1N34I

Structure of the thermus thermophilus 30s ribosomal subunit in the presence of codon and crystallographically disordered near-cognate transfer rna anticodon stem-loop mismatched at the first codon position
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
127
structure length
127
Chain Sequence
EQYYGTGRRKEAVARVFLRPGNGKVTVNGQDFNEYFQGLVRAVAALEPLRAVDALGRFDAYITVRGGGKSGQIDAIKLGIARALVQYNPDYRAKLKPLGFLTRDARVVERKKYGKHKARRAPQYSKR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S RIBOSOMAL RNA
publication title Selection of tRNA by the Ribosome Requires a Transition from an Open to a Closed Form
pubmed doi rcsb
molecule tags Ribosome
total genus 10
structure length 127
sequence length 127
ec nomenclature
pdb deposition date 2002-10-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF00380 Ribosomal_S9 Ribosomal protein S9/S16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 1n34I00
1I94I 1U2RA 1Z0WA 2R3VA 1XHKA 3ZZTA 1HR0I 2BV3A 4LF7I 1Z0GA 4DR6E 4ZVIA 4USKA 2V8PA 4JI0I 4X64I 3HULA 4FWDA 4DV6I 4B3TI 2UUBE 1KIJA 1HNWE 2V2QA 1IBMI 4GKJI 4LF6E 2HHHE 1UEKA 4DV2I 1B62A 4NXNE 4UTGA 4URLA 3QT6A 3QT5A 1ZXNA 4DR2E 4YY3E 1IBKI 1QZRA 4DV3I 1N36E 3B8HA 3PYGA 1PIEA 4FW9A 4DR7I 4FWHA 4DR3E 2ZBKB 4DV7I 4B3SI 5FLXQ 3OTOI 1I94E 2GS8A 4LF9I 4UT4A 1FNMA 2OI2A 4AQYI 1J5EE 4DPUA 1NHHA 4DU8A 4Z7CA 4KQVA 1A6FA 1MU5A 4JI0E 4PU9A 4X64E 4LFCI 3T1HI 4DV6E 4B3TE 5L3JA 5IT9Q 4DR6I 1Z0CA 4DV2E 1MX0A 1XMQI 1H72C 3WU5A 1XNRI 4LF6I 2HHHI 1IBKE 1RR9A 4MYUA 4DV3E 3J7AG 4JI7I 4HACB 3V5RA 4DV4I 3J80C 1ZM9A 4JI5I 2HK3A 1S4EA 4DR7E 4DV7E 4B3SE 3OTOE 5IWAI 2X36A 4LF9E 4K0KI 1KTVA 2UXBI 2J7KA 2UUCI 1H7SA 4B3RI 4JI8I 1WUUA 2ZM6I 4DXLA 4DUZI 1J5EI 4LFCE 3T1HE 4JI3I 3K1JA 1XMOE 3GONA 2A2DA 4DV5E 2DEJA 1HNZI 3LPSA 4LF5I 1XMQE 2LJPA 3JAMQ 1Z0TA 3WU4A 2VF3A 3B78A 2A2CA 4B3MI 3B82A 1XNRE 3Q1QA 5GMDA 4JI7E 3LNUA 1N34I 4DV4E 4HXZA 2HFSA 4JI5E 4LF4I 4ED4A 2VQEI 4DPYA 3T1YI 5IWAE 4K0KE 3J81C 2UXBE 4USMA 2UUCE 3CWVA 1N33I 2UXDI 3QT7A 3M6AA 4JI2I 4B3RE 4LF8I 4JI8E 2ZM6E 4DUZE 2AJ4A 2WW4A 4DV0I 4DPXA 4JI3E 5LL6R 1Z5CA 4DR1I 4JI1I 5IT9C 1HNZE 4YHHI 4X62I 1N0VC 4LF5E 1XMOI 1HNXI 4DV5I 4WUDA 2BM0A 5LMUI 3V2UC 4B3ME 1ELOA 1S16A 2Q2EB 1N34E 4DUYI 4LF4E 3ZZ0A 3D4JA 3ZZUA 2VQEE 3H4LA 3T1YE 3WU6A 4GKKI 1IBLI 1NHIA 1ZM2A 1N33E 4R1FA 4DPTA 2UXDE 1FI4A 4PRXA 1Z0BA 4JI2E 4LF8E 1XNQI 2V2ZA 1PKPA 4JI4I 2UXCI 4DV0E 4KHPI 1EA6A 1Z5BA 1EI1A 1BKNA 2HK2A 2E5LI 2ZITA 4DR1E 1FJGI 4JI1E 4X66I 4YHHE 4DR5I 2F4VI 4X62E 3WU3A 3PYFA 4LFBI 4M1KA 1HNXE 4DR4I 4JV5I 3JAMC 5LMUE 1H73A 2V34A 4P7AA 4DV1I 1D6TA 4P52A 2UUAI 3QT8A 4DUYE 3PYDA 4OX9I 1N32I 5A2QQ 1B63A 4LFAI 4Z7YA 4GKKE 4DPWA 1Z0EA 1IBLE 4NXMI 4MYTA 4FWGA 1ZM3A 2BM1A 1VISA 1XNQE 1PVGA 5FLXC 4JI4E 2UXCE 2R42A 4JYAI 5BR8I 2UU9I 2CZ9A 4KHPE 2VQFI 4HYMA 2DEIA 1H74A 1ZXMA 2X7IA 3ZM7A 2E5LE 1FJGE 4JI6I 2HKEA 4DU7A 4X66E 4DR5E 2F4VE 4JG4A 5LMNI 4LFBE 4WUCA 3K17A 4DR4E 4JV5E 1H7UA 4DV1E 2XEXA 1NZ0A 2UUAE 2EFGA 3J81Q 4X65I 4OX9E 2V2VA 1N32E 4LFAE 1HR0E 1ZM4A 4HY1A 4XTJA 3ZKBA 4LF7E 1K47A 1Z0VA 4NXME 1OJ4A 1N0UA 1MG7A 1Z5AA 5GMEA 3F0NA 4FN5A 1IBME 4JYAE 4GKJE 5BR8E 2UU9E 2HKJA 2VQFE 3ZKDA 1FWKA 3J7AM 1RREA 2UUBI 4HACA 4PRVA 3LTOA 2HFUA 1HNWI 4JI6E 4WUBA 1NHJA 2E1RA 3PYEA 1KVKA 5LMNE 1Z59A 1FKAE 4NXNI 4EMDA 4DR2I 4YY3I 4X65E 3J80Q 1DARA 1KKHA 4AQYE 1N36I 4I3HA 1FWLA 2NPFA 4RPFA 5A2QC 4DR3I
chains in the Genus database with same CATH superfamily
1I94I 4IFDA 1U2RA 1Z0WA 2PNLA 2R3VA 1XHKA 3ZZTA 3CDJA 1YH8A 2J65A 1HR0I 1Y6ZA 2BV3A 4LF7I 1Z0GA 4DR6E 4ZVIA 4USKA 2V8PA 4JI0I 4X64I 3HULA 4FWDA 4ISAA 4FW4A 4DV6I 4B3TI 2UUBE 1R6MA 1KIJA 1HNWE 2V2QA 5ELWA 5K36A 1IBMI 4GKJI 4LF6E 1UDOA 2HHHE 1UEKA 4DV2I 1B62A 4AIMA 4OO1B 4NXNE 4UTGA 4URLA 5DNLA 2WNRA 5K36B 3QT6A 3QT5A 1ZXNA 4DR2E 4YY3E 1IBKI 1QZRA 4DV3I 2JEBA 3K85A 4IZJD 1N36E 3B8HA 4LOMA 3PYGA 2WNRB 1PIEA 3HKMA 4FW9A 4DR7I 4FWHA 4DR3E 2O1VA 2ZBKB 4BA1B 4DV7I 4B3SI 5FLXQ 3OTOI 1I94E 2GS8A 2C37B 4LF9I 5C0XD 4OO1F 2JEBB 4UT4A 1FNMA 2AE8A 2OI2A 4AQYI 2Z5EA 1J5EE 5K36F 4DPUA 1NHHA 4DU8A 4Z7CA 2PO0B 4KQVA 1A6FA 3KRNA 1HK7A 1MU5A 4JI0E 4PU9A 3U1YA 4X64E 3P76A 4LFCI 3T1HI 4DV6E 4B3TE 2NN6C 2JEAA 3U1KA 5L3JA 5IT9Q 4DR6I 4FW3A 4IFDD 1Z0CA 2C38B 4DV2E 1MX0A 4QNJA 1XMQI 4FW6A 4IZKA 1H72C 5JEAC 4AIDA 3WU5A 1Y4SA 5DRRA 1XNRI 4LF6I 2HHHI 1IBKE 1RR9A 4MYUA 4DV3E 3J7AG 4IZJB 4JI7I 2IESA 4HACB 3V5RA 4DV4I 1OYPA 1USVA 1ZM9A 3J80C 4JI5I 2HK3A 3PS3A 2PNZB 5K36D 1S4EA 4DR7E 4DV7E 1UDNA 4B3SE 3OTOE 4MU3A 5C0XB 5IWAI 2NN6A 2X36A 4LF9E 4K0KI 1KTVA 2CGEA 2UXBI 2J7KA 2UUCI 2C39B 2JE6A 1H7SA 2GO3A 4B3RI 4JI8I 1WUUA 2ZM6I 4DXLA 5JEAA 4DUZI 1J5EI 4LFCE 2Z5BB 3T1HE 4QNKA 4JI3I 1USUA 3K1JA 1XMOE 3GONA 2A2DA 4DV5E 2DEJA 5C0XF 4IFDB 3HJCA 1HNZI 3LPSA 4LF5I 1XMQE 2GO4A 2LJPA 2BR2A 3JAMQ 1Z0TA 3WU4A 4OO1E 2VF3A 4LCGA 3B78A 2A2CA 3B82A 4B3MI 1XNRE 1RHYA 3Q1QA 5K36E 5GMDA 2Z5CA 4JI7E 3LNUA 1N34I 4DV4E 4HXZA 2HFSA 4JI5E 4LF4I 4IFDF 4ED4A 2VQEI 4DPYA 4IS9A 3T1YI 5IWAE 4K0KE 3J81C 2UXBE 4USMA 2UUCE 3CWVA 1N33I 2JT2A 2UXDI 4BA2A 3QT7A 3M6AA 4JI2I 4B3RE 4LF8I 4JI8E 2ZM6E 4GQUA 3H1CA 3UHMA 4DUZE 2AJ4A 2WW4A 4DV0I 4DPXA 4JI3E 3PS2A 1P42A 1Y60A 5LL6R 1Y5YA 1Z5CA 4DR1I 2NN6D 4JI1I 5IT9C 4YHHI 1HNZE 2PO1A 4X62I 1N0VC 4LF5E 1XMOI 1HNXI 4DV5I 1Y4UA 3P06A 4WUDA 2BM0A 5LMUI 2PO1B 3V2UC 4B3ME 2WP8A 3GMEA 5JEAD 1ELOA 1S16A 4OZEA 2Q2EB 1N34E 2JEAB 3M85D 4FW5A 4DUYI 4LF4E 3ZZ0A 3D4JA 3ZZUA 2VQEE 2GQ0A 3H4LA 3T1YE 3WU6A 4GKKI 4IZKB 3M7ND 1IBLI 1NHIA 1ZM2A 5C0XE 1OYRA 3M85G 1N33E 4R1FA 4DPTA 2UXDE 1FI4A 4PRXA 1Z0BA 4JI2E 4MU0A 4LF8E 2V2ZA 1XNQI 1PKPA 4MU4A 2BA1D 4JI4I 2CG9A 3M7NG 2UXCI 4DV0E 4KHPI 1EA6A 1Z5BA 1EI1A 1BKNA 2HK2A 2NN6B 2E5LI 2ZITA 4DR1E 1FJGI 2O1TA 4JI1E 3L7ZA 5DROA 4X66I 4YHHE 2BA1G 4X62E 4DR5I 2O3ZA 3WU3A 2F4VI 4IFDE 4OO1C 2JE6B 3B4TA 3PYFA 2CVEA 4LFBI 4M1KA 1HNXE 5K36C 4DR4I 1E3PA 4JV5I 3JAMC 1R6LA 1H73A 2V34A 4P7AA 5LMUE 4DV1I 1D6TA 4FW7A 4LPFA 5JEAB 4P52A 2UUAI 1YHCA 1OYSA 2BA0D 3QT8A 4DUYE 2NN6F 3PYDA 4OX9I 1N32I 5A2QQ 4MU1A 1B63A 4LFAI 4Z7YA 4GKKE 4DPWA 1Z0EA 1IBLE 4LCHA 2BR2B 4NBQA 2BA0G 4NXMI 4MYTA 4FWGA 1ZM3A 5JEAF 2BM1A 4OO1A 1VISA 1XNQE 2Z5CB 5FWKA 1PVGA 5FLXC 4JI4E 1E3HA 1VI7A 2UXCE 2R42A 4JYAI 5BR8I 2UU9I 2CZ9A 4KHPE 2VQFI 4HYMA 3Q6NA 2DEIA 1H74A 1ZXMA 2X7IA 3Q6MA 3ZM7A 2E5LE 1FJGE 3P3EA 2HKEA 4JI6I 4DU7A 4X66E 4DR5E 2F4VE 4JG4A 4N3OA 2O1UA 4OKGA 2IOQA 2PO2A 4BA1A 3P3GA 5LMNI 4BA2B 4MQYA 2C37A 4LFBE 4WUCA 3K17A 4DR4E 5EL9A 4JV5E 3P3CA 5EKWA 1H7UA 4DV1E 2XEXA 1NZ0A 2PO0A 2UUAE 2PO2B 2EFGA 1XXEA 3NZKA 3J81Q 2VESA 4U3BA 4X65I 5DNXA 3DD6A 4OX9E 4MDTA 2V2VA 3PRYA 1N32E 4LFAE 5C0XC 2F1DA 1HR0E 1ZM4A 4HY1A 4XTJA 3ZKBA 4LF7E 3GCMA 5DRPA 1K47A 1Z0VA 4NXME 2C38A 1OJ4A 1N0UA 2WP8B 1MG7A 1Z5AA 5GMEA 3F0NA 4FN5A 5DRQA 1IBME 4JYAE 4GKJE 5BR8E 2UU9E 2HKJA 2VQFE 1UDQA 3ZKDA 1FWKA 3J7AM 4IZJA 1RREA 4IFDC 2UUBI 4HACA 4PRVA 3LTOA 2HFUA 3PS1A 1HNWI 4JI6E 4WUBA 1NHJA 2PNMA 2E1RA 2PNZA 3PYEA 1KVKA 2NN6E 5LMNE 1Z59A 5C0XA 2IOPA 1FKAE 4NXNI 4OO1D 4AM3A 2IERA 4U3DA 4EMDA 2C39A 4DR2I 4YY3I 4J3DA 4X65E 5JEAE 3J80Q 1UDSA 1DARA 1KKHA 4AQYE 1N36I 4I3HA 2O1WA 2Z5BA 3L7ZB 3GLLA 1FWLA 2NPFA 4RPFA 5A2QC 4DR3I 3CDIA 4LCFA
chains in the Genus database with same CATH topology
1I94I 1U2RA 1Z0WA 2PNLA 2R3VA 1XHKA 3ZZTA 1HR0I 1Y6ZA 2BV3A 4LF7I 1Z0GA 4DR6E 4ZVIA 4USKA 2V8PA 4JI0I 4X64I 3HULA 4FWDA 4DV6I 4B3TI 2UUBE 1KIJA 1HNWE 2V2QA 1IBMI 4GKJI 4LF6E 2HHHE 1UEKA 4DV2I 1B62A 4NXNE 4UTGA 4URLA 3QT6A 3QT5A 1ZXNA 4DR2E 4YY3E 1IBKI 1QZRA 4DV3I 3K85A 4IZJD 1N36E 3B8HA 3PYGA 1PIEA 4FW9A 4DR7I 4FWHA 4DR3E 2O1VA 2ZBKB 4DV7I 4B3SI 5FLXQ 3OTOI 1I94E 2GS8A 4LF9I 4UT4A 1FNMA 2OI2A 4AQYI 2Z5EA 1J5EE 4DPUA 1NHHA 4DU8A 4Z7CA 4KQVA 1A6FA 1HK7A 1MU5A 4JI0E 4PU9A 4X64E 4LFCI 3T1HI 4DV6E 4B3TE 5L3JA 5IT9Q 4DR6I 1Z0CA 4DV2E 1MX0A 1XMQI 4IZKA 1H72C 3WU5A 1Y4SA 1XNRI 4LF6I 2HHHI 1IBKE 1RR9A 4MYUA 4DV3E 3J7AG 4IZJB 4JI7I 4HACB 3V5RA 4DV4I 1USVA 1ZM9A 3J80C 4JI5I 2HK3A 1S4EA 4DR7E 4DV7E 4B3SE 3OTOE 5IWAI 2X36A 4LF9E 4K0KI 1KTVA 2CGEA 2UXBI 2J7KA 2UUCI 1H7SA 4B3RI 4JI8I 1WUUA 2ZM6I 4DXLA 4DUZI 1J5EI 4LFCE 2Z5BB 3T1HE 4JI3I 1USUA 3K1JA 1XMOE 3GONA 2A2DA 4DV5E 2DEJA 3HJCA 1HNZI 3LPSA 4LF5I 1XMQE 2LJPA 3JAMQ 1Z0TA 3WU4A 2VF3A 3B78A 2A2CA 3B82A 4B3MI 1XNRE 3Q1QA 5GMDA 2Z5CA 4JI7E 3LNUA 1N34I 4DV4E 4HXZA 2HFSA 4JI5E 4LF4I 4ED4A 2VQEI 4DPYA 3T1YI 5IWAE 4K0KE 3J81C 2UXBE 4USMA 2UUCE 3CWVA 1N33I 2UXDI 3QT7A 3M6AA 4JI2I 4B3RE 4LF8I 4JI8E 2ZM6E 4DUZE 2AJ4A 2WW4A 4DV0I 4DPXA 4JI3E 5LL6R 1Z5CA 4DR1I 4JI1I 5IT9C 4YHHI 1HNZE 4X62I 1N0VC 4LF5E 1XMOI 1HNXI 4DV5I 1Y4UA 3P06A 4WUDA 2BM0A 5LMUI 3V2UC 4B3ME 1ELOA 1S16A 2Q2EB 1N34E 4DUYI 4LF4E 3ZZ0A 3D4JA 3ZZUA 2VQEE 2GQ0A 3H4LA 3T1YE 3WU6A 4GKKI 4IZKB 1IBLI 1NHIA 1ZM2A 1N33E 4R1FA 4DPTA 2UXDE 1FI4A 4PRXA 1Z0BA 4JI2E 4LF8E 1XNQI 2V2ZA 1PKPA 4JI4I 2CG9A 2UXCI 4DV0E 4KHPI 1EA6A 1Z5BA 1EI1A 1BKNA 2HK2A 2E5LI 2ZITA 4DR1E 1FJGI 2O1TA 4JI1E 4X66I 4YHHE 4DR5I 2F4VI 4X62E 3WU3A 3PYFA 4LFBI 4M1KA 1HNXE 4DR4I 4JV5I 3JAMC 5LMUE 1H73A 2V34A 4P7AA 4DV1I 1D6TA 4P52A 2UUAI 3QT8A 4DUYE 3PYDA 4OX9I 1N32I 5A2QQ 1B63A 4LFAI 4Z7YA 4GKKE 4DPWA 1Z0EA 1IBLE 4NXMI 4MYTA 4FWGA 1ZM3A 2BM1A 1VISA 1XNQE 2Z5CB 5FWKA 1PVGA 5FLXC 4JI4E 2UXCE 2R42A 4JYAI 5BR8I 2UU9I 2CZ9A 4KHPE 2VQFI 4HYMA 3Q6NA 2DEIA 1H74A 1ZXMA 2X7IA 3Q6MA 3ZM7A 2E5LE 1FJGE 4JI6I 2HKEA 4DU7A 4X66E 4DR5E 2F4VE 4JG4A 4N3OA 2O1UA 2IOQA 5LMNI 4LFBE 4WUCA 3K17A 4DR4E 4JV5E 1H7UA 4DV1E 2XEXA 1NZ0A 2UUAE 2EFGA 3J81Q 4X65I 4OX9E 2V2VA 3PRYA 1N32E 4LFAE 1HR0E 1ZM4A 4HY1A 4XTJA 3ZKBA 4LF7E 1K47A 1Z0VA 4NXME 1OJ4A 1N0UA 1MG7A 1Z5AA 5GMEA 3F0NA 4FN5A 1IBME 4JYAE 4GKJE 5BR8E 2UU9E 2HKJA 2VQFE 3ZKDA 1FWKA 3J7AM 4IZJA 1RREA 2UUBI 4HACA 4PRVA 3LTOA 2HFUA 1HNWI 4JI6E 4WUBA 1NHJA 2PNMA 2E1RA 3PYEA 1KVKA 5LMNE 1Z59A 2IOPA 1FKAE 4NXNI 4EMDA 4DR2I 4YY3I 4X65E 3J80Q 1DARA 1KKHA 4AQYE 1N36I 4I3HA 2O1WA 2Z5BA 1FWLA 2NPFA 4RPFA 5A2QC 4DR3I
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1I94 I;  1U2R A;  1Z0W A;  2R3V A;  1XHK A;  3ZZT A;  1HR0 I;  2BV3 A;  4LF7 I;  1Z0G A;  4DR6 E;  4ZVI A;  4USK A;  2V8P A;  4JI0 I;  4X64 I;  3HUL A;  4FWD A;  4DV6 I;  4B3T I;  2UUB E;  1KIJ A;  1HNW E;  2V2Q A;  1IBM I;  4GKJ I;  4LF6 E;  2HHH E;  1UEK A;  4DV2 I;  1B62 A;  4NXN E;  4UTG A;  4URL A;  3QT6 A;  3QT5 A;  1ZXN A;  4DR2 E;  4YY3 E;  1IBK I;  1QZR A;  4DV3 I;  1N36 E;  3B8H A;  3PYG A;  1PIE A;  4FW9 A;  4DR7 I;  4FWH A;  4DR3 E;  2ZBK B;  4DV7 I;  4B3S I;  5FLX Q;  3OTO I;  1I94 E;  2GS8 A;  4LF9 I;  4UT4 A;  1FNM A;  2OI2 A;  4AQY I;  1J5E E;  4DPU A;  1NHH A;  4DU8 A;  4Z7C A;  4KQV A;  1A6F A;  1MU5 A;  4JI0 E;  4PU9 A;  4X64 E;  4LFC I;  3T1H I;  4DV6 E;  4B3T E;  5L3J A;  5IT9 Q;  4DR6 I;  1Z0C A;  4DV2 E;  1MX0 A;  1XMQ I;  1H72 C;  3WU5 A;  1XNR I;  4LF6 I;  2HHH I;  1IBK E;  1RR9 A;  4MYU A;  4DV3 E;  3J7A G;  4JI7 I;  4HAC B;  3V5R A;  4DV4 I;  3J80 C;  1ZM9 A;  4JI5 I;  2HK3 A;  1S4E A;  4DR7 E;  4DV7 E;  4B3S E;  3OTO E;  5IWA I;  2X36 A;  4LF9 E;  4K0K I;  1KTV A;  2UXB I;  2J7K A;  2UUC I;  1H7S A;  4B3R I;  4JI8 I;  1WUU A;  2ZM6 I;  4DXL A;  4DUZ I;  1J5E I;  4LFC E;  3T1H E;  4JI3 I;  3K1J A;  1XMO E;  3GON A;  2A2D A;  4DV5 E;  2DEJ A;  1HNZ I;  3LPS A;  4LF5 I;  1XMQ E;  2LJP A;  3JAM Q;  1Z0T A;  3WU4 A;  2VF3 A;  3B78 A;  2A2C A;  4B3M I;  3B82 A;  1XNR E;  3Q1Q A;  5GMD A;  4JI7 E;  3LNU A;  1N34 I;  4DV4 E;  4HXZ A;  2HFS A;  4JI5 E;  4LF4 I;  4ED4 A;  2VQE I;  4DPY A;  3T1Y I;  5IWA E;  4K0K E;  3J81 C;  2UXB E;  4USM A;  2UUC E;  3CWV A;  1N33 I;  2UXD I;  3QT7 A;  3M6A A;  4JI2 I;  4B3R E;  4LF8 I;  4JI8 E;  2ZM6 E;  4DUZ E;  2AJ4 A;  2WW4 A;  4DV0 I;  4DPX A;  4JI3 E;  5LL6 R;  1Z5C A;  4DR1 I;  4JI1 I;  5IT9 C;  1HNZ E;  4YHH I;  4X62 I;  1N0V C;  4LF5 E;  1XMO I;  1HNX I;  4DV5 I;  4WUD A;  2BM0 A;  5LMU I;  3V2U C;  4B3M E;  1ELO A;  1S16 A;  2Q2E B;  1N34 E;  4DUY I;  4LF4 E;  3ZZ0 A;  3D4J A;  3ZZU A;  2VQE E;  3H4L A;  3T1Y E;  3WU6 A;  4GKK I;  1IBL I;  1NHI A;  1ZM2 A;  1N33 E;  4R1F A;  4DPT A;  2UXD E;  1FI4 A;  4PRX A;  1Z0B A;  4JI2 E;  4LF8 E;  1XNQ I;  2V2Z A;  1PKP A;  4JI4 I;  2UXC I;  4DV0 E;  4KHP I;  1EA6 A;  1Z5B A;  1EI1 A;  1BKN A;  2HK2 A;  2E5L I;  2ZIT A;  4DR1 E;  1FJG I;  4JI1 E;  4X66 I;  4YHH E;  4DR5 I;  2F4V I;  4X62 E;  3WU3 A;  3PYF A;  4LFB I;  4M1K A;  1HNX E;  4DR4 I;  4JV5 I;  3JAM C;  5LMU E;  1H73 A;  2V34 A;  4P7A A;  4DV1 I;  1D6T A;  4P52 A;  2UUA I;  3QT8 A;  4DUY E;  3PYD A;  4OX9 I;  1N32 I;  5A2Q Q;  1B63 A;  4LFA I;  4Z7Y A;  4GKK E;  4DPW A;  1Z0E A;  1IBL E;  4NXM I;  4MYT A;  4FWG A;  1ZM3 A;  2BM1 A;  1VIS A;  1XNQ E;  1PVG A;  5FLX C;  4JI4 E;  2UXC E;  2R42 A;  4JYA I;  5BR8 I;  2UU9 I;  2CZ9 A;  4KHP E;  2VQF I;  4HYM A;  2DEI A;  1H74 A;  1ZXM A;  2X7I A;  3ZM7 A;  2E5L E;  1FJG E;  4JI6 I;  2HKE A;  4DU7 A;  4X66 E;  4DR5 E;  2F4V E;  4JG4 A;  5LMN I;  4LFB E;  4WUC A;  3K17 A;  4DR4 E;  4JV5 E;  1H7U A;  4DV1 E;  2XEX A;  1NZ0 A;  2UUA E;  2EFG A;  3J81 Q;  4X65 I;  4OX9 E;  2V2V A;  1N32 E;  4LFA E;  1HR0 E;  1ZM4 A;  4HY1 A;  4XTJ A;  3ZKB A;  4LF7 E;  1K47 A;  1Z0V A;  4NXM E;  1OJ4 A;  1N0U A;  1MG7 A;  1Z5A A;  5GME A;  3F0N A;  4FN5 A;  1IBM E;  4JYA E;  4GKJ E;  5BR8 E;  2UU9 E;  2HKJ A;  2VQF E;  3ZKD A;  1FWK A;  3J7A M;  1RRE A;  2UUB I;  4HAC A;  4PRV A;  3LTO A;  2HFU A;  1HNW I;  4JI6 E;  4WUB A;  1NHJ A;  2E1R A;  3PYE A;  1KVK A;  5LMN E;  1Z59 A;  1FKA E;  4NXN I;  4EMD A;  4DR2 I;  4YY3 I;  4X65 E;  3J80 Q;  1DAR A;  1KKH A;  4AQY E;  1N36 I;  4I3H A;  1FWL A;  2NPF A;  4RPF A;  5A2Q C;  4DR3 I; 
#chains in the Genus database with same CATH topology
 1I94 I;  4IFD A;  1U2R A;  1Z0W A;  2PNL A;  2R3V A;  1XHK A;  3ZZT A;  3CDJ A;  1YH8 A;  2J65 A;  1HR0 I;  1Y6Z A;  2BV3 A;  4LF7 I;  1Z0G A;  4DR6 E;  4ZVI A;  4USK A;  2V8P A;  4JI0 I;  4X64 I;  3HUL A;  4FWD A;  4ISA A;  4FW4 A;  4DV6 I;  4B3T I;  2UUB E;  1R6M A;  1KIJ A;  1HNW E;  2V2Q A;  5ELW A;  5K36 A;  1IBM I;  4GKJ I;  4LF6 E;  1UDO A;  2HHH E;  1UEK A;  4DV2 I;  1B62 A;  4AIM A;  4OO1 B;  4NXN E;  4UTG A;  4URL A;  5DNL A;  2WNR A;  5K36 B;  3QT6 A;  3QT5 A;  1ZXN A;  4DR2 E;  4YY3 E;  1IBK I;  1QZR A;  4DV3 I;  2JEB A;  3K85 A;  4IZJ D;  1N36 E;  3B8H A;  4LOM A;  3PYG A;  2WNR B;  1PIE A;  3HKM A;  4FW9 A;  4DR7 I;  4FWH A;  4DR3 E;  2O1V A;  2ZBK B;  4BA1 B;  4DV7 I;  4B3S I;  5FLX Q;  3OTO I;  1I94 E;  2GS8 A;  2C37 B;  4LF9 I;  5C0X D;  4OO1 F;  2JEB B;  4UT4 A;  1FNM A;  2AE8 A;  2OI2 A;  4AQY I;  2Z5E A;  1J5E E;  5K36 F;  4DPU A;  1NHH A;  4DU8 A;  4Z7C A;  2PO0 B;  4KQV A;  1A6F A;  3KRN A;  1HK7 A;  1MU5 A;  4JI0 E;  4PU9 A;  3U1Y A;  4X64 E;  3P76 A;  4LFC I;  3T1H I;  4DV6 E;  4B3T E;  2NN6 C;  2JEA A;  3U1K A;  5L3J A;  5IT9 Q;  4DR6 I;  4FW3 A;  4IFD D;  1Z0C A;  2C38 B;  4DV2 E;  1MX0 A;  4QNJ A;  1XMQ I;  4FW6 A;  4IZK A;  1H72 C;  5JEA C;  4AID A;  3WU5 A;  1Y4S A;  5DRR A;  1XNR I;  4LF6 I;  2HHH I;  1IBK E;  1RR9 A;  4MYU A;  4DV3 E;  3J7A G;  4IZJ B;  4JI7 I;  2IES A;  4HAC B;  3V5R A;  4DV4 I;  1OYP A;  1USV A;  1ZM9 A;  3J80 C;  4JI5 I;  2HK3 A;  3PS3 A;  2PNZ B;  5K36 D;  1S4E A;  4DR7 E;  4DV7 E;  1UDN A;  4B3S E;  3OTO E;  4MU3 A;  5C0X B;  5IWA I;  2NN6 A;  2X36 A;  4LF9 E;  4K0K I;  1KTV A;  2CGE A;  2UXB I;  2J7K A;  2UUC I;  2C39 B;  2JE6 A;  1H7S A;  2GO3 A;  4B3R I;  4JI8 I;  1WUU A;  2ZM6 I;  4DXL A;  5JEA A;  4DUZ I;  1J5E I;  4LFC E;  2Z5B B;  3T1H E;  4QNK A;  4JI3 I;  1USU A;  3K1J A;  1XMO E;  3GON A;  2A2D A;  4DV5 E;  2DEJ A;  5C0X F;  4IFD B;  3HJC A;  1HNZ I;  3LPS A;  4LF5 I;  1XMQ E;  2GO4 A;  2LJP A;  2BR2 A;  3JAM Q;  1Z0T A;  3WU4 A;  4OO1 E;  2VF3 A;  4LCG A;  3B78 A;  2A2C A;  3B82 A;  4B3M I;  1XNR E;  1RHY A;  3Q1Q A;  5K36 E;  5GMD A;  2Z5C A;  4JI7 E;  3LNU A;  1N34 I;  4DV4 E;  4HXZ A;  2HFS A;  4JI5 E;  4LF4 I;  4IFD F;  4ED4 A;  2VQE I;  4DPY A;  4IS9 A;  3T1Y I;  5IWA E;  4K0K E;  3J81 C;  2UXB E;  4USM A;  2UUC E;  3CWV A;  1N33 I;  2JT2 A;  2UXD I;  4BA2 A;  3QT7 A;  3M6A A;  4JI2 I;  4B3R E;  4LF8 I;  4JI8 E;  2ZM6 E;  4GQU A;  3H1C A;  3UHM A;  4DUZ E;  2AJ4 A;  2WW4 A;  4DV0 I;  4DPX A;  4JI3 E;  3PS2 A;  1P42 A;  1Y60 A;  5LL6 R;  1Y5Y A;  1Z5C A;  4DR1 I;  2NN6 D;  4JI1 I;  5IT9 C;  4YHH I;  1HNZ E;  2PO1 A;  4X62 I;  1N0V C;  4LF5 E;  1XMO I;  1HNX I;  4DV5 I;  1Y4U A;  3P06 A;  4WUD A;  2BM0 A;  5LMU I;  2PO1 B;  3V2U C;  4B3M E;  2WP8 A;  3GME A;  5JEA D;  1ELO A;  1S16 A;  4OZE A;  2Q2E B;  1N34 E;  2JEA B;  3M85 D;  4FW5 A;  4DUY I;  4LF4 E;  3ZZ0 A;  3D4J A;  3ZZU A;  2VQE E;  2GQ0 A;  3H4L A;  3T1Y E;  3WU6 A;  4GKK I;  4IZK B;  3M7N D;  1IBL I;  1NHI A;  1ZM2 A;  5C0X E;  1OYR A;  3M85 G;  1N33 E;  4R1F A;  4DPT A;  2UXD E;  1FI4 A;  4PRX A;  1Z0B A;  4JI2 E;  4MU0 A;  4LF8 E;  2V2Z A;  1XNQ I;  1PKP A;  4MU4 A;  2BA1 D;  4JI4 I;  2CG9 A;  3M7N G;  2UXC I;  4DV0 E;  4KHP I;  1EA6 A;  1Z5B A;  1EI1 A;  1BKN A;  2HK2 A;  2NN6 B;  2E5L I;  2ZIT A;  4DR1 E;  1FJG I;  2O1T A;  4JI1 E;  3L7Z A;  5DRO A;  4X66 I;  4YHH E;  2BA1 G;  4X62 E;  4DR5 I;  2O3Z A;  3WU3 A;  2F4V I;  4IFD E;  4OO1 C;  2JE6 B;  3B4T A;  3PYF A;  2CVE A;  4LFB I;  4M1K A;  1HNX E;  5K36 C;  4DR4 I;  1E3P A;  4JV5 I;  3JAM C;  1R6L A;  1H73 A;  2V34 A;  4P7A A;  5LMU E;  4DV1 I;  1D6T A;  4FW7 A;  4LPF A;  5JEA B;  4P52 A;  2UUA I;  1YHC A;  1OYS A;  2BA0 D;  3QT8 A;  4DUY E;  2NN6 F;  3PYD A;  4OX9 I;  1N32 I;  5A2Q Q;  4MU1 A;  1B63 A;  4LFA I;  4Z7Y A;  4GKK E;  4DPW A;  1Z0E A;  1IBL E;  4LCH A;  2BR2 B;  4NBQ A;  2BA0 G;  4NXM I;  4MYT A;  4FWG A;  1ZM3 A;  5JEA F;  2BM1 A;  4OO1 A;  1VIS A;  1XNQ E;  2Z5C B;  5FWK A;  1PVG A;  5FLX C;  4JI4 E;  1E3H A;  1VI7 A;  2UXC E;  2R42 A;  4JYA I;  5BR8 I;  2UU9 I;  2CZ9 A;  4KHP E;  2VQF I;  4HYM A;  3Q6N A;  2DEI A;  1H74 A;  1ZXM A;  2X7I A;  3Q6M A;  3ZM7 A;  2E5L E;  1FJG E;  3P3E A;  2HKE A;  4JI6 I;  4DU7 A;  4X66 E;  4DR5 E;  2F4V E;  4JG4 A;  4N3O A;  2O1U A;  4OKG A;  2IOQ A;  2PO2 A;  4BA1 A;  3P3G A;  5LMN I;  4BA2 B;  4MQY A;  2C37 A;  4LFB E;  4WUC A;  3K17 A;  4DR4 E;  5EL9 A;  4JV5 E;  3P3C A;  5EKW A;  1H7U A;  4DV1 E;  2XEX A;  1NZ0 A;  2PO0 A;  2UUA E;  2PO2 B;  2EFG A;  1XXE A;  3NZK A;  3J81 Q;  2VES A;  4U3B A;  4X65 I;  5DNX A;  3DD6 A;  4OX9 E;  4MDT A;  2V2V A;  3PRY A;  1N32 E;  4LFA E;  5C0X C;  2F1D A;  1HR0 E;  1ZM4 A;  4HY1 A;  4XTJ A;  3ZKB A;  4LF7 E;  3GCM A;  5DRP A;  1K47 A;  1Z0V A;  4NXM E;  2C38 A;  1OJ4 A;  1N0U A;  2WP8 B;  1MG7 A;  1Z5A A;  5GME A;  3F0N A;  4FN5 A;  5DRQ A;  1IBM E;  4JYA E;  4GKJ E;  5BR8 E;  2UU9 E;  2HKJ A;  2VQF E;  1UDQ A;  3ZKD A;  1FWK A;  3J7A M;  4IZJ A;  1RRE A;  4IFD C;  2UUB I;  4HAC A;  4PRV A;  3LTO A;  2HFU A;  3PS1 A;  1HNW I;  4JI6 E;  4WUB A;  1NHJ A;  2PNM A;  2E1R A;  2PNZ A;  3PYE A;  1KVK A;  2NN6 E;  5LMN E;  1Z59 A;  5C0X A;  2IOP A;  1FKA E;  4NXN I;  4OO1 D;  4AM3 A;  2IER A;  4U3D A;  4EMD A;  2C39 A;  4DR2 I;  4YY3 I;  4J3D A;  4X65 E;  5JEA E;  3J80 Q;  1UDS A;  1DAR A;  1KKH A;  4AQY E;  1N36 I;  4I3H A;  2O1W A;  2Z5B A;  3L7Z B;  3GLL A;  1FWL A;  2NPF A;  4RPF A;  5A2Q C;  4DR3 I;  3CDI A;  4LCF A; 
#chains in the Genus database with same CATH homology
 1I94 I;  1U2R A;  1Z0W A;  2PNL A;  2R3V A;  1XHK A;  3ZZT A;  1HR0 I;  1Y6Z A;  2BV3 A;  4LF7 I;  1Z0G A;  4DR6 E;  4ZVI A;  4USK A;  2V8P A;  4JI0 I;  4X64 I;  3HUL A;  4FWD A;  4DV6 I;  4B3T I;  2UUB E;  1KIJ A;  1HNW E;  2V2Q A;  1IBM I;  4GKJ I;  4LF6 E;  2HHH E;  1UEK A;  4DV2 I;  1B62 A;  4NXN E;  4UTG A;  4URL A;  3QT6 A;  3QT5 A;  1ZXN A;  4DR2 E;  4YY3 E;  1IBK I;  1QZR A;  4DV3 I;  3K85 A;  4IZJ D;  1N36 E;  3B8H A;  3PYG A;  1PIE A;  4FW9 A;  4DR7 I;  4FWH A;  4DR3 E;  2O1V A;  2ZBK B;  4DV7 I;  4B3S I;  5FLX Q;  3OTO I;  1I94 E;  2GS8 A;  4LF9 I;  4UT4 A;  1FNM A;  2OI2 A;  4AQY I;  2Z5E A;  1J5E E;  4DPU A;  1NHH A;  4DU8 A;  4Z7C A;  4KQV A;  1A6F A;  1HK7 A;  1MU5 A;  4JI0 E;  4PU9 A;  4X64 E;  4LFC I;  3T1H I;  4DV6 E;  4B3T E;  5L3J A;  5IT9 Q;  4DR6 I;  1Z0C A;  4DV2 E;  1MX0 A;  1XMQ I;  4IZK A;  1H72 C;  3WU5 A;  1Y4S A;  1XNR I;  4LF6 I;  2HHH I;  1IBK E;  1RR9 A;  4MYU A;  4DV3 E;  3J7A G;  4IZJ B;  4JI7 I;  4HAC B;  3V5R A;  4DV4 I;  1USV A;  1ZM9 A;  3J80 C;  4JI5 I;  2HK3 A;  1S4E A;  4DR7 E;  4DV7 E;  4B3S E;  3OTO E;  5IWA I;  2X36 A;  4LF9 E;  4K0K I;  1KTV A;  2CGE A;  2UXB I;  2J7K A;  2UUC I;  1H7S A;  4B3R I;  4JI8 I;  1WUU A;  2ZM6 I;  4DXL A;  4DUZ I;  1J5E I;  4LFC E;  2Z5B B;  3T1H E;  4JI3 I;  1USU A;  3K1J A;  1XMO E;  3GON A;  2A2D A;  4DV5 E;  2DEJ A;  3HJC A;  1HNZ I;  3LPS A;  4LF5 I;  1XMQ E;  2LJP A;  3JAM Q;  1Z0T A;  3WU4 A;  2VF3 A;  3B78 A;  2A2C A;  3B82 A;  4B3M I;  1XNR E;  3Q1Q A;  5GMD A;  2Z5C A;  4JI7 E;  3LNU A;  1N34 I;  4DV4 E;  4HXZ A;  2HFS A;  4JI5 E;  4LF4 I;  4ED4 A;  2VQE I;  4DPY A;  3T1Y I;  5IWA E;  4K0K E;  3J81 C;  2UXB E;  4USM A;  2UUC E;  3CWV A;  1N33 I;  2UXD I;  3QT7 A;  3M6A A;  4JI2 I;  4B3R E;  4LF8 I;  4JI8 E;  2ZM6 E;  4DUZ E;  2AJ4 A;  2WW4 A;  4DV0 I;  4DPX A;  4JI3 E;  5LL6 R;  1Z5C A;  4DR1 I;  4JI1 I;  5IT9 C;  4YHH I;  1HNZ E;  4X62 I;  1N0V C;  4LF5 E;  1XMO I;  1HNX I;  4DV5 I;  1Y4U A;  3P06 A;  4WUD A;  2BM0 A;  5LMU I;  3V2U C;  4B3M E;  1ELO A;  1S16 A;  2Q2E B;  1N34 E;  4DUY I;  4LF4 E;  3ZZ0 A;  3D4J A;  3ZZU A;  2VQE E;  2GQ0 A;  3H4L A;  3T1Y E;  3WU6 A;  4GKK I;  4IZK B;  1IBL I;  1NHI A;  1ZM2 A;  1N33 E;  4R1F A;  4DPT A;  2UXD E;  1FI4 A;  4PRX A;  1Z0B A;  4JI2 E;  4LF8 E;  1XNQ I;  2V2Z A;  1PKP A;  4JI4 I;  2CG9 A;  2UXC I;  4DV0 E;  4KHP I;  1EA6 A;  1Z5B A;  1EI1 A;  1BKN A;  2HK2 A;  2E5L I;  2ZIT A;  4DR1 E;  1FJG I;  2O1T A;  4JI1 E;  4X66 I;  4YHH E;  4DR5 I;  2F4V I;  4X62 E;  3WU3 A;  3PYF A;  4LFB I;  4M1K A;  1HNX E;  4DR4 I;  4JV5 I;  3JAM C;  5LMU E;  1H73 A;  2V34 A;  4P7A A;  4DV1 I;  1D6T A;  4P52 A;  2UUA I;  3QT8 A;  4DUY E;  3PYD A;  4OX9 I;  1N32 I;  5A2Q Q;  1B63 A;  4LFA I;  4Z7Y A;  4GKK E;  4DPW A;  1Z0E A;  1IBL E;  4NXM I;  4MYT A;  4FWG A;  1ZM3 A;  2BM1 A;  1VIS A;  1XNQ E;  2Z5C B;  5FWK A;  1PVG A;  5FLX C;  4JI4 E;  2UXC E;  2R42 A;  4JYA I;  5BR8 I;  2UU9 I;  2CZ9 A;  4KHP E;  2VQF I;  4HYM A;  3Q6N A;  2DEI A;  1H74 A;  1ZXM A;  2X7I A;  3Q6M A;  3ZM7 A;  2E5L E;  1FJG E;  4JI6 I;  2HKE A;  4DU7 A;  4X66 E;  4DR5 E;  2F4V E;  4JG4 A;  4N3O A;  2O1U A;  2IOQ A;  5LMN I;  4LFB E;  4WUC A;  3K17 A;  4DR4 E;  4JV5 E;  1H7U A;  4DV1 E;  2XEX A;  1NZ0 A;  2UUA E;  2EFG A;  3J81 Q;  4X65 I;  4OX9 E;  2V2V A;  3PRY A;  1N32 E;  4LFA E;  1HR0 E;  1ZM4 A;  4HY1 A;  4XTJ A;  3ZKB A;  4LF7 E;  1K47 A;  1Z0V A;  4NXM E;  1OJ4 A;  1N0U A;  1MG7 A;  1Z5A A;  5GME A;  3F0N A;  4FN5 A;  1IBM E;  4JYA E;  4GKJ E;  5BR8 E;  2UU9 E;  2HKJ A;  2VQF E;  3ZKD A;  1FWK A;  3J7A M;  4IZJ A;  1RRE A;  2UUB I;  4HAC A;  4PRV A;  3LTO A;  2HFU A;  1HNW I;  4JI6 E;  4WUB A;  1NHJ A;  2PNM A;  2E1R A;  3PYE A;  1KVK A;  5LMN E;  1Z59 A;  2IOP A;  1FKA E;  4NXN I;  4EMD A;  4DR2 I;  4YY3 I;  4X65 E;  3J80 Q;  1DAR A;  1KKH A;  4AQY E;  1N36 I;  4I3H A;  2O1W A;  2Z5B A;  1FWL A;  2NPF A;  4RPF A;  5A2Q C;  4DR3 I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...