1N34K

Structure of the thermus thermophilus 30s ribosomal subunit in the presence of codon and crystallographically disordered near-cognate transfer rna anticodon stem-loop mismatched at the first codon position
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
119
structure length
119
Chain Sequence
KRQVASGRAYIHASYNNTIVTITDPDGNPITWSSGGVIGYKGSRKGTPYAAQLAALDAAKKAMAYGMQSVDVIVRGTGAGREQAIRALQASGLQVKSIVDDTPVPHNGCRPKKKFRKAS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S RIBOSOMAL RNA
publication title Selection of tRNA by the Ribosome Requires a Transition from an Open to a Closed Form
pubmed doi rcsb
molecule tags Ribosome
total genus 30
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2002-10-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF00411 Ribosomal_S11 Ribosomal protein S11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.80 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribosomal protein S11 1n34K00
4V19S 4X65K 4B3RK 4DR4K 4DUZK 4B3MK 4DV4K 4KHPK 4LF7K 5AJ3K 5LL6Z 4LFAK 5IWAK 4DR6K 4DV5K 3JAMO 5BR8K 4AQYK 4DR7K 1HNZK 4LFCK 1XNQK 4DV6K 1XMOK 2UU9K 4LFBK 4JYAK 2UUAK 1HNXK 1XMQK 4DV0K 2ZM6K 2E5LK 4DV7K 4NXMK 3J7YP 2VQFK 3T1YK 4DV3K 4NXNK 1N33K 1I94K 4JI4K 1J5EK 1N34K 1FJGK 2VQEK 2UXBK 5IT9O 4JI0K 4JV5K 3J81O 5LMUK 1IBKK 1N36K 4B3SK 3J80O 1XNRK 4K0KK 4LF5K 4JI6K 5LMNK 5FLXO 2UUCK 4JI7K 3OTOK 2UUBK 4JI2K 4DR5K 4JI3K 4DR1K 4B3TK 5A2QO 4JI8K 2UXCK 4JI1K 4DV2K 4LF6K 4LF8K 1HNWK 4YY3K 4GKJK 4LF9K 3J7AP 1HR0K 4LF4K 2UXDK 4YHHK 4OX9K 4DR3K 3T1HK 4GKKK 4CW7B 4JI5K 1N32K 4DUYK 4DV1K 1IBMK 4DR2K 2HHHK 2F4VK 4CVNE 4X64K 4X66K 1IBLK 4X62K
chains in the Genus database with same CATH superfamily
2QWMA 1MU2A 4OPHA 3SLCA 2D1KA 3U6FA 4NCGA 4I2PA 5M1KA 3V4IA 3S41A 1BHLA 2DFFA 3MK6A 4JKFA 4HUEA 2VYPA 3ZSVA 5GAHP 1I3AA 2IAJA 2D4WA 3E9LA 3VEYA 1N8RO 3O3FA 3KWIA 4DR6K 1W2BM 2DY4A 5AQTA 2E2OA 2ZGZA 4CJVA 4E3SA 4LFCK 1EQYA 3OBYA 3H3NO 3KK3A 4M3YA 4LFBK 4JYAK 1KSPA 2F9TA 4FLVA 4O55A 1X9WA 1BG3A 2XO7A 1U04A 2E1YA 5AQMA 3CIPA 4WF9L 2OPSA 4KAZA 3BEXA 4NXNK 1NGCA 4R5PA 3O4QA 3KZBA 2WC9A 3U3GA 2Z1IA 3MECA 3K2PA 4OPKA 3NF7A 3VQ4A 4CZKA 4CK2A 4BC4A 3CD6N 5CZ1A 4K0KK 1O13A 3NE6A 4JI7K 4FXDA 4JI2K 2FF6A 1S9GA 2ZD1A 1NGBA 3D7EO 2F8TA 3CJCA 2YX6A 4JKGA 1NWKA 3A5MC 1N5YA 4LF6K 1T6DA 1HR0K 3EZWA 3ZEUB 4LF4K 3M3ZA 1NKEA 4B9MA 2E2PA 4R79A 3LDPA 2KKZA 2VGMA 3KLFA 2UXDK 3CCUN 4BG8A 5AQZA 3O1WA 3RWUA 3HXMA 1RBVA 1YT3A 3E1YA 4JKEA 3K0SA 4ICLA 2HHXA 4DQ8A 3TAFA 3DXMA 3CJ1A 1LWEA 3OY9A 3QDKA 1JLGA 2GTDA 1U48A 3AVFA 1JXBA 1JLCA 2FSJA 5ELZA 1Q9XA 1DGKN 4B3MK 1KVBA 3D45A 3CETA 1W0HA 4I6MA 1QS4A 1MA9B 3V81A 1BISA 5AQFA 2OTLN 4CIFA 4BRIA 2VG7A 1IG9A 4FWMA 4DMNA 3OA9A 3CMAN 4KH4A 3THVA 4B1WB 1SKRA 3CPWM 1HPZA 4CEFA 1A5XA 5KRTA 4MQ3A 5T7BA 3EYZA 4E7JA 5CYMA 2OANA 3EY1A 2HBJA 1TVRA 3J7YP 4M3RA 1VSMA 2GX9A 1IKVA 2E2NA 2ATQA 3KLIA 4H0TB 1Q7YO 2VQEK 2BH1A 2IS3A 3VF4A 3C6UA 2P9NB 2NRHA 2VGNA 3AVKA 5AQLA 3TTCA 4A62A 2P9KA 2UYTA 1K73O 4DS4A 1S22A 1LW2A 1TL1A 5C42A 4FJGA 3LAKA 4KB1A 4CECA 2OPPA 3OJUA 4JI3K 4EP5A 4AHVA 3FLCO 3L4QA 4ZTFA 3PIPL 4RW4A 1LAVA 3EEQA 3AVJA 4KH6A 4JI1K 4CCHA 4FK4A 3AY9A 1JL1A 4FJHA 4LF9K 3ULEB 1Q18A 3SUOA 4C8LA 4CGGA 3NHGA 4DTUA 1HRHA 2F7TA 3H3OB 2IDOA 3SQ2A 3HT3A 2OPQA 5HP1A 1YF5L 4IO9L 4BRLA 4J8FA 1XC9A 2YI1A 1FW6A 3SV3A 1YJ9N 3UKUB 3AAPA 2AJQA 4BE0A 5ADXA 3CCRN 5I9EB 2HHUA 1WSGA 4EP4A 4OLAA 4M7XA 3BUZB 4GV6A 5AQUA 4HUFA 1HUXA 4OKJA 4PA1A 4M3TA 3VEVA 2P9UB 5AQXA 4DV5K 2QWPA 4CGHA 1KD1O 1KAZA 2Z1JA 3QEWA 1VSFA 4NLBA 3M8SA 5KGXA 3SCXA 4CF0A 4DV6K 3VENA 2O8CB 3ATUA 3VQCA 2QWNA 1XQSC 4JKAA 2XY5A 2HOEA 5KRSA 1YJNN 4BREA 4CEAA 4O0IA 3D6RA 2X78A 4CJEA 3CHWA 2CH5A 1X3MA 2Q0RA 3ZEUA 4CEZA 1WSFA 1HNVA 4DFJA 4CJPA 1RT1A 5HL7L 3C0BA 4O5BA 4AM6A 1UAXA 1IBKK 2HMIA 3S3MA 4WE1A 1KTQA 2NLXA 3AO5A 1XC3A 2DPNA 3SMSA 1EX4A 3L2QA 2ZF5O 4JRPA 4F2SA 3OTOK 2I7NA 3CI5A 4A59A 3GG4A 3TR8A 4DTSA 3TTFA 4DFKA 3CMEN 4CJUA 1ZBSA 4BRAA 4PWDA 2FXUA 1M90O 1KLMA 1FKOA 1NJZA 4NB4A 3EKUA 3DRSA 4CHZA 1RBSA 1SS6A 4H5NA 3AGRA 2A41A 4KTZA 3QEPA 4HUGA 1CXUA 4JI5K 3OYCA 1VSLA 1RDUA 1TL3A 3QBWA 3KKSA 3VESA 2NRRA 2Q97A 3PLAA 1NJIO 4FK2A 4X66K 4G1QA 2Q1NA 2O4IA 4H0PA 2ASOA 3EKSA 3LP0A 4FSVA 3HP6A 4E0DA 5H1SQ 1S1WA 4GV3A 2YHAA 3MMVA 1HMVA 4CD3A 1RFQA 3HTVA 5IWAK 3ZX3A 2BGGA 1RNHA 4K42A 3VQPA 3QFPA 2P9NA 4CE9A 1TAQA 5AQOA 3CQYA 4PKHA 4BC3A 1KAYA 1HNZK 5KQDA 3MN6A 4M41A 4E1MA 3OS0A 2XY6A 1ASWA 1VAZA 1D4XA 3ASMA 2GV9A 1CZBA 1XUPO 2HNZA 1LV5A 4GY2B 3NAEA 3SBTA 4CJTA 3QB0A 3HL8A 3IKMA 2EHGA 4LH5A 5EY4A 1U49A 4OLBA 3THXB 4EHUA 3G0ZA 1ILYA 2YCHA 5GADP 3SUNA 4NXMK 1S1VA 3ULEA 4BDYA 2HB5A 3VEWA 1I39A 2E6LA 1Q8IA 3ZT1A 1EETA 2FF3B 4DSLA 3HK2A 4AH9A 1GLAG 3W3DA 3FZLA 1NLVA 3ATVA 4RWTA 3DLHA 1IJJA 4ISGA 4BR7A 1TK8A 3WNGA 3OBWA 4QS8A 3UKUA 1RT6A 3K9JA 4DCHA 4BRPA 1RT5A 1WNSA 3I0SA 4Y0WA 4DR5K 3QEIA 3AO2A 2P1JA 4OGEA 3O80A 1K8KB 5C0YA 3P38A 3S9HA 1ZYQA 4FJ9A 2D0AA 2G8UA 2W41A 3CXCM 3V9WA 4JKHA 2P9UA 4CGJA 3MXIA 1P90A 3ZCMA 1OH5A 3OYMA 4H5TA 4FJKA 3QETA 3HOTA 3EE9A 2OTJN 1JLBA 2YJFA 3V9ZA 1NGHA 3ZSRA 4GV9A 2O8CA 4DUYK 3VGMA 3V1QA 3AA3A 3PY8A 3PIOL 2HBLA 5M1NA 1WUAA 3CYMA 3CCLN 4C1NI 4CFBA 4A2AA 4CEEA 2W40A 3O4NA 3LM2A 4ID1A 4CJRA 2IC3A 3HPOA 3OYFA 3OYGA 4F2RA 1NM1A 3O9RA 4NLCA 1TK5A 5F2RA 4YOTA 1NGAA 1B9FA 3H46O 3JSMA 3C6TA 3LP1A 1LAWA 3CJAA 4BRQA 1VQPN 2WONA 5KPRA 4FLXA 3CC4N 3RRHA 5HLFA 3DMJA 3TAEA 3ALYA 4DR7K 2HBMA 1RT7A 3EN9A 1HPMA 1XNQK 1WOQA 4CHOA 4RG8A 1T05A 4K25A 4A61A 3O9QA 4CHQA 2B4JA 2NRXA 2ITGA 4M3XA 1H1VA 5AFUH 2XHBA 2QKBA 3VQAA 1QTMA 4CIGA 3QESA 5D3GA 3L6QA 3KK1A 4N47A 4DV3K 2G8FA 2Q3SA 5JLFA 4WQ4A 3MX5A 5EOYA 2ZGYA 2E2QA 1B9DA 2G8IA 4YORA 3F73A 3QNNA 2PBDA 3A5LC 3J80O 3H1VX 3EZ5A 4FK0A 1NGJA 3HJFA 5LMNK 2FBTA 3VGKA 2XY7A 1Q86O 3BZKA 1VRTA 4W5RA 1WBDA 4IG0A 4O5FA 5CHIA 2BUPA 4JK7A 1KAXA 5M1PA 5C15A 1HJOA 3IUCA 4FOIA 1GLJO 4CJ3A 3C65A 4RW9A 4OPJA 3CCMN 3F9KA 3KWGA 3CCEN 2KTQA 2YHYA 3N4QA 4CGIA 2FC0A 4I2QA 3WXIA 3HPHA 4JNEA 3O4WA 3KJVA 5J2MA 1U2VB 4F3OA 3THXA 3SZ2A 4IOXA 1YUWA 3AO3A 1S72N 4CBWA 4CK1A 3VQEA 3AVGA 3V6DA 1Y97A 3OYNA 1W7AA 4RTFD 3HM8A 4WQ5C 4NYNA 5JS1A 1LOTB 5GAEP 3HVTA 4BY9C 3VPZA 3AA4A 4AHRA 2P9SB 2NNWA 5CR4A 2G8VA 4CEQA 3PUFA 4Z4CA 2G8WA 2EWSA 2A6AA 1VQLN 2UU9K 1X1PA 1LCUA 4IFVA 1REVA 2E6MA 1K8KA 2UUAK 1JLEA 1KXPA 4U67L 4M63C 3K5LA 2HNDA 1TKTA 3L4IA 4KHUA 2VQFK 1S5JA 4WQ5A 3ZT0A 3GE1A 1N34K 2W6LA 3E66A 3AVHA 4ELVA 4ID5A 4BR5A 4WCEL 4C8MA 4K8ZA 3VGLA 1VQMN 1XWLA 5AR0A 1VQ6N 3PSIA 1QZ5A 3T3FA 3LDLA 3SBGA 4L8RB 3L3UA 5FDLA 2HSTA 3K59A 1VQ5N 1KVAA 2HHTA 2OYQA 3EO3A 4CIEA 2CGJA 4M45A 4IEEA 4FWNA 1Z6RA 4GVMA 3CJ7A 4B3TK 1Q82O 5JLHA 2QK9A 3CFRA 3VQDA 4E7HA 5AQRA 2FSKA 4FWQA 1HNWK 4XEIA 5FPMA 2ITMA 3ZX0A 3CM6A 3VQ5A 1HNIA 3FFIA 3FR0A 4DQPA 3T1HK 1BCMA 1LWFA 3HZ6A 1R0AA 4KH5A 1FKPA 1DEJA 1BUPA 3TSUA 3GOIA 3LPTA 4CZMA 2QXFA 2HHHK 3K5NA 3TSQA 3RR7A 3I55N 4FPAA 4TSXA 2X6NA 1TUUA 2PYJA 3DM2A 4FWPA 5AQKA 4M3ZA 3ZSQA 5HRSA 3VEOA 1C0TA 4FVUA 4BQLA 4DV4K 2HHVA 3VTHA 5GAGP 1VHXA 4FM2A 2O8DB 1CZAN 4A57A 4FLYA 1VSHA 5AQHA 4PL7A 5FPEA 1XI1A 4B8AB 3C95A 1ASUA 3NF9A 1HKBA 5HBMA 3AVNA 3WXMB 2QWOA 3C94A 3UE5A 2NRWA 3TAGA 1WBBA 4HVJA 3TWHA 3HSTB 1IKWA 2RPIA 2LSNA 1C0UA 4W5QA 4FCYA 2ASMA 1WLJA 1KFSA 5AQYA 4KPYA 3TAMA 1Q9YA 1X3NA 1ZXOA 3SPYA 3M8PA 2P9LB 3O6WA 5CZ2A 1FK9A 4JI4K 2HHQA 3B6OA 3VEXA 4FYDA 3ZETB 1HYVA 3VN5A 4BVOA 4BC5A 3V9UA 4OVLA 4CBUA 5FPDA 4JEPA 1VSJA 4DS5A 3MEGA 1K6YA 1RTIA 3SJHA 4WYBA 1U2VA 3ZX2A 1QHTA 4B8CA 3ZSZA 1NKCA 1YIJN 3CJBA 3AO1A 2IVOA 2UUBK 4KO0A 3DXKB 2KHOA 1C1BA 4B08A 1C1AA 1QQOA 3CJ9A 1QSYA 3MEDA 4JD2B 4CEDA 2UXCK 4DWIA 1BI4B 3S3OA 3F9MA 2Q0UA 5K14A 4HHTA 4BRKA 1QQNA 2EX3A 4I9QA 3CG7A 2P9SA 3H08A 2YKNA 3NH1A 2W42A 1VSKA 3AARA 4C8KA 4QAGA 5EXWA 4DR3K 4KHWA 2RKIA 3UB5A 4JHDB 5LY3A 3LWMA 3MDQA 1WB9A 2O8EB 2HW3A 2HHSA 3SJJA 4RCHA 4CJ7A 4H5RA 4H0OA 3LAMA 3CQXA 3TAQA 2FLOA 3P5JA 3D2FB 4GW6A 3SV4A 5DK5A 3AVLA 3I56N 4A2BA 4KHNA 3SAGA 2A42A 1DTQA 3SQ0A 1G99A 4KHSA 2KFZA 3ZT4A 3BF1A 5J1EA 2ASPA 2ZJRL 4MLEA 4PUOA 1KQSM 2QEXN 2O8FB 1J53A 3WXKA 5KPTA 4JKDA 4CD1A 3O3GA 4KB0A 5HRRA 3OHRA 3R6MA 4BQZA 1GOAA 1HX1A 3MAQA 3K5OA 4FWKA 5AQIA 4GVEA 3NDKA 3NVKA 5I3UA 5LJVA 3EL2A 1NGDA 3ZT3A 3HI0A 2KW4A 4CGDA 1J5OA 3KD5E 4EZ6A 3WQTA 4FPBA 3LWLA 5AQWA 3BF3A 1U6ZA 2ZJQL 3DLKA 4BE2A 4E7KA 2IVNA 3D2EB 1TGOA 2I5JA 3HOSA 4YDUC 2PZSA 1YITN 4K41A 1NU0A 1D8YA 4LF5K 3ZLJA 3ZT2A 3C6HA 3ENHA 2GUPA 2HBKA 3OJSA 1TYQB 1L3UA 3I8DA 2O8DA 4DFMA 1X9JA 3A8YA 1CXQA 1HKGA 3AVCA 3L2RA 1BCOA 3W0LA 5F0XA 3LZJA 4CBXA 4ELTA 4EFHA 2FSNA 3WEEB 1QVFM 1V4TA 3LM9A 4DFPA 4YDUA 2VG5A 4QCLA 2GUIA 5GIOA 1WSHA 4JRQA 4QS7A 4CJ4A 5MLCQ 1ASVA 3C6AA 1SL1A 5GIPA 4MFBA 3DLBA 1YVUA 3HBTA 2WOMA 3FFKB 5JICA 4DU1A 1YI2N 4N76A 4OJRA 2P9LA 4OO1J 3NVMA 3THYB 3VF2A 3VQ9A 4B9SA 3IDHA 3ZETA 3F5TA 4H5VA 3T19A 3NGIA 3VMFB 3OYEA 1UOCA 1Z05A 5DM6L 1A5WA 3KLEA 5AQQA 2XY8A 5SWMA 2A1SA 4C1NK 5AQPA 2JWLA 3DXKA 1Z25A 4B9LA 1ZC6A 4RW7A 3ULDA 4Z4FA 1SZ2A 3AVIA 4CI6A 4FW2A 4JD2A 3SPZA 1Y64A 1BI4A 4E7LA 4K8XA 4CFCA 4DSJA 1YTUA 2O8BB 1TK0A 2G8HA 4CZIA 3L2UA 3AA5X 4EAHD 2QWQA 5C12A 3MCAB 5CE3A 2F96A 3AO4A 3OS2A 2GELA 2P5OA 1UA1A 4JHDA 2O8EA 3DJCA 4F4KA 4ZHRA 4CZHA 3HPGA 3NF8A 4NO7A 4JI6K 4KHYA 1ITGA 2VWKA 3CCQN 2CH6A 1VSIA 1WAJA 3B8AX 1IKYA 3NBPA 3DI6A 3L2WA 3D2FA 1U47A 3D0PA 1GLDG 2VWBA 1C0GA 1SKWA 3QIOA 2A40A 3T7ZA 1GLFO 3E9PA 3MX2A 3TSPA 4E19A 4MO5A 4GKJK 2G8KA 1BIZA 1NMDA 2O8FA 3TTDA 3AVAA 4LH4A 2V7ZA 1KVCA 3H1QA 2GBZA 2W6KA 4GKKK 4B9QA 3P4IA 1HQUA 3DWLA 1C1CA 3A5NC 3L0QA 4FOEA 3MWPA 4BRGA 2QI2A 4CJLA 1QVGM 4MDBA 1RDDA 3M1FA 3RMDA 4C23A 4DSFA 4Z94A 1IH7A 3P1GA 5FRNA 3SQ1A 1TUYA 1MDUB 5LL6Z 1ZBHA 3LDNA 1TAUA 3RMAA 5J2PA 2A3ZA 3FZFA 3C7NB 3D2EA 5AZJB 3OW2M 4EZ9A 2WBNA 1NK7A 4IOCL 3ID6A 3E9OA 3L3VA 5AQSA 4J2AA 1YTAA 1ZBUA 4Z0UA 3LDQA 4DF4A 4BRMA 1TYQA 5CYQA 4B1YB 1C6VA 4IO8A 5KQ8A 4FJNA 3HSCA 2JLEA 3O1BA 4FJ5A 2YNIA 4EHTA 3T1YK 1X9SA 2Q36A 4WQ4C 3KK2A 3AVBA 1I94K 3S3NA 4BRCA 1D9DA 1VQKN 4KTQA 3WEEA 1SAZA 4NCBA 4IKFA 1QHAA 3QMLA 2F9WA 3DLEA 3O8MA 2JGUA 2ZJPL 4BG9A 3UIQA 1QE1A 4E1JA 1OVQA 4DR1K 3THYA 3U4LA 1VQ4N 3CQ8A 1KCFA 4IFEA 4A5AA 3KTQA 5C10A 4YOVA 1YHQN 4YY3K 4IFYA 2Q2RA 3ID8A 4CZJA 3IAYA 1ATNA 3J7ZO 5E41A 4FL9A 1W9HA 3MXJA 2P9PB 3NCIA 4Q0BA 1GLLO 2YHXA 4FWSA 4JKCA 4DLGA 4UQGA 2HF4A 3VTIA 5AFUA 4PL8A 1A5VA 4KV8A 4CZGA 1IBLK 1T6CA 1Z26A 1ZBFA 1WSJA 3K58A 4JLHA 1SKSA 2A5XA 2O8BA 3KLHA 4DUZK 2IIRA 3PX0A 4K43A 4AHSA 4B3OA 1QQCA 4LF7K 2D0OA 2FBVA 2BDPA 2P9IB 2YV0X 3KIOA 1ZBIA 2ZWHA 2D0PA 4BE1A 1S1UA 4DLEA 2D0BA 3PX6A 3DLGA 3KKRA 4CJSA 5DM7L 2B5JA 1RTJA 4BC2A 1U4BA 4FJJA 4CK3A 3R9PA 2D0CA 4B1UB 3SMPA 3MN7A 4CERA 3OYHA 1M1KO 3U8XA 4DU4A 1RDCA 1BIUA 3WXLA 4CJKA 1RTDA 3PO4A 2FBXA 4EIAA 2X74A 5FROA 4DTOA 4H03B 4DV0K 5GINA 3O9TA 4WFNL 1JL2A 3E01A 1RT3A 2H3GX 3QIPA 1IV0A 4Q5VA 3OYKA 3Q7CA 5IT9O 4LY7A 3KVGA 1IG8A 3J81O 3GBTA 3IFRA 1V4SA 4YOYA 4ISEA 1BWFO 1SL2A 2CGLA 1WAFA 3OYBA 3CM5A 4FM0A 1IO2A 1NGIA 2DFHA 4RW6A 3QINA 3I0RA 3NGZA 3KHYA 5JVHL 2P51A 1GLBG 4JI8K 1D5AA 4DTMA 1NMNA 3SQ4A 1QQMA 4FJLA 1OKJA 4H8KA 3AV9A 3UKRB 3G4SN 4XH4A 4DF8A 3G25A 3TAPA 3NH0A 3C7NA 3JS6A 5AZJA 4H0YB 4PY5A 3FZHA 2Y1IA 1JLFA 4FO0A 4IWVA 1HYSA 1E4FT 3LDSA 2E20A 4ZTJA 3MWTA 3L8BA 3O08A 5M1FA 3QICA 2PFUA 3OYIA 4DV1K 3NGYA 1E4GT 3T1AA 2ZQBA 4CFAA 2V52B 4Z4EA 1NOYA 3CERA 4E7IA 3NF6A 4X65K 1DKGD 1LWCA 2Z1HA 5BPLA 3PO5A 4DR4K 1VQNN 4RW8A 3VEZA 3SAHA 1B92A 3VQ6A 3HVRA 3JXUA 3RVCA 1NK8A 4NCAA 3WQUA 1BOTO 2Z1GA 4XH5A 1RCHA 3N4PA 3P31A 4QOZB 5J2NA 3RMBA 4JK8A 1BA1A 1VRUA 1RDAA 2GWJA 2KZZA 4BR9A 4N5SA 3H6EA 3M8QA 5JMVA 2O4GA 3ITHA 2DFEA 4DSKA 3ZSWA 1QSSA 2NRZA 3PV8A 1HNXK 3A5OC 2E5LK 1S1TA 4DV7K 4F9OA 2BE2A 2YNGA 2YNFA 3JYTA 1GOBA 3VERA 3CF5L 3VA0A 2J4RA 4DQQA 1FJGK 4DQRA 4FJMA 2P9PA 4W5TA 4DQIA 2UXBK 4DU3A 4F3TA 1RDWX 1N36K 4H0XB 1HJRA 3THWB 4B1VA 1CLQA 1BDGA 1QSLA 1EO1A 4Z4GA 4W5OA 3TU5A 5BPNA 1TKXA 3ZSXA 3MCPA 4YOWA 2UUCK 3SK3A 3AVMA 4LSLA 3VQ7A 3RRGA 2QKKA 1JKHA 2V7YA 1RT2A 3DAWA 3FE1A 3LZIA 3DYAA 5AQNA 4CEBA 4DHYA 4UY8O 2P9IA 4LF8K 3OS1A 4CJQA 4JS4A 3J7AP 4LC9B 5AZIA 1U45A 4FJ8A 3WNHA 2CGKA 3IMXA 1NG9A 1JCGA 4DB3A 4PKGA 4OX9K 5CY4A 4KRFA 3CFPA 4Y1DA 2WTUA 2XRIA 4BWMA 3MEEA 1MWMA 3BY5A 2NRTA 3FZKA 4DR2K 2QWRA 4CJWA 4B9NA 3B6PA 4CVNE 4CFDA 3J8AA 3PX4A 5TKWA 4FWRA 4AILC 3MXMA 1K9MO 1FXXA 1YVNA 4FW1A 1BU6O 1RTHA 1VQ8N 4FZZA 2D5RA 5FPNA 4C8NA 5FRMA 4M7YA 3RR8A 4DG1A 3NH2A 5AQGA 4HCCA 5AJ3K 1VSDA 4YNQA 4CESA 3O3HA 3ZYYX 4FLWA 4JN4A 4OKKA 3FGUA 2WFBA 3VF6A 5J2QA 1KRPA 3SYZA 4OGCA 4CF2A 3SAFA 5BR8K 3O9UA 4DTRA 2RN2A 4FM1A 1NK4A 1C0MA 4MLHA 3A0IX 1S6QA 2QWLA 1XMOK 3VQQA 3VQBA 1SQKA 2E8AA 4IXCA 2BTFA 4A5BA 3R1XA 5M1OA 4AHUA 3LL3A 3GDQA 1SL0A 4O0JA 1BQMA 3G6EN 3DLRA 2V51B 3R8EA 4FLUA 3UKRA 4Y1CA 3P83D 5ADXH 1WSIA 1EP4A 4DQSA 5BN8A 3CCVN 5AQJA 1D9FA 1NKBA 2NUBA 4CEOA 5KPZA 5HRNA 3RMCA 2RE2A 5BREA 3SUPA 1JXEA 3M6GA 5AQVA 2X6SA 1ATRA 5BRHA 1HYZA 4Z4HA 1R59O 1S3XA 4AHTA 3MN9A 1S6PA 3I33A 5SZTA 3F2KA 1ESVA 1WN7A 4Z4IA 1EWRA 4BRFA 4XH1A 2KLAA 1E3MA 5C24A 1BGXT 1TKZA 2JWKA 4DSEA 4ELUA 5B8HA 3TABA 1K8AO 1JCEA 3RSEB 4BRNA 1MWKA 5EX5A 4H4MA 4O8KA 3HYFA 1DT9A 5BRDA 1RDBA 4AM7A 2NZTA 4HTUA 4IOAL 1RBRA 4BROA 4CW7B 1EXQA 2VCPA 2A1RA 4XIUA 4QS9A 3BP8A 1NK9A 2F4VK 4V19S 1HLUA 2R7YA 1LW0A 1RBUA 1NJWA 4IZ9A 3TPQA 1L3SA 5M1QA 3M5RA 1HQEA 2ETJA 4KHPK 3V1OA 3K57A 3Q7BA 2RHKA 4LFAK 3ZSOA 1GLEG 4ISFA 1T03A 2HMPA 4M3UA 3THWA 3BDPA 1NOZA 4CF8A 1OH7A 2OZMA 3H45C 5DMRA 4O44A 1YXQA 4W5NA 4AHCA 4BGAA 4C8OA 4KI4A 1G15A 1VQ9N 2QM1A 1NK5A 3A2FA 4BR4A 3WNFA 1NNEA 3SI6A 1J54A 1P8ZA 3HP9A 2B6AA 2HVIA 3L2VA 5JVGL 4DTNA 1QZ6A 5F1XA 4M3WA 4FWOA 1YJWN 3DOLA 3TI0A 3R3LA 2GEMA 1VSEA 4JI0K 4U7BA 2IOCA 5LMUK 4L3QA 3IG1A 4LD0A 5KTQA 3M8RA 1RILA 4CZLA 2I7PA 5FLXO 4M42A 3QERA 5I42A 1IKXA 2AA4A 3ENOA 1BA0A 4IG3A 4BR0A 5A2QO 3QNOA 1VQ7N 4BVPA 1KC8O 4HCBA 1Q81O 1OH6A 4AF1A 3OYLA 2YHWA 1JCFA 3LPUA 1UWBA 4DTPA 4IDKA 2E88A 2OCEA 1ZBLA 5HROA 3WXJA 2NRVA 1S1XA 4FJXA 1BO5O 4DTXA 4I9LA 5EVZA 3I8BA 4YOXA 3OYJA 4X62K 4BRHA 4CZEA 5E84A 5TKYA 5C2DA 4B3RK 4CJ5A 4FWLA 3DOKA 4CJFA 3QFUA 1X9MA 3TARA 4PKIA 2DTUA 1JLAA 4BR2A 4E89A 3AAQA 4B1XB 4KREA 1DLOA 3JAMO 2QXLA 2P5GA 1EKEA 4AQYK 1KFDA 3G10A 2VG6A 4O8UA 2HVHA 4E1NA 5BRFA 3K5MA 1JJ2M 3CFOA 4IDHA 3BZCA 4IJNA 4BDZA 3DRRA 1XMQK 4FLTA 2ZM6K 4J2EA 3U9DA 1NGGA 2PYLA 2E1ZA 3RSEA 3VETA 4G9ZA 1SV5A 4CGFA 1J5EK 1BQNA 3WUHA 3LANA 1XHXA 1RBTA 5HRPA 4CHYA 4JV5K 2F8SA 3QEXA 1S9EA 2FBYA 3OYDA 1XNRK 3KK7A 2ZE2A 3LALA 3ZSYA 3NMUA 4I7FA 4ILGB 1NGEA 4CF9A 1L5UA 1NJYA 3ISNC 2AP1A 4ILJA 4DSIA 4JAXA 1W97L 1RGIA 4PHTX 2RF2A 4BDPA 4JS5A 1J6ZA 3CC7N 3BGRA 4J2DA 2KQ2A 3QBXA 2BANA 5BR9A 3DLLL 4FZYA 4LSNA 3CPEA 1BL3A 4WFBL 2QTDA 4KBOA 4YHHK 2VWJA 1T7PA 2OA8A 3KD1E 3TANA 4YOUA 2QA4N 1NK6A 4KKOA 5LJWA 1N32K 3LDOA 1OVYA 3EE8A 4ILHA 4IJAA 4KTWA 4J2BA 4BACA 3G71N 1IBMK 2WUSA 5BPMA 2PAVA 1J9AA 1O1WA 2KFNA 3PSFA 4FVMA 2Q31A 4H4OA 3T69A 2OPRA 2YKMA 3U3YA 4NYFA 4B9UA 5EU7A 3V9SA 3HRGA 1UA0A 3CCJN 4JKGB 3V9XA 1HKCA 4MDAA 1VK0A 1NGFA 4YFUA 3V1RA 1T3VA 3LP2A 2PY5A 4KI6A 3AGKA 4B9VA 3HO1A 4HTLA 2YJEA 1N6QA 4H0VB 5HOOA 4IEIA 1SUQA 4JKBA 3ENBA 4DTJA 3P39A 1RT4A 2GWKA 2IGIA 1KLNA 5BN9A 3O5BA 1EWQA 3DXMB 5C2FA 3IS9A 1NBWA 4CHNA 1ATSA 2HNYA 4DKWA 1N33K 4BGBA 3QO9A 4CF1A 5AZIB 4JK9A 1GOCA 4N41A 1VQON 3SUQA 4I6MB 2HHWA 3VQ8A 4PQUA 3U9ZA 4F8RA 1GLCG 4FLZA 4FZXC 5KGWA 4B9TA 4B3SK 4OKEA 1DTTA 5KI6A 1L3VA 3IRXA 3LP3A 2YNHA 1NJXA 1CZ9A 3WT0A 1NK0A 1TV6A 3KLGA 2KZMA 3CCSN 1WSEA 2IVPA 2Y1JA 3WNEA 1T8EA 4BWJA 2YHBA 1C0FA 2E4LA 3OVNA 4HWIA 3OYAA 4CHPA 4FJ7A 4O4GA 4OPAA 4KFBA 4DV2K 3GL1A 2HF3A 1OH8A 3CC2N 3K9KA 4IBNA 3AA2A 4N56A 1JLQA 5E26A 4CZFA 4B1ZA 3MN5A 4FJIA 1F21A 2QW9A 3SNNA 3NFAA 5JS2A 3VA3A 1TKDA 2OZSA 1XHZA 1L3TA 3QLHA 3QEVA 3HM9A 4KHQA 4MO4A 3FZMA 4GNIA 4H5WA 1YAGA 3O9SA 4BRDA 5C25A 1T44A 4GMJB 3RTVA 4X64K 4WFAL 2P9KB 3DRPA 3VOVA
chains in the Genus database with same CATH topology
4V19S 4X65K 4B3RK 4DR4K 4DUZK 4B3MK 4DV4K 4KHPK 4LF7K 5AJ3K 5LL6Z 4LFAK 5IWAK 4DR6K 4DV5K 3JAMO 5BR8K 4AQYK 4DR7K 1HNZK 4LFCK 1XNQK 4DV6K 1XMOK 2UU9K 4LFBK 4JYAK 2UUAK 1HNXK 1XMQK 4DV0K 2ZM6K 2E5LK 4DV7K 4NXMK 3J7YP 2VQFK 3T1YK 4DV3K 4NXNK 1N33K 1I94K 4JI4K 1J5EK 1N34K 1FJGK 2VQEK 2UXBK 5IT9O 4JI0K 4JV5K 3J81O 5LMUK 1IBKK 1N36K 4B3SK 3J80O 1XNRK 4K0KK 4LF5K 4JI6K 5LMNK 5FLXO 2UUCK 4JI7K 3OTOK 2UUBK 4JI2K 4DR5K 4JI3K 4DR1K 4B3TK 5A2QO 4JI8K 2UXCK 4JI1K 4DV2K 4LF6K 4LF8K 1HNWK 4YY3K 4GKJK 4LF9K 3J7AP 1HR0K 4LF4K 2UXDK 4YHHK 4OX9K 4DR3K 3T1HK 4GKKK 4CW7B 4JI5K 1N32K 4DUYK 4DV1K 1IBMK 4DR2K 2HHHK 2F4VK 4CVNE 4X64K 4X66K 1IBLK 4X62K
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4V19 S;  4X65 K;  4B3R K;  4DR4 K;  4DUZ K;  4B3M K;  4DV4 K;  4KHP K;  4LF7 K;  5AJ3 K;  5LL6 Z;  4LFA K;  5IWA K;  4DR6 K;  4DV5 K;  3JAM O;  5BR8 K;  4AQY K;  4DR7 K;  1HNZ K;  4LFC K;  1XNQ K;  4DV6 K;  1XMO K;  2UU9 K;  4LFB K;  4JYA K;  2UUA K;  1HNX K;  1XMQ K;  4DV0 K;  2ZM6 K;  2E5L K;  4DV7 K;  4NXM K;  3J7Y P;  2VQF K;  3T1Y K;  4DV3 K;  4NXN K;  1N33 K;  1I94 K;  4JI4 K;  1J5E K;  1N34 K;  1FJG K;  2VQE K;  2UXB K;  5IT9 O;  4JI0 K;  4JV5 K;  3J81 O;  5LMU K;  1IBK K;  1N36 K;  4B3S K;  3J80 O;  1XNR K;  4K0K K;  4LF5 K;  4JI6 K;  5LMN K;  5FLX O;  2UUC K;  4JI7 K;  3OTO K;  2UUB K;  4JI2 K;  4DR5 K;  4JI3 K;  4DR1 K;  4B3T K;  5A2Q O;  4JI8 K;  2UXC K;  4JI1 K;  4DV2 K;  4LF6 K;  4LF8 K;  1HNW K;  4YY3 K;  4GKJ K;  4LF9 K;  3J7A P;  1HR0 K;  4LF4 K;  2UXD K;  4YHH K;  4OX9 K;  4DR3 K;  3T1H K;  4GKK K;  4CW7 B;  4JI5 K;  1N32 K;  4DUY K;  4DV1 K;  1IBM K;  4DR2 K;  2HHH K;  2F4V K;  4CVN E;  4X64 K;  4X66 K;  1IBL K;  4X62 K; 
#chains in the Genus database with same CATH topology
 2QWM A;  1MU2 A;  4OPH A;  3SLC A;  2D1K A;  3U6F A;  4NCG A;  4I2P A;  5M1K A;  3V4I A;  3S41 A;  1BHL A;  2DFF A;  3MK6 A;  4JKF A;  4HUE A;  2VYP A;  3ZSV A;  5GAH P;  1I3A A;  2IAJ A;  2D4W A;  3E9L A;  3VEY A;  1N8R O;  3O3F A;  3KWI A;  4DR6 K;  1W2B M;  2DY4 A;  5AQT A;  2E2O A;  2ZGZ A;  4CJV A;  4E3S A;  4LFC K;  1EQY A;  3OBY A;  3H3N O;  3KK3 A;  4M3Y A;  4LFB K;  4JYA K;  1KSP A;  2F9T A;  4FLV A;  4O55 A;  1X9W A;  1BG3 A;  2XO7 A;  1U04 A;  2E1Y A;  5AQM A;  3CIP A;  4WF9 L;  2OPS A;  4KAZ A;  3BEX A;  4NXN K;  1NGC A;  4R5P A;  3O4Q A;  3KZB A;  2WC9 A;  3U3G A;  2Z1I A;  3MEC A;  3K2P A;  4OPK A;  3NF7 A;  3VQ4 A;  4CZK A;  4CK2 A;  4BC4 A;  3CD6 N;  5CZ1 A;  4K0K K;  1O13 A;  3NE6 A;  4JI7 K;  4FXD A;  4JI2 K;  2FF6 A;  1S9G A;  2ZD1 A;  1NGB A;  3D7E O;  2F8T A;  3CJC A;  2YX6 A;  4JKG A;  1NWK A;  3A5M C;  1N5Y A;  4LF6 K;  1T6D A;  1HR0 K;  3EZW A;  3ZEU B;  4LF4 K;  3M3Z A;  1NKE A;  4B9M A;  2E2P A;  4R79 A;  3LDP A;  2KKZ A;  2VGM A;  3KLF A;  2UXD K;  3CCU N;  4BG8 A;  5AQZ A;  3O1W A;  3RWU A;  3HXM A;  1RBV A;  1YT3 A;  3E1Y A;  4JKE A;  3K0S A;  4ICL A;  2HHX A;  4DQ8 A;  3TAF A;  3DXM A;  3CJ1 A;  1LWE A;  3OY9 A;  3QDK A;  1JLG A;  2GTD A;  1U48 A;  3AVF A;  1JXB A;  1JLC A;  2FSJ A;  5ELZ A;  1Q9X A;  1DGK N;  4B3M K;  1KVB A;  3D45 A;  3CET A;  1W0H A;  4I6M A;  1QS4 A;  1MA9 B;  3V81 A;  1BIS A;  5AQF A;  2OTL N;  4CIF A;  4BRI A;  2VG7 A;  1IG9 A;  4FWM A;  4DMN A;  3OA9 A;  3CMA N;  4KH4 A;  3THV A;  4B1W B;  1SKR A;  3CPW M;  1HPZ A;  4CEF A;  1A5X A;  5KRT A;  4MQ3 A;  5T7B A;  3EYZ A;  4E7J A;  5CYM A;  2OAN A;  3EY1 A;  2HBJ A;  1TVR A;  3J7Y P;  4M3R A;  1VSM A;  2GX9 A;  1IKV A;  2E2N A;  2ATQ A;  3KLI A;  4H0T B;  1Q7Y O;  2VQE K;  2BH1 A;  2IS3 A;  3VF4 A;  3C6U A;  2P9N B;  2NRH A;  2VGN A;  3AVK A;  5AQL A;  3TTC A;  4A62 A;  2P9K A;  2UYT A;  1K73 O;  4DS4 A;  1S22 A;  1LW2 A;  1TL1 A;  5C42 A;  4FJG A;  3LAK A;  4KB1 A;  4CEC A;  2OPP A;  3OJU A;  4JI3 K;  4EP5 A;  4AHV A;  3FLC O;  3L4Q A;  4ZTF A;  3PIP L;  4RW4 A;  1LAV A;  3EEQ A;  3AVJ A;  4KH6 A;  4JI1 K;  4CCH A;  4FK4 A;  3AY9 A;  1JL1 A;  4FJH A;  4LF9 K;  3ULE B;  1Q18 A;  3SUO A;  4C8L A;  4CGG A;  3NHG A;  4DTU A;  1HRH A;  2F7T A;  3H3O B;  2IDO A;  3SQ2 A;  3HT3 A;  2OPQ A;  5HP1 A;  1YF5 L;  4IO9 L;  4BRL A;  4J8F A;  1XC9 A;  2YI1 A;  1FW6 A;  3SV3 A;  1YJ9 N;  3UKU B;  3AAP A;  2AJQ A;  4BE0 A;  5ADX A;  3CCR N;  5I9E B;  2HHU A;  1WSG A;  4EP4 A;  4OLA A;  4M7X A;  3BUZ B;  4GV6 A;  5AQU A;  4HUF A;  1HUX A;  4OKJ A;  4PA1 A;  4M3T A;  3VEV A;  2P9U B;  5AQX A;  4DV5 K;  2QWP A;  4CGH A;  1KD1 O;  1KAZ A;  2Z1J A;  3QEW A;  1VSF A;  4NLB A;  3M8S A;  5KGX A;  3SCX A;  4CF0 A;  4DV6 K;  3VEN A;  2O8C B;  3ATU A;  3VQC A;  2QWN A;  1XQS C;  4JKA A;  2XY5 A;  2HOE A;  5KRS A;  1YJN N;  4BRE A;  4CEA A;  4O0I A;  3D6R A;  2X78 A;  4CJE A;  3CHW A;  2CH5 A;  1X3M A;  2Q0R A;  3ZEU A;  4CEZ A;  1WSF A;  1HNV A;  4DFJ A;  4CJP A;  1RT1 A;  5HL7 L;  3C0B A;  4O5B A;  4AM6 A;  1UAX A;  1IBK K;  2HMI A;  3S3M A;  4WE1 A;  1KTQ A;  2NLX A;  3AO5 A;  1XC3 A;  2DPN A;  3SMS A;  1EX4 A;  3L2Q A;  2ZF5 O;  4JRP A;  4F2S A;  3OTO K;  2I7N A;  3CI5 A;  4A59 A;  3GG4 A;  3TR8 A;  4DTS A;  3TTF A;  4DFK A;  3CME N;  4CJU A;  1ZBS A;  4BRA A;  4PWD A;  2FXU A;  1M90 O;  1KLM A;  1FKO A;  1NJZ A;  4NB4 A;  3EKU A;  3DRS A;  4CHZ A;  1RBS A;  1SS6 A;  4H5N A;  3AGR A;  2A41 A;  4KTZ A;  3QEP A;  4HUG A;  1CXU A;  4JI5 K;  3OYC A;  1VSL A;  1RDU A;  1TL3 A;  3QBW A;  3KKS A;  3VES A;  2NRR A;  2Q97 A;  3PLA A;  1NJI O;  4FK2 A;  4X66 K;  4G1Q A;  2Q1N A;  2O4I A;  4H0P A;  2ASO A;  3EKS A;  3LP0 A;  4FSV A;  3HP6 A;  4E0D A;  5H1S Q;  1S1W A;  4GV3 A;  2YHA A;  3MMV A;  1HMV A;  4CD3 A;  1RFQ A;  3HTV A;  5IWA K;  3ZX3 A;  2BGG A;  1RNH A;  4K42 A;  3VQP A;  3QFP A;  2P9N A;  4CE9 A;  1TAQ A;  5AQO A;  3CQY A;  4PKH A;  4BC3 A;  1KAY A;  1HNZ K;  5KQD A;  3MN6 A;  4M41 A;  4E1M A;  3OS0 A;  2XY6 A;  1ASW A;  1VAZ A;  1D4X A;  3ASM A;  2GV9 A;  1CZB A;  1XUP O;  2HNZ A;  1LV5 A;  4GY2 B;  3NAE A;  3SBT A;  4CJT A;  3QB0 A;  3HL8 A;  3IKM A;  2EHG A;  4LH5 A;  5EY4 A;  1U49 A;  4OLB A;  3THX B;  4EHU A;  3G0Z A;  1ILY A;  2YCH A;  5GAD P;  3SUN A;  4NXM K;  1S1V A;  3ULE A;  4BDY A;  2HB5 A;  3VEW A;  1I39 A;  2E6L A;  1Q8I A;  3ZT1 A;  1EET A;  2FF3 B;  4DSL A;  3HK2 A;  4AH9 A;  1GLA G;  3W3D A;  3FZL A;  1NLV A;  3ATV A;  4RWT A;  3DLH A;  1IJJ A;  4ISG A;  4BR7 A;  1TK8 A;  3WNG A;  3OBW A;  4QS8 A;  3UKU A;  1RT6 A;  3K9J A;  4DCH A;  4BRP A;  1RT5 A;  1WNS A;  3I0S A;  4Y0W A;  4DR5 K;  3QEI A;  3AO2 A;  2P1J A;  4OGE A;  3O80 A;  1K8K B;  5C0Y A;  3P38 A;  3S9H A;  1ZYQ A;  4FJ9 A;  2D0A A;  2G8U A;  2W41 A;  3CXC M;  3V9W A;  4JKH A;  2P9U A;  4CGJ A;  3MXI A;  1P90 A;  3ZCM A;  1OH5 A;  3OYM A;  4H5T A;  4FJK A;  3QET A;  3HOT A;  3EE9 A;  2OTJ N;  1JLB A;  2YJF A;  3V9Z A;  1NGH A;  3ZSR A;  4GV9 A;  2O8C A;  4DUY K;  3VGM A;  3V1Q A;  3AA3 A;  3PY8 A;  3PIO L;  2HBL A;  5M1N A;  1WUA A;  3CYM A;  3CCL N;  4C1N I;  4CFB A;  4A2A A;  4CEE A;  2W40 A;  3O4N A;  3LM2 A;  4ID1 A;  4CJR A;  2IC3 A;  3HPO A;  3OYF A;  3OYG A;  4F2R A;  1NM1 A;  3O9R A;  4NLC A;  1TK5 A;  5F2R A;  4YOT A;  1NGA A;  1B9F A;  3H46 O;  3JSM A;  3C6T A;  3LP1 A;  1LAW A;  3CJA A;  4BRQ A;  1VQP N;  2WON A;  5KPR A;  4FLX A;  3CC4 N;  3RRH A;  5HLF A;  3DMJ A;  3TAE A;  3ALY A;  4DR7 K;  2HBM A;  1RT7 A;  3EN9 A;  1HPM A;  1XNQ K;  1WOQ A;  4CHO A;  4RG8 A;  1T05 A;  4K25 A;  4A61 A;  3O9Q A;  4CHQ A;  2B4J A;  2NRX A;  2ITG A;  4M3X A;  1H1V A;  5AFU H;  2XHB A;  2QKB A;  3VQA A;  1QTM A;  4CIG A;  3QES A;  5D3G A;  3L6Q A;  3KK1 A;  4N47 A;  4DV3 K;  2G8F A;  2Q3S A;  5JLF A;  4WQ4 A;  3MX5 A;  5EOY A;  2ZGY A;  2E2Q A;  1B9D A;  2G8I A;  4YOR A;  3F73 A;  3QNN A;  2PBD A;  3A5L C;  3J80 O;  3H1V X;  3EZ5 A;  4FK0 A;  1NGJ A;  3HJF A;  5LMN K;  2FBT A;  3VGK A;  2XY7 A;  1Q86 O;  3BZK A;  1VRT A;  4W5R A;  1WBD A;  4IG0 A;  4O5F A;  5CHI A;  2BUP A;  4JK7 A;  1KAX A;  5M1P A;  5C15 A;  1HJO A;  3IUC A;  4FOI A;  1GLJ O;  4CJ3 A;  3C65 A;  4RW9 A;  4OPJ A;  3CCM N;  3F9K A;  3KWG A;  3CCE N;  2KTQ A;  2YHY A;  3N4Q A;  4CGI A;  2FC0 A;  4I2Q A;  3WXI A;  3HPH A;  4JNE A;  3O4W A;  3KJV A;  5J2M A;  1U2V B;  4F3O A;  3THX A;  3SZ2 A;  4IOX A;  1YUW A;  3AO3 A;  1S72 N;  4CBW A;  4CK1 A;  3VQE A;  3AVG A;  3V6D A;  1Y97 A;  3OYN A;  1W7A A;  4RTF D;  3HM8 A;  4WQ5 C;  4NYN A;  5JS1 A;  1LOT B;  5GAE P;  3HVT A;  4BY9 C;  3VPZ A;  3AA4 A;  4AHR A;  2P9S B;  2NNW A;  5CR4 A;  2G8V A;  4CEQ A;  3PUF A;  4Z4C A;  2G8W A;  2EWS A;  2A6A A;  1VQL N;  2UU9 K;  1X1P A;  1LCU A;  4IFV A;  1REV A;  2E6M A;  1K8K A;  2UUA K;  1JLE A;  1KXP A;  4U67 L;  4M63 C;  3K5L A;  2HND A;  1TKT A;  3L4I A;  4KHU A;  2VQF K;  1S5J A;  4WQ5 A;  3ZT0 A;  3GE1 A;  1N34 K;  2W6L A;  3E66 A;  3AVH A;  4ELV A;  4ID5 A;  4BR5 A;  4WCE L;  4C8M A;  4K8Z A;  3VGL A;  1VQM N;  1XWL A;  5AR0 A;  1VQ6 N;  3PSI A;  1QZ5 A;  3T3F A;  3LDL A;  3SBG A;  4L8R B;  3L3U A;  5FDL A;  2HST A;  3K59 A;  1VQ5 N;  1KVA A;  2HHT A;  2OYQ A;  3EO3 A;  4CIE A;  2CGJ A;  4M45 A;  4IEE A;  4FWN A;  1Z6R A;  4GVM A;  3CJ7 A;  4B3T K;  1Q82 O;  5JLH A;  2QK9 A;  3CFR A;  3VQD A;  4E7H A;  5AQR A;  2FSK A;  4FWQ A;  1HNW K;  4XEI A;  5FPM A;  2ITM A;  3ZX0 A;  3CM6 A;  3VQ5 A;  1HNI A;  3FFI A;  3FR0 A;  4DQP A;  3T1H K;  1BCM A;  1LWF A;  3HZ6 A;  1R0A A;  4KH5 A;  1FKP A;  1DEJ A;  1BUP A;  3TSU A;  3GOI A;  3LPT A;  4CZM A;  2QXF A;  2HHH K;  3K5N A;  3TSQ A;  3RR7 A;  3I55 N;  4FPA A;  4TSX A;  2X6N A;  1TUU A;  2PYJ A;  3DM2 A;  4FWP A;  5AQK A;  4M3Z A;  3ZSQ A;  5HRS A;  3VEO A;  1C0T A;  4FVU A;  4BQL A;  4DV4 K;  2HHV A;  3VTH A;  5GAG P;  1VHX A;  4FM2 A;  2O8D B;  1CZA N;  4A57 A;  4FLY A;  1VSH A;  5AQH A;  4PL7 A;  5FPE A;  1XI1 A;  4B8A B;  3C95 A;  1ASU A;  3NF9 A;  1HKB A;  5HBM A;  3AVN A;  3WXM B;  2QWO A;  3C94 A;  3UE5 A;  2NRW A;  3TAG A;  1WBB A;  4HVJ A;  3TWH A;  3HST B;  1IKW A;  2RPI A;  2LSN A;  1C0U A;  4W5Q A;  4FCY A;  2ASM A;  1WLJ A;  1KFS A;  5AQY A;  4KPY A;  3TAM A;  1Q9Y A;  1X3N A;  1ZXO A;  3SPY A;  3M8P A;  2P9L B;  3O6W A;  5CZ2 A;  1FK9 A;  4JI4 K;  2HHQ A;  3B6O A;  3VEX A;  4FYD A;  3ZET B;  1HYV A;  3VN5 A;  4BVO A;  4BC5 A;  3V9U A;  4OVL A;  4CBU A;  5FPD A;  4JEP A;  1VSJ A;  4DS5 A;  3MEG A;  1K6Y A;  1RTI A;  3SJH A;  4WYB A;  1U2V A;  3ZX2 A;  1QHT A;  4B8C A;  3ZSZ A;  1NKC A;  1YIJ N;  3CJB A;  3AO1 A;  2IVO A;  2UUB K;  4KO0 A;  3DXK B;  2KHO A;  1C1B A;  4B08 A;  1C1A A;  1QQO A;  3CJ9 A;  1QSY A;  3MED A;  4JD2 B;  4CED A;  2UXC K;  4DWI A;  1BI4 B;  3S3O A;  3F9M A;  2Q0U A;  5K14 A;  4HHT A;  4BRK A;  1QQN A;  2EX3 A;  4I9Q A;  3CG7 A;  2P9S A;  3H08 A;  2YKN A;  3NH1 A;  2W42 A;  1VSK A;  3AAR A;  4C8K A;  4QAG A;  5EXW A;  4DR3 K;  4KHW A;  2RKI A;  3UB5 A;  4JHD B;  5LY3 A;  3LWM A;  3MDQ A;  1WB9 A;  2O8E B;  2HW3 A;  2HHS A;  3SJJ A;  4RCH A;  4CJ7 A;  4H5R A;  4H0O A;  3LAM A;  3CQX A;  3TAQ A;  2FLO A;  3P5J A;  3D2F B;  4GW6 A;  3SV4 A;  5DK5 A;  3AVL A;  3I56 N;  4A2B A;  4KHN A;  3SAG A;  2A42 A;  1DTQ A;  3SQ0 A;  1G99 A;  4KHS A;  2KFZ A;  3ZT4 A;  3BF1 A;  5J1E A;  2ASP A;  2ZJR L;  4MLE A;  4PUO A;  1KQS M;  2QEX N;  2O8F B;  1J53 A;  3WXK A;  5KPT A;  4JKD A;  4CD1 A;  3O3G A;  4KB0 A;  5HRR A;  3OHR A;  3R6M A;  4BQZ A;  1GOA A;  1HX1 A;  3MAQ A;  3K5O A;  4FWK A;  5AQI A;  4GVE A;  3NDK A;  3NVK A;  5I3U A;  5LJV A;  3EL2 A;  1NGD A;  3ZT3 A;  3HI0 A;  2KW4 A;  4CGD A;  1J5O A;  3KD5 E;  4EZ6 A;  3WQT A;  4FPB A;  3LWL A;  5AQW A;  3BF3 A;  1U6Z A;  2ZJQ L;  3DLK A;  4BE2 A;  4E7K A;  2IVN A;  3D2E B;  1TGO A;  2I5J A;  3HOS A;  4YDU C;  2PZS A;  1YIT N;  4K41 A;  1NU0 A;  1D8Y A;  4LF5 K;  3ZLJ A;  3ZT2 A;  3C6H A;  3ENH A;  2GUP A;  2HBK A;  3OJS A;  1TYQ B;  1L3U A;  3I8D A;  2O8D A;  4DFM A;  1X9J A;  3A8Y A;  1CXQ A;  1HKG A;  3AVC A;  3L2R A;  1BCO A;  3W0L A;  5F0X A;  3LZJ A;  4CBX A;  4ELT A;  4EFH A;  2FSN A;  3WEE B;  1QVF M;  1V4T A;  3LM9 A;  4DFP A;  4YDU A;  2VG5 A;  4QCL A;  2GUI A;  5GIO A;  1WSH A;  4JRQ A;  4QS7 A;  4CJ4 A;  5MLC Q;  1ASV A;  3C6A A;  1SL1 A;  5GIP A;  4MFB A;  3DLB A;  1YVU A;  3HBT A;  2WOM A;  3FFK B;  5JIC A;  4DU1 A;  1YI2 N;  4N76 A;  4OJR A;  2P9L A;  4OO1 J;  3NVM A;  3THY B;  3VF2 A;  3VQ9 A;  4B9S A;  3IDH A;  3ZET A;  3F5T A;  4H5V A;  3T19 A;  3NGI A;  3VMF B;  3OYE A;  1UOC A;  1Z05 A;  5DM6 L;  1A5W A;  3KLE A;  5AQQ A;  2XY8 A;  5SWM A;  2A1S A;  4C1N K;  5AQP A;  2JWL A;  3DXK A;  1Z25 A;  4B9L A;  1ZC6 A;  4RW7 A;  3ULD A;  4Z4F A;  1SZ2 A;  3AVI A;  4CI6 A;  4FW2 A;  4JD2 A;  3SPZ A;  1Y64 A;  1BI4 A;  4E7L A;  4K8X A;  4CFC A;  4DSJ A;  1YTU A;  2O8B B;  1TK0 A;  2G8H A;  4CZI A;  3L2U A;  3AA5 X;  4EAH D;  2QWQ A;  5C12 A;  3MCA B;  5CE3 A;  2F96 A;  3AO4 A;  3OS2 A;  2GEL A;  2P5O A;  1UA1 A;  4JHD A;  2O8E A;  3DJC A;  4F4K A;  4ZHR A;  4CZH A;  3HPG A;  3NF8 A;  4NO7 A;  4JI6 K;  4KHY A;  1ITG A;  2VWK A;  3CCQ N;  2CH6 A;  1VSI A;  1WAJ A;  3B8A X;  1IKY A;  3NBP A;  3DI6 A;  3L2W A;  3D2F A;  1U47 A;  3D0P A;  1GLD G;  2VWB A;  1C0G A;  1SKW A;  3QIO A;  2A40 A;  3T7Z A;  1GLF O;  3E9P A;  3MX2 A;  3TSP A;  4E19 A;  4MO5 A;  4GKJ K;  2G8K A;  1BIZ A;  1NMD A;  2O8F A;  3TTD A;  3AVA A;  4LH4 A;  2V7Z A;  1KVC A;  3H1Q A;  2GBZ A;  2W6K A;  4GKK K;  4B9Q A;  3P4I A;  1HQU A;  3DWL A;  1C1C A;  3A5N C;  3L0Q A;  4FOE A;  3MWP A;  4BRG A;  2QI2 A;  4CJL A;  1QVG M;  4MDB A;  1RDD A;  3M1F A;  3RMD A;  4C23 A;  4DSF A;  4Z94 A;  1IH7 A;  3P1G A;  5FRN A;  3SQ1 A;  1TUY A;  1MDU B;  5LL6 Z;  1ZBH A;  3LDN A;  1TAU A;  3RMA A;  5J2P A;  2A3Z A;  3FZF A;  3C7N B;  3D2E A;  5AZJ B;  3OW2 M;  4EZ9 A;  2WBN A;  1NK7 A;  4IOC L;  3ID6 A;  3E9O A;  3L3V A;  5AQS A;  4J2A A;  1YTA A;  1ZBU A;  4Z0U A;  3LDQ A;  4DF4 A;  4BRM A;  1TYQ A;  5CYQ A;  4B1Y B;  1C6V A;  4IO8 A;  5KQ8 A;  4FJN A;  3HSC A;  2JLE A;  3O1B A;  4FJ5 A;  2YNI A;  4EHT A;  3T1Y K;  1X9S A;  2Q36 A;  4WQ4 C;  3KK2 A;  3AVB A;  1I94 K;  3S3N A;  4BRC A;  1D9D A;  1VQK N;  4KTQ A;  3WEE A;  1SAZ A;  4NCB A;  4IKF A;  1QHA A;  3QML A;  2F9W A;  3DLE A;  3O8M A;  2JGU A;  2ZJP L;  4BG9 A;  3UIQ A;  1QE1 A;  4E1J A;  1OVQ A;  4DR1 K;  3THY A;  3U4L A;  1VQ4 N;  3CQ8 A;  1KCF A;  4IFE A;  4A5A A;  3KTQ A;  5C10 A;  4YOV A;  1YHQ N;  4YY3 K;  4IFY A;  2Q2R A;  3ID8 A;  4CZJ A;  3IAY A;  1ATN A;  3J7Z O;  5E41 A;  4FL9 A;  1W9H A;  3MXJ A;  2P9P B;  3NCI A;  4Q0B A;  1GLL O;  2YHX A;  4FWS A;  4JKC A;  4DLG A;  4UQG A;  2HF4 A;  3VTI A;  5AFU A;  4PL8 A;  1A5V A;  4KV8 A;  4CZG A;  1IBL K;  1T6C A;  1Z26 A;  1ZBF A;  1WSJ A;  3K58 A;  4JLH A;  1SKS A;  2A5X A;  2O8B A;  3KLH A;  4DUZ K;  2IIR A;  3PX0 A;  4K43 A;  4AHS A;  4B3O A;  1QQC A;  4LF7 K;  2D0O A;  2FBV A;  2BDP A;  2P9I B;  2YV0 X;  3KIO A;  1ZBI A;  2ZWH A;  2D0P A;  4BE1 A;  1S1U A;  4DLE A;  2D0B A;  3PX6 A;  3DLG A;  3KKR A;  4CJS A;  5DM7 L;  2B5J A;  1RTJ A;  4BC2 A;  1U4B A;  4FJJ A;  4CK3 A;  3R9P A;  2D0C A;  4B1U B;  3SMP A;  3MN7 A;  4CER A;  3OYH A;  1M1K O;  3U8X A;  4DU4 A;  1RDC A;  1BIU A;  3WXL A;  4CJK A;  1RTD A;  3PO4 A;  2FBX A;  4EIA A;  2X74 A;  5FRO A;  4DTO A;  4H03 B;  4DV0 K;  5GIN A;  3O9T A;  4WFN L;  1JL2 A;  3E01 A;  1RT3 A;  2H3G X;  3QIP A;  1IV0 A;  4Q5V A;  3OYK A;  3Q7C A;  5IT9 O;  4LY7 A;  3KVG A;  1IG8 A;  3J81 O;  3GBT A;  3IFR A;  1V4S A;  4YOY A;  4ISE A;  1BWF O;  1SL2 A;  2CGL A;  1WAF A;  3OYB A;  3CM5 A;  4FM0 A;  1IO2 A;  1NGI A;  2DFH A;  4RW6 A;  3QIN A;  3I0R A;  3NGZ A;  3KHY A;  5JVH L;  2P51 A;  1GLB G;  4JI8 K;  1D5A A;  4DTM A;  1NMN A;  3SQ4 A;  1QQM A;  4FJL A;  1OKJ A;  4H8K A;  3AV9 A;  3UKR B;  3G4S N;  4XH4 A;  4DF8 A;  3G25 A;  3TAP A;  3NH0 A;  3C7N A;  3JS6 A;  5AZJ A;  4H0Y B;  4PY5 A;  3FZH A;  2Y1I A;  1JLF A;  4FO0 A;  4IWV A;  1HYS A;  1E4F T;  3LDS A;  2E20 A;  4ZTJ A;  3MWT A;  3L8B A;  3O08 A;  5M1F A;  3QIC A;  2PFU A;  3OYI A;  4DV1 K;  3NGY A;  1E4G T;  3T1A A;  2ZQB A;  4CFA A;  2V52 B;  4Z4E A;  1NOY A;  3CER A;  4E7I A;  3NF6 A;  4X65 K;  1DKG D;  1LWC A;  2Z1H A;  5BPL A;  3PO5 A;  4DR4 K;  1VQN N;  4RW8 A;  3VEZ A;  3SAH A;  1B92 A;  3VQ6 A;  3HVR A;  3JXU A;  3RVC A;  1NK8 A;  4NCA A;  3WQU A;  1BOT O;  2Z1G A;  4XH5 A;  1RCH A;  3N4P A;  3P31 A;  4QOZ B;  5J2N A;  3RMB A;  4JK8 A;  1BA1 A;  1VRU A;  1RDA A;  2GWJ A;  2KZZ A;  4BR9 A;  4N5S A;  3H6E A;  3M8Q A;  5JMV A;  2O4G A;  3ITH A;  2DFE A;  4DSK A;  3ZSW A;  1QSS A;  2NRZ A;  3PV8 A;  1HNX K;  3A5O C;  2E5L K;  1S1T A;  4DV7 K;  4F9O A;  2BE2 A;  2YNG A;  2YNF A;  3JYT A;  1GOB A;  3VER A;  3CF5 L;  3VA0 A;  2J4R A;  4DQQ A;  1FJG K;  4DQR A;  4FJM A;  2P9P A;  4W5T A;  4DQI A;  2UXB K;  4DU3 A;  4F3T A;  1RDW X;  1N36 K;  4H0X B;  1HJR A;  3THW B;  4B1V A;  1CLQ A;  1BDG A;  1QSL A;  1EO1 A;  4Z4G A;  4W5O A;  3TU5 A;  5BPN A;  1TKX A;  3ZSX A;  3MCP A;  4YOW A;  2UUC K;  3SK3 A;  3AVM A;  4LSL A;  3VQ7 A;  3RRG A;  2QKK A;  1JKH A;  2V7Y A;  1RT2 A;  3DAW A;  3FE1 A;  3LZI A;  3DYA A;  5AQN A;  4CEB A;  4DHY A;  4UY8 O;  2P9I A;  4LF8 K;  3OS1 A;  4CJQ A;  4JS4 A;  3J7A P;  4LC9 B;  5AZI A;  1U45 A;  4FJ8 A;  3WNH A;  2CGK A;  3IMX A;  1NG9 A;  1JCG A;  4DB3 A;  4PKG A;  4OX9 K;  5CY4 A;  4KRF A;  3CFP A;  4Y1D A;  2WTU A;  2XRI A;  4BWM A;  3MEE A;  1MWM A;  3BY5 A;  2NRT A;  3FZK A;  4DR2 K;  2QWR A;  4CJW A;  4B9N A;  3B6P A;  4CVN E;  4CFD A;  3J8A A;  3PX4 A;  5TKW A;  4FWR A;  4AIL C;  3MXM A;  1K9M O;  1FXX A;  1YVN A;  4FW1 A;  1BU6 O;  1RTH A;  1VQ8 N;  4FZZ A;  2D5R A;  5FPN A;  4C8N A;  5FRM A;  4M7Y A;  3RR8 A;  4DG1 A;  3NH2 A;  5AQG A;  4HCC A;  5AJ3 K;  1VSD A;  4YNQ A;  4CES A;  3O3H A;  3ZYY X;  4FLW A;  4JN4 A;  4OKK A;  3FGU A;  2WFB A;  3VF6 A;  5J2Q A;  1KRP A;  3SYZ A;  4OGC A;  4CF2 A;  3SAF A;  5BR8 K;  3O9U A;  4DTR A;  2RN2 A;  4FM1 A;  1NK4 A;  1C0M A;  4MLH A;  3A0I X;  1S6Q A;  2QWL A;  1XMO K;  3VQQ A;  3VQB A;  1SQK A;  2E8A A;  4IXC A;  2BTF A;  4A5B A;  3R1X A;  5M1O A;  4AHU A;  3LL3 A;  3GDQ A;  1SL0 A;  4O0J A;  1BQM A;  3G6E N;  3DLR A;  2V51 B;  3R8E A;  4FLU A;  3UKR A;  4Y1C A;  3P83 D;  5ADX H;  1WSI A;  1EP4 A;  4DQS A;  5BN8 A;  3CCV N;  5AQJ A;  1D9F A;  1NKB A;  2NUB A;  4CEO A;  5KPZ A;  5HRN A;  3RMC A;  2RE2 A;  5BRE A;  3SUP A;  1JXE A;  3M6G A;  5AQV A;  2X6S A;  1ATR A;  5BRH A;  1HYZ A;  4Z4H A;  1R59 O;  1S3X A;  4AHT A;  3MN9 A;  1S6P A;  3I33 A;  5SZT A;  3F2K A;  1ESV A;  1WN7 A;  4Z4I A;  1EWR A;  4BRF A;  4XH1 A;  2KLA A;  1E3M A;  5C24 A;  1BGX T;  1TKZ A;  2JWK A;  4DSE A;  4ELU A;  5B8H A;  3TAB A;  1K8A O;  1JCE A;  3RSE B;  4BRN A;  1MWK A;  5EX5 A;  4H4M A;  4O8K A;  3HYF A;  1DT9 A;  5BRD A;  1RDB A;  4AM7 A;  2NZT A;  4HTU A;  4IOA L;  1RBR A;  4BRO A;  4CW7 B;  1EXQ A;  2VCP A;  2A1R A;  4XIU A;  4QS9 A;  3BP8 A;  1NK9 A;  2F4V K;  4V19 S;  1HLU A;  2R7Y A;  1LW0 A;  1RBU A;  1NJW A;  4IZ9 A;  3TPQ A;  1L3S A;  5M1Q A;  3M5R A;  1HQE A;  2ETJ A;  4KHP K;  3V1O A;  3K57 A;  3Q7B A;  2RHK A;  4LFA K;  3ZSO A;  1GLE G;  4ISF A;  1T03 A;  2HMP A;  4M3U A;  3THW A;  3BDP A;  1NOZ A;  4CF8 A;  1OH7 A;  2OZM A;  3H45 C;  5DMR A;  4O44 A;  1YXQ A;  4W5N A;  4AHC A;  4BGA A;  4C8O A;  4KI4 A;  1G15 A;  1VQ9 N;  2QM1 A;  1NK5 A;  3A2F A;  4BR4 A;  3WNF A;  1NNE A;  3SI6 A;  1J54 A;  1P8Z A;  3HP9 A;  2B6A A;  2HVI A;  3L2V A;  5JVG L;  4DTN A;  1QZ6 A;  5F1X A;  4M3W A;  4FWO A;  1YJW N;  3DOL A;  3TI0 A;  3R3L A;  2GEM A;  1VSE A;  4JI0 K;  4U7B A;  2IOC A;  5LMU K;  4L3Q A;  3IG1 A;  4LD0 A;  5KTQ A;  3M8R A;  1RIL A;  4CZL A;  2I7P A;  5FLX O;  4M42 A;  3QER A;  5I42 A;  1IKX A;  2AA4 A;  3ENO A;  1BA0 A;  4IG3 A;  4BR0 A;  5A2Q O;  3QNO A;  1VQ7 N;  4BVP A;  1KC8 O;  4HCB A;  1Q81 O;  1OH6 A;  4AF1 A;  3OYL A;  2YHW A;  1JCF A;  3LPU A;  1UWB A;  4DTP A;  4IDK A;  2E88 A;  2OCE A;  1ZBL A;  5HRO A;  3WXJ A;  2NRV A;  1S1X A;  4FJX A;  1BO5 O;  4DTX A;  4I9L A;  5EVZ A;  3I8B A;  4YOX A;  3OYJ A;  4X62 K;  4BRH A;  4CZE A;  5E84 A;  5TKY A;  5C2D A;  4B3R K;  4CJ5 A;  4FWL A;  3DOK A;  4CJF A;  3QFU A;  1X9M A;  3TAR A;  4PKI A;  2DTU A;  1JLA A;  4BR2 A;  4E89 A;  3AAQ A;  4B1X B;  4KRE A;  1DLO A;  3JAM O;  2QXL A;  2P5G A;  1EKE A;  4AQY K;  1KFD A;  3G10 A;  2VG6 A;  4O8U A;  2HVH A;  4E1N A;  5BRF A;  3K5M A;  1JJ2 M;  3CFO A;  4IDH A;  3BZC A;  4IJN A;  4BDZ A;  3DRR A;  1XMQ K;  4FLT A;  2ZM6 K;  4J2E A;  3U9D A;  1NGG A;  2PYL A;  2E1Z A;  3RSE A;  3VET A;  4G9Z A;  1SV5 A;  4CGF A;  1J5E K;  1BQN A;  3WUH A;  3LAN A;  1XHX A;  1RBT A;  5HRP A;  4CHY A;  4JV5 K;  2F8S A;  3QEX A;  1S9E A;  2FBY A;  3OYD A;  1XNR K;  3KK7 A;  2ZE2 A;  3LAL A;  3ZSY A;  3NMU A;  4I7F A;  4ILG B;  1NGE A;  4CF9 A;  1L5U A;  1NJY A;  3ISN C;  2AP1 A;  4ILJ A;  4DSI A;  4JAX A;  1W97 L;  1RGI A;  4PHT X;  2RF2 A;  4BDP A;  4JS5 A;  1J6Z A;  3CC7 N;  3BGR A;  4J2D A;  2KQ2 A;  3QBX A;  2BAN A;  5BR9 A;  3DLL L;  4FZY A;  4LSN A;  3CPE A;  1BL3 A;  4WFB L;  2QTD A;  4KBO A;  4YHH K;  2VWJ A;  1T7P A;  2OA8 A;  3KD1 E;  3TAN A;  4YOU A;  2QA4 N;  1NK6 A;  4KKO A;  5LJW A;  1N32 K;  3LDO A;  1OVY A;  3EE8 A;  4ILH A;  4IJA A;  4KTW A;  4J2B A;  4BAC A;  3G71 N;  1IBM K;  2WUS A;  5BPM A;  2PAV A;  1J9A A;  1O1W A;  2KFN A;  3PSF A;  4FVM A;  2Q31 A;  4H4O A;  3T69 A;  2OPR A;  2YKM A;  3U3Y A;  4NYF A;  4B9U A;  5EU7 A;  3V9S A;  3HRG A;  1UA0 A;  3CCJ N;  4JKG B;  3V9X A;  1HKC A;  4MDA A;  1VK0 A;  1NGF A;  4YFU A;  3V1R A;  1T3V A;  3LP2 A;  2PY5 A;  4KI6 A;  3AGK A;  4B9V A;  3HO1 A;  4HTL A;  2YJE A;  1N6Q A;  4H0V B;  5HOO A;  4IEI A;  1SUQ A;  4JKB A;  3ENB A;  4DTJ A;  3P39 A;  1RT4 A;  2GWK A;  2IGI A;  1KLN A;  5BN9 A;  3O5B A;  1EWQ A;  3DXM B;  5C2F A;  3IS9 A;  1NBW A;  4CHN A;  1ATS A;  2HNY A;  4DKW A;  1N33 K;  4BGB A;  3QO9 A;  4CF1 A;  5AZI B;  4JK9 A;  1GOC A;  4N41 A;  1VQO N;  3SUQ A;  4I6M B;  2HHW A;  3VQ8 A;  4PQU A;  3U9Z A;  4F8R A;  1GLC G;  4FLZ A;  4FZX C;  5KGW A;  4B9T A;  4B3S K;  4OKE A;  1DTT A;  5KI6 A;  1L3V A;  3IRX A;  3LP3 A;  2YNH A;  1NJX A;  1CZ9 A;  3WT0 A;  1NK0 A;  1TV6 A;  3KLG A;  2KZM A;  3CCS N;  1WSE A;  2IVP A;  2Y1J A;  3WNE A;  1T8E A;  4BWJ A;  2YHB A;  1C0F A;  2E4L A;  3OVN A;  4HWI A;  3OYA A;  4CHP A;  4FJ7 A;  4O4G A;  4OPA A;  4KFB A;  4DV2 K;  3GL1 A;  2HF3 A;  1OH8 A;  3CC2 N;  3K9K A;  4IBN A;  3AA2 A;  4N56 A;  1JLQ A;  5E26 A;  4CZF A;  4B1Z A;  3MN5 A;  4FJI A;  1F21 A;  2QW9 A;  3SNN A;  3NFA A;  5JS2 A;  3VA3 A;  1TKD A;  2OZS A;  1XHZ A;  1L3T A;  3QLH A;  3QEV A;  3HM9 A;  4KHQ A;  4MO4 A;  3FZM A;  4GNI A;  4H5W A;  1YAG A;  3O9S A;  4BRD A;  5C25 A;  1T44 A;  4GMJ B;  3RTV A;  4X64 K;  4WFA L;  2P9K B;  3DRP A;  3VOV A; 
#chains in the Genus database with same CATH homology
 4V19 S;  4X65 K;  4B3R K;  4DR4 K;  4DUZ K;  4B3M K;  4DV4 K;  4KHP K;  4LF7 K;  5AJ3 K;  5LL6 Z;  4LFA K;  5IWA K;  4DR6 K;  4DV5 K;  3JAM O;  5BR8 K;  4AQY K;  4DR7 K;  1HNZ K;  4LFC K;  1XNQ K;  4DV6 K;  1XMO K;  2UU9 K;  4LFB K;  4JYA K;  2UUA K;  1HNX K;  1XMQ K;  4DV0 K;  2ZM6 K;  2E5L K;  4DV7 K;  4NXM K;  3J7Y P;  2VQF K;  3T1Y K;  4DV3 K;  4NXN K;  1N33 K;  1I94 K;  4JI4 K;  1J5E K;  1N34 K;  1FJG K;  2VQE K;  2UXB K;  5IT9 O;  4JI0 K;  4JV5 K;  3J81 O;  5LMU K;  1IBK K;  1N36 K;  4B3S K;  3J80 O;  1XNR K;  4K0K K;  4LF5 K;  4JI6 K;  5LMN K;  5FLX O;  2UUC K;  4JI7 K;  3OTO K;  2UUB K;  4JI2 K;  4DR5 K;  4JI3 K;  4DR1 K;  4B3T K;  5A2Q O;  4JI8 K;  2UXC K;  4JI1 K;  4DV2 K;  4LF6 K;  4LF8 K;  1HNW K;  4YY3 K;  4GKJ K;  4LF9 K;  3J7A P;  1HR0 K;  4LF4 K;  2UXD K;  4YHH K;  4OX9 K;  4DR3 K;  3T1H K;  4GKK K;  4CW7 B;  4JI5 K;  1N32 K;  4DUY K;  4DV1 K;  1IBM K;  4DR2 K;  2HHH K;  2F4V K;  4CVN E;  4X64 K;  4X66 K;  1IBL K;  4X62 K; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...