1N33T

Structure of the thermus thermophilus 30s ribosomal subunit bound to codon and near-cognate transfer rna anticodon stem-loop mismatched at the second codon position at the a site with paromomycin
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
99
structure length
99
Chain Sequence
RNLSALKRHRQSLKRRLRNKAKKSAIKTLSKKAIQLAQEGKAEEALKIMRKAESLIDKAAKGSTLHKNAAARRKSRLMRKVRQLLEAAGAPLIGGGLSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S RIBOSOMAL RNA
publication title Selection of tRNA by the Ribosome Requires a Transition from an Open to a Closed Form
pubmed doi rcsb
molecule tags Ribosome
total genus 34
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 2002-10-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
T PF01649 Ribosomal_S20p Ribosomal protein S20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.110 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Ribosomal protein S20 1n33T00
4DV1T 4DV2T 4JV5T 4LF9T 1HNZT 2E5LT 4JI7T 4LF5T 4NXNT 1N32T 4DV3T 4DR3T 4DR7T 4DV0T 4JI4T 1IBMT 4KHPT 3OTOT 5BR8T 4LFCT 4DUYT 1J5ET 4LFBT 4YHHT 4X62T 4GKKT 2UUAT 4B3MT 5LMNT 4DV5T 4JI1T 2UXBT 4NXMT 4B3RT 1IBLT 4LF7T 2ZM6T 4B3TT 2VQET 4GKJT 2VQFT 5LMUT 4JI0T 4X66T 4AQYT 4LFAT 1HR0T 1HNXT 1I94T 1HNWT 4JYAT 3T1YT 4B3ST 1FJGT 1IBKT 4OX9T 1XNRT 4X64T 4JI3T 3T1HT 2UXDT 4JI6T 2UUBT 2UUCT 4K0KT 2UU9T 4LF6T 5IWAT 4LF4T 1XMOT 4LF8T 1XMQT 4DV4T 1N36T 4YY3T 4DR6T 1N34T 4DUZT 4JI5T 1N33T 4JI8T 4DR2T 4DR1T 4JI2T 4DV7T 2F4VT 2HHHT 1XNQT 4X65T 4DR4T 2UXCT 4DV6T 4DR5T
chains in the Genus database with same CATH superfamily
2V1DB 3ZEFB 3Q5DA 5HXHA 5KX5E 4ZHQE 2VWAA 3IHRA 1IJ5A 2WBLA 3FZFB 1MMAA 3Q9DA 4PJJA 2A72A 5LBMA 5AQSB 5JR9C 2A2FX 5JR9A 4TX5A 1IBLT 4B3TT 3QC9A 4QH1A 2W67A 4HFBA 5ADXL 3JAFA 3Q5WA 3VKHA 4YHJA 1WR6A 3I0QA 2K5BB 1BR0A 3MJXA 1Y64B 3ZC1A 5AFUL 2XQYA 2V7MA 4ZEYA 4JI3T 3PUQA 1SE7A 4IDOA 4EIWA 3OPCA 3AE8A 2BG9C 2WDRA 4DBRA 3F57A 4DV4T 3ETUA 5AQVB 4QH4A 2PJQA 3JC6D 1MIVA 2WWVA 4DVDA 2ODUA 2WS3A 2E9XC 4O2AE 2BS3A 4TV8E 2E9XA 1G73A 2LOPA 2LHRA 5LP6E 2K3WA 5HCJA 4YTPA 1N32T 5HXSA 2XAGB 3PU3A 2CXLA 5DABA 3TLVA 2V6YB 2CLYC 4I0UA 5LGNB 3NZQA 4DUYT 4LFBT 2PBIA 1LVFA 4U33A 1MMNA 1MIYA 4PFPA 3K3OA 2XTLA 3CK6A 4FJOA 5EK2A 2X66A 4UV9B 3PUZF 5CJ5A 2YDRA 4X1YE 3AEGA 5IUXA 2OA5A 2XM1A 2LJLA 2D2SA 3P4SA 4U2YA 5CA0E 2LRLA 1IBKT 4UF0B 1UGOA 3KVAA 4UR9A 4JI6T 3CQXC 2XQ9A 3C64A 2FUPA 4TNVA 4COFA 4KMCA 3SWHA 4UIGA 4BA9A 2NR4A 2OV9A 5L3DB 1FEWA 1D0YA 3DP7A 2A3DA 3RKOA 3SFEA 3WAKA 5KMGP 4ZI3C 2B1EA 4DV1T 4NUVA 3HKEE 4XZCA 3AA6B 3AVRA 1YXRA 2V7IA 4HE8A 2WDVA 2J62A 2FJBA 3AAIA 3EI0A 4DV3T 3CX8B 5JDNA 4ANJA 4CI1B 4DV0T 3HL6A 3BQLA 2HPJA 2IUBA 4AQFC 4HWHA 3RIAA 2QVAA 4N78D 2KT9A 4WBOA 3RC8A 2YN6A 4PK5A 2E9XD 4GKJT 4UXNB 1WLXA 4QH5A 4HTEA 2BKOA 3LBXA 3D0TA 3LK3B 4TWFA 3DJBA 2XSBA 4YT0A 2PFVA 5JDQA 4JUYA 2G0UA 4EZHA 3H3AA 4IE4A 4IDPA 2ODVA 5FKYA 4YTNA 2W62A 2VKHA 2VKOA 1OEDA 2UUBT 3ONJA 4M1PA 2W0GA 3VU7H 2NTXA 3CWZB 4PK4A 2NTYA 5IWAT 2BS4A 1SA0E 3L3PA 1XMQT 2EHOC 3UTKA 1T8BA 1FMWA 1VOMA 4ASKA 2HHHT 4P1NA 1UX5A 2JRKA 2W4XA 3SRZA 3FBZA 1HNZT 1UK5A 2I0MA 2Q9QB 4JEHB 4LF5T 5LBQB 2LM9A 3O1HA 4ADZA 1QLBA 3LK42 2JQHA 4HEAA 1MMDA 2GK9A 5HEJA 3U78A 3RYFE 3MK7C 3EVYA 4O4IE 2ZM8A 2KMFA 2CHNA 1X9BA 3AEAA 3AVSA 3A8YC 4PJMA 1ZEEA 2VVNA 2J1DG 3N2OA 4QXHB 3OJAA 3KDSE 5FY7A 2BG9B 2RP4A 3ZT5A 3PUGA 4HFCA 1T7SA 2WQYA 4OX9T 5FXWA 3E22E 4U7YA 2XAFB 3N5LA 3UUXB 2XUEA 2ZLYA 4U74A 2KZ7B 4J2CA 1I6ZA 2JPFA 2FJAA 3PTRB 4ZZBA 2BVMA 5L3BB 2X0LB 3P7IA 3I9YA 2YOEA 2Y6XA 3C98B 2CXFA 2W2UA 4ZI2C 4UEMA 5LG4A 5JDLA 2P9BA 1U4QA 3EDUA 2WDQA 4H9QC 2Z6EA 1D0ZA 2E5LT 2VL8A 3UUMA 4JI7T 2L8KA 2R6GF 2DI4A 3NRXA 4PW8A 4IIJE 5F8PA 3PV0F 4ILUA 5JDGA 3ZMZB 4GYRA 2FJEA 2HN2A 1ZV4X 2HH7A 5JDHA 2VKDA 4QXCB 4CXYA 2EHOD 2HN1A 2QA7A 4TN7B 1UX4A 4A5XA 5AQUB 1M7KA 4IDZA 2YU1A 3P50A 3RYHE 5AQFB 4HWDA 4HFDA 2IW5B 5FXXA 1HF8A 3QK6A 3SOLA 2VASA 2CHOA 3QB5K 2H7VC 4IDNA 5LGTB 2XQ8A 1IJ6A 5IYZE 3UQ4A 1KEYA 2UXDT 3IF8B 5HWXA 2H7OA 3PURA 3RIFA 4G2AA 1S94A 4MHCA 3UU5A 2W66A 4LF4T 1NEKA 5LYJE 5AQNB 1N36T 3ZN0B 3TLTA 4ILCA 4GOUA 2XQ7A 3I0OA 1W9RA 4QX7B 2ES0A 4O2BE 1H7CA 4OHFA 5FNVE 4L9IA 4X65T 2WB5A 4DR5T 5LB7B 1BR1A 2M67A 3K3QC 2V8SV 3LBXB 2BVLA 3EHZA 3AXJA 3QNUA 4HWCA 2JMKA 2AXDS 3AB3B 2DWGA 3OVUA 4WZXA 2MTQA 4ZI2D 3CQCB 4H9RC 4DMVA 4NXMT 5HYAA 4ERRA 5C3JA 2VB6A 4P0BA 5J2UE 3T1YT 2BDEA 2CPTA 4Z90A 5EK4A 4A98A 5HXRA 2WP9A 2EHOB 3P4QA 3H3MA 3PUVF 2NW7A 2QYWA 3GN5A 3ZPOA 4A97A 4EGWA 4EXTA 4AKGA 4C90A 2XAQB 4AXPA 4GIWA 3UU6A 3FXDB 4IE7A 4QXBB 1WYBA 4DUZT 2LOSA 1N33T 4JI8T 1FMVA 5LA6E 1U5PA 3CKDA 3C4XA 3N2KE 3P8CD 4TNWA 3UULA 3AAAB 4UELA 4QX8B 2YK0A 4YSXA 2PG8A 4HKAA 5CGMA 2JJ9A 2BKPA 4O4JE 3VKGA 3ZYLA 5ABFA 3SFDA 2M6BA 2D9DA 2X0HA 5CFBA 2V5DA 3PU8A 2XQ6A 3ZCJA 4CN1A 4TWHA 2UXBT 3AE2A 3RKGA 4LF7T 3VRAA 4H9SE 4QKNA 3J7Yq 2CBJA 2CRBA 2WU5A 3ZMSB 2DLRA 2FJDA 2KSRA 4ZXLA 3UUBA 1D1CA 3AA7B 3WAJA 1MIWA 5CA1E 4X1IE 3ZMVB 2SPCA 3ETVA 4KBMB 2YKSA 2E8IA 2IIUA 4X5TA 2WZIA 3EUHA 5AQHB 5JREA 4MFRA 3Q5EA 1IAPA 4I4TE 3JAEA 4CZZB 4PFOA 4DR6T 4UVBB 3ESLA 3JADA 1HFAA 2CMRA 3ZT6A 3K3NA 3IEEA 3HR0A 4ISTA 2IC6A 5HEGA 5IHYA 2UXCT 2CE7A 3I9WA 2C5IT 4IDQA 4MALA 4Z8XA 3ZMUB 3NVOA 2BBHA 3E08A 3P4PA 5JVDE 4EYYR 2LM2A 3AE7A 4IE0A 3AEBA 3CVRA 1D0XA 1SHZC 1WFDA 3RRCA 2XM2A 1ZOYA 4DMWA 4JI1T 2MOZA 3CIRA 4PNIA 2ZM6T 5J2TE 4X66T 5L4EA 2V26A 1HR0T 1Y01A 3IBPA 4JYAT 4KX6A 2DNXA 4ZS2A 4LMKA 5HWYA 3RQWA 3RRWA 4ZS3A 5AQOB 3HI2A 2DL1A 3RGLA 4KHZF 5JRCB 4U7IA 4ZOLE 5DJQC 2UUCT 1AJ3A 3V5SA 2UU9T 3P4RA 2ZMAA 3UU8A 4P09A 4A56A 4H63H 2X9YA 5LJMA 2MPKA 3FZHB 4BJNA 3AEDA 2XQ4A 1N34T 4I43B 1OEDC 2LHNA 3AE9A 3AE3A 4DV6T 2CBIA 2BG9E 2QRXA 2XAHB 1D1BA 3C50A 5FYMA 4L5GA 2ACXA 5JQGE 3CPZA 1B7TA 5JDFA 1E2AA 4ILAA 4KHPT 2JQKA 5BR8T 2IAKA 2X68A 3ONXA 5FXZA 2WM9A 4DO0A 5JR9B 3LJCA 4EAHA 3AE1A 2X0YA 5CB4E 2X9HA 4NIQA 1D1AA 3AEEA 5L3CB 5FY1A 1KNPA 5FVLA 3FZLB 3V5UA 4JI0T 3LK2B 4YXDA 4CN4A 2MYSA 1CHUA 2N2NA 4NUUA 2QGSA 4Z91A 1L0VA 3O9XA 3C4WA 1KK7A 1HCIA 4BJMA 5HEUA 4OYKA 3KV9A 4KP3C 3KVBA 4PJNA 2E5VA 4YSZA 4I55E 4O4LE 4B6XA 2WY2A 3ZMTB 3OYXA 2WU2A 3MA9A 1YD8G 3F2EA 5A1LA 3A7MA 3I1AA 2DWKA 3NKZA 3RQUA 2E9XB 3ANWA 4DV7T 3ZJ1A 4UV8B 1OWAA 4DR4T 1X79A 4YLHA 1HTJF 1MNDA 4TV9E 3ZN1B 1LRZA 1ZP0A 4ZI7E 5KDMC 3PUSA 2CLYB 3F31A 1WR0A 4HFIA 3ZT7A 4DR3T 2BS2A 5FXVA 5C2TA 2XQ3A 3LG7A 4GKKT 2XZEA 2V6YA 4AI6A 2XQ5A 3L09A 3RH3A 4UVCB 5L2LA 4CQIA 2VQET 2IHR1 5LMUT 4XBFB 2XPKA 1T98A 3DTOA 4EEDA 4TWDA 5FL0A 2WSSV 3ZSTA 4CN6A 2ZM0A 4WYVA 2V5CA 1HX8A 5EZYE 4UF0A 2LEHA 1T72A 5J1GA 5FP3A 5L3GB 3S4UA 3E0ZA 4TUYE 4GYSA 3RX6A 3ZYMA 3RYIE 3UUNA 5E0OA 2FBWA 3HKCE 3RHWA 1MNEA 4WNKA 3NZPA 5L3FB 2JIWA 4DR2T 3U3IA 3FZMB 2YINA 4Q25A 5FY0A 2Y8DA 5LHHB 1UUSA 3GWHA 5HAXA 5DQVA 2KNDA 1XWMA 4IE5A 2NP9A 4JI4T 4HFHA 4IE6A 4JEUB 1BR2A 1DU2A 3Q2MA 3NWIA 4IL9A 1GQEA 2Y48B 4B3MT 5LMNT 1YKHB 5LJNA 3FXEB 5LOVE 1YQ3A 3AA1B 4AQYT 4HGAA 3OBVE 2D0UA 3CX6B 4JBWF 3RLFF 2X51A 2CXDA 2YDSA 4I50E 4EOZB 2DHRA 1J5WA 3N9OA 4DIDB 2KWHA 3VR9A 2OLTA 4IREA 3K8PC 4AISA 1M62A 1G8XA 2PTFA 4EV6A 2VKJA 1OEDB 3N9PA 4X64T 3N9QA 5JDMA 2X9WA 4LF6T 5BMVE 3T8OA 1NENA 2YDQA 3FZKB 3PUAA 5AQLB 2YEVC 1BR4A 2N9DA 2K48A 1FIOA 2V7JA 5AQJB 2F4VT 3N9LA 4U3CA 5LXTE 1XNQT 3GMIA 2BBJA 1KNZA 4FI5A 2V7KA 2LSKA 5AQQB 2Q9QC 2C0SA 2Q9QA 4H9NC 3PDYA 5AQKB 4LFCT 3AE5A 4V1Av 2LE8A 4YHHT 4H63V 1QSDA 3N2GE 3PUYF 4KI0F 1LVKA 3HKDE 1YW0A 3NRYA 1YQ4A 3AA0B 2XAJB 4QHOA 2CCQA 3KV6A 3ZCIA 1E1HB 3SS1A 2V7LA 5LNKA 3UFGA 3HA4A 2LKGA 2BKNA 2BG9A 4CXXA 3KV4A 2VVSA 5DQWA 4OFZA 4YJ2E 1MMGA 3MKDA 3O1JA 3J9X1 3ANWB 3T1HT 3HKBE 3UFEA 3RI5A 3W15B 3KINB 2KLQA 4C91A 5AQPB 1XDOA 5H6QB 4MLKA 5L3EB 3TLSA 4OK0A 3UT5E 2IMLA 5ETWA 4JI5T 4ILBA 3AAEB 2RPAA 3TLUA 2HPLA 3QUJA 3AEFA 3MZKB 1JNZA 4DV2T 4JV5T 1EZ3A 3PJAA 3ONLC 3A5XA 2M6IA 2VK9A 3OYZA 5KXJA 3Q5XA 2C5KT 1IBMT 3NBXX 4L0RA 1J5ET 1V9DA 1KFYA 4CI3B 4KUMB 5L4HA 3L39A 1OXZA 4EYUA 2KWIB 2XSAA 3GA8A 3LSVA 2I6HA 2W00A 2Q9QD 2NW8A 2H88A 3UU4A 1HG2A 1VRBA 1XNRT 1E7PA 2WWUA 2K9AA 4U2ZA 3VHLA 3KBTA 3M3ZB 3BK9A 2A9UA 4F6RC 4PAGA 4LF8T 2YU2A 3N9MA 1R8IA 2CM0A 1WCRA 2NW9A 2I59A 5EK3A 4O8SA 1HG5A 2K24A 3JCFA 5AQIB 4AKHA 1WRDA 3B57A 3O4XE 3FBLA 4IHJE 4DR1T 4MBQA 4AQFA 4IT4A 3ZJ2A 4ZZCA 4LMJA 2NOXA 2D0TA 3ZLIA 3KV5A 2D5UA 2L3LA 1W0BA 3AXJB 5L47A 3EDVA 4NXNT 3C4ZA 1CUNA 3B5MA 4EEBA 1SUMB 3ZSSA 4IL4A 3AE4A 3R84B 5HXEA 4HWIB 3PE0A 4BAYB 2UXXB 3L8RA 4JLEA 3ABVA 4HWFA 2VL0A 1J1JA 2XHEB 3B13A 3N9NA 2LLYA 5M4YA 3WI3A 4YJ3E 4LFAT 3TKLB 4E7ZA 1XDPA 3CX7B 2WMNA 5TAOA 2B76A 2KXPB 3OKQA 2V6XA 5FL1A 2RA1A 3PJAJ 3GN5B 4O4HE 3C51A 4E7SA 2WZHA 3K1SA 2EHOA 3VRBA 4WBNE 3AECA 1NAFA 3RPUA 2AE9A 2LT3A 3TLWA 2LSGA 2ZM2A 2WAUA 4GK5E 4YTMA 3RYCE 1VCSA 3ZYKA 4XAXB 5J0ZA 2X9XA 2MBGA 3UU3A 3VR8A 4EZ4A 2N1GA 3KFWX 4IGUA 4JI2T 2LSJA 2JMHA 3BQKA 4X20E 1Z0PA 4LF9T 3EABA 1UURA 1WYCA 5LHIB 1S35A 5ABFB 4ZI3D 4X1KE 2VURA 1W09A 4AQGA 1HX1B 2H89A 5LHGB 2XJ7A 1JNRA 2JQQA 4H9OC 5ABGA 5FVKA 2LRKA 3RC3A 2X67A 4U72A 4HFVA 1QUUA 3G06A 4B3RT 4PK6A 2CWOA 5HEOA 3O1IA 2VQFT 5LCYA 3LDQB 2CA5A 1I94T 4DNDA 2NWBA 2C5JA 4UVAB 4CI2B 4B3ST 1KNRA 1ZHCA 2J47A 2J4GA 4HFEA 3EAMA 4YFSA 3R6NA 4YSYA 3RIUC 4QWNB 4CXWA 2MAWA 2E2AA 3RIUA 4OYJA 3QOFA 5AQRB 4K0KT 1IZNB 3CQGB 5AQTB 4ISSA 4H9PC 2H3RA 1ZKEA 3FHNA 4AKLA 5JTGA 5F3JA 1XZYA 1O3XA 3UQ7A 5HEHA 3MXZA 2XY8B 2KINB 4K0UA 1YKEB 2LSYA 5HXCA 3RF1A 3PUXF 3QB5A 3H37A 4TZ4C 4LMLA 5LGUB 5C8YE 4G63A 2XASB 2W61A 2XQAA 1OEDE 3FB2A 4P0AA 4DR7T 1W0AA 2IDOB 2BZBA 5ABHA 2CWYA 3BQIA 2DCFA 3OTOT 3KBUA 5AQGB 5H6RB 1UCUA 2W63A 3LFMA 4X62T 2WMOA 3CMLA 4GK0E 2UUAT 1VCTA 5AQMB 2L9QA 4DV5T 2IC9A 1LKXA 5FMNA 3ZC0A 3P4WA 4U31A 1HS7A 4DBQA 5ABEA 3MACA 1HNXT 3JC6C 2JQ9A 2LKHA 3X1DA 1HNWT 5F5WA 5LG3A 2UXNB 4HN9A 3ZKRA 1FJGT 2LSIA 3PUWF 4PJLA 5GONE 3AE6A 1NWMX 5JRCA 2CEAA 1KF6A 4NPPA 1US7B 4WW0A 2WCAA 3M65A 1XMOT 3IA3A 4YY3T 2ACZA 4AKIA 1Z8UA 5JH7E 5HCMA 4EB6E 4AKRB 4AIUA 4F8HA
chains in the Genus database with same CATH topology
4DV1T 4DV2T 4JV5T 4LF9T 1HNZT 2E5LT 4JI7T 4LF5T 4NXNT 1N32T 4DV3T 4DR3T 4DR7T 4DV0T 4JI4T 1IBMT 4KHPT 3OTOT 5BR8T 4LFCT 4DUYT 1J5ET 4LFBT 4YHHT 4X62T 4GKKT 2UUAT 4B3MT 5LMNT 4DV5T 4JI1T 2UXBT 4NXMT 4B3RT 1IBLT 4LF7T 2ZM6T 4B3TT 2VQET 4GKJT 2VQFT 5LMUT 4JI0T 4X66T 4AQYT 4LFAT 1HR0T 1HNXT 1I94T 1HNWT 4JYAT 3T1YT 4B3ST 1FJGT 1IBKT 4OX9T 1XNRT 4X64T 4JI3T 3T1HT 2UXDT 4JI6T 2UUBT 2UUCT 4K0KT 2UU9T 4LF6T 5IWAT 4LF4T 1XMOT 4LF8T 1XMQT 4DV4T 1N36T 4YY3T 4DR6T 1N34T 4DUZT 4JI5T 1N33T 4JI8T 4DR2T 4DR1T 4JI2T 4DV7T 2F4VT 2HHHT 1XNQT 4X65T 4DR4T 2UXCT 4DV6T 4DR5T
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DV1 T;  4DV2 T;  4JV5 T;  4LF9 T;  1HNZ T;  2E5L T;  4JI7 T;  4LF5 T;  4NXN T;  1N32 T;  4DV3 T;  4DR3 T;  4DR7 T;  4DV0 T;  4JI4 T;  1IBM T;  4KHP T;  3OTO T;  5BR8 T;  4LFC T;  4DUY T;  1J5E T;  4LFB T;  4YHH T;  4X62 T;  4GKK T;  2UUA T;  4B3M T;  5LMN T;  4DV5 T;  4JI1 T;  2UXB T;  4NXM T;  4B3R T;  1IBL T;  4LF7 T;  2ZM6 T;  4B3T T;  2VQE T;  4GKJ T;  2VQF T;  5LMU T;  4JI0 T;  4X66 T;  4AQY T;  4LFA T;  1HR0 T;  1HNX T;  1I94 T;  1HNW T;  4JYA T;  3T1Y T;  4B3S T;  1FJG T;  1IBK T;  4OX9 T;  1XNR T;  4X64 T;  4JI3 T;  3T1H T;  2UXD T;  4JI6 T;  2UUB T;  2UUC T;  4K0K T;  2UU9 T;  4LF6 T;  5IWA T;  4LF4 T;  1XMO T;  4LF8 T;  1XMQ T;  4DV4 T;  1N36 T;  4YY3 T;  4DR6 T;  1N34 T;  4DUZ T;  4JI5 T;  1N33 T;  4JI8 T;  4DR2 T;  4DR1 T;  4JI2 T;  4DV7 T;  2F4V T;  2HHH T;  1XNQ T;  4X65 T;  4DR4 T;  2UXC T;  4DV6 T;  4DR5 T; 
#chains in the Genus database with same CATH topology
 2V1D B;  3ZEF B;  3Q5D A;  5HXH A;  5KX5 E;  4ZHQ E;  2VWA A;  3IHR A;  1IJ5 A;  2WBL A;  3FZF B;  1MMA A;  3Q9D A;  4PJJ A;  2A72 A;  5LBM A;  5AQS B;  5JR9 C;  2A2F X;  5JR9 A;  4TX5 A;  1IBL T;  4B3T T;  3QC9 A;  4QH1 A;  2W67 A;  4HFB A;  5ADX L;  3JAF A;  3Q5W A;  3VKH A;  4YHJ A;  1WR6 A;  3I0Q A;  2K5B B;  1BR0 A;  3MJX A;  1Y64 B;  3ZC1 A;  5AFU L;  2XQY A;  2V7M A;  4ZEY A;  4JI3 T;  3PUQ A;  1SE7 A;  4IDO A;  4EIW A;  3OPC A;  3AE8 A;  2BG9 C;  2WDR A;  4DBR A;  3F57 A;  4DV4 T;  3ETU A;  5AQV B;  4QH4 A;  2PJQ A;  3JC6 D;  1MIV A;  2WWV A;  4DVD A;  2ODU A;  2WS3 A;  2E9X C;  4O2A E;  2BS3 A;  4TV8 E;  2E9X A;  1G73 A;  2LOP A;  2LHR A;  5LP6 E;  2K3W A;  5HCJ A;  4YTP A;  1N32 T;  5HXS A;  2XAG B;  3PU3 A;  2CXL A;  5DAB A;  3TLV A;  2V6Y B;  2CLY C;  4I0U A;  5LGN B;  3NZQ A;  4DUY T;  4LFB T;  2PBI A;  1LVF A;  4U33 A;  1MMN A;  1MIY A;  4PFP A;  3K3O A;  2XTL A;  3CK6 A;  4FJO A;  5EK2 A;  2X66 A;  4UV9 B;  3PUZ F;  5CJ5 A;  2YDR A;  4X1Y E;  3AEG A;  5IUX A;  2OA5 A;  2XM1 A;  2LJL A;  2D2S A;  3P4S A;  4U2Y A;  5CA0 E;  2LRL A;  1IBK T;  4UF0 B;  1UGO A;  3KVA A;  4UR9 A;  4JI6 T;  3CQX C;  2XQ9 A;  3C64 A;  2FUP A;  4TNV A;  4COF A;  4KMC A;  3SWH A;  4UIG A;  4BA9 A;  2NR4 A;  2OV9 A;  5L3D B;  1FEW A;  1D0Y A;  3DP7 A;  2A3D A;  3RKO A;  3SFE A;  3WAK A;  5KMG P;  4ZI3 C;  2B1E A;  4DV1 T;  4NUV A;  3HKE E;  4XZC A;  3AA6 B;  3AVR A;  1YXR A;  2V7I A;  4HE8 A;  2WDV A;  2J62 A;  2FJB A;  3AAI A;  3EI0 A;  4DV3 T;  3CX8 B;  5JDN A;  4ANJ A;  4CI1 B;  4DV0 T;  3HL6 A;  3BQL A;  2HPJ A;  2IUB A;  4AQF C;  4HWH A;  3RIA A;  2QVA A;  4N78 D;  2KT9 A;  4WBO A;  3RC8 A;  2YN6 A;  4PK5 A;  2E9X D;  4GKJ T;  4UXN B;  1WLX A;  4QH5 A;  4HTE A;  2BKO A;  3LBX A;  3D0T A;  3LK3 B;  4TWF A;  3DJB A;  2XSB A;  4YT0 A;  2PFV A;  5JDQ A;  4JUY A;  2G0U A;  4EZH A;  3H3A A;  4IE4 A;  4IDP A;  2ODV A;  5FKY A;  4YTN A;  2W62 A;  2VKH A;  2VKO A;  1OED A;  2UUB T;  3ONJ A;  4M1P A;  2W0G A;  3VU7 H;  2NTX A;  3CWZ B;  4PK4 A;  2NTY A;  5IWA T;  2BS4 A;  1SA0 E;  3L3P A;  1XMQ T;  2EHO C;  3UTK A;  1T8B A;  1FMW A;  1VOM A;  4ASK A;  2HHH T;  4P1N A;  1UX5 A;  2JRK A;  2W4X A;  3SRZ A;  3FBZ A;  1HNZ T;  1UK5 A;  2I0M A;  2Q9Q B;  4JEH B;  4LF5 T;  5LBQ B;  2LM9 A;  3O1H A;  4ADZ A;  1QLB A;  3LK4 2;  2JQH A;  4HEA A;  1MMD A;  2GK9 A;  5HEJ A;  3U78 A;  3RYF E;  3MK7 C;  3EVY A;  4O4I E;  2ZM8 A;  2KMF A;  2CHN A;  1X9B A;  3AEA A;  3AVS A;  3A8Y C;  4PJM A;  1ZEE A;  2VVN A;  2J1D G;  3N2O A;  4QXH B;  3OJA A;  3KDS E;  5FY7 A;  2BG9 B;  2RP4 A;  3ZT5 A;  3PUG A;  4HFC A;  1T7S A;  2WQY A;  4OX9 T;  5FXW A;  3E22 E;  4U7Y A;  2XAF B;  3N5L A;  3UUX B;  2XUE A;  2ZLY A;  4U74 A;  2KZ7 B;  4J2C A;  1I6Z A;  2JPF A;  2FJA A;  3PTR B;  4ZZB A;  2BVM A;  5L3B B;  2X0L B;  3P7I A;  3I9Y A;  2YOE A;  2Y6X A;  3C98 B;  2CXF A;  2W2U A;  4ZI2 C;  4UEM A;  5LG4 A;  5JDL A;  2P9B A;  1U4Q A;  3EDU A;  2WDQ A;  4H9Q C;  2Z6E A;  1D0Z A;  2E5L T;  2VL8 A;  3UUM A;  4JI7 T;  2L8K A;  2R6G F;  2DI4 A;  3NRX A;  4PW8 A;  4IIJ E;  5F8P A;  3PV0 F;  4ILU A;  5JDG A;  3ZMZ B;  4GYR A;  2FJE A;  2HN2 A;  1ZV4 X;  2HH7 A;  5JDH A;  2VKD A;  4QXC B;  4CXY A;  2EHO D;  2HN1 A;  2QA7 A;  4TN7 B;  1UX4 A;  4A5X A;  5AQU B;  1M7K A;  4IDZ A;  2YU1 A;  3P50 A;  3RYH E;  5AQF B;  4HWD A;  4HFD A;  2IW5 B;  5FXX A;  1HF8 A;  3QK6 A;  3SOL A;  2VAS A;  2CHO A;  3QB5 K;  2H7V C;  4IDN A;  5LGT B;  2XQ8 A;  1IJ6 A;  5IYZ E;  3UQ4 A;  1KEY A;  2UXD T;  3IF8 B;  5HWX A;  2H7O A;  3PUR A;  3RIF A;  4G2A A;  1S94 A;  4MHC A;  3UU5 A;  2W66 A;  4LF4 T;  1NEK A;  5LYJ E;  5AQN B;  1N36 T;  3ZN0 B;  3TLT A;  4ILC A;  4GOU A;  2XQ7 A;  3I0O A;  1W9R A;  4QX7 B;  2ES0 A;  4O2B E;  1H7C A;  4OHF A;  5FNV E;  4L9I A;  4X65 T;  2WB5 A;  4DR5 T;  5LB7 B;  1BR1 A;  2M67 A;  3K3Q C;  2V8S V;  3LBX B;  2BVL A;  3EHZ A;  3AXJ A;  3QNU A;  4HWC A;  2JMK A;  2AXD S;  3AB3 B;  2DWG A;  3OVU A;  4WZX A;  2MTQ A;  4ZI2 D;  3CQC B;  4H9R C;  4DMV A;  4NXM T;  5HYA A;  4ERR A;  5C3J A;  2VB6 A;  4P0B A;  5J2U E;  3T1Y T;  2BDE A;  2CPT A;  4Z90 A;  5EK4 A;  4A98 A;  5HXR A;  2WP9 A;  2EHO B;  3P4Q A;  3H3M A;  3PUV F;  2NW7 A;  2QYW A;  3GN5 A;  3ZPO A;  4A97 A;  4EGW A;  4EXT A;  4AKG A;  4C90 A;  2XAQ B;  4AXP A;  4GIW A;  3UU6 A;  3FXD B;  4IE7 A;  4QXB B;  1WYB A;  4DUZ T;  2LOS A;  1N33 T;  4JI8 T;  1FMV A;  5LA6 E;  1U5P A;  3CKD A;  3C4X A;  3N2K E;  3P8C D;  4TNW A;  3UUL A;  3AAA B;  4UEL A;  4QX8 B;  2YK0 A;  4YSX A;  2PG8 A;  4HKA A;  5CGM A;  2JJ9 A;  2BKP A;  4O4J E;  3VKG A;  3ZYL A;  5ABF A;  3SFD A;  2M6B A;  2D9D A;  2X0H A;  5CFB A;  2V5D A;  3PU8 A;  2XQ6 A;  3ZCJ A;  4CN1 A;  4TWH A;  2UXB T;  3AE2 A;  3RKG A;  4LF7 T;  3VRA A;  4H9S E;  4QKN A;  3J7Y q;  2CBJ A;  2CRB A;  2WU5 A;  3ZMS B;  2DLR A;  2FJD A;  2KSR A;  4ZXL A;  3UUB A;  1D1C A;  3AA7 B;  3WAJ A;  1MIW A;  5CA1 E;  4X1I E;  3ZMV B;  2SPC A;  3ETV A;  4KBM B;  2YKS A;  2E8I A;  2IIU A;  4X5T A;  2WZI A;  3EUH A;  5AQH B;  5JRE A;  4MFR A;  3Q5E A;  1IAP A;  4I4T E;  3JAE A;  4CZZ B;  4PFO A;  4DR6 T;  4UVB B;  3ESL A;  3JAD A;  1HFA A;  2CMR A;  3ZT6 A;  3K3N A;  3IEE A;  3HR0 A;  4IST A;  2IC6 A;  5HEG A;  5IHY A;  2UXC T;  2CE7 A;  3I9W A;  2C5I T;  4IDQ A;  4MAL A;  4Z8X A;  3ZMU B;  3NVO A;  2BBH A;  3E08 A;  3P4P A;  5JVD E;  4EYY R;  2LM2 A;  3AE7 A;  4IE0 A;  3AEB A;  3CVR A;  1D0X A;  1SHZ C;  1WFD A;  3RRC A;  2XM2 A;  1ZOY A;  4DMW A;  4JI1 T;  2MOZ A;  3CIR A;  4PNI A;  2ZM6 T;  5J2T E;  4X66 T;  5L4E A;  2V26 A;  1HR0 T;  1Y01 A;  3IBP A;  4JYA T;  4KX6 A;  2DNX A;  4ZS2 A;  4LMK A;  5HWY A;  3RQW A;  3RRW A;  4ZS3 A;  5AQO B;  3HI2 A;  2DL1 A;  3RGL A;  4KHZ F;  5JRC B;  4U7I A;  4ZOL E;  5DJQ C;  2UUC T;  1AJ3 A;  3V5S A;  2UU9 T;  3P4R A;  2ZMA A;  3UU8 A;  4P09 A;  4A56 A;  4H63 H;  2X9Y A;  5LJM A;  2MPK A;  3FZH B;  4BJN A;  3AED A;  2XQ4 A;  1N34 T;  4I43 B;  1OED C;  2LHN A;  3AE9 A;  3AE3 A;  4DV6 T;  2CBI A;  2BG9 E;  2QRX A;  2XAH B;  1D1B A;  3C50 A;  5FYM A;  4L5G A;  2ACX A;  5JQG E;  3CPZ A;  1B7T A;  5JDF A;  1E2A A;  4ILA A;  4KHP T;  2JQK A;  5BR8 T;  2IAK A;  2X68 A;  3ONX A;  5FXZ A;  2WM9 A;  4DO0 A;  5JR9 B;  3LJC A;  4EAH A;  3AE1 A;  2X0Y A;  5CB4 E;  2X9H A;  4NIQ A;  1D1A A;  3AEE A;  5L3C B;  5FY1 A;  1KNP A;  5FVL A;  3FZL B;  3V5U A;  4JI0 T;  3LK2 B;  4YXD A;  4CN4 A;  2MYS A;  1CHU A;  2N2N A;  4NUU A;  2QGS A;  4Z91 A;  1L0V A;  3O9X A;  3C4W A;  1KK7 A;  1HCI A;  4BJM A;  5HEU A;  4OYK A;  3KV9 A;  4KP3 C;  3KVB A;  4PJN A;  2E5V A;  4YSZ A;  4I55 E;  4O4L E;  4B6X A;  2WY2 A;  3ZMT B;  3OYX A;  2WU2 A;  3MA9 A;  1YD8 G;  3F2E A;  5A1L A;  3A7M A;  3I1A A;  2DWK A;  3NKZ A;  3RQU A;  2E9X B;  3ANW A;  4DV7 T;  3ZJ1 A;  4UV8 B;  1OWA A;  4DR4 T;  1X79 A;  4YLH A;  1HTJ F;  1MND A;  4TV9 E;  3ZN1 B;  1LRZ A;  1ZP0 A;  4ZI7 E;  5KDM C;  3PUS A;  2CLY B;  3F31 A;  1WR0 A;  4HFI A;  3ZT7 A;  4DR3 T;  2BS2 A;  5FXV A;  5C2T A;  2XQ3 A;  3LG7 A;  4GKK T;  2XZE A;  2V6Y A;  4AI6 A;  2XQ5 A;  3L09 A;  3RH3 A;  4UVC B;  5L2L A;  4CQI A;  2VQE T;  2IHR 1;  5LMU T;  4XBF B;  2XPK A;  1T98 A;  3DTO A;  4EED A;  4TWD A;  5FL0 A;  2WSS V;  3ZST A;  4CN6 A;  2ZM0 A;  4WYV A;  2V5C A;  1HX8 A;  5EZY E;  4UF0 A;  2LEH A;  1T72 A;  5J1G A;  5FP3 A;  5L3G B;  3S4U A;  3E0Z A;  4TUY E;  4GYS A;  3RX6 A;  3ZYM A;  3RYI E;  3UUN A;  5E0O A;  2FBW A;  3HKC E;  3RHW A;  1MNE A;  4WNK A;  3NZP A;  5L3F B;  2JIW A;  4DR2 T;  3U3I A;  3FZM B;  2YIN A;  4Q25 A;  5FY0 A;  2Y8D A;  5LHH B;  1UUS A;  3GWH A;  5HAX A;  5DQV A;  2KND A;  1XWM A;  4IE5 A;  2NP9 A;  4JI4 T;  4HFH A;  4IE6 A;  4JEU B;  1BR2 A;  1DU2 A;  3Q2M A;  3NWI A;  4IL9 A;  1GQE A;  2Y48 B;  4B3M T;  5LMN T;  1YKH B;  5LJN A;  3FXE B;  5LOV E;  1YQ3 A;  3AA1 B;  4AQY T;  4HGA A;  3OBV E;  2D0U A;  3CX6 B;  4JBW F;  3RLF F;  2X51 A;  2CXD A;  2YDS A;  4I50 E;  4EOZ B;  2DHR A;  1J5W A;  3N9O A;  4DID B;  2KWH A;  3VR9 A;  2OLT A;  4IRE A;  3K8P C;  4AIS A;  1M62 A;  1G8X A;  2PTF A;  4EV6 A;  2VKJ A;  1OED B;  3N9P A;  4X64 T;  3N9Q A;  5JDM A;  2X9W A;  4LF6 T;  5BMV E;  3T8O A;  1NEN A;  2YDQ A;  3FZK B;  3PUA A;  5AQL B;  2YEV C;  1BR4 A;  2N9D A;  2K48 A;  1FIO A;  2V7J A;  5AQJ B;  2F4V T;  3N9L A;  4U3C A;  5LXT E;  1XNQ T;  3GMI A;  2BBJ A;  1KNZ A;  4FI5 A;  2V7K A;  2LSK A;  5AQQ B;  2Q9Q C;  2C0S A;  2Q9Q A;  4H9N C;  3PDY A;  5AQK B;  4LFC T;  3AE5 A;  4V1A v;  2LE8 A;  4YHH T;  4H63 V;  1QSD A;  3N2G E;  3PUY F;  4KI0 F;  1LVK A;  3HKD E;  1YW0 A;  3NRY A;  1YQ4 A;  3AA0 B;  2XAJ B;  4QHO A;  2CCQ A;  3KV6 A;  3ZCI A;  1E1H B;  3SS1 A;  2V7L A;  5LNK A;  3UFG A;  3HA4 A;  2LKG A;  2BKN A;  2BG9 A;  4CXX A;  3KV4 A;  2VVS A;  5DQW A;  4OFZ A;  4YJ2 E;  1MMG A;  3MKD A;  3O1J A;  3J9X 1;  3ANW B;  3T1H T;  3HKB E;  3UFE A;  3RI5 A;  3W15 B;  3KIN B;  2KLQ A;  4C91 A;  5AQP B;  1XDO A;  5H6Q B;  4MLK A;  5L3E B;  3TLS A;  4OK0 A;  3UT5 E;  2IML A;  5ETW A;  4JI5 T;  4ILB A;  3AAE B;  2RPA A;  3TLU A;  2HPL A;  3QUJ A;  3AEF A;  3MZK B;  1JNZ A;  4DV2 T;  4JV5 T;  1EZ3 A;  3PJA A;  3ONL C;  3A5X A;  2M6I A;  2VK9 A;  3OYZ A;  5KXJ A;  3Q5X A;  2C5K T;  1IBM T;  3NBX X;  4L0R A;  1J5E T;  1V9D A;  1KFY A;  4CI3 B;  4KUM B;  5L4H A;  3L39 A;  1OXZ A;  4EYU A;  2KWI B;  2XSA A;  3GA8 A;  3LSV A;  2I6H A;  2W00 A;  2Q9Q D;  2NW8 A;  2H88 A;  3UU4 A;  1HG2 A;  1VRB A;  1XNR T;  1E7P A;  2WWU A;  2K9A A;  4U2Z A;  3VHL A;  3KBT A;  3M3Z B;  3BK9 A;  2A9U A;  4F6R C;  4PAG A;  4LF8 T;  2YU2 A;  3N9M A;  1R8I A;  2CM0 A;  1WCR A;  2NW9 A;  2I59 A;  5EK3 A;  4O8S A;  1HG5 A;  2K24 A;  3JCF A;  5AQI B;  4AKH A;  1WRD A;  3B57 A;  3O4X E;  3FBL A;  4IHJ E;  4DR1 T;  4MBQ A;  4AQF A;  4IT4 A;  3ZJ2 A;  4ZZC A;  4LMJ A;  2NOX A;  2D0T A;  3ZLI A;  3KV5 A;  2D5U A;  2L3L A;  1W0B A;  3AXJ B;  5L47 A;  3EDV A;  4NXN T;  3C4Z A;  1CUN A;  3B5M A;  4EEB A;  1SUM B;  3ZSS A;  4IL4 A;  3AE4 A;  3R84 B;  5HXE A;  4HWI B;  3PE0 A;  4BAY B;  2UXX B;  3L8R A;  4JLE A;  3ABV A;  4HWF A;  2VL0 A;  1J1J A;  2XHE B;  3B13 A;  3N9N A;  2LLY A;  5M4Y A;  3WI3 A;  4YJ3 E;  4LFA T;  3TKL B;  4E7Z A;  1XDP A;  3CX7 B;  2WMN A;  5TAO A;  2B76 A;  2KXP B;  3OKQ A;  2V6X A;  5FL1 A;  2RA1 A;  3PJA J;  3GN5 B;  4O4H E;  3C51 A;  4E7S A;  2WZH A;  3K1S A;  2EHO A;  3VRB A;  4WBN E;  3AEC A;  1NAF A;  3RPU A;  2AE9 A;  2LT3 A;  3TLW A;  2LSG A;  2ZM2 A;  2WAU A;  4GK5 E;  4YTM A;  3RYC E;  1VCS A;  3ZYK A;  4XAX B;  5J0Z A;  2X9X A;  2MBG A;  3UU3 A;  3VR8 A;  4EZ4 A;  2N1G A;  3KFW X;  4IGU A;  4JI2 T;  2LSJ A;  2JMH A;  3BQK A;  4X20 E;  1Z0P A;  4LF9 T;  3EAB A;  1UUR A;  1WYC A;  5LHI B;  1S35 A;  5ABF B;  4ZI3 D;  4X1K E;  2VUR A;  1W09 A;  4AQG A;  1HX1 B;  2H89 A;  5LHG B;  2XJ7 A;  1JNR A;  2JQQ A;  4H9O C;  5ABG A;  5FVK A;  2LRK A;  3RC3 A;  2X67 A;  4U72 A;  4HFV A;  1QUU A;  3G06 A;  4B3R T;  4PK6 A;  2CWO A;  5HEO A;  3O1I A;  2VQF T;  5LCY A;  3LDQ B;  2CA5 A;  1I94 T;  4DND A;  2NWB A;  2C5J A;  4UVA B;  4CI2 B;  4B3S T;  1KNR A;  1ZHC A;  2J47 A;  2J4G A;  4HFE A;  3EAM A;  4YFS A;  3R6N A;  4YSY A;  3RIU C;  4QWN B;  4CXW A;  2MAW A;  2E2A A;  3RIU A;  4OYJ A;  3QOF A;  5AQR B;  4K0K T;  1IZN B;  3CQG B;  5AQT B;  4ISS A;  4H9P C;  2H3R A;  1ZKE A;  3FHN A;  4AKL A;  5JTG A;  5F3J A;  1XZY A;  1O3X A;  3UQ7 A;  5HEH A;  3MXZ A;  2XY8 B;  2KIN B;  4K0U A;  1YKE B;  2LSY A;  5HXC A;  3RF1 A;  3PUX F;  3QB5 A;  3H37 A;  4TZ4 C;  4LML A;  5LGU B;  5C8Y E;  4G63 A;  2XAS B;  2W61 A;  2XQA A;  1OED E;  3FB2 A;  4P0A A;  4DR7 T;  1W0A A;  2IDO B;  2BZB A;  5ABH A;  2CWY A;  3BQI A;  2DCF A;  3OTO T;  3KBU A;  5AQG B;  5H6R B;  1UCU A;  2W63 A;  3LFM A;  4X62 T;  2WMO A;  3CML A;  4GK0 E;  2UUA T;  1VCT A;  5AQM B;  2L9Q A;  4DV5 T;  2IC9 A;  1LKX A;  5FMN A;  3ZC0 A;  3P4W A;  4U31 A;  1HS7 A;  4DBQ A;  5ABE A;  3MAC A;  1HNX T;  3JC6 C;  2JQ9 A;  2LKH A;  3X1D A;  1HNW T;  5F5W A;  5LG3 A;  2UXN B;  4HN9 A;  3ZKR A;  1FJG T;  2LSI A;  3PUW F;  4PJL A;  5GON E;  3AE6 A;  1NWM X;  5JRC A;  2CEA A;  1KF6 A;  4NPP A;  1US7 B;  4WW0 A;  2WCA A;  3M65 A;  1XMO T;  3IA3 A;  4YY3 T;  2ACZ A;  4AKI A;  1Z8U A;  5JH7 E;  5HCM A;  4EB6 E;  4AKR B;  4AIU A;  4F8H A; 
#chains in the Genus database with same CATH homology
 4DV1 T;  4DV2 T;  4JV5 T;  4LF9 T;  1HNZ T;  2E5L T;  4JI7 T;  4LF5 T;  4NXN T;  1N32 T;  4DV3 T;  4DR3 T;  4DR7 T;  4DV0 T;  4JI4 T;  1IBM T;  4KHP T;  3OTO T;  5BR8 T;  4LFC T;  4DUY T;  1J5E T;  4LFB T;  4YHH T;  4X62 T;  4GKK T;  2UUA T;  4B3M T;  5LMN T;  4DV5 T;  4JI1 T;  2UXB T;  4NXM T;  4B3R T;  1IBL T;  4LF7 T;  2ZM6 T;  4B3T T;  2VQE T;  4GKJ T;  2VQF T;  5LMU T;  4JI0 T;  4X66 T;  4AQY T;  4LFA T;  1HR0 T;  1HNX T;  1I94 T;  1HNW T;  4JYA T;  3T1Y T;  4B3S T;  1FJG T;  1IBK T;  4OX9 T;  1XNR T;  4X64 T;  4JI3 T;  3T1H T;  2UXD T;  4JI6 T;  2UUB T;  2UUC T;  4K0K T;  2UU9 T;  4LF6 T;  5IWA T;  4LF4 T;  1XMO T;  4LF8 T;  1XMQ T;  4DV4 T;  1N36 T;  4YY3 T;  4DR6 T;  1N34 T;  4DUZ T;  4JI5 T;  1N33 T;  4JI8 T;  4DR2 T;  4DR1 T;  4JI2 T;  4DV7 T;  2F4V T;  2HHH T;  1XNQ T;  4X65 T;  4DR4 T;  2UXC T;  4DV6 T;  4DR5 T; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...