1N34I

Structure of the thermus thermophilus 30s ribosomal subunit in the presence of codon and crystallographically disordered near-cognate transfer rna anticodon stem-loop mismatched at the first codon position
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
127
structure length
127
Chain Sequence
EQYYGTGRRKEAVARVFLRPGNGKVTVNGQDFNEYFQGLVRAVAALEPLRAVDALGRFDAYITVRGGGKSGQIDAIKLGIARALVQYNPDYRAKLKPLGFLTRDARVVERKKYGKHKARRAPQYSKR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S RIBOSOMAL RNA
publication title Selection of tRNA by the Ribosome Requires a Transition from an Open to a Closed Form
pubmed doi rcsb
molecule tags Ribosome
total genus 10
structure length 127
sequence length 127
ec nomenclature
pdb deposition date 2002-10-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF00380 Ribosomal_S9 Ribosomal protein S9/S16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 1n34I00
3J7AG 4AQYI 3ZKDA 2DEIA 3J81C 1XNRI 4DV3E 1IBLI 1HR0E 1Z59A 2J7KA 1FWLA 1XMOE 1FKAE 4B3ME 4I3HA 4DPWA 4AQYE 1FNMA 4HACA 4EMDA 4B3TI 1IBLE 1Z0VA 2E5LE 1MU5A 2UU9I 3WU5A 4DU7A 2BV3A 4DU8A 1Z5AA 3T1YI 2UUAE 3J7AM 1PKPA 3ZM7A 3CWVA 3V2UC 1NZ0A 4GKKE 2HK3A 4DXLA 3GONA 1PVGA 1ZM4A 5L3JA 3QT8A 3OTOI 2V2QA 2F4VE 4RPFA 3F0NA 1IBKI 4DR1E 1S16A 4URLA 1BKNA 1D6TA 4JI0I 4LFCI 1NHJA 4LF7I 4GKJI 4YY3I 4DR7I 2UXBI 1HNWI 2UXDI 5LMNE 4FWGA 2HFUA 4JYAE 1RREA 4R1FA 4LF8I 4NXME 1N33I 4USKA 2CZ9A 3V5RA 4DV4I 1FJGE 2UUBE 4JI8E 2ZM6I 1H7SA 1HNXI 4JV5I 1MG7A 1N33E 4DV4E 3J80Q 2E1RA 3WU3A 4KHPI 1KVKA 1N0UA 5LMUI 5A2QQ 2UXCI 4LF5I 4DR6E 4X65E 2X36A 4DV3I 4X66E 2V2VA 4DPYA 1HR0I 1ZXNA 1XMOI 4MYUA 4B3MI 4HY1A 4LF5E 4OX9E 4JI3E 1I94I 4DPTA 5FLXQ 4JI4I 1ZM9A 4DUZE 2E5LI 4DR4E 1KIJA 4Z7CA 4UT4A 1I94E 3JAMQ 1Z0CA 1N0VC 3K17A 4JI4E 2UUAI 1OJ4A 3LNUA 3PYGA 1XMQI 1HNZE 4GKKI 1ELOA 2OI2A 5GMEA 3B78A 4X64E 3D4JA 1H7UA 2F4VI 3HULA 3ZZUA 5IT9C 4DR1I 1XMQE 1IBME 2GS8A 4LF9I 3ZZ0A 1N36E 4DR5I 2Q2EB 2VQFE 4YHHI 2AJ4A 1FWKA 2HKEA 3J80C 3Q1QA 1Z5BA 4LF9E 4DR5E 4KQVA 5LMNI 4JI2E 2VF3A 4LF4E 2HKJA 4UTGA 4YHHE 2HFSA 5A2QC 4DV6E 4JYAI 3M6AA 4FW9A 1Z0BA 4DV5E 4DV1E 1UEKA 4HYMA 4DV0E 4NXMI 4JI7E 1B63A 1FJGI 4WUBA 2UUBI 4DUYE 4JI8I 1J5EE 3ZKBA 1RR9A 1XNQE 2HHHE 1Z0EA 2A2DA 5IT9Q 5FLXC 4HACB 4PRVA 4DR3I 2A2CA 1N32I 3K1JA 1Z0WA 2VQEI 4DV2E 5IWAI 3JAMC 3PYFA 4B3RI 4FWHA 4DR3E 4LF6E 1N32E 4DR6I 2VQEE 1ZM2A 4MYTA 4X65I 5IWAE 4X66I 4DR2I 2ZITA 4B3RE 3WU6A 4OX9I 4JI3I 4JI5E 1Z0GA 4DUZI 4DR2E 4DR4I 3QT7A 1NHIA 5LL6R 2EFGA 1PIEA 4DPXA 3B82A 3QT5A 1KKHA 4JI6E 4Z7YA 1HNZI 1K47A 3LPSA 4X64I 4LFAE 4XTJA 1ZXMA 1IBMI 4PU9A 1S4EA 1N36I 4P52A 2VQFI 3QT6A 4B3SE 4X62E 2UUCE 3H4LA 5BR8I 1XNRE 1A6FA 4JI2I 2R3VA 4LF4I 4DV6I 2X7IA 1NHHA 4B3TE 5BR8E 1N34I 3LTOA 4DV5I 4DV1I 2BM0A 4WUDA 4DV0I 2R42A 2UU9E 4JI7I 4DUYI 2XEXA 3WU4A 1VISA 3T1YE 1J5EI 3T1HI 1N34E 1XNQI 2BM1A 2HHHI 5GMDA 2UUCI 1QZRA 2HK2A 3B8HA 3PYDA 3J81Q 4DV2I 3T1HE 3OTOE 3ZZTA 2LJPA 1IBKE 4LF6I 4DPUA 1KTVA 1H73A 1B62A 4JI0E 4LFCE 2DEJA 4NXNI 4LF7E 1DARA 4GKJE 4YY3E 1Z0TA 4DR7E 1ZM3A 1H74A 2UXBE 1HNWE 2UXDE 1WUUA 4JI5I 1EI1A 2V2ZA 4NXNE 4USMA 4FWDA 1U2RA 1Z5CA 2WW4A 2ZBKB 4LFBI 4LF8E 1H72C 4FN5A 4P7AA 1MX0A 1XHKA 4JI6I 2ZM6E 4K0KI 2V8PA 1HNXE 4M1KA 4ED4A 4JV5E 1FI4A 4WUCA 4DV7I 4LFBE 4LFAI 3PYEA 4HXZA 1EA6A 4JI1I 4K0KE 4KHPE 2V34A 5LMUE 4DV7E 2UXCE 2NPFA 4JG4A 4PRXA 4ZVIA 4B3SI 4X62I 4JI1E
chains in the Genus database with same CATH superfamily
3J7AG 4AQYI 4MQYA 3ZKDA 2DEIA 4FW6A 3J81C 1XNRI 4DV3E 2PNZA 1IBLI 1HR0E 1Z59A 2NN6D 2J7KA 1FWLA 4NBQA 1XMOE 1FKAE 4B3ME 4I3HA 4DPWA 4AQYE 1FNMA 4LPFA 4HACA 4EMDA 4B3TI 2C38A 3P76A 4GQUA 4OO1B 2JT2A 1IBLE 1Z0VA 2E5LE 1MU5A 2UU9I 3WU5A 4DU7A 4QNJA 2BV3A 2JE6B 4DU8A 1Z5AA 2O1UA 3T1YI 2UUAE 3J7AM 2WNRB 1PKPA 4OZEA 5K36B 5DRPA 3ZM7A 1VI7A 3PS2A 3CWVA 3V2UC 2O1WA 3L7ZB 1NZ0A 4U3DA 4GKKE 2HK3A 4DXLA 3GONA 1PVGA 1Y4UA 1ZM4A 5L3JA 3QT8A 3OTOI 2V2QA 2F4VE 4RPFA 3F0NA 1IBKI 4DR1E 4JI1E 1OYPA 4IFDE 1S16A 4URLA 1BKNA 1D6TA 2BR2A 4JI0I 1UDQA 4LFCI 4AIMA 1NHJA 1OYSA 4LF7I 4GKJI 3P3EA 4N3OA 1UDSA 4YY3I 4DR7I 2JEAB 2UXBI 1HNWI 4LCHA 2UXDI 3P06A 1E3HA 5LMNE 4FWGA 4IZKB 2PO2B 2HFUA 4JYAE 1RREA 4R1FA 3M85G 5DROA 4LF8I 4NXME 2J65A 1N33I 4USKA 2CZ9A 3V5RA 4DV4I 1FJGE 2UUBE 4JI8E 3K85A 4IZJB 2ZM6I 1H7SA 1HNXI 4JV5I 1MG7A 3GCMA 1N33E 1Y5YA 2C39B 4DV4E 3J80Q 2E1RA 4FW4A 3WU3A 1USVA 5K36D 4KHPI 1KVKA 1Y60A 1N0UA 5LMUI 5A2QQ 2UXCI 1XXEA 5C0XB 4LF5I 4DR6E 4BA2B 2PO0B 3GLLA 2CG9A 4X65E 5JEAA 1E3PA 2X36A 4IFDA 5JEAF 4DV3I 4X66E 4IFDF 2V2VA 4DPYA 1HR0I 1ZXNA 3HKMA 1XMOI 2C37B 4MYUA 4B3MI 4HY1A 4LF5E 5ELWA 4OX9E 4JI3E 2GO3A 1I94I 4DPTA 5FLXQ 4FW7A 4JI4I 3U1YA 1ZM9A 4DUZE 2E5LI 4DR4E 1KIJA 4Z7CA 4BA1B 4UT4A 2Z5CB 1I94E 3JAMQ 1Z0CA 1N0VC 3K17A 2F1DA 2IOPA 4JI4E 2UUAI 2NN6A 1OJ4A 2Z5BB 2BA0G 3LNUA 2NN6F 3PYGA 1XMQI 4AIDA 3UHMA 1HNZE 4GKKI 1ELOA 1R6MA 2OI2A 3B78A 5GMEA 3U1KA 4X64E 3M7NG 3D4JA 1H7UA 1USUA 4MU3A 4OO1E 2F4VI 2PNLA 3HULA 3ZZUA 4IZJD 5IT9C 4DR1I 1XMQE 1IBME 2GS8A 4LF9I 3ZZ0A 1N36E 4DR5I 2Q2EB 5K36E 2VQFE 4YHHI 2AJ4A 2WP8A 1FWKA 2HKEA 3J80C 3Q1QA 1Z5BA 4LF9E 4DR5E 5DNLA 3GMEA 4FW5A 4KQVA 4LCFA 5LMNI 4JI2E 2VF3A 4LF4E 2HKJA 4UTGA 5JEAC 4YHHE 4IFDC 2HFSA 5A2QC 4DV6E 4JYAI 3M6AA 4U3BA 4FW9A 1Z0BA 4DV5E 4DV1E 1UEKA 4HYMA 2JEBA 4DV0E 1HK7A 4JI7E 1B63A 4NXMI 2BA0D 4OKGA 1FJGI 4WUBA 2UUBI 4MU1A 1P42A 2PNZB 4DUYE 2BA1G 4JI8I 2PO1A 2GQ0A 1J5EE 3ZKBA 1RR9A 1XNQE 2HHHE 5EKWA 1Z0EA 2A2DA 2AE8A 3M7ND 5IT9Q 5FLXC 4HACB 2C38B 2NN6C 4PRVA 2VESA 4DR3I 2A2CA 1N32I 3K1JA 1Z0WA 2VQEI 4DV2E 4OO1D 5IWAI 3JAMC 3PYFA 1R6LA 4B3RI 4FWHA 4DR3E 4OO1A 4LF6E 1N32E 4DR6I 3PS1A 1ZM2A 2VQEE 4OO1F 4MYTA 4X65I 5IWAE 2CVEA 2JE6A 4X66I 4DR2I 2ZITA 2IERA 4MU0A 4B3RE 2WNRA 5K36A 3WU6A 3PRYA 4OX9I 4JI3I 5K36F 4JI5E 1Z0GA 2IOQA 3L7ZA 4DUZI 2BR2B 4DR2E 4DR4I 3QT7A 4LCGA 1NHIA 5LL6R 2EFGA 5C0XE 1PIEA 4DPXA 3B82A 3KRNA 3M85D 2O3ZA 3QT5A 1KKHA 4JI6E 4MDTA 4Z7YA 1HNZI 1K47A 3LPSA 2GO4A 5DRQA 1Y6ZA 4X64I 2CGEA 4FW3A 4LFAE 2JEAA 3CDJA 3B4TA 1UDNA 4XTJA 4IZKA 1ZXMA 1IBMI 2O1TA 2PO2A 4PU9A 5DRRA 1S4EA 1N36I 4P52A 4LOMA 2VQFI 4QNKA 3QT6A 4B3SE 4X62E 1OYRA 2UUCE 3H4LA 5BR8I 1XNRE 4OO1C 3Q6MA 1A6FA 4IZJA 4JI2I 2R3VA 3PS3A 4LF4I 4IS9A 4DV6I 2X7IA 1NHHA 4B3TE 5BR8E 2C39A 1N34I 3LTOA 5K36C 4DV5I 4DV1I 2BM0A 3CDIA 4WUDA 4DV0I 2R42A 2UU9E 4JI7I 5JEAB 5C0XD 4IFDB 4DUYI 2XEXA 3WU4A 1VISA 3T1YE 1J5EI 3T1HI 1N34E 1XNQI 1RHYA 2BM1A 5C0XA 2HHHI 4BA2A 5GMDA 2PO0A 5C0XF 5JEAE 1QZRA 2HK2A 2IESA 1YHCA 3B8HA 3PYDA 3HJCA 3J81Q 2C37A 4DV2I 4AM3A 3T1HE 3OTOE 3P3CA 3ZZTA 2LJPA 1IBKE 2NN6B 5DNXA 4LF6I 4DPUA 1YH8A 1KTVA 1H73A 1B62A 4JI0E 4LFCE 4BA1A 2Z5CA 2DEJA 4ISAA 4NXNI 4LF7E 1DARA 4GKJE 2NN6E 4YY3E 1Z0TA 4DR7E 1ZM3A 2Z5BA 1H74A 2UXBE 1HNWE 2UXDE 1WUUA 4J3DA 4JI5I 1EI1A 2V2ZA 3NZKA 4NXNE 4USMA 4FWDA 1U2RA 1Z5CA 2WW4A 5EL9A 2ZBKB 2WP8B 4LFBI 4LF8E 1H72C 3P3GA 3H1CA 4FN5A 3DD6A 4P7AA 1MX0A 1XHKA 1Y4SA 4JI6I 2ZM6E 4K0KI 3Q6NA 2V8PA 1HNXE 4M1KA 4ED4A 4JV5E 1FI4A 4WUCA 4DV7I 2BA1D 4LFBE 4LFAI 3PYEA 4HXZA 5JEAD 4IFDD 1EA6A 2O1VA 5C0XC 4JI1I 2JEBB 4K0KE 2Z5EA 4MU4A 2PNMA 4KHPE 5FWKA 2V34A 5LMUE 4DV7E 1UDOA 2UXCE 2NPFA 4JG4A 2PO1B 4PRXA 4ZVIA 4B3SI 4X62I 2UUCI
chains in the Genus database with same CATH topology
3J7AG 4AQYI 3ZKDA 2DEIA 3J81C 1XNRI 4DV3E 1IBLI 1HR0E 1Z59A 2J7KA 1FWLA 1XMOE 1FKAE 4B3ME 4I3HA 4DPWA 4AQYE 1FNMA 4HACA 4EMDA 4B3TI 1IBLE 1Z0VA 2E5LE 1MU5A 2UU9I 3WU5A 4DU7A 2BV3A 4DU8A 1Z5AA 2O1UA 3T1YI 2UUAE 3J7AM 1PKPA 3ZM7A 3CWVA 3V2UC 2O1WA 1NZ0A 4GKKE 2HK3A 4DXLA 3GONA 1PVGA 1Y4UA 1ZM4A 5L3JA 3QT8A 3OTOI 2V2QA 2F4VE 4RPFA 3F0NA 1IBKI 4DR1E 4JI1E 1S16A 4URLA 1BKNA 1D6TA 4JI0I 4LFCI 1NHJA 4LF7I 4GKJI 4N3OA 4YY3I 4DR7I 2UXBI 1HNWI 2UXDI 3P06A 5LMNE 4FWGA 4IZKB 2HFUA 4JYAE 1RREA 4R1FA 4LF8I 4NXME 1N33I 4USKA 2CZ9A 3V5RA 4DV4I 1FJGE 2UUBE 4JI8E 3K85A 4IZJB 2ZM6I 1H7SA 1HNXI 4JV5I 1MG7A 1N33E 4DV4E 3J80Q 2E1RA 3WU3A 1USVA 4KHPI 1KVKA 1N0UA 5LMUI 5A2QQ 2UXCI 4LF5I 4DR6E 2CG9A 4X65E 2X36A 4DV3I 4X66E 2V2VA 4DPYA 1HR0I 1ZXNA 1XMOI 4MYUA 4B3MI 4HY1A 4LF5E 4OX9E 4JI3E 1I94I 4DPTA 5FLXQ 4JI4I 1ZM9A 4DUZE 2E5LI 4DR4E 1KIJA 4Z7CA 4UT4A 2Z5CB 1I94E 3JAMQ 1Z0CA 1N0VC 3K17A 2IOPA 4JI4E 2UUAI 1OJ4A 2Z5BB 3LNUA 3PYGA 1XMQI 1HNZE 4GKKI 1ELOA 2OI2A 5GMEA 3B78A 4X64E 3D4JA 1H7UA 1USUA 2F4VI 2PNLA 3HULA 3ZZUA 4IZJD 5IT9C 4DR1I 1XMQE 1IBME 2GS8A 4LF9I 3ZZ0A 1N36E 4DR5I 2Q2EB 2VQFE 4YHHI 2AJ4A 1FWKA 2HKEA 3J80C 3Q1QA 1Z5BA 4LF9E 4DR5E 4KQVA 5LMNI 4JI2E 2VF3A 4LF4E 2HKJA 4UTGA 4YHHE 2HFSA 5A2QC 4DV6E 4JYAI 3M6AA 4FW9A 1Z0BA 4DV5E 4DV1E 1UEKA 4HYMA 4DV0E 4NXMI 1HK7A 4JI7E 1B63A 1FJGI 4WUBA 2UUBI 4DUYE 4JI8I 2GQ0A 1J5EE 3ZKBA 1RR9A 1XNQE 2HHHE 1Z0EA 2A2DA 5IT9Q 5FLXC 4HACB 4PRVA 4DR3I 2A2CA 1N32I 3K1JA 1Z0WA 2VQEI 4DV2E 5IWAI 3JAMC 3PYFA 4B3RI 4FWHA 4DR3E 4LF6E 1N32E 4DR6I 2VQEE 1ZM2A 4MYTA 4X65I 5IWAE 4X66I 4DR2I 2ZITA 4B3RE 3WU6A 3PRYA 4OX9I 4JI3I 4JI5E 1Z0GA 2IOQA 4DUZI 4DR2E 4DR4I 3QT7A 1NHIA 5LL6R 2EFGA 1PIEA 4DPXA 3B82A 3QT5A 1KKHA 4JI6E 4Z7YA 1HNZI 1K47A 3LPSA 1Y6ZA 4X64I 2CGEA 4LFAE 4XTJA 4IZKA 1ZXMA 1IBMI 2O1TA 4PU9A 1S4EA 1N36I 4P52A 2VQFI 3QT6A 4B3SE 4X62E 2UUCE 3H4LA 5BR8I 1XNRE 3Q6MA 1A6FA 4IZJA 4JI2I 2R3VA 4LF4I 4DV6I 2X7IA 1NHHA 4B3TE 5BR8E 1N34I 3LTOA 4DV5I 4DV1I 2BM0A 4WUDA 4DV0I 2R42A 2UU9E 4JI7I 4DUYI 2XEXA 3WU4A 1VISA 3T1YE 1J5EI 3T1HI 1N34E 1XNQI 2BM1A 2HHHI 5GMDA 1QZRA 2HK2A 3B8HA 3PYDA 3J81Q 3HJCA 4DV2I 3T1HE 3OTOE 3ZZTA 2LJPA 1IBKE 4LF6I 4DPUA 1KTVA 1H73A 1B62A 4JI0E 4LFCE 2Z5CA 2DEJA 4NXNI 4LF7E 1DARA 4GKJE 4YY3E 1Z0TA 4DR7E 1ZM3A 2Z5BA 1H74A 2UXBE 1HNWE 2UXDE 1WUUA 4JI5I 1EI1A 2V2ZA 4NXNE 4USMA 4FWDA 1U2RA 1Z5CA 2WW4A 2ZBKB 4LFBI 4LF8E 1H72C 4FN5A 4P7AA 1MX0A 1XHKA 1Y4SA 4JI6I 2ZM6E 4K0KI 3Q6NA 2V8PA 1HNXE 4M1KA 4ED4A 4JV5E 1FI4A 4WUCA 4DV7I 4LFBE 4LFAI 3PYEA 4HXZA 1EA6A 2O1VA 4JI1I 4K0KE 2Z5EA 2PNMA 4KHPE 5FWKA 2V34A 5LMUE 4DV7E 2UXCE 2NPFA 4JG4A 4PRXA 4ZVIA 4B3SI 4X62I 2UUCI
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3J7A G;  4AQY I;  3ZKD A;  2DEI A;  3J81 C;  1XNR I;  4DV3 E;  1IBL I;  1HR0 E;  1Z59 A;  2J7K A;  1FWL A;  1XMO E;  1FKA E;  4B3M E;  4I3H A;  4DPW A;  4AQY E;  1FNM A;  4HAC A;  4EMD A;  4B3T I;  1IBL E;  1Z0V A;  2E5L E;  1MU5 A;  2UU9 I;  3WU5 A;  4DU7 A;  2BV3 A;  4DU8 A;  1Z5A A;  3T1Y I;  2UUA E;  3J7A M;  1PKP A;  3ZM7 A;  3CWV A;  3V2U C;  1NZ0 A;  4GKK E;  2HK3 A;  4DXL A;  3GON A;  1PVG A;  1ZM4 A;  5L3J A;  3QT8 A;  3OTO I;  2V2Q A;  2F4V E;  4RPF A;  3F0N A;  1IBK I;  4DR1 E;  1S16 A;  4URL A;  1BKN A;  1D6T A;  4JI0 I;  4LFC I;  1NHJ A;  4LF7 I;  4GKJ I;  4YY3 I;  4DR7 I;  2UXB I;  1HNW I;  2UXD I;  5LMN E;  4FWG A;  2HFU A;  4JYA E;  1RRE A;  4R1F A;  4LF8 I;  4NXM E;  1N33 I;  4USK A;  2CZ9 A;  3V5R A;  4DV4 I;  1FJG E;  2UUB E;  4JI8 E;  2ZM6 I;  1H7S A;  1HNX I;  4JV5 I;  1MG7 A;  1N33 E;  4DV4 E;  3J80 Q;  2E1R A;  3WU3 A;  4KHP I;  1KVK A;  1N0U A;  5LMU I;  5A2Q Q;  2UXC I;  4LF5 I;  4DR6 E;  4X65 E;  2X36 A;  4DV3 I;  4X66 E;  2V2V A;  4DPY A;  1HR0 I;  1ZXN A;  1XMO I;  4MYU A;  4B3M I;  4HY1 A;  4LF5 E;  4OX9 E;  4JI3 E;  1I94 I;  4DPT A;  5FLX Q;  4JI4 I;  1ZM9 A;  4DUZ E;  2E5L I;  4DR4 E;  1KIJ A;  4Z7C A;  4UT4 A;  1I94 E;  3JAM Q;  1Z0C A;  1N0V C;  3K17 A;  4JI4 E;  2UUA I;  1OJ4 A;  3LNU A;  3PYG A;  1XMQ I;  1HNZ E;  4GKK I;  1ELO A;  2OI2 A;  5GME A;  3B78 A;  4X64 E;  3D4J A;  1H7U A;  2F4V I;  3HUL A;  3ZZU A;  5IT9 C;  4DR1 I;  1XMQ E;  1IBM E;  2GS8 A;  4LF9 I;  3ZZ0 A;  1N36 E;  4DR5 I;  2Q2E B;  2VQF E;  4YHH I;  2AJ4 A;  1FWK A;  2HKE A;  3J80 C;  3Q1Q A;  1Z5B A;  4LF9 E;  4DR5 E;  4KQV A;  5LMN I;  4JI2 E;  2VF3 A;  4LF4 E;  2HKJ A;  4UTG A;  4YHH E;  2HFS A;  5A2Q C;  4DV6 E;  4JYA I;  3M6A A;  4FW9 A;  1Z0B A;  4DV5 E;  4DV1 E;  1UEK A;  4HYM A;  4DV0 E;  4NXM I;  4JI7 E;  1B63 A;  1FJG I;  4WUB A;  2UUB I;  4DUY E;  4JI8 I;  1J5E E;  3ZKB A;  1RR9 A;  1XNQ E;  2HHH E;  1Z0E A;  2A2D A;  5IT9 Q;  5FLX C;  4HAC B;  4PRV A;  4DR3 I;  2A2C A;  1N32 I;  3K1J A;  1Z0W A;  2VQE I;  4DV2 E;  5IWA I;  3JAM C;  3PYF A;  4B3R I;  4FWH A;  4DR3 E;  4LF6 E;  1N32 E;  4DR6 I;  2VQE E;  1ZM2 A;  4MYT A;  4X65 I;  5IWA E;  4X66 I;  4DR2 I;  2ZIT A;  4B3R E;  3WU6 A;  4OX9 I;  4JI3 I;  4JI5 E;  1Z0G A;  4DUZ I;  4DR2 E;  4DR4 I;  3QT7 A;  1NHI A;  5LL6 R;  2EFG A;  1PIE A;  4DPX A;  3B82 A;  3QT5 A;  1KKH A;  4JI6 E;  4Z7Y A;  1HNZ I;  1K47 A;  3LPS A;  4X64 I;  4LFA E;  4XTJ A;  1ZXM A;  1IBM I;  4PU9 A;  1S4E A;  1N36 I;  4P52 A;  2VQF I;  3QT6 A;  4B3S E;  4X62 E;  2UUC E;  3H4L A;  5BR8 I;  1XNR E;  1A6F A;  4JI2 I;  2R3V A;  4LF4 I;  4DV6 I;  2X7I A;  1NHH A;  4B3T E;  5BR8 E;  1N34 I;  3LTO A;  4DV5 I;  4DV1 I;  2BM0 A;  4WUD A;  4DV0 I;  2R42 A;  2UU9 E;  4JI7 I;  4DUY I;  2XEX A;  3WU4 A;  1VIS A;  3T1Y E;  1J5E I;  3T1H I;  1N34 E;  1XNQ I;  2BM1 A;  2HHH I;  5GMD A;  2UUC I;  1QZR A;  2HK2 A;  3B8H A;  3PYD A;  3J81 Q;  4DV2 I;  3T1H E;  3OTO E;  3ZZT A;  2LJP A;  1IBK E;  4LF6 I;  4DPU A;  1KTV A;  1H73 A;  1B62 A;  4JI0 E;  4LFC E;  2DEJ A;  4NXN I;  4LF7 E;  1DAR A;  4GKJ E;  4YY3 E;  1Z0T A;  4DR7 E;  1ZM3 A;  1H74 A;  2UXB E;  1HNW E;  2UXD E;  1WUU A;  4JI5 I;  1EI1 A;  2V2Z A;  4NXN E;  4USM A;  4FWD A;  1U2R A;  1Z5C A;  2WW4 A;  2ZBK B;  4LFB I;  4LF8 E;  1H72 C;  4FN5 A;  4P7A A;  1MX0 A;  1XHK A;  4JI6 I;  2ZM6 E;  4K0K I;  2V8P A;  1HNX E;  4M1K A;  4ED4 A;  4JV5 E;  1FI4 A;  4WUC A;  4DV7 I;  4LFB E;  4LFA I;  3PYE A;  4HXZ A;  1EA6 A;  4JI1 I;  4K0K E;  4KHP E;  2V34 A;  5LMU E;  4DV7 E;  2UXC E;  2NPF A;  4JG4 A;  4PRX A;  4ZVI A;  4B3S I;  4X62 I;  4JI1 E; 
#chains in the Genus database with same CATH topology
 3J7A G;  4AQY I;  4MQY A;  3ZKD A;  2DEI A;  4FW6 A;  3J81 C;  1XNR I;  4DV3 E;  2PNZ A;  1IBL I;  1HR0 E;  1Z59 A;  2NN6 D;  2J7K A;  1FWL A;  4NBQ A;  1XMO E;  1FKA E;  4B3M E;  4I3H A;  4DPW A;  4AQY E;  1FNM A;  4LPF A;  4HAC A;  4EMD A;  4B3T I;  2C38 A;  3P76 A;  4GQU A;  4OO1 B;  2JT2 A;  1IBL E;  1Z0V A;  2E5L E;  1MU5 A;  2UU9 I;  3WU5 A;  4DU7 A;  4QNJ A;  2BV3 A;  2JE6 B;  4DU8 A;  1Z5A A;  2O1U A;  3T1Y I;  2UUA E;  3J7A M;  2WNR B;  1PKP A;  4OZE A;  5K36 B;  5DRP A;  3ZM7 A;  1VI7 A;  3PS2 A;  3CWV A;  3V2U C;  2O1W A;  3L7Z B;  1NZ0 A;  4U3D A;  4GKK E;  2HK3 A;  4DXL A;  3GON A;  1PVG A;  1Y4U A;  1ZM4 A;  5L3J A;  3QT8 A;  3OTO I;  2V2Q A;  2F4V E;  4RPF A;  3F0N A;  1IBK I;  4DR1 E;  4JI1 E;  1OYP A;  4IFD E;  1S16 A;  4URL A;  1BKN A;  1D6T A;  2BR2 A;  4JI0 I;  1UDQ A;  4LFC I;  4AIM A;  1NHJ A;  1OYS A;  4LF7 I;  4GKJ I;  3P3E A;  4N3O A;  1UDS A;  4YY3 I;  4DR7 I;  2JEA B;  2UXB I;  1HNW I;  4LCH A;  2UXD I;  3P06 A;  1E3H A;  5LMN E;  4FWG A;  4IZK B;  2PO2 B;  2HFU A;  4JYA E;  1RRE A;  4R1F A;  3M85 G;  5DRO A;  4LF8 I;  4NXM E;  2J65 A;  1N33 I;  4USK A;  2CZ9 A;  3V5R A;  4DV4 I;  1FJG E;  2UUB E;  4JI8 E;  3K85 A;  4IZJ B;  2ZM6 I;  1H7S A;  1HNX I;  4JV5 I;  1MG7 A;  3GCM A;  1N33 E;  1Y5Y A;  2C39 B;  4DV4 E;  3J80 Q;  2E1R A;  4FW4 A;  3WU3 A;  1USV A;  5K36 D;  4KHP I;  1KVK A;  1Y60 A;  1N0U A;  5LMU I;  5A2Q Q;  2UXC I;  1XXE A;  5C0X B;  4LF5 I;  4DR6 E;  4BA2 B;  2PO0 B;  3GLL A;  2CG9 A;  4X65 E;  5JEA A;  1E3P A;  2X36 A;  4IFD A;  5JEA F;  4DV3 I;  4X66 E;  4IFD F;  2V2V A;  4DPY A;  1HR0 I;  1ZXN A;  3HKM A;  1XMO I;  2C37 B;  4MYU A;  4B3M I;  4HY1 A;  4LF5 E;  5ELW A;  4OX9 E;  4JI3 E;  2GO3 A;  1I94 I;  4DPT A;  5FLX Q;  4FW7 A;  4JI4 I;  3U1Y A;  1ZM9 A;  4DUZ E;  2E5L I;  4DR4 E;  1KIJ A;  4Z7C A;  4BA1 B;  4UT4 A;  2Z5C B;  1I94 E;  3JAM Q;  1Z0C A;  1N0V C;  3K17 A;  2F1D A;  2IOP A;  4JI4 E;  2UUA I;  2NN6 A;  1OJ4 A;  2Z5B B;  2BA0 G;  3LNU A;  2NN6 F;  3PYG A;  1XMQ I;  4AID A;  3UHM A;  1HNZ E;  4GKK I;  1ELO A;  1R6M A;  2OI2 A;  3B78 A;  5GME A;  3U1K A;  4X64 E;  3M7N G;  3D4J A;  1H7U A;  1USU A;  4MU3 A;  4OO1 E;  2F4V I;  2PNL A;  3HUL A;  3ZZU A;  4IZJ D;  5IT9 C;  4DR1 I;  1XMQ E;  1IBM E;  2GS8 A;  4LF9 I;  3ZZ0 A;  1N36 E;  4DR5 I;  2Q2E B;  5K36 E;  2VQF E;  4YHH I;  2AJ4 A;  2WP8 A;  1FWK A;  2HKE A;  3J80 C;  3Q1Q A;  1Z5B A;  4LF9 E;  4DR5 E;  5DNL A;  3GME A;  4FW5 A;  4KQV A;  4LCF A;  5LMN I;  4JI2 E;  2VF3 A;  4LF4 E;  2HKJ A;  4UTG A;  5JEA C;  4YHH E;  4IFD C;  2HFS A;  5A2Q C;  4DV6 E;  4JYA I;  3M6A A;  4U3B A;  4FW9 A;  1Z0B A;  4DV5 E;  4DV1 E;  1UEK A;  4HYM A;  2JEB A;  4DV0 E;  1HK7 A;  4JI7 E;  1B63 A;  4NXM I;  2BA0 D;  4OKG A;  1FJG I;  4WUB A;  2UUB I;  4MU1 A;  1P42 A;  2PNZ B;  4DUY E;  2BA1 G;  4JI8 I;  2PO1 A;  2GQ0 A;  1J5E E;  3ZKB A;  1RR9 A;  1XNQ E;  2HHH E;  5EKW A;  1Z0E A;  2A2D A;  2AE8 A;  3M7N D;  5IT9 Q;  5FLX C;  4HAC B;  2C38 B;  2NN6 C;  4PRV A;  2VES A;  4DR3 I;  2A2C A;  1N32 I;  3K1J A;  1Z0W A;  2VQE I;  4DV2 E;  4OO1 D;  5IWA I;  3JAM C;  3PYF A;  1R6L A;  4B3R I;  4FWH A;  4DR3 E;  4OO1 A;  4LF6 E;  1N32 E;  4DR6 I;  3PS1 A;  1ZM2 A;  2VQE E;  4OO1 F;  4MYT A;  4X65 I;  5IWA E;  2CVE A;  2JE6 A;  4X66 I;  4DR2 I;  2ZIT A;  2IER A;  4MU0 A;  4B3R E;  2WNR A;  5K36 A;  3WU6 A;  3PRY A;  4OX9 I;  4JI3 I;  5K36 F;  4JI5 E;  1Z0G A;  2IOQ A;  3L7Z A;  4DUZ I;  2BR2 B;  4DR2 E;  4DR4 I;  3QT7 A;  4LCG A;  1NHI A;  5LL6 R;  2EFG A;  5C0X E;  1PIE A;  4DPX A;  3B82 A;  3KRN A;  3M85 D;  2O3Z A;  3QT5 A;  1KKH A;  4JI6 E;  4MDT A;  4Z7Y A;  1HNZ I;  1K47 A;  3LPS A;  2GO4 A;  5DRQ A;  1Y6Z A;  4X64 I;  2CGE A;  4FW3 A;  4LFA E;  2JEA A;  3CDJ A;  3B4T A;  1UDN A;  4XTJ A;  4IZK A;  1ZXM A;  1IBM I;  2O1T A;  2PO2 A;  4PU9 A;  5DRR A;  1S4E A;  1N36 I;  4P52 A;  4LOM A;  2VQF I;  4QNK A;  3QT6 A;  4B3S E;  4X62 E;  1OYR A;  2UUC E;  3H4L A;  5BR8 I;  1XNR E;  4OO1 C;  3Q6M A;  1A6F A;  4IZJ A;  4JI2 I;  2R3V A;  3PS3 A;  4LF4 I;  4IS9 A;  4DV6 I;  2X7I A;  1NHH A;  4B3T E;  5BR8 E;  2C39 A;  1N34 I;  3LTO A;  5K36 C;  4DV5 I;  4DV1 I;  2BM0 A;  3CDI A;  4WUD A;  4DV0 I;  2R42 A;  2UU9 E;  4JI7 I;  5JEA B;  5C0X D;  4IFD B;  4DUY I;  2XEX A;  3WU4 A;  1VIS A;  3T1Y E;  1J5E I;  3T1H I;  1N34 E;  1XNQ I;  1RHY A;  2BM1 A;  5C0X A;  2HHH I;  4BA2 A;  5GMD A;  2PO0 A;  5C0X F;  5JEA E;  1QZR A;  2HK2 A;  2IES A;  1YHC A;  3B8H A;  3PYD A;  3HJC A;  3J81 Q;  2C37 A;  4DV2 I;  4AM3 A;  3T1H E;  3OTO E;  3P3C A;  3ZZT A;  2LJP A;  1IBK E;  2NN6 B;  5DNX A;  4LF6 I;  4DPU A;  1YH8 A;  1KTV A;  1H73 A;  1B62 A;  4JI0 E;  4LFC E;  4BA1 A;  2Z5C A;  2DEJ A;  4ISA A;  4NXN I;  4LF7 E;  1DAR A;  4GKJ E;  2NN6 E;  4YY3 E;  1Z0T A;  4DR7 E;  1ZM3 A;  2Z5B A;  1H74 A;  2UXB E;  1HNW E;  2UXD E;  1WUU A;  4J3D A;  4JI5 I;  1EI1 A;  2V2Z A;  3NZK A;  4NXN E;  4USM A;  4FWD A;  1U2R A;  1Z5C A;  2WW4 A;  5EL9 A;  2ZBK B;  2WP8 B;  4LFB I;  4LF8 E;  1H72 C;  3P3G A;  3H1C A;  4FN5 A;  3DD6 A;  4P7A A;  1MX0 A;  1XHK A;  1Y4S A;  4JI6 I;  2ZM6 E;  4K0K I;  3Q6N A;  2V8P A;  1HNX E;  4M1K A;  4ED4 A;  4JV5 E;  1FI4 A;  4WUC A;  4DV7 I;  2BA1 D;  4LFB E;  4LFA I;  3PYE A;  4HXZ A;  5JEA D;  4IFD D;  1EA6 A;  2O1V A;  5C0X C;  4JI1 I;  2JEB B;  4K0K E;  2Z5E A;  4MU4 A;  2PNM A;  4KHP E;  5FWK A;  2V34 A;  5LMU E;  4DV7 E;  1UDO A;  2UXC E;  2NPF A;  4JG4 A;  2PO1 B;  4PRX A;  4ZVI A;  4B3S I;  4X62 I;  2UUC I; 
#chains in the Genus database with same CATH homology
 3J7A G;  4AQY I;  3ZKD A;  2DEI A;  3J81 C;  1XNR I;  4DV3 E;  1IBL I;  1HR0 E;  1Z59 A;  2J7K A;  1FWL A;  1XMO E;  1FKA E;  4B3M E;  4I3H A;  4DPW A;  4AQY E;  1FNM A;  4HAC A;  4EMD A;  4B3T I;  1IBL E;  1Z0V A;  2E5L E;  1MU5 A;  2UU9 I;  3WU5 A;  4DU7 A;  2BV3 A;  4DU8 A;  1Z5A A;  2O1U A;  3T1Y I;  2UUA E;  3J7A M;  1PKP A;  3ZM7 A;  3CWV A;  3V2U C;  2O1W A;  1NZ0 A;  4GKK E;  2HK3 A;  4DXL A;  3GON A;  1PVG A;  1Y4U A;  1ZM4 A;  5L3J A;  3QT8 A;  3OTO I;  2V2Q A;  2F4V E;  4RPF A;  3F0N A;  1IBK I;  4DR1 E;  4JI1 E;  1S16 A;  4URL A;  1BKN A;  1D6T A;  4JI0 I;  4LFC I;  1NHJ A;  4LF7 I;  4GKJ I;  4N3O A;  4YY3 I;  4DR7 I;  2UXB I;  1HNW I;  2UXD I;  3P06 A;  5LMN E;  4FWG A;  4IZK B;  2HFU A;  4JYA E;  1RRE A;  4R1F A;  4LF8 I;  4NXM E;  1N33 I;  4USK A;  2CZ9 A;  3V5R A;  4DV4 I;  1FJG E;  2UUB E;  4JI8 E;  3K85 A;  4IZJ B;  2ZM6 I;  1H7S A;  1HNX I;  4JV5 I;  1MG7 A;  1N33 E;  4DV4 E;  3J80 Q;  2E1R A;  3WU3 A;  1USV A;  4KHP I;  1KVK A;  1N0U A;  5LMU I;  5A2Q Q;  2UXC I;  4LF5 I;  4DR6 E;  2CG9 A;  4X65 E;  2X36 A;  4DV3 I;  4X66 E;  2V2V A;  4DPY A;  1HR0 I;  1ZXN A;  1XMO I;  4MYU A;  4B3M I;  4HY1 A;  4LF5 E;  4OX9 E;  4JI3 E;  1I94 I;  4DPT A;  5FLX Q;  4JI4 I;  1ZM9 A;  4DUZ E;  2E5L I;  4DR4 E;  1KIJ A;  4Z7C A;  4UT4 A;  2Z5C B;  1I94 E;  3JAM Q;  1Z0C A;  1N0V C;  3K17 A;  2IOP A;  4JI4 E;  2UUA I;  1OJ4 A;  2Z5B B;  3LNU A;  3PYG A;  1XMQ I;  1HNZ E;  4GKK I;  1ELO A;  2OI2 A;  5GME A;  3B78 A;  4X64 E;  3D4J A;  1H7U A;  1USU A;  2F4V I;  2PNL A;  3HUL A;  3ZZU A;  4IZJ D;  5IT9 C;  4DR1 I;  1XMQ E;  1IBM E;  2GS8 A;  4LF9 I;  3ZZ0 A;  1N36 E;  4DR5 I;  2Q2E B;  2VQF E;  4YHH I;  2AJ4 A;  1FWK A;  2HKE A;  3J80 C;  3Q1Q A;  1Z5B A;  4LF9 E;  4DR5 E;  4KQV A;  5LMN I;  4JI2 E;  2VF3 A;  4LF4 E;  2HKJ A;  4UTG A;  4YHH E;  2HFS A;  5A2Q C;  4DV6 E;  4JYA I;  3M6A A;  4FW9 A;  1Z0B A;  4DV5 E;  4DV1 E;  1UEK A;  4HYM A;  4DV0 E;  4NXM I;  1HK7 A;  4JI7 E;  1B63 A;  1FJG I;  4WUB A;  2UUB I;  4DUY E;  4JI8 I;  2GQ0 A;  1J5E E;  3ZKB A;  1RR9 A;  1XNQ E;  2HHH E;  1Z0E A;  2A2D A;  5IT9 Q;  5FLX C;  4HAC B;  4PRV A;  4DR3 I;  2A2C A;  1N32 I;  3K1J A;  1Z0W A;  2VQE I;  4DV2 E;  5IWA I;  3JAM C;  3PYF A;  4B3R I;  4FWH A;  4DR3 E;  4LF6 E;  1N32 E;  4DR6 I;  2VQE E;  1ZM2 A;  4MYT A;  4X65 I;  5IWA E;  4X66 I;  4DR2 I;  2ZIT A;  4B3R E;  3WU6 A;  3PRY A;  4OX9 I;  4JI3 I;  4JI5 E;  1Z0G A;  2IOQ A;  4DUZ I;  4DR2 E;  4DR4 I;  3QT7 A;  1NHI A;  5LL6 R;  2EFG A;  1PIE A;  4DPX A;  3B82 A;  3QT5 A;  1KKH A;  4JI6 E;  4Z7Y A;  1HNZ I;  1K47 A;  3LPS A;  1Y6Z A;  4X64 I;  2CGE A;  4LFA E;  4XTJ A;  4IZK A;  1ZXM A;  1IBM I;  2O1T A;  4PU9 A;  1S4E A;  1N36 I;  4P52 A;  2VQF I;  3QT6 A;  4B3S E;  4X62 E;  2UUC E;  3H4L A;  5BR8 I;  1XNR E;  3Q6M A;  1A6F A;  4IZJ A;  4JI2 I;  2R3V A;  4LF4 I;  4DV6 I;  2X7I A;  1NHH A;  4B3T E;  5BR8 E;  1N34 I;  3LTO A;  4DV5 I;  4DV1 I;  2BM0 A;  4WUD A;  4DV0 I;  2R42 A;  2UU9 E;  4JI7 I;  4DUY I;  2XEX A;  3WU4 A;  1VIS A;  3T1Y E;  1J5E I;  3T1H I;  1N34 E;  1XNQ I;  2BM1 A;  2HHH I;  5GMD A;  1QZR A;  2HK2 A;  3B8H A;  3PYD A;  3J81 Q;  3HJC A;  4DV2 I;  3T1H E;  3OTO E;  3ZZT A;  2LJP A;  1IBK E;  4LF6 I;  4DPU A;  1KTV A;  1H73 A;  1B62 A;  4JI0 E;  4LFC E;  2Z5C A;  2DEJ A;  4NXN I;  4LF7 E;  1DAR A;  4GKJ E;  4YY3 E;  1Z0T A;  4DR7 E;  1ZM3 A;  2Z5B A;  1H74 A;  2UXB E;  1HNW E;  2UXD E;  1WUU A;  4JI5 I;  1EI1 A;  2V2Z A;  4NXN E;  4USM A;  4FWD A;  1U2R A;  1Z5C A;  2WW4 A;  2ZBK B;  4LFB I;  4LF8 E;  1H72 C;  4FN5 A;  4P7A A;  1MX0 A;  1XHK A;  1Y4S A;  4JI6 I;  2ZM6 E;  4K0K I;  3Q6N A;  2V8P A;  1HNX E;  4M1K A;  4ED4 A;  4JV5 E;  1FI4 A;  4WUC A;  4DV7 I;  4LFB E;  4LFA I;  3PYE A;  4HXZ A;  1EA6 A;  2O1V A;  4JI1 I;  4K0K E;  2Z5E A;  2PNM A;  4KHP E;  5FWK A;  2V34 A;  5LMU E;  4DV7 E;  2UXC E;  2NPF A;  4JG4 A;  4PRX A;  4ZVI A;  4B3S I;  4X62 I;  2UUC I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...