1N34I

Structure of the thermus thermophilus 30s ribosomal subunit in the presence of codon and crystallographically disordered near-cognate transfer rna anticodon stem-loop mismatched at the first codon position
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
127
structure length
127
Chain Sequence
b'EQYYGTGRRKEAVARVFLRPGNGKVTVNGQDFNEYFQGLVRAVAALEPLRAVDALGRFDAYITVRGGGKSGQIDAIKLGIARALVQYNPDYRAKLKPLGFLTRDARVVERKKYGKHKARRAPQYSKR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S RIBOSOMAL RNA
publication title Selection of tRNA by the Ribosome Requires a Transition from an Open to a Closed Form
pubmed doi rcsb
molecule tags Ribosome
total genus 10
structure length 127
sequence length 127
ec nomenclature
pdb deposition date 2002-10-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF00380 Ribosomal_S9 Ribosomal protein S9/S16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 1n34I00
3LPSA 3OTOI 4DV2E 4X64I 2WW4A 4LF4I 4KQVA 1QZRA 1J5EI 2CZ9A 3PYDA 4ZVIA 2GS8A 2ZM6E 4HYMA 1DARA 1RREA 1FJGE 2V2ZA 4JI7E 3J81Q 4DR6I 5LMNE 4DV3I 1XMQE 2UXDI 4RPFA 4DPUA 4FWGA 4Z7YA 4DV6E 4DR1I 5LMUI 3ZZUA 1VISA 4DR2I 4YHHI 1KIJA 2E1RA 2EFGA 4FWHA 4JI4E 4AQYE 4JV5I 3B8HA 1MG7A 2V2VA 1IBKI 4USKA 1HNXE 3JAMQ 2X7IA 1EI1A 4WUDA 4DPTA 1Z0GA 2UUCE 1ZXMA 1ZM2A 5L3JA 4DU8A 4EMDA 3WU4A 1XMOI 1H7UA 2XEXA 4GKKE 3J7AG 1IBLE 1I94I 4OX9E 1XNQE 2UUBI 5GMDA 1OJ4A 1PKPA 1HNWI 4DR5E 4DV7E 4DR7E 2UXCE 4LF5E 4DUZE 3GONA 1PVGA 2DEIA 2UUAE 1RR9A 2ZBKB 3V5RA 1H74A 4NXME 2HHHI 5LL6R 1N33E 4B3TI 1Z5BA 4DV1I 4DR4E 4I3HA 4DUYI 1FWLA 4DXLA 1XHKA 4K0KE 4JI5E 1NZ0A 4X66I 3LNUA 4XTJA 2R3VA 4LFBI 1HNZE 5IWAI 3ZZ0A 5BR8E 4PRXA 3PYGA 1HR0E 1IBMI 4B3SI 4LF7I 1H7SA 4JI1E 2UU9I 4X65I 2F4VI 4WUCA 2VQEE 4DV4E 3J80Q 3ZKDA 3D4JA 4JI2I 2UXBE 4LF8I 1KTVA 4KHPI 2E5LI 5IT9C 4LF9I 3T1HI 4FWDA 3B82A 3T1YE 4UTGA 4UT4A 4X62E 4DV5E 1FNMA 2ZITA 1N36I 4YY3I 4LFCI 2VF3A 2R42A 1N32I 4LFAI 4JI8E 4GKJI 2BM0A 4JI0I 4B3ME 4JI3I 4R1FA 2HK3A 4P7AA 3OTOE 3K17A 1UEKA 4MYUA 1ZM3A 4FW9A 4FN5A 4X64E 4LF4E 1J5EE 2V34A 3ZKBA 1S4EA 4WUBA 3B78A 1ELOA 4HXZA 1ZM9A 4MYTA 3J7AM 4B3RI 2A2DA 4DR6E 4DV3E 2UXDE 4DR1E 5A2QC 5LMUE 2HFSA 4LF6I 3K1JA 3CWVA 4DV0I 4DR2E 4YHHE 2HKJA 1WUUA 4NXNI 4DPYA 3Q1QA 4JV5E 2J7KA 4DR3I 1XNRI 4JYAI 1N34I 4DU7A 1IBKE 2DEJA 2A2CA 2VQFI 1Z0BA 5GMEA 4JI6I 1N0VC 1KVKA 1N0UA 4URLA 1B62A 1XMOE 4HACB 5FLXC 2Q2EB 1B63A 4DV2I 1NHJA 1Z0WA 1Z0CA 1I94E 2UUBE 2ZM6I 2HKEA 1Z59A 1FJGI 1HNWE 1D6TA 1FKAE 3PYFA 1ZM4A 4JI7I 5LMNI 3QT7A 1XMQI 4DV6I 3V2UC 2HK2A 2NPFA 1H72C 2BV3A 2BM1A 2HHHE 4JI4I 4AQYI 4DPXA 1K47A 4B3TE 4DV1E 1HNXI 4DUYE 3J80C 1ZXNA 2AJ4A 4P52A 1Z0VA 2UUCI 4X66E 4USMA 4LFBE 5IT9Q 1S16A 3J81C 5IWAE 4GKKI 1IBLI 1FI4A 1MU5A 4OX9I 1XNQI 3QT6A 1U2RA 2V8PA 1A6FA 4DR5I 1IBME 4DV7I 4DR7I 2UXCI 4B3SE 3H4LA 4LF5I 2V2QA 4DUZI 4LF7E 2UU9E 4X65E 3JAMC 2F4VE 4JG4A 2UUAI 3LTOA 1MX0A 3F0NA 4JI2E 4LF8E 4NXMI 4KHPE 2E5LE 1N33I 1FWKA 1NHIA 4LF9E 3T1HE 4ED4A 4DR4I 4K0KI 1H73A 4JI5I 3QT5A 1N36E 1HNZI 4YY3E 4LFCE 3M6AA 1N32E 4HY1A 5BR8I 4LFAE 5A2QQ 3PYEA 4GKJE 4JI0E 4HACA 4JI3E 4PRVA 1HR0I 1BKNA 3WU5A 2X36A 1EA6A 1Z5CA 1KKHA 4JI1I 2OI2A 4M1KA 3QT8A 2LJPA 2VQEI 4DV4I 2UXBI 2HFUA 3HULA 4B3RE 4Z7CA 3WU6A 5FLXQ 1PIEA 3T1YI 4LF6E 4DV0E 1Z0EA 3WU3A 1NHHA 4X62I 4DV5I 4NXNE 4DPWA 4DR3E 1XNRE 4JYAE 1N34E 1Z5AA 1Z0TA 4PU9A 3ZZTA 2VQFE 4JI8I 3ZM7A 4JI6E 4B3MI
chains in the Genus database with same CATH superfamily
5DNLA 3LPSA 2BR2B 3OTOI 3GCMA 2Z5EA 4IZJA 4DV2E 1HK7A 4LCGA 2WW4A 4X64I 4LF4I 4KQVA 1QZRA 1J5EI 2PNMA 5C0XA 2CZ9A 3PYDA 4ZVIA 2C37A 2GS8A 1YH8A 2ZM6E 4HYMA 2PO2A 1DARA 1RREA 1FJGE 2JEAA 3M7NG 2V2ZA 4JI7E 3J81Q 4DR6I 5LMNE 2C37B 4DV3I 1XMQE 2UXDI 4RPFA 4DPUA 4FWGA 4Z7YA 4DV6E 4DR1I 5LMUI 3ZZUA 4IFDF 1VISA 2BA1D 4DR2I 1VI7A 4YHHI 1KIJA 2E1RA 3Q6NA 2EFGA 2CVEA 4FWHA 4JI4E 2Z5CA 4AQYE 4JV5I 3B8HA 1MG7A 2V2VA 4BA2A 2VESA 5DRPA 1IBKI 4USKA 1HNXE 3JAMQ 2X7IA 1EI1A 2Z5BB 4WUDA 4DPTA 1Z0GA 2UUCE 1ZXMA 4BA2B 1ZM2A 5L3JA 3M85D 4DU8A 1E3PA 3WU4A 4EMDA 2PO1A 1XMOI 3H1CA 5K36C 1H7UA 2XEXA 4GKKE 3J7AG 1IBLE 4U3DA 3U1KA 1RHYA 1I94I 4OX9E 1XNQE 4FW7A 2PO1B 2UUBI 4IZJD 4MU4A 5GMDA 1UDQA 1OJ4A 1PKPA 1HNWI 4MU3A 4DR5E 4MDTA 4LCHA 5DRQA 4DV7E 4DR7E 2UXCE 4LF5E 4DUZE 3GONA 4IFDB 1PVGA 2DEIA 2CGEA 2UUAE 3P06A 5JEAF 5K36E 1RR9A 2ZBKB 3V5RA 1H74A 4NXME 4OO1F 2HHHI 5LL6R 1N33E 5DRRA 2PNZB 1Y6ZA 4B3TI 1Z5BA 2JEBB 4DV1I 4DR4E 4I3HA 4DUYI 1FWLA 4DXLA 1XHKA 4K0KE 1Y60A 4JI5E 2JE6A 1NZ0A 5K36F 4X66I 3LNUA 4XTJA 2R3VA 4LFBI 1HNZE 3CDJA 2IOQA 3Q6MA 4NBQA 5IWAI 1E3HA 3ZZ0A 4IFDC 2C38A 5BR8E 2BA1G 4PRXA 2BR2A 2IERA 5ELWA 3PYGA 1HR0E 3UHMA 1USUA 1IBMI 5DNXA 4B3SI 4LF7I 1H7SA 4JI1E 2UU9I 4X65I 2F4VI 3K85A 2NN6C 4OO1B 4WUCA 2VQEE 4DV4E 4IFDE 3J80Q 3ZKDA 3D4JA 3M85G 4JI2I 2UXBE 4LF8I 1KTVA 4KHPI 2E5LI 5IT9C 4LF9I 3T1HI 2GO3A 4MU0A 1Y5YA 4FWDA 5K36B 3B82A 3T1YE 4LPFA 4N3OA 4UTGA 4LCFA 3GLLA 4UT4A 4X62E 4DV5E 4OKGA 2NN6E 3PS3A 1FNMA 2ZITA 1N36I 3PS2A 4YY3I 2Z5BA 1UDSA 4LFCI 2VF3A 2R42A 5JEAC 1N32I 4LFAI 3HKMA 4JI8E 4OO1C 4GKJI 2BM0A 4JI0I 4B3ME 2O1TA 3L7ZB 4JI3I 4R1FA 2HK3A 4P7AA 3OTOE 3K17A 1UEKA 2GQ0A 2NN6F 4MYUA 1ZM3A 4FW9A 4FN5A 4FW4A 4X64E 4LF4E 3B4TA 4AIDA 1J5EE 2V34A 3ZKBA 1S4EA 2O1WA 4WUBA 5JEAE 3B78A 3U1YA 2O3ZA 1Y4UA 1ELOA 4IFDA 4HXZA 5DROA 1ZM9A 4MYTA 3J7AM 1USVA 4OO1E 4B3RI 2A2DA 4DR6E 3P3EA 2WP8B 4DV3E 2UXDE 5K36D 4DR1E 5A2QC 5LMUE 2C39B 2HFSA 4LF6I 3K1JA 3CWVA 3KRNA 4DV0I 5C0XC 2PO0B 4DR2E 1XXEA 2PNZA 4FW5A 4YHHE 2WNRB 2HKJA 2JT2A 1WUUA 2JEBA 4NXNI 4DPYA 3Q1QA 2AE8A 4JV5E 2J7KA 2NN6A 4DR3I 1XNRI 4JYAI 1N34I 4DU7A 1IBKE 2DEJA 2A2CA 2VQFI 1Z0BA 1YHCA 2NN6B 5GMEA 4JI6I 1N0VC 4J3DA 1KVKA 1N0UA 4URLA 1B62A 1XMOE 4HACB 5FLXC 2Q2EB 5C0XE 1B63A 4DV2I 1NHJA 1Z0WA 1Z0CA 2IESA 1I94E 2UUBE 2ZM6I 4QNJA 2HKEA 1Z59A 5JEAA 1FJGI 1HNWE 1D6TA 4AM3A 1FKAE 2J65A 3PYFA 1ZM4A 3P76A 4OO1A 5FWKA 4JI7I 5LMNI 5C0XF 3QT7A 1XMQI 4IFDD 5JEAB 4DV6I 3V2UC 2HK2A 2NPFA 1H72C 2BV3A 2PNLA 2BM1A 1OYSA 2HHHE 1R6LA 4JI4I 1Y4SA 4AQYI 4DPXA 5K36A 1K47A 4B3TE 4DV1E 1HNXI 4DUYE 1UDNA 3J80C 1ZXNA 2AJ4A 4IZKB 4P52A 1Z0VA 2NN6D 4IS9A 2UUCI 4X66E 4USMA 2BA0D 4LFBE 5IT9Q 1S16A 3J81C 2O1VA 5IWAE 4GKKI 1IBLI 1FI4A 1MU5A 3L7ZA 4OZEA 4IZJB 4OX9I 1XNQI 3QT6A 1U2RA 2V8PA 1A6FA 5C0XB 4DR5I 1IBME 4DV7I 4DR7I 2UXCI 3H4LA 4B3SE 4LF5I 2V2QA 4DUZI 4LF7E 2PO2B 2UU9E 4X65E 3DD6A 3JAMC 2JEAB 2F4VE 5JEAD 4JG4A 2UUAI 4U3BA 4FW6A 3LTOA 1MX0A 3F0NA 4OO1D 4JI2E 4LF8E 2WP8A 4NXMI 4KHPE 2E5LE 4AIMA 1N33I 1FWKA 1NHIA 5EKWA 4LF9E 3T1HE 2C39A 1OYPA 4ED4A 4DR4I 2Z5CB 2PO0A 3CDIA 3HJCA 2WNRA 4BA1A 4K0KI 1H73A 4JI5I 3QT5A 3GMEA 1N36E 4QNKA 1HNZI 4YY3E 3M7ND 1P42A 1UDOA 4BA1B 4LFCE 3M6AA 3P3GA 1N32E 4HY1A 5BR8I 4LFAE 5A2QQ 3PYEA 4GKJE 4JI0E 2GO4A 4HACA 2CG9A 4JI3E 4PRVA 5C0XD 1HR0I 1BKNA 3WU5A 2X36A 1EA6A 2F1DA 1Z5CA 1KKHA 4JI1I 2OI2A 4M1KA 3NZKA 3QT8A 2LJPA 1R6MA 4GQUA 4MQYA 2VQEI 2IOPA 4DV4I 2BA0G 2UXBI 2HFUA 3HULA 4B3RE 4Z7CA 3WU6A 3PS1A 5FLXQ 5EL9A 4LOMA 1PIEA 4ISAA 3T1YI 4LF6E 3P3CA 4FW3A 4DV0E 1Z0EA 3WU3A 1NHHA 4X62I 1OYRA 4DV5I 4NXNE 2JE6B 4DPWA 4DR3E 1XNRE 4JYAE 4IZKA 1N34E 1Z5AA 4MU1A 1Z0TA 4PU9A 3ZZTA 2VQFE 4JI8I 2C38B 2O1UA 3ZM7A 3PRYA 4JI6E 4B3MI
chains in the Genus database with same CATH topology
3LPSA 3OTOI 2Z5EA 4IZJA 4DV2E 1HK7A 4X64I 2WW4A 4LF4I 4KQVA 1QZRA 1J5EI 2PNMA 2CZ9A 3PYDA 4ZVIA 2GS8A 2ZM6E 4HYMA 1DARA 1RREA 1FJGE 2V2ZA 4JI7E 3J81Q 4DR6I 5LMNE 4DV3I 1XMQE 2UXDI 4RPFA 4DPUA 4FWGA 4Z7YA 4DV6E 4DR1I 5LMUI 3ZZUA 1VISA 4DR2I 4YHHI 1KIJA 2E1RA 3Q6NA 2EFGA 4FWHA 4JI4E 2Z5CA 4AQYE 4JV5I 3B8HA 1MG7A 2V2VA 1IBKI 4USKA 1HNXE 3JAMQ 2X7IA 1EI1A 2Z5BB 4WUDA 4DPTA 1Z0GA 2UUCE 1ZXMA 1ZM2A 5L3JA 4DU8A 4EMDA 3WU4A 1XMOI 1H7UA 2XEXA 4GKKE 3J7AG 1IBLE 1I94I 4OX9E 1XNQE 2UUBI 4IZJD 5GMDA 1OJ4A 1PKPA 1HNWI 4DR5E 4DV7E 4DR7E 2UXCE 4LF5E 4DUZE 3GONA 1PVGA 2DEIA 2CGEA 2UUAE 3P06A 1RR9A 2ZBKB 3V5RA 1H74A 4NXME 2HHHI 5LL6R 1N33E 4B3TI 1Y6ZA 1Z5BA 4DV1I 4DR4E 4I3HA 4DUYI 1FWLA 4DXLA 1XHKA 4K0KE 4JI5E 1NZ0A 4X66I 3LNUA 4XTJA 2R3VA 4LFBI 1HNZE 2IOQA 3Q6MA 5IWAI 3ZZ0A 5BR8E 4PRXA 3PYGA 1HR0E 1USUA 1IBMI 4B3SI 4LF7I 1H7SA 4JI1E 2UU9I 4X65I 2F4VI 3K85A 4WUCA 2VQEE 4DV4E 3J80Q 3ZKDA 3D4JA 4JI2I 2UXBE 4LF8I 1KTVA 4KHPI 2E5LI 5IT9C 4LF9I 3T1HI 4FWDA 3B82A 3T1YE 4N3OA 4UTGA 4UT4A 4X62E 4DV5E 1FNMA 2ZITA 1N36I 4YY3I 2Z5BA 4LFCI 2VF3A 2R42A 1N32I 4LFAI 4JI8E 4GKJI 2BM0A 4JI0I 4B3ME 2O1TA 4JI3I 4R1FA 2HK3A 4P7AA 3OTOE 3K17A 1UEKA 2GQ0A 4MYUA 1ZM3A 4FW9A 4FN5A 4X64E 4LF4E 1J5EE 2V34A 3ZKBA 1S4EA 2O1WA 4WUBA 3B78A 1Y4UA 1ELOA 4HXZA 1ZM9A 4MYTA 3J7AM 1USVA 4B3RI 2A2DA 4DR6E 4DV3E 2UXDE 4DR1E 5A2QC 5LMUE 2HFSA 4LF6I 3K1JA 3CWVA 4DV0I 4DR2E 4YHHE 2HKJA 1WUUA 4NXNI 4DPYA 3Q1QA 4JV5E 2J7KA 4DR3I 1XNRI 4JYAI 1N34I 4DU7A 1IBKE 2DEJA 2A2CA 2VQFI 1Z0BA 5GMEA 4JI6I 1N0VC 1KVKA 1N0UA 4URLA 1B62A 1XMOE 4HACB 5FLXC 2Q2EB 1B63A 4DV2I 1NHJA 1Z0WA 1Z0CA 1I94E 2UUBE 2ZM6I 2HKEA 1Z59A 1FJGI 1HNWE 1D6TA 1FKAE 3PYFA 1ZM4A 5FWKA 4JI7I 5LMNI 3QT7A 1XMQI 4DV6I 3V2UC 2HK2A 2NPFA 1H72C 2BV3A 2PNLA 2BM1A 2HHHE 4JI4I 1Y4SA 4AQYI 4DPXA 1K47A 4B3TE 4DV1E 1HNXI 4DUYE 3J80C 1ZXNA 2AJ4A 4IZKB 4P52A 1Z0VA 2UUCI 4X66E 4USMA 4LFBE 5IT9Q 1S16A 3J81C 2O1VA 5IWAE 4GKKI 1IBLI 1FI4A 1MU5A 4IZJB 4OX9I 1XNQI 3QT6A 1U2RA 2V8PA 1A6FA 4DR5I 1IBME 4DV7I 4DR7I 2UXCI 3H4LA 4B3SE 4LF5I 2V2QA 4DUZI 4LF7E 2UU9E 4X65E 3JAMC 2F4VE 4JG4A 2UUAI 3LTOA 1MX0A 3F0NA 4JI2E 4LF8E 4NXMI 4KHPE 2E5LE 1N33I 1FWKA 1NHIA 4LF9E 3T1HE 4ED4A 4DR4I 2Z5CB 3HJCA 4K0KI 1H73A 4JI5I 3QT5A 1N36E 1HNZI 4YY3E 4LFCE 3M6AA 1N32E 4HY1A 5BR8I 4LFAE 5A2QQ 3PYEA 4GKJE 4JI0E 4HACA 2CG9A 4JI3E 4PRVA 1HR0I 1BKNA 3WU5A 2X36A 1EA6A 1Z5CA 1KKHA 4JI1I 2OI2A 4M1KA 3QT8A 2LJPA 2VQEI 2IOPA 4DV4I 2UXBI 2HFUA 3HULA 4B3RE 4Z7CA 3WU6A 5FLXQ 1PIEA 3T1YI 4LF6E 4DV0E 1Z0EA 3WU3A 1NHHA 4X62I 4DV5I 4NXNE 4DPWA 4DR3E 1XNRE 4JYAE 4IZKA 1N34E 1Z5AA 1Z0TA 4PU9A 3ZZTA 2VQFE 4JI8I 2O1UA 3ZM7A 3PRYA 4JI6E 4B3MI
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3LPS A;  3OTO I;  4DV2 E;  4X64 I;  2WW4 A;  4LF4 I;  4KQV A;  1QZR A;  1J5E I;  2CZ9 A;  3PYD A;  4ZVI A;  2GS8 A;  2ZM6 E;  4HYM A;  1DAR A;  1RRE A;  1FJG E;  2V2Z A;  4JI7 E;  3J81 Q;  4DR6 I;  5LMN E;  4DV3 I;  1XMQ E;  2UXD I;  4RPF A;  4DPU A;  4FWG A;  4Z7Y A;  4DV6 E;  4DR1 I;  5LMU I;  3ZZU A;  1VIS A;  4DR2 I;  4YHH I;  1KIJ A;  2E1R A;  2EFG A;  4FWH A;  4JI4 E;  4AQY E;  4JV5 I;  3B8H A;  1MG7 A;  2V2V A;  1IBK I;  4USK A;  1HNX E;  3JAM Q;  2X7I A;  1EI1 A;  4WUD A;  4DPT A;  1Z0G A;  2UUC E;  1ZXM A;  1ZM2 A;  5L3J A;  4DU8 A;  4EMD A;  3WU4 A;  1XMO I;  1H7U A;  2XEX A;  4GKK E;  3J7A G;  1IBL E;  1I94 I;  4OX9 E;  1XNQ E;  2UUB I;  5GMD A;  1OJ4 A;  1PKP A;  1HNW I;  4DR5 E;  4DV7 E;  4DR7 E;  2UXC E;  4LF5 E;  4DUZ E;  3GON A;  1PVG A;  2DEI A;  2UUA E;  1RR9 A;  2ZBK B;  3V5R A;  1H74 A;  4NXM E;  2HHH I;  5LL6 R;  1N33 E;  4B3T I;  1Z5B A;  4DV1 I;  4DR4 E;  4I3H A;  4DUY I;  1FWL A;  4DXL A;  1XHK A;  4K0K E;  4JI5 E;  1NZ0 A;  4X66 I;  3LNU A;  4XTJ A;  2R3V A;  4LFB I;  1HNZ E;  5IWA I;  3ZZ0 A;  5BR8 E;  4PRX A;  3PYG A;  1HR0 E;  1IBM I;  4B3S I;  4LF7 I;  1H7S A;  4JI1 E;  2UU9 I;  4X65 I;  2F4V I;  4WUC A;  2VQE E;  4DV4 E;  3J80 Q;  3ZKD A;  3D4J A;  4JI2 I;  2UXB E;  4LF8 I;  1KTV A;  4KHP I;  2E5L I;  5IT9 C;  4LF9 I;  3T1H I;  4FWD A;  3B82 A;  3T1Y E;  4UTG A;  4UT4 A;  4X62 E;  4DV5 E;  1FNM A;  2ZIT A;  1N36 I;  4YY3 I;  4LFC I;  2VF3 A;  2R42 A;  1N32 I;  4LFA I;  4JI8 E;  4GKJ I;  2BM0 A;  4JI0 I;  4B3M E;  4JI3 I;  4R1F A;  2HK3 A;  4P7A A;  3OTO E;  3K17 A;  1UEK A;  4MYU A;  1ZM3 A;  4FW9 A;  4FN5 A;  4X64 E;  4LF4 E;  1J5E E;  2V34 A;  3ZKB A;  1S4E A;  4WUB A;  3B78 A;  1ELO A;  4HXZ A;  1ZM9 A;  4MYT A;  3J7A M;  4B3R I;  2A2D A;  4DR6 E;  4DV3 E;  2UXD E;  4DR1 E;  5A2Q C;  5LMU E;  2HFS A;  4LF6 I;  3K1J A;  3CWV A;  4DV0 I;  4DR2 E;  4YHH E;  2HKJ A;  1WUU A;  4NXN I;  4DPY A;  3Q1Q A;  4JV5 E;  2J7K A;  4DR3 I;  1XNR I;  4JYA I;  1N34 I;  4DU7 A;  1IBK E;  2DEJ A;  2A2C A;  2VQF I;  1Z0B A;  5GME A;  4JI6 I;  1N0V C;  1KVK A;  1N0U A;  4URL A;  1B62 A;  1XMO E;  4HAC B;  5FLX C;  2Q2E B;  1B63 A;  4DV2 I;  1NHJ A;  1Z0W A;  1Z0C A;  1I94 E;  2UUB E;  2ZM6 I;  2HKE A;  1Z59 A;  1FJG I;  1HNW E;  1D6T A;  1FKA E;  3PYF A;  1ZM4 A;  4JI7 I;  5LMN I;  3QT7 A;  1XMQ I;  4DV6 I;  3V2U C;  2HK2 A;  2NPF A;  1H72 C;  2BV3 A;  2BM1 A;  2HHH E;  4JI4 I;  4AQY I;  4DPX A;  1K47 A;  4B3T E;  4DV1 E;  1HNX I;  4DUY E;  3J80 C;  1ZXN A;  2AJ4 A;  4P52 A;  1Z0V A;  2UUC I;  4X66 E;  4USM A;  4LFB E;  5IT9 Q;  1S16 A;  3J81 C;  5IWA E;  4GKK I;  1IBL I;  1FI4 A;  1MU5 A;  4OX9 I;  1XNQ I;  3QT6 A;  1U2R A;  2V8P A;  1A6F A;  4DR5 I;  1IBM E;  4DV7 I;  4DR7 I;  2UXC I;  4B3S E;  3H4L A;  4LF5 I;  2V2Q A;  4DUZ I;  4LF7 E;  2UU9 E;  4X65 E;  3JAM C;  2F4V E;  4JG4 A;  2UUA I;  3LTO A;  1MX0 A;  3F0N A;  4JI2 E;  4LF8 E;  4NXM I;  4KHP E;  2E5L E;  1N33 I;  1FWK A;  1NHI A;  4LF9 E;  3T1H E;  4ED4 A;  4DR4 I;  4K0K I;  1H73 A;  4JI5 I;  3QT5 A;  1N36 E;  1HNZ I;  4YY3 E;  4LFC E;  3M6A A;  1N32 E;  4HY1 A;  5BR8 I;  4LFA E;  5A2Q Q;  3PYE A;  4GKJ E;  4JI0 E;  4HAC A;  4JI3 E;  4PRV A;  1HR0 I;  1BKN A;  3WU5 A;  2X36 A;  1EA6 A;  1Z5C A;  1KKH A;  4JI1 I;  2OI2 A;  4M1K A;  3QT8 A;  2LJP A;  2VQE I;  4DV4 I;  2UXB I;  2HFU A;  3HUL A;  4B3R E;  4Z7C A;  3WU6 A;  5FLX Q;  1PIE A;  3T1Y I;  4LF6 E;  4DV0 E;  1Z0E A;  3WU3 A;  1NHH A;  4X62 I;  4DV5 I;  4NXN E;  4DPW A;  4DR3 E;  1XNR E;  4JYA E;  1N34 E;  1Z5A A;  1Z0T A;  4PU9 A;  3ZZT A;  2VQF E;  4JI8 I;  3ZM7 A;  4JI6 E;  4B3M I; 
#chains in the Genus database with same CATH topology
 5DNL A;  3LPS A;  2BR2 B;  3OTO I;  3GCM A;  2Z5E A;  4IZJ A;  4DV2 E;  1HK7 A;  4LCG A;  2WW4 A;  4X64 I;  4LF4 I;  4KQV A;  1QZR A;  1J5E I;  2PNM A;  5C0X A;  2CZ9 A;  3PYD A;  4ZVI A;  2C37 A;  2GS8 A;  1YH8 A;  2ZM6 E;  4HYM A;  2PO2 A;  1DAR A;  1RRE A;  1FJG E;  2JEA A;  3M7N G;  2V2Z A;  4JI7 E;  3J81 Q;  4DR6 I;  5LMN E;  2C37 B;  4DV3 I;  1XMQ E;  2UXD I;  4RPF A;  4DPU A;  4FWG A;  4Z7Y A;  4DV6 E;  4DR1 I;  5LMU I;  3ZZU A;  4IFD F;  1VIS A;  2BA1 D;  4DR2 I;  1VI7 A;  4YHH I;  1KIJ A;  2E1R A;  3Q6N A;  2EFG A;  2CVE A;  4FWH A;  4JI4 E;  2Z5C A;  4AQY E;  4JV5 I;  3B8H A;  1MG7 A;  2V2V A;  4BA2 A;  2VES A;  5DRP A;  1IBK I;  4USK A;  1HNX E;  3JAM Q;  2X7I A;  1EI1 A;  2Z5B B;  4WUD A;  4DPT A;  1Z0G A;  2UUC E;  1ZXM A;  4BA2 B;  1ZM2 A;  5L3J A;  3M85 D;  4DU8 A;  1E3P A;  3WU4 A;  4EMD A;  2PO1 A;  1XMO I;  3H1C A;  5K36 C;  1H7U A;  2XEX A;  4GKK E;  3J7A G;  1IBL E;  4U3D A;  3U1K A;  1RHY A;  1I94 I;  4OX9 E;  1XNQ E;  4FW7 A;  2PO1 B;  2UUB I;  4IZJ D;  4MU4 A;  5GMD A;  1UDQ A;  1OJ4 A;  1PKP A;  1HNW I;  4MU3 A;  4DR5 E;  4MDT A;  4LCH A;  5DRQ A;  4DV7 E;  4DR7 E;  2UXC E;  4LF5 E;  4DUZ E;  3GON A;  4IFD B;  1PVG A;  2DEI A;  2CGE A;  2UUA E;  3P06 A;  5JEA F;  5K36 E;  1RR9 A;  2ZBK B;  3V5R A;  1H74 A;  4NXM E;  4OO1 F;  2HHH I;  5LL6 R;  1N33 E;  5DRR A;  2PNZ B;  1Y6Z A;  4B3T I;  1Z5B A;  2JEB B;  4DV1 I;  4DR4 E;  4I3H A;  4DUY I;  1FWL A;  4DXL A;  1XHK A;  4K0K E;  1Y60 A;  4JI5 E;  2JE6 A;  1NZ0 A;  5K36 F;  4X66 I;  3LNU A;  4XTJ A;  2R3V A;  4LFB I;  1HNZ E;  3CDJ A;  2IOQ A;  3Q6M A;  4NBQ A;  5IWA I;  1E3H A;  3ZZ0 A;  4IFD C;  2C38 A;  5BR8 E;  2BA1 G;  4PRX A;  2BR2 A;  2IER A;  5ELW A;  3PYG A;  1HR0 E;  3UHM A;  1USU A;  1IBM I;  5DNX A;  4B3S I;  4LF7 I;  1H7S A;  4JI1 E;  2UU9 I;  4X65 I;  2F4V I;  3K85 A;  2NN6 C;  4OO1 B;  4WUC A;  2VQE E;  4DV4 E;  4IFD E;  3J80 Q;  3ZKD A;  3D4J A;  3M85 G;  4JI2 I;  2UXB E;  4LF8 I;  1KTV A;  4KHP I;  2E5L I;  5IT9 C;  4LF9 I;  3T1H I;  2GO3 A;  4MU0 A;  1Y5Y A;  4FWD A;  5K36 B;  3B82 A;  3T1Y E;  4LPF A;  4N3O A;  4UTG A;  4LCF A;  3GLL A;  4UT4 A;  4X62 E;  4DV5 E;  4OKG A;  2NN6 E;  3PS3 A;  1FNM A;  2ZIT A;  1N36 I;  3PS2 A;  4YY3 I;  2Z5B A;  1UDS A;  4LFC I;  2VF3 A;  2R42 A;  5JEA C;  1N32 I;  4LFA I;  3HKM A;  4JI8 E;  4OO1 C;  4GKJ I;  2BM0 A;  4JI0 I;  4B3M E;  2O1T A;  3L7Z B;  4JI3 I;  4R1F A;  2HK3 A;  4P7A A;  3OTO E;  3K17 A;  1UEK A;  2GQ0 A;  2NN6 F;  4MYU A;  1ZM3 A;  4FW9 A;  4FN5 A;  4FW4 A;  4X64 E;  4LF4 E;  3B4T A;  4AID A;  1J5E E;  2V34 A;  3ZKB A;  1S4E A;  2O1W A;  4WUB A;  5JEA E;  3B78 A;  3U1Y A;  2O3Z A;  1Y4U A;  1ELO A;  4IFD A;  4HXZ A;  5DRO A;  1ZM9 A;  4MYT A;  3J7A M;  1USV A;  4OO1 E;  4B3R I;  2A2D A;  4DR6 E;  3P3E A;  2WP8 B;  4DV3 E;  2UXD E;  5K36 D;  4DR1 E;  5A2Q C;  5LMU E;  2C39 B;  2HFS A;  4LF6 I;  3K1J A;  3CWV A;  3KRN A;  4DV0 I;  5C0X C;  2PO0 B;  4DR2 E;  1XXE A;  2PNZ A;  4FW5 A;  4YHH E;  2WNR B;  2HKJ A;  2JT2 A;  1WUU A;  2JEB A;  4NXN I;  4DPY A;  3Q1Q A;  2AE8 A;  4JV5 E;  2J7K A;  2NN6 A;  4DR3 I;  1XNR I;  4JYA I;  1N34 I;  4DU7 A;  1IBK E;  2DEJ A;  2A2C A;  2VQF I;  1Z0B A;  1YHC A;  2NN6 B;  5GME A;  4JI6 I;  1N0V C;  4J3D A;  1KVK A;  1N0U A;  4URL A;  1B62 A;  1XMO E;  4HAC B;  5FLX C;  2Q2E B;  5C0X E;  1B63 A;  4DV2 I;  1NHJ A;  1Z0W A;  1Z0C A;  2IES A;  1I94 E;  2UUB E;  2ZM6 I;  4QNJ A;  2HKE A;  1Z59 A;  5JEA A;  1FJG I;  1HNW E;  1D6T A;  4AM3 A;  1FKA E;  2J65 A;  3PYF A;  1ZM4 A;  3P76 A;  4OO1 A;  5FWK A;  4JI7 I;  5LMN I;  5C0X F;  3QT7 A;  1XMQ I;  4IFD D;  5JEA B;  4DV6 I;  3V2U C;  2HK2 A;  2NPF A;  1H72 C;  2BV3 A;  2PNL A;  2BM1 A;  1OYS A;  2HHH E;  1R6L A;  4JI4 I;  1Y4S A;  4AQY I;  4DPX A;  5K36 A;  1K47 A;  4B3T E;  4DV1 E;  1HNX I;  4DUY E;  1UDN A;  3J80 C;  1ZXN A;  2AJ4 A;  4IZK B;  4P52 A;  1Z0V A;  2NN6 D;  4IS9 A;  2UUC I;  4X66 E;  4USM A;  2BA0 D;  4LFB E;  5IT9 Q;  1S16 A;  3J81 C;  2O1V A;  5IWA E;  4GKK I;  1IBL I;  1FI4 A;  1MU5 A;  3L7Z A;  4OZE A;  4IZJ B;  4OX9 I;  1XNQ I;  3QT6 A;  1U2R A;  2V8P A;  1A6F A;  5C0X B;  4DR5 I;  1IBM E;  4DV7 I;  4DR7 I;  2UXC I;  3H4L A;  4B3S E;  4LF5 I;  2V2Q A;  4DUZ I;  4LF7 E;  2PO2 B;  2UU9 E;  4X65 E;  3DD6 A;  3JAM C;  2JEA B;  2F4V E;  5JEA D;  4JG4 A;  2UUA I;  4U3B A;  4FW6 A;  3LTO A;  1MX0 A;  3F0N A;  4OO1 D;  4JI2 E;  4LF8 E;  2WP8 A;  4NXM I;  4KHP E;  2E5L E;  4AIM A;  1N33 I;  1FWK A;  1NHI A;  5EKW A;  4LF9 E;  3T1H E;  2C39 A;  1OYP A;  4ED4 A;  4DR4 I;  2Z5C B;  2PO0 A;  3CDI A;  3HJC A;  2WNR A;  4BA1 A;  4K0K I;  1H73 A;  4JI5 I;  3QT5 A;  3GME A;  1N36 E;  4QNK A;  1HNZ I;  4YY3 E;  3M7N D;  1P42 A;  1UDO A;  4BA1 B;  4LFC E;  3M6A A;  3P3G A;  1N32 E;  4HY1 A;  5BR8 I;  4LFA E;  5A2Q Q;  3PYE A;  4GKJ E;  4JI0 E;  2GO4 A;  4HAC A;  2CG9 A;  4JI3 E;  4PRV A;  5C0X D;  1HR0 I;  1BKN A;  3WU5 A;  2X36 A;  1EA6 A;  2F1D A;  1Z5C A;  1KKH A;  4JI1 I;  2OI2 A;  4M1K A;  3NZK A;  3QT8 A;  2LJP A;  1R6M A;  4GQU A;  4MQY A;  2VQE I;  2IOP A;  4DV4 I;  2BA0 G;  2UXB I;  2HFU A;  3HUL A;  4B3R E;  4Z7C A;  3WU6 A;  3PS1 A;  5FLX Q;  5EL9 A;  4LOM A;  1PIE A;  4ISA A;  3T1Y I;  4LF6 E;  3P3C A;  4FW3 A;  4DV0 E;  1Z0E A;  3WU3 A;  1NHH A;  4X62 I;  1OYR A;  4DV5 I;  4NXN E;  2JE6 B;  4DPW A;  4DR3 E;  1XNR E;  4JYA E;  4IZK A;  1N34 E;  1Z5A A;  4MU1 A;  1Z0T A;  4PU9 A;  3ZZT A;  2VQF E;  4JI8 I;  2C38 B;  2O1U A;  3ZM7 A;  3PRY A;  4JI6 E;  4B3M I; 
#chains in the Genus database with same CATH homology
 3LPS A;  3OTO I;  2Z5E A;  4IZJ A;  4DV2 E;  1HK7 A;  4X64 I;  2WW4 A;  4LF4 I;  4KQV A;  1QZR A;  1J5E I;  2PNM A;  2CZ9 A;  3PYD A;  4ZVI A;  2GS8 A;  2ZM6 E;  4HYM A;  1DAR A;  1RRE A;  1FJG E;  2V2Z A;  4JI7 E;  3J81 Q;  4DR6 I;  5LMN E;  4DV3 I;  1XMQ E;  2UXD I;  4RPF A;  4DPU A;  4FWG A;  4Z7Y A;  4DV6 E;  4DR1 I;  5LMU I;  3ZZU A;  1VIS A;  4DR2 I;  4YHH I;  1KIJ A;  2E1R A;  3Q6N A;  2EFG A;  4FWH A;  4JI4 E;  2Z5C A;  4AQY E;  4JV5 I;  3B8H A;  1MG7 A;  2V2V A;  1IBK I;  4USK A;  1HNX E;  3JAM Q;  2X7I A;  1EI1 A;  2Z5B B;  4WUD A;  4DPT A;  1Z0G A;  2UUC E;  1ZXM A;  1ZM2 A;  5L3J A;  4DU8 A;  4EMD A;  3WU4 A;  1XMO I;  1H7U A;  2XEX A;  4GKK E;  3J7A G;  1IBL E;  1I94 I;  4OX9 E;  1XNQ E;  2UUB I;  4IZJ D;  5GMD A;  1OJ4 A;  1PKP A;  1HNW I;  4DR5 E;  4DV7 E;  4DR7 E;  2UXC E;  4LF5 E;  4DUZ E;  3GON A;  1PVG A;  2DEI A;  2CGE A;  2UUA E;  3P06 A;  1RR9 A;  2ZBK B;  3V5R A;  1H74 A;  4NXM E;  2HHH I;  5LL6 R;  1N33 E;  4B3T I;  1Y6Z A;  1Z5B A;  4DV1 I;  4DR4 E;  4I3H A;  4DUY I;  1FWL A;  4DXL A;  1XHK A;  4K0K E;  4JI5 E;  1NZ0 A;  4X66 I;  3LNU A;  4XTJ A;  2R3V A;  4LFB I;  1HNZ E;  2IOQ A;  3Q6M A;  5IWA I;  3ZZ0 A;  5BR8 E;  4PRX A;  3PYG A;  1HR0 E;  1USU A;  1IBM I;  4B3S I;  4LF7 I;  1H7S A;  4JI1 E;  2UU9 I;  4X65 I;  2F4V I;  3K85 A;  4WUC A;  2VQE E;  4DV4 E;  3J80 Q;  3ZKD A;  3D4J A;  4JI2 I;  2UXB E;  4LF8 I;  1KTV A;  4KHP I;  2E5L I;  5IT9 C;  4LF9 I;  3T1H I;  4FWD A;  3B82 A;  3T1Y E;  4N3O A;  4UTG A;  4UT4 A;  4X62 E;  4DV5 E;  1FNM A;  2ZIT A;  1N36 I;  4YY3 I;  2Z5B A;  4LFC I;  2VF3 A;  2R42 A;  1N32 I;  4LFA I;  4JI8 E;  4GKJ I;  2BM0 A;  4JI0 I;  4B3M E;  2O1T A;  4JI3 I;  4R1F A;  2HK3 A;  4P7A A;  3OTO E;  3K17 A;  1UEK A;  2GQ0 A;  4MYU A;  1ZM3 A;  4FW9 A;  4FN5 A;  4X64 E;  4LF4 E;  1J5E E;  2V34 A;  3ZKB A;  1S4E A;  2O1W A;  4WUB A;  3B78 A;  1Y4U A;  1ELO A;  4HXZ A;  1ZM9 A;  4MYT A;  3J7A M;  1USV A;  4B3R I;  2A2D A;  4DR6 E;  4DV3 E;  2UXD E;  4DR1 E;  5A2Q C;  5LMU E;  2HFS A;  4LF6 I;  3K1J A;  3CWV A;  4DV0 I;  4DR2 E;  4YHH E;  2HKJ A;  1WUU A;  4NXN I;  4DPY A;  3Q1Q A;  4JV5 E;  2J7K A;  4DR3 I;  1XNR I;  4JYA I;  1N34 I;  4DU7 A;  1IBK E;  2DEJ A;  2A2C A;  2VQF I;  1Z0B A;  5GME A;  4JI6 I;  1N0V C;  1KVK A;  1N0U A;  4URL A;  1B62 A;  1XMO E;  4HAC B;  5FLX C;  2Q2E B;  1B63 A;  4DV2 I;  1NHJ A;  1Z0W A;  1Z0C A;  1I94 E;  2UUB E;  2ZM6 I;  2HKE A;  1Z59 A;  1FJG I;  1HNW E;  1D6T A;  1FKA E;  3PYF A;  1ZM4 A;  5FWK A;  4JI7 I;  5LMN I;  3QT7 A;  1XMQ I;  4DV6 I;  3V2U C;  2HK2 A;  2NPF A;  1H72 C;  2BV3 A;  2PNL A;  2BM1 A;  2HHH E;  4JI4 I;  1Y4S A;  4AQY I;  4DPX A;  1K47 A;  4B3T E;  4DV1 E;  1HNX I;  4DUY E;  3J80 C;  1ZXN A;  2AJ4 A;  4IZK B;  4P52 A;  1Z0V A;  2UUC I;  4X66 E;  4USM A;  4LFB E;  5IT9 Q;  1S16 A;  3J81 C;  2O1V A;  5IWA E;  4GKK I;  1IBL I;  1FI4 A;  1MU5 A;  4IZJ B;  4OX9 I;  1XNQ I;  3QT6 A;  1U2R A;  2V8P A;  1A6F A;  4DR5 I;  1IBM E;  4DV7 I;  4DR7 I;  2UXC I;  3H4L A;  4B3S E;  4LF5 I;  2V2Q A;  4DUZ I;  4LF7 E;  2UU9 E;  4X65 E;  3JAM C;  2F4V E;  4JG4 A;  2UUA I;  3LTO A;  1MX0 A;  3F0N A;  4JI2 E;  4LF8 E;  4NXM I;  4KHP E;  2E5L E;  1N33 I;  1FWK A;  1NHI A;  4LF9 E;  3T1H E;  4ED4 A;  4DR4 I;  2Z5C B;  3HJC A;  4K0K I;  1H73 A;  4JI5 I;  3QT5 A;  1N36 E;  1HNZ I;  4YY3 E;  4LFC E;  3M6A A;  1N32 E;  4HY1 A;  5BR8 I;  4LFA E;  5A2Q Q;  3PYE A;  4GKJ E;  4JI0 E;  4HAC A;  2CG9 A;  4JI3 E;  4PRV A;  1HR0 I;  1BKN A;  3WU5 A;  2X36 A;  1EA6 A;  1Z5C A;  1KKH A;  4JI1 I;  2OI2 A;  4M1K A;  3QT8 A;  2LJP A;  2VQE I;  2IOP A;  4DV4 I;  2UXB I;  2HFU A;  3HUL A;  4B3R E;  4Z7C A;  3WU6 A;  5FLX Q;  1PIE A;  3T1Y I;  4LF6 E;  4DV0 E;  1Z0E A;  3WU3 A;  1NHH A;  4X62 I;  4DV5 I;  4NXN E;  4DPW A;  4DR3 E;  1XNR E;  4JYA E;  4IZK A;  1N34 E;  1Z5A A;  1Z0T A;  4PU9 A;  3ZZT A;  2VQF E;  4JI8 I;  2O1U A;  3ZM7 A;  3PRY A;  4JI6 E;  4B3M I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...