1N34K

Structure of the thermus thermophilus 30s ribosomal subunit in the presence of codon and crystallographically disordered near-cognate transfer rna anticodon stem-loop mismatched at the first codon position
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
119
structure length
119
Chain Sequence
KRQVASGRAYIHASYNNTIVTITDPDGNPITWSSGGVIGYKGSRKGTPYAAQLAALDAAKKAMAYGMQSVDVIVRGTGAGREQAIRALQASGLQVKSIVDDTPVPHNGCRPKKKFRKAS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Selection of tRNA by the Ribosome Requires a Transition from an Open to a Closed Form
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 16S RIBOSOMAL RNA
total genus 30
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2002-10-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF00411 Ribosomal_S11 Ribosomal protein S11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.80 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribosomal protein S11 1n34K00
4LF5K 2UXBK 4DV2K 4DV4K 4JV5K 4DR1K 1HNWK 4DR2K 4OX9K 1N34K 1IBKK 2UUCK 4KHPK 5A2QO 4YHHK 4LF6K 5IWAK 4LFBK 4JI8K 1XNRK 4CVNE 2HHHK 2VQEK 1N33K 2UUBK 4LF9K 4DR4K 5IT9O 4JI6K 4CW7B 4DV3K 4LF8K 4DR6K 5LMNK 4LFAK 3OTOK 5LL6Z 4NXMK 4LF4K 4K0KK 1XNQK 4X64K 3JAMO 4JI3K 4DR5K 4DV0K 4JI2K 4B3SK 1HR0K 4DV5K 2F4VK 3J81O 5FLXO 4DUYK 3J7YP 2VQFK 4JI7K 2UXDK 2ZM6K 1XMQK 4X62K 4B3TK 4DV1K 4NXNK 1J5EK 4X66K 2UUAK 3J7AP 4DUZK 4AQYK 4JI5K 4JI1K 4DR7K 3T1HK 4JYAK 4X65K 4DV6K 5AJ3K 4YY3K 1N36K 3J80O 4V19S 1FJGK 4GKKK 4DV7K 4B3RK 5BR8K 4B3MK 1IBMK 1I94K 1N32K 4LFCK 3T1YK 4LF7K 4JI4K 4JI0K 2E5LK 4GKJK 2UXCK 2UU9K 1IBLK 1HNXK 1HNZK 1XMOK 5LMUK 4DR3K
chains in the Genus database with same CATH superfamily
3RMBA 3CJ1A 4BE0A 4M3WA 1QSYA 1JLGA 3P38A 1WN7A 3HO1A 4OX9K 3E66A 3CPEA 2Q97A 2W40A 2ZJRL 1RT3A 3OYBA 3CCMN 5LJWA 1C1CA 3QEPA 3RMAA 2FSJA 2J4RA 1HLUA 4FJJA 2PZSA 2JLEA 3THXB 2JGUA 2DTUA 4JI6K 4H0XB 1XC9A 4M7XA 4JK7A 3HPOA 3DLBA 3T1AA 5H1SQ 4AH9A 1NGCA 5LL6Z 4FO0A 4R5PA 5LY3A 3TARA 4JKCA 5HRPA 4F8RA 1NK9A 3JAMO 4Z4EA 3ALYA 3ZX3A 2IIRA 1BL3A 3P31A 2GEMA 1WSEA 1BO5O 2XY7A 4OPAA 3DJCA 1J5OA 2P9UB 4FSVA 3VOVA 1K8KB 4CBUA 3VQ6A 4JI7K 5GAEP 3FZMA 1VSDA 1VRUA 1WSHA 1J5EK 4M3ZA 4DUZK 4JI5K 4A5AA 4CZFA 1RT4A 3MX2A 3CQYA 4BACA 4RCHA 3VQDA 1Z26A 2HVHA 1TYQB 4DTPA 5CE3A 3QB0A 4O5FA 3NBPA 5KPRA 4CZMA 1IKVA 3QEWA 4CGDA 3VEXA 1SL1A 3LDOA 2YJFA 1J9AA 3O4QA 4KTZA 1EWRA 2HNYA 3OYFA 1W9HA 2E2QA 4DFPA 3AV9A 3NHGA 3W0LA 4M41A 1UWBA 1T03A 1G15A 3O9UA 3BDPA 3ZSWA 4BG8A 1IG9A 2Y1IA 1IO2A 3RRHA 1C0TA 5LMUK 5HP1A 4BG9A 4RTFD 1A5VA 2YNHA 4Z4IA 4JLHA 3AVCA 5FRMA 1HNWK 4CEEA 2GTDA 2VG5A 3K5OA 4C1NK 3VQCA 4ISFA 3D45A 1GLFO 1N33K 4KH4A 2NLXA 2CGKA 3TWHA 3VGLA 1TAUA 3K57A 4BGBA 4DR4K 4CW7B 4E7LA 1V4TA 1S5JA 4KFBA 3OTOK 3K59A 4BRQA 1NU0A 4NXMK 1RBSA 2B6AA 5HRRA 4CGJA 2YHAA 5C0YA 1EX4A 1BHLA 4PKIA 4CJPA 2ZF5O 1TV6A 1HKGA 3WNGA 4XEIA 4FWMA 3QBXA 1Q18A 1VQPN 1IKYA 2FSNA 1WUAA 2RE2A 5JS1A 2DFFA 1TGOA 1HYZA 2E2PA 4PQUA 3VA0A 1NOZA 2HHSA 2VQFK 3TR8A 4ILHA 4Q5VA 3EE9A 5I42A 2V52B 4YDUA 1Q7YO 5KPTA 5E84A 3ZETA 2YCHA 2O8FA 4CI6A 4CIFA 5HBMA 5AQXA 3T1HK 4JYAK 1O1WA 1JL2A 1EKEA 4M7YA 3KK1A 4Z4GA 3FZKA 3LPTA 1HX1A 5B8HA 4IEEA 4K8XA 3JYTA 1KAZA 5KRSA 2FBTA 4DF8A 1YTUA 2GBZA 3CC7N 1T44A 3ZSVA 4EFHA 1YJNN 3CMEN 1GLJO 5KI6A 4CFAA 4W5QA 2VWJA 3DLEA 5ELZA 4FWSA 1VQ7N 5CYQA 4L8RB 3RWUA 4GKJK 4O8UA 3SUPA 2BH1A 2O8EB 2DFEA 2LSNA 2ZGYA 5FPNA 1TK0A 3AARA 2P9PA 1B9DA 1RDBA 1NK0A 1HNZK 4YOVA 3HZ6A 4H0PA 1KVCA 4OGCA 4N41A 1DLOA 2Q1NA 4FJ5A 5AZIA 1T6CA 3HM9A 1SV5A 3SUNA 4BC5A 4FOIA 3G0ZA 3MDQA 2YJEA 1C0MA 1NK5A 3HRGA 5AQTA 5CR4A 4M63C 3V9SA 3ZX2A 3NAEA 2HBKA 4LF4K 1FXXA 2P9PB 3TTFA 4HVJA 4F2RA 4OPJA 4BR7A 4CIGA 3AO5A 4RW7A 4CJEA 1SKWA 2KFZA 4E19A 3SPYA 1VQ9N 3MN9A 2F4VK 1BA0A 3I0SA 1NKBA 2QW9A 1HNIA 3Q7CA 4CK3A 4MDBA 4B9NA 3EKSA 3AA2A 1XWLA 4GNIA 1VSLA 4DV1K 1QHAA 1JXBA 4QCLA 3WNEA 2P1JA 2IDOA 1VQNN 3NFAA 3M8QA 4BRHA 3V9UA 1S1XA 3HK2A 3HJFA 1XC3A 1C0GA 1LCUA 2X6NA 4N76A 5AZJB 1JLEA 4JKEA 1QHTA 1S22A 4GMJB 3ZSYA 1TYQA 2EHGA 4Y1CA 1REVA 2D0OA 3TAEA 2E4LA 1RT5A 3U9ZA 3CJBA 1SL0A 2XRIA 2O8CB 1QVGM 4I7FA 1YAGA 3U9DA 5TKWA 4YOUA 3OA9A 1IV0A 4CJFA 3S41A 4BR2A 2JWLA 4AHUA 4MO4A 2QXLA 5J2MA 1T8EA 1XMOK 3AGKA 3VQQA 4DTNA 3KD1E 4OPHA 3C0BA 1S1VA 1RT7A 4U7BA 3ZSXA 4C23A 3K2PA 4FK2A 1S1TA 4CHNA 5MLCQ 1IBKK 4XIUA 2AJQA 3IFRA 3ZT2A 2UYTA 1ZC6A 4NCBA 3AA5X 1XNRK 1QSSA 2QI2A 2FBVA 5AR0A 3LP3A 4JRPA 2E20A 4MLEA 3DYAA 3EZ5A 2WOMA 4DSJA 3VGMA 4E1JA 3U8XA 4CEFA 4BRFA 3GDQA 3CIPA 1KQSM 4OGEA 1SAZA 2ASPA 3MX5A 3KK2A 4CEAA 4DSFA 4HHTA 3QEIA 1HUXA 2NRHA 2HHTA 4CD3A 4G9ZA 2F7TA 3ZT1A 4N5SA 4GW6A 3S9HA 5AQSA 4CEBA 2A6AA 1HR0K 3WXKA 3SQ0A 5CZ1A 3VEWA 3ZT3A 3AVIA 4MFBA 2PFUA 1OH7A 1C6VA 3WNHA 4FLVA 3CG7A 2KW4A 5TKYA 1WNSA 1OVYA 3AA3A 1BGXT 3MWTA 3KZBA 4CJUA 5GAHP 1WLJA 1HKBA 4WFAL 1BI4A 3NMUA 3DLHA 1SZ2A 3SJJA 3LAKA 4YDUC 1U4BA 3IKMA 2QEXN 4AHCA 1TUYA 5HRSA 4I9QA 4PHTX 2OPQA 1D8YA 4OO1J 3SAGA 3H46O 4JRQA 3D7EO 2VGNA 2O4IA 3OJSA 2Q2RA 4IBNA 4OKJA 4DU4A 4E7HA 1X1PA 3FGUA 4BRPA 1IBMK 1MA9B 4K41A 3O4NA 1I3AA 2QWOA 3DXMB 5AQRA 3DMJA 5AZIB 2YNGA 2UXCK 3HT3A 1IKWA 1L3UA 4CHQA 3FFKB 1VSIA 1MDUB 3VPZA 1HMVA 3J8AA 3OYEA 3OYKA 5C2FA 4FW2A 3QICA 3C6TA 4CJ5A 1GLCG 3MK6A 1NK7A 5AQMA 5HL7L 2P51A 4OLAA 3LANA 5HROA 2VG7A 4FJNA 3H1QA 2QWRA 2DFHA 3QERA 2NRRA 5GAGP 4KHPK 4FJHA 4KRFA 1RCHA 3E01A 4IOCL 1DGKN 3R6MA 4IXCA 4CF2A 4FVUA 3QIPA 3CI5A 1R59O 1MWKA 5FPEA 5IT9O 4DSKA 3SQ1A 2GX9A 2HSTA 4JKHA 3SBTA 1HJOA 3ULDA 4I2QA 1CZ9A 4C8NA 1YUWA 4X64K 1NGJA 3M8SA 3L4QA 3OYNA 4BY9C 5F2RA 3PIOL 2F8SA 3D2FA 1UOCA 4OVLA 1XQSC 1T05A 3J7YP 5AQJA 1TKZA 1QQNA 4O0JA 3MXJA 4ISEA 2Q31A 4A57A 3CYMA 3ULEB 1SS6A 4NXNK 4FZZA 1RDWX 3L3VA 3LDPA 3LDLA 4DS4A 2Q3SA 2FF6A 4H5TA 1F21A 4JKFA 4FJMA 4CK1A 2E6MA 1YT3A 4IO9L 2H3GX 2QKBA 2G8VA 4MLHA 3VEOA 5DM6L 4DTJA 1ZBIA 4DHYA 4CZJA 5SZTA 4J2EA 3ID8A 3O3GA 4W5NA 4M3UA 2O8EA 4AILC 5AQOA 2HF3A 3I55N 3D6RA 4LSNA 4KKOA 4DF4A 3R8EA 4DQ8A 3QEVA 3O1BA 3BY5A 4FK0A 2DY4A 1FW6A 4NLBA 4CERA 4HTUA 2IC3A 1DKGD 2HW3A 1W7AA 3HOSA 1S9EA 5ADXH 3ASMA 4BR9A 1GOBA 5ADXA 3WXMB 2OCEA 4IZ9A 4IJNA 3NF8A 4EP4A 3MEDA 3CQ8A 4F9OA 1NMNA 4BR0A 5AQLA 1KFDA 1RDAA 4MDAA 5AQHA 3AVAA 4WFNL 4CD1A 3M1FA 4K25A 3HL8A 3LAMA 4CZKA 3ZX0A 5EOYA 2P9LB 2OTJN 1BIUA 1SL2A 1NGDA 3UKRA 3D2EB 4O8KA 4JI8K 2EWSA 3CQXA 1VRTA 3Q7BA 4YOXA 2VQEK 4PA1A 3F73A 3SV4A 2ITGA 4LF9K 1QS4A 4EHUA 2BANA 2OPPA 4DSIA 4BRDA 3AY9A 1D9DA 1WSGA 4YFUA 3DLRA 4FWLA 4KH5A 2IOCA 1KD1O 3MAQA 3L2RA 3JSMA 4IG0A 3ITHA 4LC9B 3BEXA 3IS9A 1BCOA 1JLAA 5EXWA 4CJ3A 5F1XA 4F3TA 3LP2A 1HQEA 3CERA 4DV0K 2WBNA 4CF0A 3HYFA 4H4OA 3O80A 4DSLA 3LZIA 3VF4A 2QK9A 2XY5A 4CGGA 1YXQA 3WUHA 2V51B 3JXUA 5GADP 3HVTA 3SNNA 3ISNC 3OJUA 3ZSQA 4BGAA 3WNFA 3HTVA 3QIOA 3NVMA 3PV8A 1LWEA 3NVKA 4BRKA 3WEEB 2BE2A 1OVQA 3KLGA 4BR4A 4KTQA 1W0HA 2E88A 3O1WA 4DFJA 4C8OA 5J2NA 4O4GA 3S3MA 3GOIA 2NRWA 4WQ5A 4BRMA 3CFRA 1NG9A 5FPMA 2G8FA 2E2OA 4M45A 3RSEA 4B1VA 3C7NB 1VK0A 5CZ2A 4H5VA 1NK4A 4FLYA 2VG6A 2HF4A 3NDKA 2KFNA 4CFDA 2RHKA 4JKDA 3PSFA 5K14A 3F5TA 4U67L 4W5RA 3DXKA 2VCPA 3H45C 3O4WA 3P83D 3LPUA 4KHUA 1NM1A 2O8FB 3TU5A 1MU2A 4CE9A 4JHDA 3PX4A 1HPMA 5C2DA 3KKSA 1X3MA 3KLFA 3K5LA 4AHTA 3MN5A 4HCCA 1E3MA 5HOOA 3OS2A 1E4GT 4ILGB 1K8AO 1Y97A 4DV4K 1NLVA 4BC2A 1ZBFA 4BRGA 4DR1K 3EE8A 2D4WA 3AAQA 3ATUA 3UKUB 1N5YA 1TL3A 1RBRA 3O9RA 4DU1A 4FJXA 5D3GA 4WQ4C 1BA1A 2A3ZA 3D2FB 5J2QA 4CHZA 2RN2A 5KTQA 3CCLN 3I56N 1L3VA 5EY4A 1UA1A 2A42A 4B1WB 4FWRA 2YKMA 3EZWA 4KHYA 5KRTA 4DV5K 3MXMA 4DQQA 3HVRA 3OY9A 1HRHA 1KAYA 4CF1A 3W3DA 3BZKA 1L3TA 4H8KA 3L2VA 2QXFA 1BUPA 2P9SB 4R79A 3CJAA 2W42A 3SAHA 2X74A 4BE1A 3BUZB 3K0SA 4IFVA 1JLCA 4F3OA 1JLFA 4GV9A 3L0QA 4CZGA 2P9IA 3F9MA 4BR5A 3THXA 1S9GA 3V9XA 1KRPA 1GLLO 4NCAA 2YI1A 3MCPA 2Z1IA 4B1ZA 3HSCA 2R7YA 1YF5L 4E0DA 3MWPA 5C15A 5BR8K 3WXLA 2GUIA 4GVMA 4H03B 5CY4A 4BQLA 2XHBA 3NH1A 5BR9A 3OBWA 3PLAA 3ZT0A 4KHWA 1GOCA 3QFPA 4KH6A 1WB9A 3SV3A 3M5RA 1UAXA 5LJVA 4Z4CA 4BRIA 4A2AA 3ULEA 5AQQA 4LF5K 2HBLA 3GL1A 3CFOA 4Y0WA 3AO3A 4M42A 3A5OC 5JLHA 1YVNA 3E9OA 1TKTA 4BE2A 1WSIA 4BDYA 2QWQA 4PL8A 3VA3A 3MCAB 3K58A 3L4IA 4LY7A 3CJ9A 2HB5A 1NK6A 5LMNK 4IJAA 3HI0A 4LFAK 1NGIA 5SWMA 2XY8A 2Z1GA 4JI3K 3AVKA 1N6QA 5JLFA 4B3SK 3IG1A 5DMRA 5AQUA 4O5BA 4DCHA 4G1QA 5M1OA 1JLQA 4GV6A 1YJWN 4K42A 2BGGA 5AFUA 1ATSA 3E1YA 1QVFM 1ZBUA 1ASVA 1MWMA 2ZQBA 3DLKA 4E1MA 2O8BA 1BU6O 2NUBA 3QINA 3OS1A 5CYMA 4QS9A 4CEOA 1KAXA 1TVRA 3J80O 3TPQA 2F8TA 5JS2A 1Z25A 4KPYA 4PY5A 1GLBG 1EWQA 1VAZA 2KTQA 1CXQA 4BRAA 3KLHA 4B3RK 1CZBA 4I6MB 3NF9A 3N4QA 4KV8A 5JVHL 1U6ZA 3QLHA 4H5RA 4DB3A 5C42A 5BN9A 3THYA 5AQIA 4KI4A 2UU9K 4IOXA 3RSEB 3SJHA 2E1ZA 2G8HA 4YNQA 5FPDA 1HNXK 3WT0A 1YTAA 3V1RA 3THVA 2WFBA 1Y64A 1FK9A 2A1SA 4A5BA 4WCEL 3EYZA 1KVAA 3OYCA 1K73O 1TUUA 1HPZA 3L6QA 1IJJA 1S72N 5JMVA 2GV9A 4KAZA 1D9FA 1NBWA 4LFBK 5FRNA 1VSJA 2YHYA 5C24A 4JKGB 2QM1A 2AA4A 4CJ7A 1RTJA 4KB1A 4CJVA 4ILJA 3VESA 1JJ2M 2ZE2A 1LW0A 5J2PA 1NK8A 4IOAL 3I8DA 1TKXA 4IFYA 2VYPA 1IG8A 4B8AB 4DSEA 4B3OA 1M90O 1XNQK 1ATNA 1JLBA 3ZLJA 1VSHA 4DTMA 3ZSOA 3P39A 3OYDA 2Y1JA 1YITN 2HHXA 3SUOA 3HOTA 1NGEA 3KLEA 3CM6A 4FZYA 4ID1A 4RWTA 3GBTA 3BP8A 1S6QA 2OTLN 4X62K 4DQRA 3V81A 3I8BA 4RW6A 4X66K 4FL9A 3CJCA 2E8AA 5F0XA 3K9JA 1S3XA 3TAGA 2QA4N 1RT6A 5AQKA 4DG1A 4FWNA 1NJIO 3KWIA 4DFMA 1J53A 1XUPO 1GLEG 1A5WA 5AJ3K 4BWJA 5BRFA 3V9WA 5J1EA 4YY3K 2I5JA 2CGLA 1SUQA 3SZ2A 5E26A 3LZJA 3NCIA 2OA8A 3CD6N 1VSEA 3DXMA 5E41A 3U6FA 4CHYA 3OYMA 1I39A 1QZ6A 2KHOA 4WF9L 4KO0A 1KC8O 2E5LK 1RDDA 4CJLA 4XH1A 1NGAA 2A41A 3K9KA 4KHNA 1WSJA 1EO1A 3QEXA 4FWKA 5JICA 5C12A 3RR7A 1S1WA 1W97L 3HP9A 4BDZA 4FJIA 1LWFA 3VF6A 3OHRA 4CJ4A 4JV5K 3LDSA 4ELVA 4DR2K 4BDPA 2CH6A 5KPZA 2UUCK 2CH5A 4K43A 3MEGA 2YNIA 2P9NA 1U45A 5AZJA 4CJTA 1EXQA 3O5BA 2HHHK 2UUBK 3ID6A 4CEZA 2OYQA 1E4FT 2WC9A 3QFUA 3U4LA 3KJVA 3L8BA 3OW2M 1KSPA 1NNEA 1M1KO 1EETA 1TKDA 3MMVA 5FROA 4IFEA 3CCEN 3IDHA 1QQMA 1SKRA 1NGBA 1W2BM 3C6UA 4LH5A 2ATQA 4DR5K 4Z0UA 4GVEA 4DTSA 5FLXO 4CGFA 4B8CA 2DPNA 3C6AA 3MEEA 3OVNA 2KQ2A 4BVPA 3L2WA 1X9JA 2ITMA 1HYVA 4BWMA 5C25A 3TTCA 1C0FA 1KFSA 2VWBA 3FZLA 2AP1A 2EX3A 4JKAA 4NO7A 3WQTA 5M1PA 4YORA 1KLMA 2NZTA 4DS5A 5AQYA 4YOTA 3SYZA 3SK3A 2JWKA 4XH5A 3PUFA 1YI2N 1U48A 1Q86O 2FLOA 1DTTA 4B1YB 2ASMA 2A40A 2WONA 1N36K 2ZD1A 1NWKA 4V19S 2OANA 1K8KA 3E9LA 2OPSA 3OYGA 2X6SA 1TK5A 3EN9A 4OKEA 3QNOA 3A8YA 3T19A 5T7BA 4JI4K 2F9TA 2W6LA 4JS5A 1JKHA 3DLGA 3KIOA 4DTUA 2ZGZA 1VQLN 4GY2B 2P5OA 1RBTA 4M3XA 3LWLA 2WUSA 4AM7A 2I7PA 3E9PA 3ZT4A 3VGKA 4FM1A 1S6PA 3MN7A 1P8ZA 1WOQA 1ASUA 3EEQA 3PSIA 5DM7L 1Q81O 1NKCA 1VQ5N 5I9EB 4B9SA 4BC3A 3SQ4A 5GIPA 2ASOA 4BRNA 3FLCO 1HKCA 1RDUA 3LL3A 3UB5A 3P4IA 3VEVA 5AQWA 4ISGA 2E1YA 2PAVA 3O9TA 4IG3A 4K0KK 1GLDG 2HHWA 3A5LC 3OYJA 4DKWA 4AM6A 1OH6A 4CF9A 1C0UA 3CCRN 3D2EA 3TTDA 4WQ4A 3B6PA 5AQNA 3NE6A 1RBVA 4WFBL 3THWA 4FJGA 3UE5A 4H0TB 3G10A 3G4SN 2GUPA 3BZCA 2HVIA 4QAGA 1YJ9N 2UUAK 3PX6A 4CZIA 5DK5A 3TSUA 4IKFA 3RVCA 3SMSA 3DRPA 4OLBA 1DT9A 4W5OA 1ZBLA 3CPWM 4DV6K 2IS3A 4DTXA 3PIPL 4PKGA 3KK3A 5BRHA 4C8MA 5KQ8A 4O0IA 2YV0X 4CGIA 2HHQA 1ZXOA 4QOZB 3P1GA 1UA0A 1FJGK 3KK7A 2PYJA 1A5XA 4FK4A 4IDKA 3TSQA 3VENA 1N32K 1DTQA 3WEEA 3ZETB 3DRRA 2P9IB 3RMCA 4FJ8A 3DAWA 4BROA 4C8KA 3SUQA 3RTVA 1VHXA 2ZJQL 3BF1A 4FLTA 4H5NA 4DR3K 3VF2A 2D0PA 3DOKA 1NJYA 2W6KA 4M3YA 3L3UA 1OH5A 1WAJA 3KHYA 3G6EN 4DFKA 3LM2A 3AVNA 3KWGA 5BPNA 3IAYA 1EP4A 2BUPA 3R3LA 4LH4A 4HTLA 3A0IX 4CJQA 3K5MA 4KBOA 2QKKA 1ATRA 2NRTA 2D1KA 3J7ZO 1QTMA 1D4XA 4BRLA 3IUCA 2P9UA 5JVGL 4DLGA 4BVOA 1NGHA 3NGYA 3T3FA 2HHVA 3TANA 4B1XB 1LV5A 4H0VB 4CZLA 3ZCMA 2E6LA 3T69A 2PYLA 2Q0UA 4FW1A 4EP5A 4LSLA 4DUYK 3T7ZA 4B1UB 4DQSA 2V7YA 4CJKA 3V9ZA 4OPKA 2HOEA 4KTWA 3CF5L 4EZ6A 3ATVA 4PL7A 3GE1A 3FFIA 4BRCA 4DMNA 2UXDK 2NRXA 1Q82O 4NYNA 4B3TK 3O08A 1TK8A 2ZJPL 2IVNA 3QNNA 1RGIA 1OKJA 4JI1K 3TAPA 3AO2A 2RKIA 2Z1JA 2F9WA 3O8MA 3I0RA 3V6DA 3EKUA 2BDPA 4FWQA 4HCBA 3EY1A 3V4IA 1JXEA 1YVUA 4CJSA 4EIAA 3P5JA 1VQKN 1TAQA 1QZ5A 3WXJA 1LAWA 2BTFA 1ZBHA 3K5NA 3CC2N 4CHPA 1H1VA 4F4KA 5AQZA 1HYSA 1IH7A 5KGWA 4FWOA 1I94K 2OZSA 4F2SA 4LFCK 3FZHA 3O6WA 3QO9A 4IO8A 4HWIA 3ENOA 2O8BB 3CCSN 3KKRA 4CEQA 4B9TA 2V7ZA 1ESVA 4OKKA 5AQVA 3S3NA 4C1NI 3DLLL 2HBJA 3CMAN 3LP1A 3V1QA 4E7IA 3AVJA 3CCJN 3CXCM 1NGFA 1BQMA 4FPBA 3OS0A 3VQ4A 1Q8IA 5C10A 3EL2A 3N4PA 4YHHK 3G25A 5IWAK 3VETA 5BPMA 4JK8A 4NLCA 2NRVA 3ZSRA 3LWMA 4H4MA 4YOWA 4CHOA 4CBXA 1R0AA 3SAFA 4HUEA 1Z05A 1RILA 4DV3K 4M3TA 3BGRA 4DR6K 1XHZA 4E3SA 3HPGA 3DM2A 2KZMA 1JCFA 3KTQA 3SCXA 2O8DA 1O13A 4FWPA 5BREA 1XI1A 1VSFA 3J81O 1NJWA 1RTDA 4HUFA 2G8WA 1WBDA 2QWNA 4I6MA 4JK9A 1TL1A 4A62A 4B9MA 4HUGA 1X9MA 2D0AA 4ID5A 2XY6A 1NGGA 4UQGA 1Z6RA 1BCMA 4CF8A 1QSLA 5FDLA 4FM2A 3NF7A 5M1QA 3VQBA 3THYB 3VERA 3CFPA 1ASWA 2GWJA 2YX6A 3ENHA 3UKUA 3R1XA 4FM0A 3AVMA 3LDQA 2Q0RA 2HMIA 2YHBA 1VSMA 3H3OB 4CZEA 3TABA 2O4GA 3DXKB 1CZAN 1IKXA 3OYAA 4E1NA 5BPLA 3G71N 4AHRA 4FJLA 5EVZA 3KD5E 3VQ5A 3NGIA 1QQOA 3VQPA 4JKBA 4BREA 3WQUA 3M3ZA 1Q9YA 3O9QA 1BISA 2FF3B 1RTIA 2YHXA 3DOLA 3C65A 4DU3A 4RG8A 1V4SA 4KB0A 3VTHA 4MQ3A 3RR8A 3LP0A 2HMPA 3GG4A 4JI0K 3C7NA 4DQIA 1EQYA 2OPRA 4I2PA 3AO4A 4Y1DA 4CECA 4PUOA 3F2KA 4N47A 3TAMA 1YIJN 4WQ5C 4JD2A 3M6GA 1LWCA 1RT1A 2YKNA 2YNFA 3AVFA 1ILYA 4QS7A 3A5NC 1ZBSA 3MN6A 5KQDA 4B08A 3H3NO 1CXUA 4FPAA 4CEDA 5BN8A 3TAFA 1LW2A 1HQUA 3NF6A 4CVNE 3O3HA 2W41A 3SBGA 4FJ7A 4B9UA 2FBYA 1D5AA 3A2FA 2ETJA 3C94A 1BG3A 4IDHA 3FR0A 2YHWA 4K8ZA 5M1NA 5HRNA 4NB4A 1ZYQA 1L5UA 2VWKA 1VQ6N 1FKPA 3H08A 1KXPA 1WSFA 2IVPA 3KVGA 4B9QA 3OBYA 5KGXA 4FXDA 1DEJA 1T6DA 4NYFA 1BI4B 3PO5A 4AF1A 3DI6A 5HLFA 1VQ8N 3DWLA 4RW9A 4DTOA 4Q0BA 1XMQK 3MXIA 5AQPA 3H6EA 3TSPA 4CESA 5M1FA 1G99A 2G8UA 3TI0A 2P9SA 2G8IA 4DWIA 4PWDA 4JAXA 3S3OA 3IRXA 2A1RA 2ZWHA 1T7PA 4FYDA 2XO7A 2X78A 4GV3A 4CFBA 2RF2A 4WE1A 4CIEA 3L2QA 3AVBA 4FVMA 1VQMN 4IWVA 3VEZA 3QETA 4DV7K 4GKKK 1SKSA 1J54A 4YOYA 4RW4A 4ZTFA 3PO4A 4E7JA 5BRDA 3CM5A 2E2NA 4FCYA 4WYBA 5EU7A 3UIQA 4XH4A 3VTIA 2P9KA 4DLEA 4KHQA 2KZZA 3SMPA 1U2VB 3CETA 4RW8A 3ZYYX 2A5XA 3C6HA 1VQ4N 3PX0A 1NJZA 4FOEA 3NH2A 3VN5A 3SLCA 1KTQA 4CZHA 3MECA 4O44A 3U3GA 2FSKA 1BWFO 4A61A 4EZ9A 4FLZA 3QDKA 4E89A 2WTUA 2Z1HA 3M8PA 1N34K 1B92A 5A2QO 3NGZA 2D0BA 3SQ2A 4EHTA 2GELA 4B9VA 3B8AX 2FC0A 4UY8O 1T3VA 3FZFA 1K9MO 4CK2A 4H0OA 4JNEA 4ZHRA 4LF8K 1QQCA 3I33A 2HNZA 4BQZA 2PBDA 4DTRA 2NNWA 1C1BA 3VEYA 4ELUA 3VMFB 3CCQN 1JCEA 2QWMA 5GINA 2KLAA 2QWLA 3ENBA 3EO3A 2VGMA 1BQNA 3CHWA 4CJWA 4ICLA 2HBMA 1U47A 3AA4A 3HSTB 4TSXA 3AVLA 3LALA 4M3RA 2QWPA 3B6OA 2ZM6K 1RFQA 4CBWA 3OYHA 3SI6A 3KLIA 1VSKA 1Q9XA 3VQ9A 3D0PA 2GWKA 2P9KB 4KHSA 1GOAA 3C95A 3J7AP 4AQYK 1BDGA 1FKOA 2O8CA 2G8KA 2QTDA 3VQ7A 3OYLA 3ZSZA 3HP6A 4FJKA 3VQAA 3L2UA 2IGIA 3FE1A 1N8RO 1NJXA 3CJ7A 3RRGA 4FLWA 4DQPA 4B3MK 4LD0A 4FJ9A 3T1YK 2Q36A 2CGJA 5I3UA 4A59A 4O55A 2OZMA 3M8RA 2KKZA 4FZXC 2NRZA 4NCGA 4CFCA 3HXMA 1SQKA 3HPHA 5M1KA 1U49A 1WAFA 3UKRB 4EAHD 4BC4A 1S1UA 4CJRA 4JI2K 3QMLA 3O9SA 4MO5A 5AQFA 2UXBK 4J8FA 1WBBA 1P90A 4W5TA 1VQON 2P5GA 4H0YB 4DV2K 1KLNA 1X9WA 4FLXA 3AAPA 3R9PA 3CC4N 2O8DB 4C8LA 4LF6K 3U3YA 2FBXA 1ITGA 4JS4A 2B5JA 1JL1A 4I9LA 4Z4HA 5GIOA 1HJRA 1J6ZA 1JCGA 3ZEUB 4E7KA 4KI6A 3NH0A 3HM8A 3CCUN 4JKGA 3AVGA 2IVOA 3HBTA 3V1OA 4J2DA 2P9NB 1NMDA 3TAQA 3AGRA 4J2BA 1K6YA 2HHUA 1U04A 4A2BA 1KVBA 2FXUA 1B9FA 3F9KA 1LOTB 3AO1A 5EX5A 2I7NA 4FLUA 1OH8A 2RPIA 4AHSA 3OYIA 3PY8A 1YHQN 3QESA 4IEIA 1XHXA 5AQGA 1HNVA 4JEPA 1BIZA 1RNHA 1RTHA 3CCVN 3VQEA 4ELTA 3A5MC 3AVHA 2F96A 3VQ8A 5CHIA 3LM9A 4PKHA 4CGHA 4B9LA 4H5WA 4DR7K 2D5RA 3JS6A 2D0CA 4N56A 4KREA 1CLQA 3BF3A 4X65K 1BOTO 4AHVA 3THWB 4CCHA 2IAJA 3DRSA 4Z94A 4OJRA 1NOYA 2HNDA 3IMXA 3O3FA 3QBWA 4ZTJA 1U2VA 4JHDB 1RT2A 4L3QA 3RMDA 3SPZA 1C1AA 3LDNA 4JD2B 1QE1A 4JN4A 1LAVA 1RDCA 2P9LA 3H1VX 4LF7K 1NKEA 3ZEUA 1GLAG 4J2AA 4QS8A 2PY5A 1X9SA 1RBUA 1KCFA 1X3NA 5AFUH 3WXIA 4Z4FA 1IBLK 1L3SA 2B4JA
chains in the Genus database with same CATH topology
4LF5K 2UXBK 4DV2K 4DV4K 4JV5K 4DR1K 1HNWK 4DR2K 4OX9K 1N34K 1IBKK 2UUCK 4KHPK 5A2QO 4YHHK 4LF6K 5IWAK 4LFBK 4JI8K 1XNRK 4CVNE 2HHHK 2VQEK 1N33K 2UUBK 4LF9K 4DR4K 5IT9O 4JI6K 4CW7B 4DV3K 4LF8K 4DR6K 5LMNK 4LFAK 3OTOK 5LL6Z 4NXMK 4LF4K 4K0KK 1XNQK 4X64K 3JAMO 4JI3K 4DR5K 4DV0K 4JI2K 4B3SK 1HR0K 4DV5K 2F4VK 3J81O 5FLXO 4DUYK 3J7YP 2VQFK 4JI7K 2UXDK 2ZM6K 1XMQK 4X62K 4B3TK 4DV1K 4NXNK 1J5EK 4X66K 2UUAK 3J7AP 4DUZK 4AQYK 4JI5K 4JI1K 4DR7K 3T1HK 4JYAK 4X65K 4DV6K 5AJ3K 4YY3K 1N36K 3J80O 4V19S 1FJGK 4GKKK 4DV7K 4B3RK 5BR8K 4B3MK 1IBMK 1I94K 1N32K 4LFCK 3T1YK 4LF7K 4JI4K 4JI0K 2E5LK 4GKJK 2UXCK 2UU9K 1IBLK 1HNXK 1HNZK 1XMOK 5LMUK 4DR3K
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4LF5 K;  2UXB K;  4DV2 K;  4DV4 K;  4JV5 K;  4DR1 K;  1HNW K;  4DR2 K;  4OX9 K;  1N34 K;  1IBK K;  2UUC K;  4KHP K;  5A2Q O;  4YHH K;  4LF6 K;  5IWA K;  4LFB K;  4JI8 K;  1XNR K;  4CVN E;  2HHH K;  2VQE K;  1N33 K;  2UUB K;  4LF9 K;  4DR4 K;  5IT9 O;  4JI6 K;  4CW7 B;  4DV3 K;  4LF8 K;  4DR6 K;  5LMN K;  4LFA K;  3OTO K;  5LL6 Z;  4NXM K;  4LF4 K;  4K0K K;  1XNQ K;  4X64 K;  3JAM O;  4JI3 K;  4DR5 K;  4DV0 K;  4JI2 K;  4B3S K;  1HR0 K;  4DV5 K;  2F4V K;  3J81 O;  5FLX O;  4DUY K;  3J7Y P;  2VQF K;  4JI7 K;  2UXD K;  2ZM6 K;  1XMQ K;  4X62 K;  4B3T K;  4DV1 K;  4NXN K;  1J5E K;  4X66 K;  2UUA K;  3J7A P;  4DUZ K;  4AQY K;  4JI5 K;  4JI1 K;  4DR7 K;  3T1H K;  4JYA K;  4X65 K;  4DV6 K;  5AJ3 K;  4YY3 K;  1N36 K;  3J80 O;  4V19 S;  1FJG K;  4GKK K;  4DV7 K;  4B3R K;  5BR8 K;  4B3M K;  1IBM K;  1I94 K;  1N32 K;  4LFC K;  3T1Y K;  4LF7 K;  4JI4 K;  4JI0 K;  2E5L K;  4GKJ K;  2UXC K;  2UU9 K;  1IBL K;  1HNX K;  1HNZ K;  1XMO K;  5LMU K;  4DR3 K; 
#chains in the Genus database with same CATH topology
 3RMB A;  3CJ1 A;  4BE0 A;  4M3W A;  1QSY A;  1JLG A;  3P38 A;  1WN7 A;  3HO1 A;  4OX9 K;  3E66 A;  3CPE A;  2Q97 A;  2W40 A;  2ZJR L;  1RT3 A;  3OYB A;  3CCM N;  5LJW A;  1C1C A;  3QEP A;  3RMA A;  2FSJ A;  2J4R A;  1HLU A;  4FJJ A;  2PZS A;  2JLE A;  3THX B;  2JGU A;  2DTU A;  4JI6 K;  4H0X B;  1XC9 A;  4M7X A;  4JK7 A;  3HPO A;  3DLB A;  3T1A A;  5H1S Q;  4AH9 A;  1NGC A;  5LL6 Z;  4FO0 A;  4R5P A;  5LY3 A;  3TAR A;  4JKC A;  5HRP A;  4F8R A;  1NK9 A;  3JAM O;  4Z4E A;  3ALY A;  3ZX3 A;  2IIR A;  1BL3 A;  3P31 A;  2GEM A;  1WSE A;  1BO5 O;  2XY7 A;  4OPA A;  3DJC A;  1J5O A;  2P9U B;  4FSV A;  3VOV A;  1K8K B;  4CBU A;  3VQ6 A;  4JI7 K;  5GAE P;  3FZM A;  1VSD A;  1VRU A;  1WSH A;  1J5E K;  4M3Z A;  4DUZ K;  4JI5 K;  4A5A A;  4CZF A;  1RT4 A;  3MX2 A;  3CQY A;  4BAC A;  4RCH A;  3VQD A;  1Z26 A;  2HVH A;  1TYQ B;  4DTP A;  5CE3 A;  3QB0 A;  4O5F A;  3NBP A;  5KPR A;  4CZM A;  1IKV A;  3QEW A;  4CGD A;  3VEX A;  1SL1 A;  3LDO A;  2YJF A;  1J9A A;  3O4Q A;  4KTZ A;  1EWR A;  2HNY A;  3OYF A;  1W9H A;  2E2Q A;  4DFP A;  3AV9 A;  3NHG A;  3W0L A;  4M41 A;  1UWB A;  1T03 A;  1G15 A;  3O9U A;  3BDP A;  3ZSW A;  4BG8 A;  1IG9 A;  2Y1I A;  1IO2 A;  3RRH A;  1C0T A;  5LMU K;  5HP1 A;  4BG9 A;  4RTF D;  1A5V A;  2YNH A;  4Z4I A;  4JLH A;  3AVC A;  5FRM A;  1HNW K;  4CEE A;  2GTD A;  2VG5 A;  3K5O A;  4C1N K;  3VQC A;  4ISF A;  3D45 A;  1GLF O;  1N33 K;  4KH4 A;  2NLX A;  2CGK A;  3TWH A;  3VGL A;  1TAU A;  3K57 A;  4BGB A;  4DR4 K;  4CW7 B;  4E7L A;  1V4T A;  1S5J A;  4KFB A;  3OTO K;  3K59 A;  4BRQ A;  1NU0 A;  4NXM K;  1RBS A;  2B6A A;  5HRR A;  4CGJ A;  2YHA A;  5C0Y A;  1EX4 A;  1BHL A;  4PKI A;  4CJP A;  2ZF5 O;  1TV6 A;  1HKG A;  3WNG A;  4XEI A;  4FWM A;  3QBX A;  1Q18 A;  1VQP N;  1IKY A;  2FSN A;  1WUA A;  2RE2 A;  5JS1 A;  2DFF A;  1TGO A;  1HYZ A;  2E2P A;  4PQU A;  3VA0 A;  1NOZ A;  2HHS A;  2VQF K;  3TR8 A;  4ILH A;  4Q5V A;  3EE9 A;  5I42 A;  2V52 B;  4YDU A;  1Q7Y O;  5KPT A;  5E84 A;  3ZET A;  2YCH A;  2O8F A;  4CI6 A;  4CIF A;  5HBM A;  5AQX A;  3T1H K;  4JYA K;  1O1W A;  1JL2 A;  1EKE A;  4M7Y A;  3KK1 A;  4Z4G A;  3FZK A;  3LPT A;  1HX1 A;  5B8H A;  4IEE A;  4K8X A;  3JYT A;  1KAZ A;  5KRS A;  2FBT A;  4DF8 A;  1YTU A;  2GBZ A;  3CC7 N;  1T44 A;  3ZSV A;  4EFH A;  1YJN N;  3CME N;  1GLJ O;  5KI6 A;  4CFA A;  4W5Q A;  2VWJ A;  3DLE A;  5ELZ A;  4FWS A;  1VQ7 N;  5CYQ A;  4L8R B;  3RWU A;  4GKJ K;  4O8U A;  3SUP A;  2BH1 A;  2O8E B;  2DFE A;  2LSN A;  2ZGY A;  5FPN A;  1TK0 A;  3AAR A;  2P9P A;  1B9D A;  1RDB A;  1NK0 A;  1HNZ K;  4YOV A;  3HZ6 A;  4H0P A;  1KVC A;  4OGC A;  4N41 A;  1DLO A;  2Q1N A;  4FJ5 A;  5AZI A;  1T6C A;  3HM9 A;  1SV5 A;  3SUN A;  4BC5 A;  4FOI A;  3G0Z A;  3MDQ A;  2YJE A;  1C0M A;  1NK5 A;  3HRG A;  5AQT A;  5CR4 A;  4M63 C;  3V9S A;  3ZX2 A;  3NAE A;  2HBK A;  4LF4 K;  1FXX A;  2P9P B;  3TTF A;  4HVJ A;  4F2R A;  4OPJ A;  4BR7 A;  4CIG A;  3AO5 A;  4RW7 A;  4CJE A;  1SKW A;  2KFZ A;  4E19 A;  3SPY A;  1VQ9 N;  3MN9 A;  2F4V K;  1BA0 A;  3I0S A;  1NKB A;  2QW9 A;  1HNI A;  3Q7C A;  4CK3 A;  4MDB A;  4B9N A;  3EKS A;  3AA2 A;  1XWL A;  4GNI A;  1VSL A;  4DV1 K;  1QHA A;  1JXB A;  4QCL A;  3WNE A;  2P1J A;  2IDO A;  1VQN N;  3NFA A;  3M8Q A;  4BRH A;  3V9U A;  1S1X A;  3HK2 A;  3HJF A;  1XC3 A;  1C0G A;  1LCU A;  2X6N A;  4N76 A;  5AZJ B;  1JLE A;  4JKE A;  1QHT A;  1S22 A;  4GMJ B;  3ZSY A;  1TYQ A;  2EHG A;  4Y1C A;  1REV A;  2D0O A;  3TAE A;  2E4L A;  1RT5 A;  3U9Z A;  3CJB A;  1SL0 A;  2XRI A;  2O8C B;  1QVG M;  4I7F A;  1YAG A;  3U9D A;  5TKW A;  4YOU A;  3OA9 A;  1IV0 A;  4CJF A;  3S41 A;  4BR2 A;  2JWL A;  4AHU A;  4MO4 A;  2QXL A;  5J2M A;  1T8E A;  1XMO K;  3AGK A;  3VQQ A;  4DTN A;  3KD1 E;  4OPH A;  3C0B A;  1S1V A;  1RT7 A;  4U7B A;  3ZSX A;  4C23 A;  3K2P A;  4FK2 A;  1S1T A;  4CHN A;  5MLC Q;  1IBK K;  4XIU A;  2AJQ A;  3IFR A;  3ZT2 A;  2UYT A;  1ZC6 A;  4NCB A;  3AA5 X;  1XNR K;  1QSS A;  2QI2 A;  2FBV A;  5AR0 A;  3LP3 A;  4JRP A;  2E20 A;  4MLE A;  3DYA A;  3EZ5 A;  2WOM A;  4DSJ A;  3VGM A;  4E1J A;  3U8X A;  4CEF A;  4BRF A;  3GDQ A;  3CIP A;  1KQS M;  4OGE A;  1SAZ A;  2ASP A;  3MX5 A;  3KK2 A;  4CEA A;  4DSF A;  4HHT A;  3QEI A;  1HUX A;  2NRH A;  2HHT A;  4CD3 A;  4G9Z A;  2F7T A;  3ZT1 A;  4N5S A;  4GW6 A;  3S9H A;  5AQS A;  4CEB A;  2A6A A;  1HR0 K;  3WXK A;  3SQ0 A;  5CZ1 A;  3VEW A;  3ZT3 A;  3AVI A;  4MFB A;  2PFU A;  1OH7 A;  1C6V A;  3WNH A;  4FLV A;  3CG7 A;  2KW4 A;  5TKY A;  1WNS A;  1OVY A;  3AA3 A;  1BGX T;  3MWT A;  3KZB A;  4CJU A;  5GAH P;  1WLJ A;  1HKB A;  4WFA L;  1BI4 A;  3NMU A;  3DLH A;  1SZ2 A;  3SJJ A;  3LAK A;  4YDU C;  1U4B A;  3IKM A;  2QEX N;  4AHC A;  1TUY A;  5HRS A;  4I9Q A;  4PHT X;  2OPQ A;  1D8Y A;  4OO1 J;  3SAG A;  3H46 O;  4JRQ A;  3D7E O;  2VGN A;  2O4I A;  3OJS A;  2Q2R A;  4IBN A;  4OKJ A;  4DU4 A;  4E7H A;  1X1P A;  3FGU A;  4BRP A;  1IBM K;  1MA9 B;  4K41 A;  3O4N A;  1I3A A;  2QWO A;  3DXM B;  5AQR A;  3DMJ A;  5AZI B;  2YNG A;  2UXC K;  3HT3 A;  1IKW A;  1L3U A;  4CHQ A;  3FFK B;  1VSI A;  1MDU B;  3VPZ A;  1HMV A;  3J8A A;  3OYE A;  3OYK A;  5C2F A;  4FW2 A;  3QIC A;  3C6T A;  4CJ5 A;  1GLC G;  3MK6 A;  1NK7 A;  5AQM A;  5HL7 L;  2P51 A;  4OLA A;  3LAN A;  5HRO A;  2VG7 A;  4FJN A;  3H1Q A;  2QWR A;  2DFH A;  3QER A;  2NRR A;  5GAG P;  4KHP K;  4FJH A;  4KRF A;  1RCH A;  3E01 A;  4IOC L;  1DGK N;  3R6M A;  4IXC A;  4CF2 A;  4FVU A;  3QIP A;  3CI5 A;  1R59 O;  1MWK A;  5FPE A;  5IT9 O;  4DSK A;  3SQ1 A;  2GX9 A;  2HST A;  4JKH A;  3SBT A;  1HJO A;  3ULD A;  4I2Q A;  1CZ9 A;  4C8N A;  1YUW A;  4X64 K;  1NGJ A;  3M8S A;  3L4Q A;  3OYN A;  4BY9 C;  5F2R A;  3PIO L;  2F8S A;  3D2F A;  1UOC A;  4OVL A;  1XQS C;  1T05 A;  3J7Y P;  5AQJ A;  1TKZ A;  1QQN A;  4O0J A;  3MXJ A;  4ISE A;  2Q31 A;  4A57 A;  3CYM A;  3ULE B;  1SS6 A;  4NXN K;  4FZZ A;  1RDW X;  3L3V A;  3LDP A;  3LDL A;  4DS4 A;  2Q3S A;  2FF6 A;  4H5T A;  1F21 A;  4JKF A;  4FJM A;  4CK1 A;  2E6M A;  1YT3 A;  4IO9 L;  2H3G X;  2QKB A;  2G8V A;  4MLH A;  3VEO A;  5DM6 L;  4DTJ A;  1ZBI A;  4DHY A;  4CZJ A;  5SZT A;  4J2E A;  3ID8 A;  3O3G A;  4W5N A;  4M3U A;  2O8E A;  4AIL C;  5AQO A;  2HF3 A;  3I55 N;  3D6R A;  4LSN A;  4KKO A;  4DF4 A;  3R8E A;  4DQ8 A;  3QEV A;  3O1B A;  3BY5 A;  4FK0 A;  2DY4 A;  1FW6 A;  4NLB A;  4CER A;  4HTU A;  2IC3 A;  1DKG D;  2HW3 A;  1W7A A;  3HOS A;  1S9E A;  5ADX H;  3ASM A;  4BR9 A;  1GOB A;  5ADX A;  3WXM B;  2OCE A;  4IZ9 A;  4IJN A;  3NF8 A;  4EP4 A;  3MED A;  3CQ8 A;  4F9O A;  1NMN A;  4BR0 A;  5AQL A;  1KFD A;  1RDA A;  4MDA A;  5AQH A;  3AVA A;  4WFN L;  4CD1 A;  3M1F A;  4K25 A;  3HL8 A;  3LAM A;  4CZK A;  3ZX0 A;  5EOY A;  2P9L B;  2OTJ N;  1BIU A;  1SL2 A;  1NGD A;  3UKR A;  3D2E B;  4O8K A;  4JI8 K;  2EWS A;  3CQX A;  1VRT A;  3Q7B A;  4YOX A;  2VQE K;  4PA1 A;  3F73 A;  3SV4 A;  2ITG A;  4LF9 K;  1QS4 A;  4EHU A;  2BAN A;  2OPP A;  4DSI A;  4BRD A;  3AY9 A;  1D9D A;  1WSG A;  4YFU A;  3DLR A;  4FWL A;  4KH5 A;  2IOC A;  1KD1 O;  3MAQ A;  3L2R A;  3JSM A;  4IG0 A;  3ITH A;  4LC9 B;  3BEX A;  3IS9 A;  1BCO A;  1JLA A;  5EXW A;  4CJ3 A;  5F1X A;  4F3T A;  3LP2 A;  1HQE A;  3CER A;  4DV0 K;  2WBN A;  4CF0 A;  3HYF A;  4H4O A;  3O80 A;  4DSL A;  3LZI A;  3VF4 A;  2QK9 A;  2XY5 A;  4CGG A;  1YXQ A;  3WUH A;  2V51 B;  3JXU A;  5GAD P;  3HVT A;  3SNN A;  3ISN C;  3OJU A;  3ZSQ A;  4BGA A;  3WNF A;  3HTV A;  3QIO A;  3NVM A;  3PV8 A;  1LWE A;  3NVK A;  4BRK A;  3WEE B;  2BE2 A;  1OVQ A;  3KLG A;  4BR4 A;  4KTQ A;  1W0H A;  2E88 A;  3O1W A;  4DFJ A;  4C8O A;  5J2N A;  4O4G A;  3S3M A;  3GOI A;  2NRW A;  4WQ5 A;  4BRM A;  3CFR A;  1NG9 A;  5FPM A;  2G8F A;  2E2O A;  4M45 A;  3RSE A;  4B1V A;  3C7N B;  1VK0 A;  5CZ2 A;  4H5V A;  1NK4 A;  4FLY A;  2VG6 A;  2HF4 A;  3NDK A;  2KFN A;  4CFD A;  2RHK A;  4JKD A;  3PSF A;  5K14 A;  3F5T A;  4U67 L;  4W5R A;  3DXK A;  2VCP A;  3H45 C;  3O4W A;  3P83 D;  3LPU A;  4KHU A;  1NM1 A;  2O8F B;  3TU5 A;  1MU2 A;  4CE9 A;  4JHD A;  3PX4 A;  1HPM A;  5C2D A;  3KKS A;  1X3M A;  3KLF A;  3K5L A;  4AHT A;  3MN5 A;  4HCC A;  1E3M A;  5HOO A;  3OS2 A;  1E4G T;  4ILG B;  1K8A O;  1Y97 A;  4DV4 K;  1NLV A;  4BC2 A;  1ZBF A;  4BRG A;  4DR1 K;  3EE8 A;  2D4W A;  3AAQ A;  3ATU A;  3UKU B;  1N5Y A;  1TL3 A;  1RBR A;  3O9R A;  4DU1 A;  4FJX A;  5D3G A;  4WQ4 C;  1BA1 A;  2A3Z A;  3D2F B;  5J2Q A;  4CHZ A;  2RN2 A;  5KTQ A;  3CCL N;  3I56 N;  1L3V A;  5EY4 A;  1UA1 A;  2A42 A;  4B1W B;  4FWR A;  2YKM A;  3EZW A;  4KHY A;  5KRT A;  4DV5 K;  3MXM A;  4DQQ A;  3HVR A;  3OY9 A;  1HRH A;  1KAY A;  4CF1 A;  3W3D A;  3BZK A;  1L3T A;  4H8K A;  3L2V A;  2QXF A;  1BUP A;  2P9S B;  4R79 A;  3CJA A;  2W42 A;  3SAH A;  2X74 A;  4BE1 A;  3BUZ B;  3K0S A;  4IFV A;  1JLC A;  4F3O A;  1JLF A;  4GV9 A;  3L0Q A;  4CZG A;  2P9I A;  3F9M A;  4BR5 A;  3THX A;  1S9G A;  3V9X A;  1KRP A;  1GLL O;  4NCA A;  2YI1 A;  3MCP A;  2Z1I A;  4B1Z A;  3HSC A;  2R7Y A;  1YF5 L;  4E0D A;  3MWP A;  5C15 A;  5BR8 K;  3WXL A;  2GUI A;  4GVM A;  4H03 B;  5CY4 A;  4BQL A;  2XHB A;  3NH1 A;  5BR9 A;  3OBW A;  3PLA A;  3ZT0 A;  4KHW A;  1GOC A;  3QFP A;  4KH6 A;  1WB9 A;  3SV3 A;  3M5R A;  1UAX A;  5LJV A;  4Z4C A;  4BRI A;  4A2A A;  3ULE A;  5AQQ A;  4LF5 K;  2HBL A;  3GL1 A;  3CFO A;  4Y0W A;  3AO3 A;  4M42 A;  3A5O C;  5JLH A;  1YVN A;  3E9O A;  1TKT A;  4BE2 A;  1WSI A;  4BDY A;  2QWQ A;  4PL8 A;  3VA3 A;  3MCA B;  3K58 A;  3L4I A;  4LY7 A;  3CJ9 A;  2HB5 A;  1NK6 A;  5LMN K;  4IJA A;  3HI0 A;  4LFA K;  1NGI A;  5SWM A;  2XY8 A;  2Z1G A;  4JI3 K;  3AVK A;  1N6Q A;  5JLF A;  4B3S K;  3IG1 A;  5DMR A;  5AQU A;  4O5B A;  4DCH A;  4G1Q A;  5M1O A;  1JLQ A;  4GV6 A;  1YJW N;  4K42 A;  2BGG A;  5AFU A;  1ATS A;  3E1Y A;  1QVF M;  1ZBU A;  1ASV A;  1MWM A;  2ZQB A;  3DLK A;  4E1M A;  2O8B A;  1BU6 O;  2NUB A;  3QIN A;  3OS1 A;  5CYM A;  4QS9 A;  4CEO A;  1KAX A;  1TVR A;  3J80 O;  3TPQ A;  2F8T A;  5JS2 A;  1Z25 A;  4KPY A;  4PY5 A;  1GLB G;  1EWQ A;  1VAZ A;  2KTQ A;  1CXQ A;  4BRA A;  3KLH A;  4B3R K;  1CZB A;  4I6M B;  3NF9 A;  3N4Q A;  4KV8 A;  5JVH L;  1U6Z A;  3QLH A;  4H5R A;  4DB3 A;  5C42 A;  5BN9 A;  3THY A;  5AQI A;  4KI4 A;  2UU9 K;  4IOX A;  3RSE B;  3SJH A;  2E1Z A;  2G8H A;  4YNQ A;  5FPD A;  1HNX K;  3WT0 A;  1YTA A;  3V1R A;  3THV A;  2WFB A;  1Y64 A;  1FK9 A;  2A1S A;  4A5B A;  4WCE L;  3EYZ A;  1KVA A;  3OYC A;  1K73 O;  1TUU A;  1HPZ A;  3L6Q A;  1IJJ A;  1S72 N;  5JMV A;  2GV9 A;  4KAZ A;  1D9F A;  1NBW A;  4LFB K;  5FRN A;  1VSJ A;  2YHY A;  5C24 A;  4JKG B;  2QM1 A;  2AA4 A;  4CJ7 A;  1RTJ A;  4KB1 A;  4CJV A;  4ILJ A;  3VES A;  1JJ2 M;  2ZE2 A;  1LW0 A;  5J2P A;  1NK8 A;  4IOA L;  3I8D A;  1TKX A;  4IFY A;  2VYP A;  1IG8 A;  4B8A B;  4DSE A;  4B3O A;  1M90 O;  1XNQ K;  1ATN A;  1JLB A;  3ZLJ A;  1VSH A;  4DTM A;  3ZSO A;  3P39 A;  3OYD A;  2Y1J A;  1YIT N;  2HHX A;  3SUO A;  3HOT A;  1NGE A;  3KLE A;  3CM6 A;  4FZY A;  4ID1 A;  4RWT A;  3GBT A;  3BP8 A;  1S6Q A;  2OTL N;  4X62 K;  4DQR A;  3V81 A;  3I8B A;  4RW6 A;  4X66 K;  4FL9 A;  3CJC A;  2E8A A;  5F0X A;  3K9J A;  1S3X A;  3TAG A;  2QA4 N;  1RT6 A;  5AQK A;  4DG1 A;  4FWN A;  1NJI O;  3KWI A;  4DFM A;  1J53 A;  1XUP O;  1GLE G;  1A5W A;  5AJ3 K;  4BWJ A;  5BRF A;  3V9W A;  5J1E A;  4YY3 K;  2I5J A;  2CGL A;  1SUQ A;  3SZ2 A;  5E26 A;  3LZJ A;  3NCI A;  2OA8 A;  3CD6 N;  1VSE A;  3DXM A;  5E41 A;  3U6F A;  4CHY A;  3OYM A;  1I39 A;  1QZ6 A;  2KHO A;  4WF9 L;  4KO0 A;  1KC8 O;  2E5L K;  1RDD A;  4CJL A;  4XH1 A;  1NGA A;  2A41 A;  3K9K A;  4KHN A;  1WSJ A;  1EO1 A;  3QEX A;  4FWK A;  5JIC A;  5C12 A;  3RR7 A;  1S1W A;  1W97 L;  3HP9 A;  4BDZ A;  4FJI A;  1LWF A;  3VF6 A;  3OHR A;  4CJ4 A;  4JV5 K;  3LDS A;  4ELV A;  4DR2 K;  4BDP A;  2CH6 A;  5KPZ A;  2UUC K;  2CH5 A;  4K43 A;  3MEG A;  2YNI A;  2P9N A;  1U45 A;  5AZJ A;  4CJT A;  1EXQ A;  3O5B A;  2HHH K;  2UUB K;  3ID6 A;  4CEZ A;  2OYQ A;  1E4F T;  2WC9 A;  3QFU A;  3U4L A;  3KJV A;  3L8B A;  3OW2 M;  1KSP A;  1NNE A;  1M1K O;  1EET A;  1TKD A;  3MMV A;  5FRO A;  4IFE A;  3CCE N;  3IDH A;  1QQM A;  1SKR A;  1NGB A;  1W2B M;  3C6U A;  4LH5 A;  2ATQ A;  4DR5 K;  4Z0U A;  4GVE A;  4DTS A;  5FLX O;  4CGF A;  4B8C A;  2DPN A;  3C6A A;  3MEE A;  3OVN A;  2KQ2 A;  4BVP A;  3L2W A;  1X9J A;  2ITM A;  1HYV A;  4BWM A;  5C25 A;  3TTC A;  1C0F A;  1KFS A;  2VWB A;  3FZL A;  2AP1 A;  2EX3 A;  4JKA A;  4NO7 A;  3WQT A;  5M1P A;  4YOR A;  1KLM A;  2NZT A;  4DS5 A;  5AQY A;  4YOT A;  3SYZ A;  3SK3 A;  2JWK A;  4XH5 A;  3PUF A;  1YI2 N;  1U48 A;  1Q86 O;  2FLO A;  1DTT A;  4B1Y B;  2ASM A;  2A40 A;  2WON A;  1N36 K;  2ZD1 A;  1NWK A;  4V19 S;  2OAN A;  1K8K A;  3E9L A;  2OPS A;  3OYG A;  2X6S A;  1TK5 A;  3EN9 A;  4OKE A;  3QNO A;  3A8Y A;  3T19 A;  5T7B A;  4JI4 K;  2F9T A;  2W6L A;  4JS5 A;  1JKH A;  3DLG A;  3KIO A;  4DTU A;  2ZGZ A;  1VQL N;  4GY2 B;  2P5O A;  1RBT A;  4M3X A;  3LWL A;  2WUS A;  4AM7 A;  2I7P A;  3E9P A;  3ZT4 A;  3VGK A;  4FM1 A;  1S6P A;  3MN7 A;  1P8Z A;  1WOQ A;  1ASU A;  3EEQ A;  3PSI A;  5DM7 L;  1Q81 O;  1NKC A;  1VQ5 N;  5I9E B;  4B9S A;  4BC3 A;  3SQ4 A;  5GIP A;  2ASO A;  4BRN A;  3FLC O;  1HKC A;  1RDU A;  3LL3 A;  3UB5 A;  3P4I A;  3VEV A;  5AQW A;  4ISG A;  2E1Y A;  2PAV A;  3O9T A;  4IG3 A;  4K0K K;  1GLD G;  2HHW A;  3A5L C;  3OYJ A;  4DKW A;  4AM6 A;  1OH6 A;  4CF9 A;  1C0U A;  3CCR N;  3D2E A;  3TTD A;  4WQ4 A;  3B6P A;  5AQN A;  3NE6 A;  1RBV A;  4WFB L;  3THW A;  4FJG A;  3UE5 A;  4H0T B;  3G10 A;  3G4S N;  2GUP A;  3BZC A;  2HVI A;  4QAG A;  1YJ9 N;  2UUA K;  3PX6 A;  4CZI A;  5DK5 A;  3TSU A;  4IKF A;  3RVC A;  3SMS A;  3DRP A;  4OLB A;  1DT9 A;  4W5O A;  1ZBL A;  3CPW M;  4DV6 K;  2IS3 A;  4DTX A;  3PIP L;  4PKG A;  3KK3 A;  5BRH A;  4C8M A;  5KQ8 A;  4O0I A;  2YV0 X;  4CGI A;  2HHQ A;  1ZXO A;  4QOZ B;  3P1G A;  1UA0 A;  1FJG K;  3KK7 A;  2PYJ A;  1A5X A;  4FK4 A;  4IDK A;  3TSQ A;  3VEN A;  1N32 K;  1DTQ A;  3WEE A;  3ZET B;  3DRR A;  2P9I B;  3RMC A;  4FJ8 A;  3DAW A;  4BRO A;  4C8K A;  3SUQ A;  3RTV A;  1VHX A;  2ZJQ L;  3BF1 A;  4FLT A;  4H5N A;  4DR3 K;  3VF2 A;  2D0P A;  3DOK A;  1NJY A;  2W6K A;  4M3Y A;  3L3U A;  1OH5 A;  1WAJ A;  3KHY A;  3G6E N;  4DFK A;  3LM2 A;  3AVN A;  3KWG A;  5BPN A;  3IAY A;  1EP4 A;  2BUP A;  3R3L A;  4LH4 A;  4HTL A;  3A0I X;  4CJQ A;  3K5M A;  4KBO A;  2QKK A;  1ATR A;  2NRT A;  2D1K A;  3J7Z O;  1QTM A;  1D4X A;  4BRL A;  3IUC A;  2P9U A;  5JVG L;  4DLG A;  4BVO A;  1NGH A;  3NGY A;  3T3F A;  2HHV A;  3TAN A;  4B1X B;  1LV5 A;  4H0V B;  4CZL A;  3ZCM A;  2E6L A;  3T69 A;  2PYL A;  2Q0U A;  4FW1 A;  4EP5 A;  4LSL A;  4DUY K;  3T7Z A;  4B1U B;  4DQS A;  2V7Y A;  4CJK A;  3V9Z A;  4OPK A;  2HOE A;  4KTW A;  3CF5 L;  4EZ6 A;  3ATV A;  4PL7 A;  3GE1 A;  3FFI A;  4BRC A;  4DMN A;  2UXD K;  2NRX A;  1Q82 O;  4NYN A;  4B3T K;  3O08 A;  1TK8 A;  2ZJP L;  2IVN A;  3QNN A;  1RGI A;  1OKJ A;  4JI1 K;  3TAP A;  3AO2 A;  2RKI A;  2Z1J A;  2F9W A;  3O8M A;  3I0R A;  3V6D A;  3EKU A;  2BDP A;  4FWQ A;  4HCB A;  3EY1 A;  3V4I A;  1JXE A;  1YVU A;  4CJS A;  4EIA A;  3P5J A;  1VQK N;  1TAQ A;  1QZ5 A;  3WXJ A;  1LAW A;  2BTF A;  1ZBH A;  3K5N A;  3CC2 N;  4CHP A;  1H1V A;  4F4K A;  5AQZ A;  1HYS A;  1IH7 A;  5KGW A;  4FWO A;  1I94 K;  2OZS A;  4F2S A;  4LFC K;  3FZH A;  3O6W A;  3QO9 A;  4IO8 A;  4HWI A;  3ENO A;  2O8B B;  3CCS N;  3KKR A;  4CEQ A;  4B9T A;  2V7Z A;  1ESV A;  4OKK A;  5AQV A;  3S3N A;  4C1N I;  3DLL L;  2HBJ A;  3CMA N;  3LP1 A;  3V1Q A;  4E7I A;  3AVJ A;  3CCJ N;  3CXC M;  1NGF A;  1BQM A;  4FPB A;  3OS0 A;  3VQ4 A;  1Q8I A;  5C10 A;  3EL2 A;  3N4P A;  4YHH K;  3G25 A;  5IWA K;  3VET A;  5BPM A;  4JK8 A;  4NLC A;  2NRV A;  3ZSR A;  3LWM A;  4H4M A;  4YOW A;  4CHO A;  4CBX A;  1R0A A;  3SAF A;  4HUE A;  1Z05 A;  1RIL A;  4DV3 K;  4M3T A;  3BGR A;  4DR6 K;  1XHZ A;  4E3S A;  3HPG A;  3DM2 A;  2KZM A;  1JCF A;  3KTQ A;  3SCX A;  2O8D A;  1O13 A;  4FWP A;  5BRE A;  1XI1 A;  1VSF A;  3J81 O;  1NJW A;  1RTD A;  4HUF A;  2G8W A;  1WBD A;  2QWN A;  4I6M A;  4JK9 A;  1TL1 A;  4A62 A;  4B9M A;  4HUG A;  1X9M A;  2D0A A;  4ID5 A;  2XY6 A;  1NGG A;  4UQG A;  1Z6R A;  1BCM A;  4CF8 A;  1QSL A;  5FDL A;  4FM2 A;  3NF7 A;  5M1Q A;  3VQB A;  3THY B;  3VER A;  3CFP A;  1ASW A;  2GWJ A;  2YX6 A;  3ENH A;  3UKU A;  3R1X A;  4FM0 A;  3AVM A;  3LDQ A;  2Q0R A;  2HMI A;  2YHB A;  1VSM A;  3H3O B;  4CZE A;  3TAB A;  2O4G A;  3DXK B;  1CZA N;  1IKX A;  3OYA A;  4E1N A;  5BPL A;  3G71 N;  4AHR A;  4FJL A;  5EVZ A;  3KD5 E;  3VQ5 A;  3NGI A;  1QQO A;  3VQP A;  4JKB A;  4BRE A;  3WQU A;  3M3Z A;  1Q9Y A;  3O9Q A;  1BIS A;  2FF3 B;  1RTI A;  2YHX A;  3DOL A;  3C65 A;  4DU3 A;  4RG8 A;  1V4S A;  4KB0 A;  3VTH A;  4MQ3 A;  3RR8 A;  3LP0 A;  2HMP A;  3GG4 A;  4JI0 K;  3C7N A;  4DQI A;  1EQY A;  2OPR A;  4I2P A;  3AO4 A;  4Y1D A;  4CEC A;  4PUO A;  3F2K A;  4N47 A;  3TAM A;  1YIJ N;  4WQ5 C;  4JD2 A;  3M6G A;  1LWC A;  1RT1 A;  2YKN A;  2YNF A;  3AVF A;  1ILY A;  4QS7 A;  3A5N C;  1ZBS A;  3MN6 A;  5KQD A;  4B08 A;  3H3N O;  1CXU A;  4FPA A;  4CED A;  5BN8 A;  3TAF A;  1LW2 A;  1HQU A;  3NF6 A;  4CVN E;  3O3H A;  2W41 A;  3SBG A;  4FJ7 A;  4B9U A;  2FBY A;  1D5A A;  3A2F A;  2ETJ A;  3C94 A;  1BG3 A;  4IDH A;  3FR0 A;  2YHW A;  4K8Z A;  5M1N A;  5HRN A;  4NB4 A;  1ZYQ A;  1L5U A;  2VWK A;  1VQ6 N;  1FKP A;  3H08 A;  1KXP A;  1WSF A;  2IVP A;  3KVG A;  4B9Q A;  3OBY A;  5KGX A;  4FXD A;  1DEJ A;  1T6D A;  4NYF A;  1BI4 B;  3PO5 A;  4AF1 A;  3DI6 A;  5HLF A;  1VQ8 N;  3DWL A;  4RW9 A;  4DTO A;  4Q0B A;  1XMQ K;  3MXI A;  5AQP A;  3H6E A;  3TSP A;  4CES A;  5M1F A;  1G99 A;  2G8U A;  3TI0 A;  2P9S A;  2G8I A;  4DWI A;  4PWD A;  4JAX A;  3S3O A;  3IRX A;  2A1R A;  2ZWH A;  1T7P A;  4FYD A;  2XO7 A;  2X78 A;  4GV3 A;  4CFB A;  2RF2 A;  4WE1 A;  4CIE A;  3L2Q A;  3AVB A;  4FVM A;  1VQM N;  4IWV A;  3VEZ A;  3QET A;  4DV7 K;  4GKK K;  1SKS A;  1J54 A;  4YOY A;  4RW4 A;  4ZTF A;  3PO4 A;  4E7J A;  5BRD A;  3CM5 A;  2E2N A;  4FCY A;  4WYB A;  5EU7 A;  3UIQ A;  4XH4 A;  3VTI A;  2P9K A;  4DLE A;  4KHQ A;  2KZZ A;  3SMP A;  1U2V B;  3CET A;  4RW8 A;  3ZYY X;  2A5X A;  3C6H A;  1VQ4 N;  3PX0 A;  1NJZ A;  4FOE A;  3NH2 A;  3VN5 A;  3SLC A;  1KTQ A;  4CZH A;  3MEC A;  4O44 A;  3U3G A;  2FSK A;  1BWF O;  4A61 A;  4EZ9 A;  4FLZ A;  3QDK A;  4E89 A;  2WTU A;  2Z1H A;  3M8P A;  1N34 K;  1B92 A;  5A2Q O;  3NGZ A;  2D0B A;  3SQ2 A;  4EHT A;  2GEL A;  4B9V A;  3B8A X;  2FC0 A;  4UY8 O;  1T3V A;  3FZF A;  1K9M O;  4CK2 A;  4H0O A;  4JNE A;  4ZHR A;  4LF8 K;  1QQC A;  3I33 A;  2HNZ A;  4BQZ A;  2PBD A;  4DTR A;  2NNW A;  1C1B A;  3VEY A;  4ELU A;  3VMF B;  3CCQ N;  1JCE A;  2QWM A;  5GIN A;  2KLA A;  2QWL A;  3ENB A;  3EO3 A;  2VGM A;  1BQN A;  3CHW A;  4CJW A;  4ICL A;  2HBM A;  1U47 A;  3AA4 A;  3HST B;  4TSX A;  3AVL A;  3LAL A;  4M3R A;  2QWP A;  3B6O A;  2ZM6 K;  1RFQ A;  4CBW A;  3OYH A;  3SI6 A;  3KLI A;  1VSK A;  1Q9X A;  3VQ9 A;  3D0P A;  2GWK A;  2P9K B;  4KHS A;  1GOA A;  3C95 A;  3J7A P;  4AQY K;  1BDG A;  1FKO A;  2O8C A;  2G8K A;  2QTD A;  3VQ7 A;  3OYL A;  3ZSZ A;  3HP6 A;  4FJK A;  3VQA A;  3L2U A;  2IGI A;  3FE1 A;  1N8R O;  1NJX A;  3CJ7 A;  3RRG A;  4FLW A;  4DQP A;  4B3M K;  4LD0 A;  4FJ9 A;  3T1Y K;  2Q36 A;  2CGJ A;  5I3U A;  4A59 A;  4O55 A;  2OZM A;  3M8R A;  2KKZ A;  4FZX C;  2NRZ A;  4NCG A;  4CFC A;  3HXM A;  1SQK A;  3HPH A;  5M1K A;  1U49 A;  1WAF A;  3UKR B;  4EAH D;  4BC4 A;  1S1U A;  4CJR A;  4JI2 K;  3QML A;  3O9S A;  4MO5 A;  5AQF A;  2UXB K;  4J8F A;  1WBB A;  1P90 A;  4W5T A;  1VQO N;  2P5G A;  4H0Y B;  4DV2 K;  1KLN A;  1X9W A;  4FLX A;  3AAP A;  3R9P A;  3CC4 N;  2O8D B;  4C8L A;  4LF6 K;  3U3Y A;  2FBX A;  1ITG A;  4JS4 A;  2B5J A;  1JL1 A;  4I9L A;  4Z4H A;  5GIO A;  1HJR A;  1J6Z A;  1JCG A;  3ZEU B;  4E7K A;  4KI6 A;  3NH0 A;  3HM8 A;  3CCU N;  4JKG A;  3AVG A;  2IVO A;  3HBT A;  3V1O A;  4J2D A;  2P9N B;  1NMD A;  3TAQ A;  3AGR A;  4J2B A;  1K6Y A;  2HHU A;  1U04 A;  4A2B A;  1KVB A;  2FXU A;  1B9F A;  3F9K A;  1LOT B;  3AO1 A;  5EX5 A;  2I7N A;  4FLU A;  1OH8 A;  2RPI A;  4AHS A;  3OYI A;  3PY8 A;  1YHQ N;  3QES A;  4IEI A;  1XHX A;  5AQG A;  1HNV A;  4JEP A;  1BIZ A;  1RNH A;  1RTH A;  3CCV N;  3VQE A;  4ELT A;  3A5M C;  3AVH A;  2F96 A;  3VQ8 A;  5CHI A;  3LM9 A;  4PKH A;  4CGH A;  4B9L A;  4H5W A;  4DR7 K;  2D5R A;  3JS6 A;  2D0C A;  4N56 A;  4KRE A;  1CLQ A;  3BF3 A;  4X65 K;  1BOT O;  4AHV A;  3THW B;  4CCH A;  2IAJ A;  3DRS A;  4Z94 A;  4OJR A;  1NOY A;  2HND A;  3IMX A;  3O3F A;  3QBW A;  4ZTJ A;  1U2V A;  4JHD B;  1RT2 A;  4L3Q A;  3RMD A;  3SPZ A;  1C1A A;  3LDN A;  4JD2 B;  1QE1 A;  4JN4 A;  1LAV A;  1RDC A;  2P9L A;  3H1V X;  4LF7 K;  1NKE A;  3ZEU A;  1GLA G;  4J2A A;  4QS8 A;  2PY5 A;  1X9S A;  1RBU A;  1KCF A;  1X3N A;  5AFU H;  3WXI A;  4Z4F A;  1IBL K;  1L3S A;  2B4J A; 
#chains in the Genus database with same CATH homology
 4LF5 K;  2UXB K;  4DV2 K;  4DV4 K;  4JV5 K;  4DR1 K;  1HNW K;  4DR2 K;  4OX9 K;  1N34 K;  1IBK K;  2UUC K;  4KHP K;  5A2Q O;  4YHH K;  4LF6 K;  5IWA K;  4LFB K;  4JI8 K;  1XNR K;  4CVN E;  2HHH K;  2VQE K;  1N33 K;  2UUB K;  4LF9 K;  4DR4 K;  5IT9 O;  4JI6 K;  4CW7 B;  4DV3 K;  4LF8 K;  4DR6 K;  5LMN K;  4LFA K;  3OTO K;  5LL6 Z;  4NXM K;  4LF4 K;  4K0K K;  1XNQ K;  4X64 K;  3JAM O;  4JI3 K;  4DR5 K;  4DV0 K;  4JI2 K;  4B3S K;  1HR0 K;  4DV5 K;  2F4V K;  3J81 O;  5FLX O;  4DUY K;  3J7Y P;  2VQF K;  4JI7 K;  2UXD K;  2ZM6 K;  1XMQ K;  4X62 K;  4B3T K;  4DV1 K;  4NXN K;  1J5E K;  4X66 K;  2UUA K;  3J7A P;  4DUZ K;  4AQY K;  4JI5 K;  4JI1 K;  4DR7 K;  3T1H K;  4JYA K;  4X65 K;  4DV6 K;  5AJ3 K;  4YY3 K;  1N36 K;  3J80 O;  4V19 S;  1FJG K;  4GKK K;  4DV7 K;  4B3R K;  5BR8 K;  4B3M K;  1IBM K;  1I94 K;  1N32 K;  4LFC K;  3T1Y K;  4LF7 K;  4JI4 K;  4JI0 K;  2E5L K;  4GKJ K;  2UXC K;  2UU9 K;  1IBL K;  1HNX K;  1HNZ K;  1XMO K;  5LMU K;  4DR3 K; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...