N A;  3AA6 B;  5AQJ B;  2X0L B;  3EHZ A;  5BMV E;  2MYS A;  2K3W A;  4AIS A;  3Q5E A;  2B1E A;  2C0S A;  1YQ4 A;  3A7M A;  3PJA A;  5LNK A;  2DLR A;  3MKD A;  1T98 A;  4KP3 C;  3HKE E;  4G2A A;  2L3L A;  5LB7 B;  1IAP A;  1UGO A;  3NKZ A;  4U74 A;  2LRK A;  3CKD A;  4TNW A;  5LOV E;  4PAG A;  5LA6 E;  4X20 E;  3ZJ2 A;  3ZMT B;  4P1N A;  3HA4 A;  5LBM A;  3ZEF B;  2YKS A;  3RX6 A;  2IUB A;  3HKB E;  2W66 A;  4NPP A;  1NEK A;  2B76 A;  2CMR A;  5HXS A;  4JYA T;  2RP4 A;  2X0H A;  3FXE B;  3LBX A;  5L4E A;  1FIO A;  1WR0 A;  2ODU A;  2W00 A;  5AQI B;  4LF8 T;  3S4U A;  1XMO T;  5KX5 E;  2JQQ A;  3C4X A;  4NXN T;  3IA3 A;  4XZC A;  1X79 A;  1XZY A;  4OHF A;  3RQU A;  2J47 A;  2WY2 A;  3RYF E;  4ILB A;  2D5U A;  2N1G A;  3AE7 A;  4DV0 T;  1BR4 A;  4ASK A;  3ZYK A;  5L2L A;  1ZV4 X;  3L39 A;  4PW8 A;  4U2Z A;  4EAH A;  1QUU A;  4CQI A;  2CXL A;  3ANW A;  2YIN A;  4UVC B;  3CVR A;  4GYR A;  1NWM X;  2BS2 A;  5AQS B;  3D0T A;  4DR1 T;  2H7O A;  2H89 A;  1MIW A;  4DR5 T;  2WQY A;  2L8K A;  3FB2 A;  3KBU A;  2LEH A;  5HAX A;  1O3X A;  4U72 A;  4LF7 T;  3GN5 B;  3Q2M A;  5F8P A;  2E2A A;  4IGU A;  2DI4 A;  3ZMZ B;  3FZM B;  5EZY E;  4IST A;  2WU2 A;  5LHH B;  2HPL A;  3MZK B;  1OWA A;  2ODV A;  2DWG A;  2BBH A;  3JAD A;  4QXC B;  3RC3 A;  5LJM A;  5C2T A;  2IC6 A;  5LJN A;  4DR7 T;  3U3I A;  4TUY E;  2WM9 A;  2H7V C;  3AA1 B;  3AEC A;  3N5L A;  3RIU A;  4DVD A;  1HX8 A;  2RA1 A;  3AAA B;  4HWC A;  4CI3 B;  3OTO T;  2Q9Q C;  3AE5 A;  3A5X A;  3VR9 A;  3QUJ A;  4UF0 B;  2K5B B;  4IHJ E;  2L9Q A;  3JC6 D;  2ZM0 A;  4GOU A;  4IE6 A;  2ES0 A;  3AXJ A;  5HEG A;  4AQG A;  4DID B;  1W09 A;  2E9X C;  3ONJ A;  4HFH A;  4OYK A;  1KNP A;  3R6N A;  2CPT A;  3B57 A;  5AFU L;  2IIU A;  2XQA A;  4IRE A;  2XJ7 A;  4X62 T;  4ILC A;  2PBI A;  3UUN A;  2E5L T;  1D1A A;  4IDQ A;  1YW0 A;  2CEA A;  5AQN B;  2VQE T;  3KV9 A;  3TLV A;  2BVL A;  5FY0 A;  2WS3 A;  2CHO A;  1UX5 A;  2HN1 A;  4QH1 A;  5BR8 T;  2J1D G;  4TX5 A;  2XQ4 A;  1NEN A;  2V6Y B;  5DJQ C;  5LXT E;  2ZM6 T;  1HTJ F;  5HEJ A;  4X65 T;  3IEE A;  1HNZ T;  3NRY A;  3PUQ A;  3ZKR A;  5J0Z A;  3A8Y C;  2CCQ A;  3N9O A;  2E9X A;  5LBQ B;  4L9I A;  3RI5 A;  2HHH T;  4IE7 A;  2MOZ A;  5JQG E;  2J62 A;  2X51 A;  2UXN B;  2DWK A;  2W0G A;  3MA9 A;  5FKY A;  4ZI3 C;  5IHY A;  2SPC A;  3N9L A;  2ACZ A;  2KT9 A;  2V7K A;  3GMI A;  4IDP A;  5FY7 A;  5A1L A;  3VR8 A;  3F31 A;  2YN6 A;  5JDG A;  4YT0 A;  2IML A;  1X9B A;  3BQI A;  1E1H B;  5L3D B;  3Q5W A;  4AXP A;  3VKG A;  5GON E;  3CQX C;  3HKC E;  3Q5X A;  4GK0 E;  3CX6 B;  4Z8X A;  5H6R B;  2BBJ A;  3PV0 F;  4KBM B;  3TLS A;  2UXC T;  1I94 T;  2E9X B;  5FYM A;  3ZMU B;  5AQQ B;  3PJA J;  1YXR A;  5JVD E;  2CBI A;  2XHE B;  4AKH A;  1WYB A;  4DV5 T;  4TV8 E;  3AED A;  1WRD A;  3C4W A;  3P4W A;  2D0T A;  2WWV A;  3AEG A;  2BKN A;  5FXZ A;  1LVF A;  4ZHQ E;  4QXH B;  2Q9Q B;  1N32 T;  4UF0 A;  2A3D A;  1US7 B;  4P0A A;  3T1H T;  3DJB A;  4EZH A;  5ADX L;  1OXZ A;  4NUV A;  4WW0 A;  1LVK A;  5KMG P;  4JI6 T;  1MNE A;  2LSI A;  3AVR A;  4TN7 B;  1UK5 A;  3P4P A;  1HR0 T;  3PE0 A;  2HPJ A;  3P50 A;  4ZS2 A;  4U7Y A;  3W15 B;  1BR1 A;  5ABG A;  4BA9 A;  4HFC A;  4O4L E;  3SFE A;  3C98 B;  4EGW A;  3PUR A;  2WDR A;  4YHJ A;  4EOZ B;  1KF6 A;  4HN9 A;  4LF9 T;  5AQU B;  3ZN1 B;  4DUY T;  2WWU A;  2X68 A;  4A98 A;  4HFE A;  3UU5 A;  1G8X A;  4KUM B;  5DAB A;  2KMF A;  3SRZ A;  5FNV E;  5JTG A;  4ZI3 D;  2KWH A;  3RIF A;  2PJQ A;  4QWN B;  3CK6 A;  3ZC1 A;  4DR4 T;  3O1H A;  2A9U A;  5CB4 E;  4E7Z A;  3IBP A;  4I43 B;  1J1J A;  2JQ9 A;  3AEE A;  1UUS A;  4IL9 A;  1BR0 A;  4O8S A;  3VHL A;  5IUX A;  1VOM A;  3RYI E;  1I6Z A;  1Z8U A;  3KBT A;  1W0A A;  2EHO A;  3O1I A;  2H88 A;  3CX8 B;  3AB3 B;  3CPZ A;  4KX6 A;  2NR4 A;  3AVS A;  1T72 A;  4OK0 A;  3JAE A;  4CN1 A;  3WI3 A;  1MND A;  5IYZ E;  3AE6 A;  3RYH E;  3RLF F;  2C5J A;  4PK4 A;  3SWH A;  3ZC0 A;  4G63 A;  1H7C A;  3RPU A;  4X1Y E;  1SUM B;  2X66 A;  3HKD E;  4ERR A;  2C5I T;  2WAU A;  4IE4 A;  4OFZ A;  2IW5 B;  4HGA A;  1GQE A;  3M3Z B;  4CXW A;  1SHZ C;  5L47 A;  4N78 D;  2IAK A;  3HR0 A;  4DO0 A;  5ETW A;  2KIN B;  5FMN A;  3UQ4 A;  1FJG T;  2XM2 A;  2GK9 A;  1S35 A;  2XTL A;  4ILA A;  5AQP B;  4P09 A;  2P9B A;  4ADZ A;  4UEL A;  4YFS A;  3RH3 A;  1VCS A;  1DU2 A;  1W0B A;  4HKA A;  2LSJ A;  2NW9 A;  4H9N C;  3QNU A;  4NXM T;  3NRX A;  4IL4 A;  2CE7 A;  2MAW A;  2X9H A;  2CRB A;  3N9P A;  3N9Q A;  4H9S E;  4JLE A;  3B5M A;  4UV9 B;  5HEO A;  2W61 A;  2ACX A;  4YSZ A;  5HXE A;  2JQK A;  2LHR A;  2DNX A;  4COF A;  5M4Y A;  3WAJ A;  2UUB T;  4EYU A;  2FBW A;  4I55 E;  2LJL A;  2BKO A;  2YEV C;  3E0Z A;  4ISS A;  2OA5 A;  4JI4 T;  3L3P A;  3UU4 A;  2KXP B;  3P7I A;  4QKN A;  5JRC A;  2MTQ A;  2VB6 A;  3CML A;  5AQT B;  4O4I E;  1YQ3 A;  4LFB T;  4DND A;  4O4H E;  3GN5 A;  3P4R A;  2Z6E A;  2VKD A;  4L0R A;  2WZI A;  2CXD A;  4ZZB A;  1D0Y A;  5JDH A;  4UVA B;  1Z0P A;  2CBJ A;  2FUP A;  2LSK A;  1M7K A;  2PFV A;  2DHR A;  2V26 A;  3CQG B;  3EDU A;  5FVK A;  3TKL B;  4DUZ T;  3ANW B;  2CWY A;  2XQ3 A;  3PUV F;  2KLQ A;  4LMK A;  4X66 T;  5LGN B;  1OED A;  2D2S A;  4PFP A;  5LYJ E;  2I6H A;  4PJL A;  3J7Y q;  3ZMV B;  1ZEE A;  2UUC T;  3AE2 A;  2M67 A;  1ZP0 A;  2CLY C;  2YDR A;  4ZXL A;  1YD8 G;  1HG5 A;  2VK9 A;  2WSS V;  3K3O A;  3KV5 A;  4U3C A;  1YKE B;  4ZI7 E;  1FEW A;  1D1C A;  4JI1 T;  3FZL B;  3F2E A;  1IBK T;  5HXC A;  4EIW A;  4M1P A;  3AE8 A;  3ONL C;  5AQH B;  4X1I E;  4X64 T;  2XQ6 A;  3I0O A;  1D0Z A;  1J5W A;  3ZN0 B;  4A5X A;  4QH4 A;  5FL1 A;  1VCT A;  4P0B A;  4UXN B;  2YOE A;  3NZQ A;  2JQH A;  4KHP T;  1HX1 B;  4Z91 A;  4CN6 A;  4H63 H;  4Q25 A;  5LGU B;  3QOF A;  2W4X A;  2I0M A;  2BZB A;  2I59 A;  2WMN A;  3PU3 A;  2XQ9 A;  3KV4 A;  4HEA A;  3RQW A;  3UU6 A;  5DQV A;  3LK4 2;  2MPK A;  5AQM B;  2M6I A;  5JDF A;  2OLT A;  4KHZ F;  4EZ4 A;  2WCA A;  3RKO A;  3LJC A;  2V5C A;  4JEU B;  3T1Y T;  4GKJ T;  2NP9 A;  1HG2 A;  2WBL A;  4B3M T;  1SE7 A;  3NVO A;  2A2F X;  2M6B A;  2W67 A;  3C64 A;  3JCF A;  2XAQ B;  1JNR A;  2KND A;  3PUZ F;  1S94 A;  4WYV A;  5HCJ A;  5ABF A;  2RPA A;  1MIV A;  3OJA A;  2WMO A;  4YXD A;  1XDO A;  5LHG B;  5C3J A;  4B3T T;  4XAX B;  3TLT A;  2VL8 A;  3B13 A;  2AXD S;  2XAJ B;  5TAO A;  2NTY A;  4MBQ A;  3CX7 B;  2LOP A;  4UR9 A;  2PTF A;  1WYC A;  2R6G F;  3RKG A;  3ZST A;  5CA0 E;  2X9Y A;  3ONX A;  2A72 A;  1MMN A;  2CA5 A;  4PK5 A;  5HXR A;  3LBX B;  4U7I A;  3LK3 B;  3ZJ1 A;  3DP7 A;  5AQG B;  3ZCI A;  2DCF A;  5C8Y E;  5JH7 E;  3AE9 A;  2XAG B;  4EYY R;  4H63 V;  5HXH A;  1CUN A;  2BG9 C;  3UFE A;  4YJ3 E;  4QX8 B;  5HEU A;  2XAF B;  4QXB B;  1KNZ A;  5LGT B;  3JC6 C;  4YJ2 E;  3ZT6 A;  4LFA T;  1JNZ A;  3ETU A;  5JDL A;  4K0K T;  2LT3 A;  2X9W A;  3TLU A;  1E2A A;  2FJB A;  2JMK A;  2VL0 A;  2YDS A;  2QYW A;  4HFV A;  4IIJ E;  4TV9 E;  2FJD A;  4H9P C;  3ESL A;  5H6Q B;  3OYX A;  2HN2 A;  3PTR B;  3UQ7 A;  3P4S A;  4PK6 A;  4UV8 B;  4EXT A;  5AQF B;  2VVS A;  4UEM A;  2QVA A;  1UUR A;  1HF8 A;  2NTX A;  2V7I A;  2VAS A;  1T7S A;  2XAH B;  1FMW A;  3QC9 A;  3PU8 A;  4HWH A;  5CJ5 A;  4YHH T;  4B3R T;  2CXF A;  3EVY A;  5F5W A;  3VRB A;  4B6X A;  3IHR A;  3AAI A;  3J9X 1;  1XWM A;  3UUX B;  5FXX A;  3PUW F;  4DV6 T;  1OED B;  2VKJ A;  3EUH A;  5AQL B;  2LSY A;  4YLH A;  4TWF A;  4PJN A;  3AEF A;  4HWI B;  3U78 A;  5L3B B;  3BQL A;  4X5T A;  3RC8 A;  3RIU C;  4O2A E;  1Y01 A;  2VVN A;  5ABE A;  2E5V A;  1KFY A;  1YKH B;  3QB5 A;  3KDS E;  3FZH B;  4FI5 A;  4H9O C;  3QK6 A;  5EK3 A;  5J2T E;  4DV7 T;  4AKG A;  4QX7 B;  2Y8D A;  1R8I A;  5FY1 A;  4C91 A;  4F6R C;  2CM0 A;  5CA1 E;  5AQR B;  4JI8 T;  1IZN B;  1QLB A;  1BR2 A;  3UUM A;  4F8H A;  4JI2 T;  4HWF A;  3NWI A;  2X67 A;  3FZK B;  3NZP A;  5LMN T;  2BS4 A;  1UX4 A;  2V8S V;  2QRX A;  3RYC E;  5J2U E;  3H37 A;  2LHN A;  2XUE A;  2ZMA A;  4ZEY A;  5FP3 A;  3QB5 K;  1KEY A;  4MFR A;  3ZLI A;  2W2U A;  2FJE A;  1WLX A;  4C90 A;  4GIW A;  3AEA A;  4YY3 T;  3L09 A;  2CLY B;  2CWO A;  4H9R C;  4ZI2 D;  3OPC A;  1N36 T;  2UXB T;  3EAM A;  2H3R A;  5LG3 A;  4IDZ A;  3AA0 B;  3CIR A;  5L4H A;  4K0U A;  4UIG A;  4X1K E;  4BAY B;  2XSA A;  2V7M A;  2BKP A;  4ZOL E;  5KXJ A;  3FZF B;  3K1S A;  2C5K T;  3FHN A;  4EB6 E;  4DBR A;  4JUY A;  3F57 A;  2XPK A;  1J5E T;  2UU9 T;  3C50 A;  3T8O A;  3PUX F;  4JI0 T;  3Q9D A;  3UUB A;  2EHO B;  4DR6 T;  2NW8 A;  5HYA A;  2Y48 B;  2IHR 1;  2OV9 A;  1XDP A;  3CWZ B;  2WDQ A;  4I4T E;  1IJ6 A;  4NUU A;  2WB5 A;  4DMV A;  3O9X A;  4JV5 T;  4WZX A;  2VKH A;  5HWX A;  4DV2 T;  2WU5 A;  4AKI A;  2BG9 A;  1B7T A;  2LOS A;  1U5P A;  1Y64 B;  3E22 E;  4HFI A;  1N33 T;  4U2Y A;  2LSG A;  2X0Y A;  5IWA T;  2W63 A;  4LF4 T;  3UU3 A;  5HWY A;  2MBG A;  2QA7 A;  1MMG A;  3V5S A;  4AIU A;  3C4Z A;  2XQ5 A;  2UUA T;  4CI2 B;  2NW7 A;  3ZYM A;  3WAK A;  3LK2 B;  2ZLY A;  2VKO A;  3JAF A;  3RRW A;  4CXX A;  3ZCJ A;  1XNR T;  2WZH A;  5CFB A;  2LLY A;  2WDV A;  3OYZ A;  4PJJ A;  4MAL A;  3VKH A;  2E8I A;  3DTO A;  3ZYL A;  5FXV A;  1QSD A;  4PNI A;  4A56 A;  4EEB A;  5LHI B;  2AE9 A;  1KNR A;  3OVU A;  4NIQ A;  5J1G A;  4B3S T;  3Q5D A;  5JRE A;  4HFD A;  4IE0 A;  3ABV A;  3I9W A;  3KV6 A;  3LSV A;  2V7J A;  2VUR A;  5FL0 A;  1EZ3 A;  2W62 A;  3SS1 A;  5F3J A;  4YTP A;  4IT4 A;  5L3C B;  2EHO C;  4AQF C;  4LMJ A;  5JR9 B;  1HNW T;  4V1A v;  2Q9Q A;  3AAE B;  4XBF B;  4HWD A;  5L3E B;  1D1B A;  4U33 A;  1MIY A;  1ZKE A;  4IDO A;  3I1A A;  4KI0 F;  2BG9 B;  3GWH A;  1AJ3 A;  2LKH A;  3H3A A;  3N2K E;  3AXJ B;  4ILU A;  4O2B E;  4TWD A;  2K24 A;  4ZS3 A;  5AQO B;  5HEH A;  4E7S A;  4YTN A;  4I0U A;  4TNV A;  1WFD A;  4DR3 T;  1VRB A;  4AKR B;  4LF5 T;  5KDM C;  3CQC B;  2XQ7 A;  3GA8 A;  4DMW A;  4DBQ A;  3FXD B;  3OBV E;  2BG9 E;  3BQK A;  3I9Y A;  3I0Q A;  2IC9 A;  3M65 A;  4HFB A;  4QH5 A;  3UU8 A;  1IBM T;  5JR9 C;  2KZ7 B;  2X9X A;  4JI7 T;  2BDE A;  2Q9Q D;  3PUS A;  2J4G A;  4ZZC A;  2LM2 A;  4FJO A;  5L3G B;  5JRC B;  3RRC A;  2V5D A;  3EI0 A;  4GKK T;  3RHW A;  4WBN E;  2E9X D;  3EDV A;  4TWH A;  3ZPO A;  3N9M A;  1IJ5 A;  3O1J A;  5JDN A;  1W9R A;  4ANJ A;  2ZM2 A;  4IDN A;  3SOL A;  3BK9 A;  3KVB A;  2K48 A;  2XAS B;  3KVA A;  4YSY A;  2FJA A;  3RIA A;  4DV1 T;  4WNK A;  4IE5 A;  2WP9 A;  1OED C;  1SA0 E;  3ETV A;  4KMC A;  5HCM A;  5CGM A;  5LP6 E;  2LRL A;  1MMA A;  4LML A;  4JI5 T;  3ZT7 A;  2YDQ A;  2YU1 A;  4CXY A;  2VQF T;  1G73 A;  2NWB A;  2D0U A;  2XM1 A;  1CHU A;  1D0X A;  1M62 A;  3OKQ A;  2VWA A;  3G06 A;  3MAC A;  1L0V A;  2XQ8 A;  3V5U A;  3TLW A;  1U4Q A;  2Y6X A;  3LDQ B;  2BVM A;  4CN4 A;  4WBO A;  2NOX A;  4UVB B;  4YSX A;  4ZI2 C;  2XZE A;  5FVL A;  5FXW A;  4CZZ B;  4DV3 T;  2G0U A;  3KFW X;  3O4X E;  2HH7 A;  1XMQ T;  3UFG A;  2XY8 B;  3P8C D;  2V7L A;  4Z90 A;  3PUG A;  4MLK A;  3N2O A;  2LE8 A;  3ZSS A;  3ZMS B;  2K9A A;  4I50 E;  4LFC T;  4PJM A;  4DR2 T;  3UUL A;  4AQY T;  4BJN A;  1HCI A;  5L3F B;  1UCU A;  3RGL A;  2JJ9 A;  3R84 B;  3VRA A;  3MJX A;  3NBX X;  4YTM A;  4EV6 A;  4JI3 T;  4TZ4 C;  4HTE A;  2JPF A;  3MXZ A;  2DL1 A;  3ZT5 A;  4GK5 E;  3PUY F;  3N2G E;  2V1D B;  2LKG A;  3K8P C;  4CI1 B;  1V9D A;  3RF1 A;  5E0O A;  1XNQ T;  4J2C A;  3K3Q C;  5AQK B;  3AE4 A;  5JR9 A;  4AI6 A;  1NAF A;  4JBW F;  1ZHC A;  2V6X A;  3P4Q A;  2UXD T;  2JIW A;  1LKX A;  2D9D A;  2BS3 A;  1HNX T;  1HS7 A;  4DV4 T;  2CHN A;  2JRK A;  3AEB A;  5DQW A;  3AE3 A;  3EAB A;  5LCY A;  3SFD A;  3X1D A;  5ABF B;  2F4V T;  5LMU T;  3AE1 A;  3MK7 C;  5JDM A;  4LF6 T;  1FMV A;  3LFM A;  1KK7 A;  3IF8 B;  4PFO A;  3UTK A;  4EED A;  3C51 A;  2KWI B;  1N34 T;  3L8R A;  4L5G A;  1LRZ A;  3E08 A;  4O4J E;  4MHC A; 
#chains in the Genus database with same CATH homology
 4OX9 T;  1N33 T;  5IWA T;  4LF4 T;  4KHP T;  4DV5 T;  1IBL T;  2UUA T;  3T1H T;  1XNR T;  4JI6 T;  3T1Y T;  4GKJ T;  4B3M T;  1HR0 T;  4B3S T;  4AQY T;  1HNW T;  4LF9 T;  4B3T T;  4DUY T;  4JYA T;  4DR4 T;  4DR3 T;  4LF5 T;  4LF8 T;  1XMO T;  4NXN T;  1IBM T;  4JI7 T;  4DV0 T;  4GKK T;  4LFA T;  4K0K T;  4DR1 T;  4DR5 T;  4DV1 T;  4LF7 T;  1N32 T;  4JI5 T;  2VQF T;  1FJG T;  4YHH T;  4B3R T;  4DR7 T;  4NXM T;  4DV6 T;  3OTO T;  4DV3 T;  2UUB T;  1XMQ T;  4DV7 T;  4X62 T;  4JI4 T;  4LFC T;  2E5L T;  4DR2 T;  4JI8 T;  2VQE T;  4LFB T;  4JI2 T;  5LMN T;  4JI3 T;  5BR8 T;  2ZM6 T;  4X65 T;  1HNZ T;  2F4V T;  4YY3 T;  4DUZ T;  2HHH T;  4X66 T;  1XNQ T;  1N36 T;  2UXB T;  2UXD T;  2UUC T;  1HNX T;  4DV4 T;  1J5E T;  4JI0 T;  2UU9 T;  4DR6 T;  5LMU T;  4LF6 T;  4JI1 T;  4JV5 T;  1N34 T;  1IBK T;  4DV2 T;  2UXC T;  1I94 T;  4X64 T; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...