1N34M

Structure of the thermus thermophilus 30s ribosomal subunit in the presence of codon and crystallographically disordered near-cognate transfer rna anticodon stem-loop mismatched at the first codon position
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
118
structure length
118
Chain Sequence
ARIAGVEIPRNKRVDVALTYIYGIGKARAKEALEKTGINPATRVKDLTEAEVVRLREYVENTWKLEGELRAEVAANIKRLMDIGCYRGLRHRRGLPVRGQRTRTNARTRKGPRKTVAG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S RIBOSOMAL RNA
publication title Selection of tRNA by the Ribosome Requires a Transition from an Open to a Closed Form
pubmed doi rcsb
molecule tags Ribosome
total genus 21
structure length 118
sequence length 118
ec nomenclature
pdb deposition date 2002-10-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
M PF00416 Ribosomal_S13 Ribosomal protein S13/S18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.50 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 1n34M01
4.10.910.10 Few Secondary Structures Irregular 30s ribosomal protein s13; domain 2 30s ribosomal protein s13, domain 2 1n34M02
4LF5M 5ITXE 5IWAM 1HNZM 3U6MA 4YY3M 1HNWM 4DV1M 2UXDM 3SAWA 1N32M 2XZFA 4DV0M 4LFAM 1IBMM 1IBLM 1XNQM 1Z59A 4JYAM 3GPUA 3U6PA 4B3MM 4DUZM 4JI2M 4B3RM 2HHHM 1PJJA 5LMUM 3DOAA 4LFCM 1K3WA 3GP1A 3T1HM 2UUBM 3JR5A 1NNJA 4G4RA 4LF6M 4DR7M 3SATA 4JI5M 2VQFM 3GQ3A 1KFVA 5A2QS 2F5OA 4LF4M 4DR2M 3U6DA 3GQ5A 1K3XA 2UUAM 4DV6M 3T1YM 4DR6M 4G4NA 4DR1M 5ITRA 1Q3CA 3OTOM 4NRVA 4B3SM 1N33M 4PDGA 4G4OA 4YHHM 3A45A 4DR5M 2F4VM 4PCZA 4MB7A 1I94M 4DR4M 5LMNM 4DV2M 3SAUA 1HNXM 2UXBM 3GPPA 2VQEM 4JV5M 4LF8M 1XNRM 1TDHA 3J81S 1K82A 4DV5M 4K0KM 1PM5A 1MU5A 3GQ4A 2UU9M 2HKJA 3GO8A 3U6QA 2ZM6M 1N36M 1L2CA 3TWLA 2UUCM 3A42A 1N34M 3JAMS 1L2BA 4KHPM 4X66M 5ITTA 5BR8M 3J7AS 2UXCM 5IT9S 3U6OA 5FLXS 2F5SA 4DUYM 1FJGM 4B3TM 5ITQA 1L1TA 1Z5CA 1EE8A 3TWKA 1XC8A 2F5NA 4JI1M 3GPXA 5ITXA 2EA0A 1J5EM 3SARA 4NRWA 3A46A 2ZBKB 1XMQM 4GKJM 1Z5BA 4G4QA 2OQ4A 1HR0M 4OX9M 1PJIA 3SBJA 4LFBM 1MX0A 2F5QA 3TWMA 1XMOM 4JI3M 4DV7M 4JI6M 1Q39A 2XZUA 4PDIA 4JI4M 2E5LM 2OPFA 1R2ZA 4LF7M 1Z5AA 3VK7A 4GKKM 4X64M 4X65M 3U6EA 4PD2A 4ITQA 4CISA 4JI0M 3W0FA 3C58A 1Q3BA 1TDZA 1IBKM 3SAVA 4DV3M 3U6CA 4DR3M 2Q2EB 4X62M 4AQYM 3SASA 3JR4A 4JI7M 3VK8A 4LF9M 2F5PA 5ITUA 1R2YA 1L2DA 1L1ZA 4JI8M 5ITYA 4NXNM 3U6LA 3J80S 3U6SA 4DV4M 4NXMM 3GPYA
chains in the Genus database with same CATH superfamily
4LF5M 5ITXE 5IWAM 3U6MA 4LCBA 3FYCA 1NHWC 1TF0B 4GC9A 4QHSA 2QENA 3SAWA 1OKSA 1N32M 1IBMM 1WHCA 3B7QA 1JR3E 4REZA 1SXJD 3AKZA 4GEWA 1Z6TA 2X4AA 1N77A 3TL4X 3M6AA 3GLFA 2K47A 4ANRA 4B3RM 4M9XA 3GLHB 2CRUA 5EP3A 2LNHC 4MGHA 5KPRA 3D8LA 2JZ1A 2DVWB 4M0WA 4G4RA 4LF6M 3KP1E 2XH9A 3SATA 1OAIA 2KDLA 3FD9A 1DGFA 3GQ3A 1KFVA 2XSZA 2DHRA 1E94E 2Y0TA 2MGWA 4LJ8A 4DV6M 2KNAA 3HY5A 2JY7A 3T1YM 2Y21A 4G4NA 4DR1M 5EXTA 1Q3CA 3KOWE 4B3SM 2CHVA 1R6BX 1QANA 3Q8XA 1I4WA 4I5SA 1ZV1A 5DYGA 2F4VM 2L4EA 2CV1A 2BWBA 4MB7A 4AKHA 3GLGA 4AG5A 1UFZA 1RU3A 3GLHE 3LMMA 4LG2A 1XNRM 3I4YA 1FNNA 3KSXA 4OVZB 4B7HA 4I81A 1QVRA 1SXJE 3GQ4A 1G41A 2UU9M 1VEJA 1QZEA 2KZSA 4D82A 2DAMA 2QNJA 3V76A 1C7YA 2X8AA 5EP4A 3U6QA 2ZTDA 2ERCA 4LJ5A 3I51A 4Q7JA 3TWLA 4IBJA 1VDLA 1HJPA 5F3WA 4GC5A 4IBKA 3ZH9B 1KYIA 3AOGA 3GLIA 3B74A 2DXIA 2KW0A 4LRTA 2RGOA 3TPZA 3SYKA 5ITQA 3CF0A 2X49A 3FUTA 1XC8A 4GHLA 2LVOC 2YQZA 3UMMA 3CF6E 4B08A 2Z3XA 3SMPA 3SARA 3NBXX 3UZUA 2HWJA 1PJIA 3SBJA 3WHKA 2O25A 3HJ8A 1Q39A 4GMQA 2EKKA 4PDIA 4JI4M 2L09A 2CHQA 3QYEA 2Z4RA 1R2ZA 3VK7A 3SHFA 3T38A 4NSRA 1TR8A 4PD2A 1DGHB 1NNUC 2HL7A 3AV0A 1GLNA 3LW5F 4JI0M 4GITA 4R71A 2V1CA 3J2PB 4FVMA 3UGJA 2Q2EB 4MM3B 2EUCA 4AQYM 4FWDA 3HKPA 3KVWA 3FRIA 4A3VB 4FW9A 2VDBB 3M0EA 1D0KA 1G59A 1UM8A 1WIVA 1NV9A 2WZJA 1NJGA 3FE3A 5L8RF 3CF2A 1IN7A 1L1ZA 3GRVA 1D2NA 3KSJA 3L27A 4KLNA 1F4IA 1IY0A 2MR9A 4RNAA 4I4LA 1XHBA 3AOEC 5E6JA 4NXMM 4QOZC 3HHXA 1NO1A 4NSOB 1HNZM 3VKHA 1A5TA 2R46A 5H37D 4YY3M 1IN4A 4II7A 1WR1B 2D7HA 2DAKA 3LCUA 5JI2E 3FRHA 3H4MA 4CJ6A 1VEGA 3PXGA 3U5ZB 2OO9A 3UJNA 1XNQM 4BB9A 1C1KA 2QSFX 4AG6A 1H6UA 3PNVA 3GPUA 2W82A 5FTLA 3FUUA 3L25A 4RKUF 1QDTA 5EJCA 4F2LA 4GIPA 3HU2A 4BBAA 1V92A 2HHHM 1Y8GA 2CWBA 2LHGA 2OOAA 2R4JA 1LV7A 2R44A 2KNZA 3E4RA 4LZJA 1K3WA 1OTRA 2DKLA 2UUBM 2K0BX 2K6BA 1QAMA 5EXPA 1T6OA 1PRBA 4FWHA 2VQFM 1IY2A 5FTNA 5A2QS 7CATA 5IZ7D 4LF4M 4DR2M 2NQ8C 2J7OA 1ZMWA 3GQ5A 2UUAM 1YE9A 4DR6M 1TGUA 3OTOM 3Q8GA 4OW0A 4QNMA 1OIPA 5FTJA 4F1IA 3VFDA 5EP1A 3MMPA 3PFIA 1IN6A 5FSWA 4DR4M 1XXHA 5LMNM 4Y28F 4GH9A 3SAUA 1HNXM 2UXBM 2QPAA 4XBOA 2JY6B 2XGNA 1JQJC 1TDHA 4W5WA 1R4GA 4KODA 4WW0A 3ZQJA 2I7PA 5KO3A 1K82A 4K0KM 1MU5A 2HKJA 4MH0E 2LXEA 2KHHA 2QCUA 3DA1A 3KS4A 2ZTCA 4IBDA 2DHYA 3HX3A 1ZMVA 3IHPA 2VF7A 4LJ9A 4EIWA 1N36M 3HJSA 1GO5A 4LJ6A 4LJ7A 3UK6A 4DBGB 1ORYB 1N34M 3CTWB 1HT1E 2R18A 4KHPM 2DNAA 2D7EA 2JY5A 1GJTA 1QAOA 1J7KA 4XK8F 5BR8M 4CIZA 1YUBA 3J7AS 3E46A 4JXJA 3U6OA 2UXCM 1NJFA 2H5XA 2F5SA 4DUYM 4M9ZA 3M7GA 4TUWA 2QBYB 1L1TA 3TQSA 1AIPC 3U60A 3SMSA 1GL7A 1Z5CA 2C96A 1DV0A 2L2DA 4FCVA 5ITXA 3K9PA 4S12A 3A46A 3KXEC 3MK6A 1XMQM 4G4QA 2V6ZM 5DFLA 4LZZA 1TTEA 2XLJA 2L7HA 1HR0M 4L6V6 4LFBM 3BOSA 2KRUA 1IY1A 3L29A 3RGPA 1V34A 1Q02A 2DAEA 5EP2A 4DV7M 1JR3A 4L8RC 1NV8A 4WURA 3AL0C 3HJQA 1IXSA 4IJFA 3VDUA 3LCVB 3QWLA 3PNYA 4L4UA 4Z6YA 2CV0A 4X64M 3VDPA 4AZFA 2RRUA 3IECA 3J27B 1LTMA 3KOXE 4MGIE 2QHOB 1TDZA 1Q3BA 2BJWA 2CUZA 4DV3M 3SYLA 1AUAA 4JI7M 4HL4A 4LF9M 4D80A 2WSCF 1SG9A 1EFUB 2F5PA 2J5YA 2G5GX 3FTEA 4L15A 2LVPC 4KT0F 3KP0E 3IG8A 1R2YA 4NL4H 1L2DA 1QAQA 2HCBA 3K1JA 1QQWA 2C9CA 2GNOA 4IBFA 3U6LA 4LJ4A 1FJGM 4P16A 4R7GA 3PVSA 3E9SA 1R5LA 4IBGA 5EXSA 1PGYA 3HWSA 1P3QQ 4HEOA 3E21A 1OIZA 1PJQA 2LTUA 3SFZA 2XZFA 4DV0M 4LFAM 3BBZA 3U61A 3GLHA 3FKEA 2JWSA 1YLAA 2MJ5B 1SXJA 2YNMD 2C99A 4JYAM 3HGIA 3SC3A 2L4FA 4M9SA 1WXQA 2CP8A 1VG5A 4JI2M 4IBEA 2JXNA 1DGBA 3HU3A 4NOOB 5C18A 4ZPXA 2LHCA 1PJJA 5LMUM 4G3OA 1VQ1A 5DYIA 3GP1A 1GJSA 3GLFB 1XXHB 3GRUA 3JR5A 3LVWA 2DWZB 2ZAMA 4JI5M 1QYRA 2XFSA 4CGYB 2XSZD 2DWMA 4FCWA 2VIIA 3K2LA 1L8QA 3HU1A 1D0MA 2F5OA 5FTKA 2JZ0A 3GRRA 4QNRA 1IFYA 2KXEA 3IG5A 4Z8XA 4MGZE 1N33M 1GKIA 4NRVA 4PDGA 2DAGA 4G4OA 3B7NA 1GL6A 1XB2B 2XEPA 1IN5A 2FE8A 3HHWA 4DR5M 4GHAA 3WHLA 2LVNC 5KQ8A 2ZANA 4FWGA 2DWLA 4JV5M 1E9SA 2J7NA 3AJIB 4LF8M 4B7FA 1ZMUA 4FCTA 4OU7A 2N35A 3J81S 2CEAA 2C5RA 4D81A 4R3DA 2A5YB 5KQDA 4JN6A 3FUWA 3GLFE 3GO8A 2LVAA 3FTDA 3GLGB 3VKGA 3LQRA 3DZDA 1DGGA 3SHGB 2ZM6M 1L2CA 2UUCM 3K8ZA 2KZUA 5EQTA 3A42A 1X37A 4WP2A 3JAMS 2I7NA 2JY8A 2MROB 3THGA 4X66M 3B7ZA 2Y0QA 3EIHA 1NY5A 5ITTA 1IXSB 1G8PA 5IT9S 2EJSA 1HQYE 2R65A 3NBIA 2GQFA 1JB0F 4PT5A 3A98B 3TWKA 3L26A 4AI6A 1GABA 2FOIC 4RF1A 1J5EM 1HT2E 2EA0A 4BLCA 2B3TA 2FS1A 2QZ4A 3GLIB 4NRWA 1Z5BA 4GKJM 4L78A 3T6PA 2OQ4A 2XF3A 1TH3A 1MJGM 3I4VA 1BVSA 2QP9X 1MX0A 4QHTA 1DGHA 3FYDA 1S3SA 1ZAEA 3GLGE 1QUTA 2XFTA 4RF0A 2K9DA 4HLQA 1CUKA 3BXWA 1Z5AA 3I01M 1NVMA 3CGWA 3ZCBB 1W5SA 4X65M 2KNVA 3U6EA 2R4EA 1MN3A 2R6FA 4CISA 1IBKM 3SAVA 3R9XB 4DR3M 4X62M 3ZC7B 3AFHA 3JR4A 3SASA 3VK8A 4NC6A 3U61B 3H4JA 3FTFA 4QOSA 3GLIE 3TE6A 1SXJB 2JNHA 1E9RA 8CATA 4FD2A 4JI8M 2DZNB 1WGNA 2DENA 3KOZE 4LY6A 2AHMA 3J80S 3U6SA 3T15A 3U5ZA 4AKGA 2R62A 1ZQ9A 1OJLA 3GPYA 3K92A 4AKIA 2RGHA 3GRYA 4MGYE 4DV1M 3RE8A 1HNWM 2KEBA 2UXDM 2OOBA 5E26A 1TH4A 1QDRA 1G3IA 2KA6B 3W0LB 1IBLM 1NY6A 2V1UA 3KS8A 1NHGC 1IM2A 1OFHA 1IN8A 5EXXA 1Z59A 3KW6A 4IJEA 4KO8A 1V33A 4P17A 3HHZA 2R0IA 2HAKA 1VDDA 3U6PA 3B9PA 1T3TA 4B3MM 4DUZM 2Y20A 2R45A 4IBIA 2H1RA 1IXRC 2Z8YM 2JA2A 4LGMA 2EO2A 3DOAA 4LFCM 3DFZA 4IIWA 1DO2A 2O01F 1PJTA 3T1HM 1NNJA 1N78A 2LWXA 4B7GA 4DR7M 5BPVA 1D0LA 2WSEF 3LVVA 3MJ5A 2M60A 1NSFA 1T43A 2JUJA 2VF8A 3U6DA 1K3XA 3QYBA 3R8FA 3I04M 5ITRA 2FH0A 4YHHM 3A45A 5KPZA 2DZLA 4XGIA 2Z7JA 4PCZA 1XWIA 2LH0A 1OAOC 1I94M 2G3QA 2YR0A 4DV2M 1WJ7A 2BWEA 3RFWA 3GPPA 2VQEM 2P5TA 3RGSA 1YSYA 2FFJA 3L2AA 1SXJC 2ZAOA 3K9OA 2CHGA 4DV5M 1KSFX 1PM5A 3KOYE 1G4AE 2DWNA 4M0DA 1G71A 1QUSA 3HHYA 1GVNA 3LQQA 2QBYA 3W68A 1PJSA 2M5ZA 4LJAA 1L2BA 3EIEA 4CHTB 3L28A 5FLXS 3FTCA 5FTMA 2EKFA 5KPTA 2C9OA 4B3TM 4OVZA 1R7RA 1QZMA 1N75A 2CE7A 2DI0A 1EE8A 2F5NA 4JI1M 1VEKA 1E32A 3AOEA 3GPXA 3C3DA 2LVQD 2G8LA 2ZBKB 2C98A 4G6ZA 3B89A 3MHVC 1IQPA 4I8OA 4LGYA 2JP7A 4OX9M 3VLFB 3C3EA 4UN2B 3C9PA 4GRIA 2F5QA 4L16A 3TWMA 2LBCA 1JR3D 3U60B 5IREB 3F92A 3ILKA 4JI3M 1XMOM 4JI6M 5JI3E 3KFUG 2XZUA 1XXHE 4AW4A 2E5LM 5GKNA 1DO0A 2OPFA 3KDSE 2BNKA 4LF7M 2MH8A 1IXZA 2FNAA 4LRSA 4GKKM 2DZOB 1TH2A 3FUXA 2QQ8A 4ITQA 2YFQA 1WGLA 3NWLA 3J7BA 3QAUA 3W0FA 5C1BA 3C58A 3U6CA 4MGKE 1W5TA 2D7GA 2APLA 3D8BA 1HQCA 1EIJA 2WSFF 4IBCA 3HZJA 2BJVA 2Z4SA 2CFOA 5ITUA 2L7IA 2CV2A 2L6OA 1J09A 2DAIA 2O5RA 1OQYA 3FUVA 3W67A 5DNYA 4IBBA 2RKOA 5ITYA 4NXNM 2KRKA 4DV4M 1OFIA
chains in the Genus database with same CATH topology
4LF5M 5ITXE 5IWAM 3U6MA 4LCBA 3FYCA 1NHWC 4GC9A 4QHSA 2QENA 3SAWA 1N32M 1IBMM 4REZA 1SXJD 3AKZA 1Z6TA 2X4AA 1N77A 3TL4X 3M6AA 3GLFA 2K47A 4B3RM 4M9XA 3GLHB 5EP3A 2LNHC 4MGHA 5KPRA 3D8LA 2DVWB 4M0WA 4G4RA 4LF6M 3KP1E 2XH9A 3SATA 3FD9A 1DGFA 3GQ3A 1KFVA 2XSZA 2DHRA 1E94E 2Y0TA 4LJ8A 4DV6M 3T1YM 2Y21A 4G4NA 4DR1M 5EXTA 1Q3CA 3KOWE 4B3SM 2CHVA 1R6BX 1QANA 3Q8XA 1I4WA 4I5SA 5DYGA 2F4VM 2CV1A 4MB7A 4AKHA 3GLGA 4AG5A 4LG2A 3LMMA 1XNRM 3I4YA 1FNNA 3KSXA 4OVZB 4B7HA 4I81A 1QVRA 1SXJE 3GQ4A 1G41A 2UU9M 2KZSA 4D82A 2X8AA 5EP4A 3U6QA 2ERCA 4LJ5A 3I51A 3TWLA 4IBJA 5F3WA 4GC5A 4IBKA 3ZH9B 1KYIA 3AOGA 3GLIA 2DXIA 2KW0A 4LRTA 2RGOA 3TPZA 3SYKA 5ITQA 3CF0A 2X49A 3FUTA 1XC8A 4GHLA 2YQZA 3UMMA 3CF6E 4B08A 2Z3XA 3SMPA 3SARA 3UZUA 1PJIA 3SBJA 3WHKA 3HJ8A 1Q39A 4GMQA 4PDIA 4JI4M 2L09A 2CHQA 2Z4RA 1R2ZA 3VK7A 3SHFA 3T38A 4NSRA 4PD2A 1DGHB 1NNUC 2HL7A 3AV0A 1GLNA 4JI0M 4GITA 2V1CA 3J2PB 4FVMA 3UGJA 2Q2EB 4MM3B 2EUCA 4AQYM 4FWDA 3HKPA 3KVWA 4A3VB 4FW9A 3M0EA 1G59A 1UM8A 1NJGA 3CF2A 1IN7A 1L1ZA 3GRVA 1D2NA 3KSJA 3L27A 4KLNA 1IY0A 4RNAA 4I4LA 3AOEC 1XHBA 5E6JA 4NXMM 4QOZC 3HHXA 3VKHA 4NSOB 1HNZM 5H37D 2R46A 4YY3M 1IN4A 4II7A 2D7HA 5JI2E 3H4MA 3PXGA 3U5ZB 3UJNA 1XNQM 4BB9A 1C1KA 4AG6A 1H6UA 3PNVA 3GPUA 2W82A 5FTLA 3FUUA 3L25A 5EJCA 4GIPA 3HU2A 4BBAA 2HHHM 2R4JA 4LZJA 1LV7A 3E4RA 1K3WA 2UUBM 5EXPA 1QAMA 4FWHA 2VQFM 1IY2A 5FTNA 5A2QS 7CATA 5IZ7D 4LF4M 4DR2M 2NQ8C 2J7OA 3GQ5A 2UUAM 1YE9A 4DR6M 1TGUA 3OTOM 4OW0A 4QNMA 5FTJA 3VFDA 5EP1A 3PFIA 1IN6A 5FSWA 4DR4M 1XXHA 5LMNM 4GH9A 3SAUA 1HNXM 2UXBM 2QPAA 4XBOA 2XGNA 1JQJC 1TDHA 4W5WA 4KODA 4WW0A 1K82A 2I7PA 5KO3A 4K0KM 1MU5A 2HKJA 4MH0E 2LXEA 2QCUA 3DA1A 4IBDA 3KS4A 4EIWA 4LJ9A 1N36M 3HJSA 4LJ6A 4LJ7A 3UK6A 1ORYB 1N34M 3CTWB 1HT1E 2R18A 4KHPM 2D7EA 1QAOA 1J7KA 5BR8M 3J7AS 1YUBA 2UXCM 4JXJA 3U6OA 1NJFA 2F5SA 4TUWA 4DUYM 4M9ZA 3M7GA 2QBYB 1L1TA 3TQSA 3U60A 3SMSA 1GL7A 1Z5CA 2C96A 4FCVA 5ITXA 4S12A 3A46A 3KXEC 3MK6A 1XMQM 4G4QA 2V6ZM 4LZZA 1HR0M 2XLJA 2L7HA 4LFBM 3BOSA 2KRUA 1IY1A 3L29A 3RGPA 5EP2A 4DV7M 1JR3A 4L8RC 4WURA 3AL0C 3HJQA 4IJFA 3VDUA 3QWLA 4L4UA 3PNYA 4Z6YA 2CV0A 4X64M 3VDPA 4AZFA 3J27B 3KOXE 4MGIE 1TDZA 1Q3BA 2BJWA 2CUZA 4DV3M 3SYLA 4JI7M 4LF9M 4HL4A 4D80A 2F5PA 2G5GX 3FTEA 4L15A 1R2YA 3KP0E 3IG8A 1L2DA 4NL4H 1QAQA 2HCBA 3K1JA 1QQWA 2C9CA 4IBFA 3U6LA 4LJ4A 1FJGM 4P16A 4R7GA 3PVSA 3E9SA 4IBGA 5EXSA 3HWSA 3SFZA 2XZFA 4DV0M 4LFAM 3U61A 3GLHA 3FKEA 1SXJA 2YNMD 2C99A 4JYAM 3HGIA 3SC3A 4M9SA 1WXQA 4JI2M 4IBEA 3HU3A 1DGBA 4NOOB 5C18A 4ZPXA 1PJJA 5LMUM 5DYIA 3GP1A 3GLFB 1XXHB 3GRUA 3JR5A 3LVWA 2DWZB 2ZAMA 4JI5M 1QYRA 2XFSA 4CGYB 2XSZD 2DWMA 4FCWA 2VIIA 3K2LA 1L8QA 3HU1A 2F5OA 5FTKA 3GRRA 4QNRA 2KXEA 3IG5A 4Z8XA 4MGZE 1N33M 1GKIA 4NRVA 4PDGA 4G4OA 1GL6A 2XEPA 1IN5A 2FE8A 3HHWA 4DR5M 4GHAA 3WHLA 5KQ8A 2ZANA 4FWGA 2DWLA 4JV5M 1E9SA 2J7NA 3AJIB 4LF8M 4B7FA 4FCTA 4OU7A 3J81S 2C5RA 2CEAA 4D81A 4R3DA 2A5YB 5KQDA 4JN6A 3FUWA 3GO8A 3FTDA 3GLGB 3VKGA 3LQRA 3DZDA 1DGGA 3SHGB 2ZM6M 1L2CA 2UUCM 3K8ZA 2KZUA 5EQTA 3A42A 1X37A 3JAMS 2I7NA 3THGA 4X66M 2Y0QA 3EIHA 1NY5A 5ITTA 1IXSB 1G8PA 5IT9S 1HQYE 2R65A 3NBIA 3TWKA 4PT5A 3A98B 3L26A 4AI6A 2FOIC 4RF1A 1J5EM 1HT2E 2EA0A 4BLCA 2QZ4A 4NRWA 3GLIB 4GKJM 1Z5BA 4L78A 2OQ4A 2XF3A 1TH3A 3I4VA 2QP9X 1MX0A 4QHTA 1DGHA 3FYDA 1S3SA 1ZAEA 2XFTA 4RF0A 4HLQA 1Z5AA 3ZCBB 1NVMA 1W5SA 4X65M 3U6EA 2R4EA 4CISA 1IBKM 3SAVA 3R9XB 4DR3M 4X62M 3ZC7B 3AFHA 3JR4A 3SASA 3VK8A 3U61B 3FTFA 4QOSA 3TE6A 1SXJB 1E9RA 8CATA 4FD2A 4JI8M 2DZNB 4LY6A 3KOZE 2AHMA 3J80S 3U6SA 3T15A 3U5ZA 4AKGA 2R62A 1ZQ9A 1OJLA 3GPYA 3K92A 4AKIA 2RGHA 3GRYA 4MGYE 4DV1M 3RE8A 1HNWM 2KEBA 2UXDM 5E26A 1TH4A 1G3IA 2KA6B 3W0LB 1IBLM 1NY6A 2V1UA 3KS8A 1NHGC 1IM2A 1OFHA 1IN8A 5EXXA 1Z59A 3KW6A 4IJEA 4KO8A 3HHZA 3U6PA 1VDDA 4B3MM 3B9PA 1T3TA 4DUZM 2Y20A 2R45A 4IBIA 2H1RA 1IXRC 2JA2A 4LGMA 2EO2A 3DOAA 4LFCM 3DFZA 4IIWA 1DO2A 3T1HM 1NNJA 1N78A 2LWXA 4B7GA 4DR7M 5BPVA 3LVVA 3MJ5A 2M60A 1NSFA 3U6DA 1K3XA 3R8FA 5ITRA 4YHHM 3A45A 5KPZA 4XGIA 2Z7JA 4PCZA 1XWIA 2LH0A 1I94M 2YR0A 4DV2M 3RFWA 3GPPA 2VQEM 2P5TA 3RGSA 1YSYA 2FFJA 3L2AA 1SXJC 2ZAOA 2CHGA 4DV5M 1KSFX 1PM5A 3KOYE 1G4AE 2DWNA 4M0DA 3HHYA 1GVNA 3LQQA 2QBYA 2M5ZA 4LJAA 1L2BA 3EIEA 4CHTB 3L28A 5FLXS 3FTCA 5FTMA 5KPTA 2C9OA 4B3TM 4OVZA 1R7RA 1QZMA 1N75A 2CE7A 1EE8A 2F5NA 4JI1M 1E32A 3AOEA 3GPXA 2ZBKB 2G8LA 4G6ZA 2C98A 3MHVC 4LGYA 1IQPA 4I8OA 4OX9M 3VLFB 4GRIA 2F5QA 4L16A 3TWMA 3U60B 1JR3D 5IREB 3ILKA 4JI3M 1XMOM 4JI6M 3KFUG 5JI3E 2XZUA 4AW4A 2E5LM 5GKNA 1DO0A 2OPFA 3KDSE 2BNKA 4LF7M 1IXZA 2FNAA 4LRSA 4GKKM 2DZOB 1TH2A 3FUXA 4ITQA 2YFQA 3NWLA 3QAUA 3J7BA 3W0FA 3C58A 5C1BA 3U6CA 4MGKE 1W5TA 2D7GA 3D8BA 1HQCA 4IBCA 5ITUA 2BJVA 2Z4SA 2CFOA 2L7IA 2CV2A 2L6OA 1J09A 2O5RA 3FUVA 5DNYA 4IBBA 2RKOA 5ITYA 4NXNM 2KRKA 4DV4M 1OFIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4LF5 M;  5ITX E;  5IWA M;  1HNZ M;  3U6M A;  4YY3 M;  1HNW M;  4DV1 M;  2UXD M;  3SAW A;  1N32 M;  2XZF A;  4DV0 M;  4LFA M;  1IBM M;  1IBL M;  1XNQ M;  1Z59 A;  4JYA M;  3GPU A;  3U6P A;  4B3M M;  4DUZ M;  4JI2 M;  4B3R M;  2HHH M;  1PJJ A;  5LMU M;  3DOA A;  4LFC M;  1K3W A;  3GP1 A;  3T1H M;  2UUB M;  3JR5 A;  1NNJ A;  4G4R A;  4LF6 M;  4DR7 M;  3SAT A;  4JI5 M;  2VQF M;  3GQ3 A;  1KFV A;  5A2Q S;  2F5O A;  4LF4 M;  4DR2 M;  3U6D A;  3GQ5 A;  1K3X A;  2UUA M;  4DV6 M;  3T1Y M;  4DR6 M;  4G4N A;  4DR1 M;  5ITR A;  1Q3C A;  3OTO M;  4NRV A;  4B3S M;  1N33 M;  4PDG A;  4G4O A;  4YHH M;  3A45 A;  4DR5 M;  2F4V M;  4PCZ A;  4MB7 A;  1I94 M;  4DR4 M;  5LMN M;  4DV2 M;  3SAU A;  1HNX M;  2UXB M;  3GPP A;  2VQE M;  4JV5 M;  4LF8 M;  1XNR M;  1TDH A;  3J81 S;  1K82 A;  4DV5 M;  4K0K M;  1PM5 A;  1MU5 A;  3GQ4 A;  2UU9 M;  2HKJ A;  3GO8 A;  3U6Q A;  2ZM6 M;  1N36 M;  1L2C A;  3TWL A;  2UUC M;  3A42 A;  1N34 M;  3JAM S;  1L2B A;  4KHP M;  4X66 M;  5ITT A;  5BR8 M;  3J7A S;  2UXC M;  5IT9 S;  3U6O A;  5FLX S;  2F5S A;  4DUY M;  1FJG M;  4B3T M;  5ITQ A;  1L1T A;  1Z5C A;  1EE8 A;  3TWK A;  1XC8 A;  2F5N A;  4JI1 M;  3GPX A;  5ITX A;  2EA0 A;  1J5E M;  3SAR A;  4NRW A;  3A46 A;  2ZBK B;  1XMQ M;  4GKJ M;  1Z5B A;  4G4Q A;  2OQ4 A;  1HR0 M;  4OX9 M;  1PJI A;  3SBJ A;  4LFB M;  1MX0 A;  2F5Q A;  3TWM A;  1XMO M;  4JI3 M;  4DV7 M;  4JI6 M;  1Q39 A;  2XZU A;  4PDI A;  4JI4 M;  2E5L M;  2OPF A;  1R2Z A;  4LF7 M;  1Z5A A;  3VK7 A;  4GKK M;  4X64 M;  4X65 M;  3U6E A;  4PD2 A;  4ITQ A;  4CIS A;  4JI0 M;  3W0F A;  3C58 A;  1Q3B A;  1TDZ A;  1IBK M;  3SAV A;  4DV3 M;  3U6C A;  4DR3 M;  2Q2E B;  4X62 M;  4AQY M;  3SAS A;  3JR4 A;  4JI7 M;  3VK8 A;  4LF9 M;  2F5P A;  5ITU A;  1R2Y A;  1L2D A;  1L1Z A;  4JI8 M;  5ITY A;  4NXN M;  3U6L A;  3J80 S;  3U6S A;  4DV4 M;  4NXM M;  3GPY A; 
#chains in the Genus database with same CATH topology
 4LF5 M;  5ITX E;  5IWA M;  3U6M A;  4LCB A;  3FYC A;  1NHW C;  1TF0 B;  4GC9 A;  4QHS A;  2QEN A;  3SAW A;  1OKS A;  1N32 M;  1IBM M;  1WHC A;  3B7Q A;  1JR3 E;  4REZ A;  1SXJ D;  3AKZ A;  4GEW A;  1Z6T A;  2X4A A;  1N77 A;  3TL4 X;  3M6A A;  3GLF A;  2K47 A;  4ANR A;  4B3R M;  4M9X A;  3GLH B;  2CRU A;  5EP3 A;  2LNH C;  4MGH A;  5KPR A;  3D8L A;  2JZ1 A;  2DVW B;  4M0W A;  4G4R A;  4LF6 M;  3KP1 E;  2XH9 A;  3SAT A;  1OAI A;  2KDL A;  3FD9 A;  1DGF A;  3GQ3 A;  1KFV A;  2XSZ A;  2DHR A;  1E94 E;  2Y0T A;  2MGW A;  4LJ8 A;  4DV6 M;  2KNA A;  3HY5 A;  2JY7 A;  3T1Y M;  2Y21 A;  4G4N A;  4DR1 M;  5EXT A;  1Q3C A;  3KOW E;  4B3S M;  2CHV A;  1R6B X;  1QAN A;  3Q8X A;  1I4W A;  4I5S A;  1ZV1 A;  5DYG A;  2F4V M;  2L4E A;  2CV1 A;  2BWB A;  4MB7 A;  4AKH A;  3GLG A;  4AG5 A;  1UFZ A;  1RU3 A;  3GLH E;  3LMM A;  4LG2 A;  1XNR M;  3I4Y A;  1FNN A;  3KSX A;  4OVZ B;  4B7H A;  4I81 A;  1QVR A;  1SXJ E;  3GQ4 A;  1G41 A;  2UU9 M;  1VEJ A;  1QZE A;  2KZS A;  4D82 A;  2DAM A;  2QNJ A;  3V76 A;  1C7Y A;  2X8A A;  5EP4 A;  3U6Q A;  2ZTD A;  2ERC A;  4LJ5 A;  3I51 A;  4Q7J A;  3TWL A;  4IBJ A;  1VDL A;  1HJP A;  5F3W A;  4GC5 A;  4IBK A;  3ZH9 B;  1KYI A;  3AOG A;  3GLI A;  3B74 A;  2DXI A;  2KW0 A;  4LRT A;  2RGO A;  3TPZ A;  3SYK A;  5ITQ A;  3CF0 A;  2X49 A;  3FUT A;  1XC8 A;  4GHL A;  2LVO C;  2YQZ A;  3UMM A;  3CF6 E;  4B08 A;  2Z3X A;  3SMP A;  3SAR A;  3NBX X;  3UZU A;  2HWJ A;  1PJI A;  3SBJ A;  3WHK A;  2O25 A;  3HJ8 A;  1Q39 A;  4GMQ A;  2EKK A;  4PDI A;  4JI4 M;  2L09 A;  2CHQ A;  3QYE A;  2Z4R A;  1R2Z A;  3VK7 A;  3SHF A;  3T38 A;  4NSR A;  1TR8 A;  4PD2 A;  1DGH B;  1NNU C;  2HL7 A;  3AV0 A;  1GLN A;  3LW5 F;  4JI0 M;  4GIT A;  4R71 A;  2V1C A;  3J2P B;  4FVM A;  3UGJ A;  2Q2E B;  4MM3 B;  2EUC A;  4AQY M;  4FWD A;  3HKP A;  3KVW A;  3FRI A;  4A3V B;  4FW9 A;  2VDB B;  3M0E A;  1D0K A;  1G59 A;  1UM8 A;  1WIV A;  1NV9 A;  2WZJ A;  1NJG A;  3FE3 A;  5L8R F;  3CF2 A;  1IN7 A;  1L1Z A;  3GRV A;  1D2N A;  3KSJ A;  3L27 A;  4KLN A;  1F4I A;  1IY0 A;  2MR9 A;  4RNA A;  4I4L A;  1XHB A;  3AOE C;  5E6J A;  4NXM M;  4QOZ C;  3HHX A;  1NO1 A;  4NSO B;  1HNZ M;  3VKH A;  1A5T A;  2R46 A;  5H37 D;  4YY3 M;  1IN4 A;  4II7 A;  1WR1 B;  2D7H A;  2DAK A;  3LCU A;  5JI2 E;  3FRH A;  3H4M A;  4CJ6 A;  1VEG A;  3PXG A;  3U5Z B;  2OO9 A;  3UJN A;  1XNQ M;  4BB9 A;  1C1K A;  2QSF X;  4AG6 A;  1H6U A;  3PNV A;  3GPU A;  2W82 A;  5FTL A;  3FUU A;  3L25 A;  4RKU F;  1QDT A;  5EJC A;  4F2L A;  4GIP A;  3HU2 A;  4BBA A;  1V92 A;  2HHH M;  1Y8G A;  2CWB A;  2LHG A;  2OOA A;  2R4J A;  1LV7 A;  2R44 A;  2KNZ A;  3E4R A;  4LZJ A;  1K3W A;  1OTR A;  2DKL A;  2UUB M;  2K0B X;  2K6B A;  1QAM A;  5EXP A;  1T6O A;  1PRB A;  4FWH A;  2VQF M;  1IY2 A;  5FTN A;  5A2Q S;  7CAT A;  5IZ7 D;  4LF4 M;  4DR2 M;  2NQ8 C;  2J7O A;  1ZMW A;  3GQ5 A;  2UUA M;  1YE9 A;  4DR6 M;  1TGU A;  3OTO M;  3Q8G A;  4OW0 A;  4QNM A;  1OIP A;  5FTJ A;  4F1I A;  3VFD A;  5EP1 A;  3MMP A;  3PFI A;  1IN6 A;  5FSW A;  4DR4 M;  1XXH A;  5LMN M;  4Y28 F;  4GH9 A;  3SAU A;  1HNX M;  2UXB M;  2QPA A;  4XBO A;  2JY6 B;  2XGN A;  1JQJ C;  1TDH A;  4W5W A;  1R4G A;  4KOD A;  4WW0 A;  3ZQJ A;  2I7P A;  5KO3 A;  1K82 A;  4K0K M;  1MU5 A;  2HKJ A;  4MH0 E;  2LXE A;  2KHH A;  2QCU A;  3DA1 A;  3KS4 A;  2ZTC A;  4IBD A;  2DHY A;  3HX3 A;  1ZMV A;  3IHP A;  2VF7 A;  4LJ9 A;  4EIW A;  1N36 M;  3HJS A;  1GO5 A;  4LJ6 A;  4LJ7 A;  3UK6 A;  4DBG B;  1ORY B;  1N34 M;  3CTW B;  1HT1 E;  2R18 A;  4KHP M;  2DNA A;  2D7E A;  2JY5 A;  1GJT A;  1QAO A;  1J7K A;  4XK8 F;  5BR8 M;  4CIZ A;  1YUB A;  3J7A S;  3E46 A;  4JXJ A;  3U6O A;  2UXC M;  1NJF A;  2H5X A;  2F5S A;  4DUY M;  4M9Z A;  3M7G A;  4TUW A;  2QBY B;  1L1T A;  3TQS A;  1AIP C;  3U60 A;  3SMS A;  1GL7 A;  1Z5C A;  2C96 A;  1DV0 A;  2L2D A;  4FCV A;  5ITX A;  3K9P A;  4S12 A;  3A46 A;  3KXE C;  3MK6 A;  1XMQ M;  4G4Q A;  2V6Z M;  5DFL A;  4LZZ A;  1TTE A;  2XLJ A;  2L7H A;  1HR0 M;  4L6V 6;  4LFB M;  3BOS A;  2KRU A;  1IY1 A;  3L29 A;  3RGP A;  1V34 A;  1Q02 A;  2DAE A;  5EP2 A;  4DV7 M;  1JR3 A;  4L8R C;  1NV8 A;  4WUR A;  3AL0 C;  3HJQ A;  1IXS A;  4IJF A;  3VDU A;  3LCV B;  3QWL A;  3PNY A;  4L4U A;  4Z6Y A;  2CV0 A;  4X64 M;  3VDP A;  4AZF A;  2RRU A;  3IEC A;  3J27 B;  1LTM A;  3KOX E;  4MGI E;  2QHO B;  1TDZ A;  1Q3B A;  2BJW A;  2CUZ A;  4DV3 M;  3SYL A;  1AUA A;  4JI7 M;  4HL4 A;  4LF9 M;  4D80 A;  2WSC F;  1SG9 A;  1EFU B;  2F5P A;  2J5Y A;  2G5G X;  3FTE A;  4L15 A;  2LVP C;  4KT0 F;  3KP0 E;  3IG8 A;  1R2Y A;  4NL4 H;  1L2D A;  1QAQ A;  2HCB A;  3K1J A;  1QQW A;  2C9C A;  2GNO A;  4IBF A;  3U6L A;  4LJ4 A;  1FJG M;  4P16 A;  4R7G A;  3PVS A;  3E9S A;  1R5L A;  4IBG A;  5EXS A;  1PGY A;  3HWS A;  1P3Q Q;  4HEO A;  3E21 A;  1OIZ A;  1PJQ A;  2LTU A;  3SFZ A;  2XZF A;  4DV0 M;  4LFA M;  3BBZ A;  3U61 A;  3GLH A;  3FKE A;  2JWS A;  1YLA A;  2MJ5 B;  1SXJ A;  2YNM D;  2C99 A;  4JYA M;  3HGI A;  3SC3 A;  2L4F A;  4M9S A;  1WXQ A;  2CP8 A;  1VG5 A;  4JI2 M;  4IBE A;  2JXN A;  1DGB A;  3HU3 A;  4NOO B;  5C18 A;  4ZPX A;  2LHC A;  1PJJ A;  5LMU M;  4G3O A;  1VQ1 A;  5DYI A;  3GP1 A;  1GJS A;  3GLF B;  1XXH B;  3GRU A;  3JR5 A;  3LVW A;  2DWZ B;  2ZAM A;  4JI5 M;  1QYR A;  2XFS A;  4CGY B;  2XSZ D;  2DWM A;  4FCW A;  2VII A;  3K2L A;  1L8Q A;  3HU1 A;  1D0M A;  2F5O A;  5FTK A;  2JZ0 A;  3GRR A;  4QNR A;  1IFY A;  2KXE A;  3IG5 A;  4Z8X A;  4MGZ E;  1N33 M;  1GKI A;  4NRV A;  4PDG A;  2DAG A;  4G4O A;  3B7N A;  1GL6 A;  1XB2 B;  2XEP A;  1IN5 A;  2FE8 A;  3HHW A;  4DR5 M;  4GHA A;  3WHL A;  2LVN C;  5KQ8 A;  2ZAN A;  4FWG A;  2DWL A;  4JV5 M;  1E9S A;  2J7N A;  3AJI B;  4LF8 M;  4B7F A;  1ZMU A;  4FCT A;  4OU7 A;  2N35 A;  3J81 S;  2CEA A;  2C5R A;  4D81 A;  4R3D A;  2A5Y B;  5KQD A;  4JN6 A;  3FUW A;  3GLF E;  3GO8 A;  2LVA A;  3FTD A;  3GLG B;  3VKG A;  3LQR A;  3DZD A;  1DGG A;  3SHG B;  2ZM6 M;  1L2C A;  2UUC M;  3K8Z A;  2KZU A;  5EQT A;  3A42 A;  1X37 A;  4WP2 A;  3JAM S;  2I7N A;  2JY8 A;  2MRO B;  3THG A;  4X66 M;  3B7Z A;  2Y0Q A;  3EIH A;  1NY5 A;  5ITT A;  1IXS B;  1G8P A;  5IT9 S;  2EJS A;  1HQY E;  2R65 A;  3NBI A;  2GQF A;  1JB0 F;  4PT5 A;  3A98 B;  3TWK A;  3L26 A;  4AI6 A;  1GAB A;  2FOI C;  4RF1 A;  1J5E M;  1HT2 E;  2EA0 A;  4BLC A;  2B3T A;  2FS1 A;  2QZ4 A;  3GLI B;  4NRW A;  1Z5B A;  4GKJ M;  4L78 A;  3T6P A;  2OQ4 A;  2XF3 A;  1TH3 A;  1MJG M;  3I4V A;  1BVS A;  2QP9 X;  1MX0 A;  4QHT A;  1DGH A;  3FYD A;  1S3S A;  1ZAE A;  3GLG E;  1QUT A;  2XFT A;  4RF0 A;  2K9D A;  4HLQ A;  1CUK A;  3BXW A;  1Z5A A;  3I01 M;  1NVM A;  3CGW A;  3ZCB B;  1W5S A;  4X65 M;  2KNV A;  3U6E A;  2R4E A;  1MN3 A;  2R6F A;  4CIS A;  1IBK M;  3SAV A;  3R9X B;  4DR3 M;  4X62 M;  3ZC7 B;  3AFH A;  3JR4 A;  3SAS A;  3VK8 A;  4NC6 A;  3U61 B;  3H4J A;  3FTF A;  4QOS A;  3GLI E;  3TE6 A;  1SXJ B;  2JNH A;  1E9R A;  8CAT A;  4FD2 A;  4JI8 M;  2DZN B;  1WGN A;  2DEN A;  3KOZ E;  4LY6 A;  2AHM A;  3J80 S;  3U6S A;  3T15 A;  3U5Z A;  4AKG A;  2R62 A;  1ZQ9 A;  1OJL A;  3GPY A;  3K92 A;  4AKI A;  2RGH A;  3GRY A;  4MGY E;  4DV1 M;  3RE8 A;  1HNW M;  2KEB A;  2UXD M;  2OOB A;  5E26 A;  1TH4 A;  1QDR A;  1G3I A;  2KA6 B;  3W0L B;  1IBL M;  1NY6 A;  2V1U A;  3KS8 A;  1NHG C;  1IM2 A;  1OFH A;  1IN8 A;  5EXX A;  1Z59 A;  3KW6 A;  4IJE A;  4KO8 A;  1V33 A;  4P17 A;  3HHZ A;  2R0I A;  2HAK A;  1VDD A;  3U6P A;  3B9P A;  1T3T A;  4B3M M;  4DUZ M;  2Y20 A;  2R45 A;  4IBI A;  2H1R A;  1IXR C;  2Z8Y M;  2JA2 A;  4LGM A;  2EO2 A;  3DOA A;  4LFC M;  3DFZ A;  4IIW A;  1DO2 A;  2O01 F;  1PJT A;  3T1H M;  1NNJ A;  1N78 A;  2LWX A;  4B7G A;  4DR7 M;  5BPV A;  1D0L A;  2WSE F;  3LVV A;  3MJ5 A;  2M60 A;  1NSF A;  1T43 A;  2JUJ A;  2VF8 A;  3U6D A;  1K3X A;  3QYB A;  3R8F A;  3I04 M;  5ITR A;  2FH0 A;  4YHH M;  3A45 A;  5KPZ A;  2DZL A;  4XGI A;  2Z7J A;  4PCZ A;  1XWI A;  2LH0 A;  1OAO C;  1I94 M;  2G3Q A;  2YR0 A;  4DV2 M;  1WJ7 A;  2BWE A;  3RFW A;  3GPP A;  2VQE M;  2P5T A;  3RGS A;  1YSY A;  2FFJ A;  3L2A A;  1SXJ C;  2ZAO A;  3K9O A;  2CHG A;  4DV5 M;  1KSF X;  1PM5 A;  3KOY E;  1G4A E;  2DWN A;  4M0D A;  1G71 A;  1QUS A;  3HHY A;  1GVN A;  3LQQ A;  2QBY A;  3W68 A;  1PJS A;  2M5Z A;  4LJA A;  1L2B A;  3EIE A;  4CHT B;  3L28 A;  5FLX S;  3FTC A;  5FTM A;  2EKF A;  5KPT A;  2C9O A;  4B3T M;  4OVZ A;  1R7R A;  1QZM A;  1N75 A;  2CE7 A;  2DI0 A;  1EE8 A;  2F5N A;  4JI1 M;  1VEK A;  1E32 A;  3AOE A;  3GPX A;  3C3D A;  2LVQ D;  2G8L A;  2ZBK B;  2C98 A;  4G6Z A;  3B89 A;  3MHV C;  1IQP A;  4I8O A;  4LGY A;  2JP7 A;  4OX9 M;  3VLF B;  3C3E A;  4UN2 B;  3C9P A;  4GRI A;  2F5Q A;  4L16 A;  3TWM A;  2LBC A;  1JR3 D;  3U60 B;  5IRE B;  3F92 A;  3ILK A;  4JI3 M;  1XMO M;  4JI6 M;  5JI3 E;  3KFU G;  2XZU A;  1XXH E;  4AW4 A;  2E5L M;  5GKN A;  1DO0 A;  2OPF A;  3KDS E;  2BNK A;  4LF7 M;  2MH8 A;  1IXZ A;  2FNA A;  4LRS A;  4GKK M;  2DZO B;  1TH2 A;  3FUX A;  2QQ8 A;  4ITQ A;  2YFQ A;  1WGL A;  3NWL A;  3J7B A;  3QAU A;  3W0F A;  5C1B A;  3C58 A;  3U6C A;  4MGK E;  1W5T A;  2D7G A;  2APL A;  3D8B A;  1HQC A;  1EIJ A;  2WSF F;  4IBC A;  3HZJ A;  2BJV A;  2Z4S A;  2CFO A;  5ITU A;  2L7I A;  2CV2 A;  2L6O A;  1J09 A;  2DAI A;  2O5R A;  1OQY A;  3FUV A;  3W67 A;  5DNY A;  4IBB A;  2RKO A;  5ITY A;  4NXN M;  2KRK A;  4DV4 M;  1OFI A; 
#chains in the Genus database with same CATH homology
 4LF5 M;  5ITX E;  5IWA M;  3U6M A;  4LCB A;  3FYC A;  1NHW C;  4GC9 A;  4QHS A;  2QEN A;  3SAW A;  1N32 M;  1IBM M;  4REZ A;  1SXJ D;  3AKZ A;  1Z6T A;  2X4A A;  1N77 A;  3TL4 X;  3M6A A;  3GLF A;  2K47 A;  4B3R M;  4M9X A;  3GLH B;  5EP3 A;  2LNH C;  4MGH A;  5KPR A;  3D8L A;  2DVW B;  4M0W A;  4G4R A;  4LF6 M;  3KP1 E;  2XH9 A;  3SAT A;  3FD9 A;  1DGF A;  3GQ3 A;  1KFV A;  2XSZ A;  2DHR A;  1E94 E;  2Y0T A;  4LJ8 A;  4DV6 M;  3T1Y M;  2Y21 A;  4G4N A;  4DR1 M;  5EXT A;  1Q3C A;  3KOW E;  4B3S M;  2CHV A;  1R6B X;  1QAN A;  3Q8X A;  1I4W A;  4I5S A;  5DYG A;  2F4V M;  2CV1 A;  4MB7 A;  4AKH A;  3GLG A;  4AG5 A;  4LG2 A;  3LMM A;  1XNR M;  3I4Y A;  1FNN A;  3KSX A;  4OVZ B;  4B7H A;  4I81 A;  1QVR A;  1SXJ E;  3GQ4 A;  1G41 A;  2UU9 M;  2KZS A;  4D82 A;  2X8A A;  5EP4 A;  3U6Q A;  2ERC A;  4LJ5 A;  3I51 A;  3TWL A;  4IBJ A;  5F3W A;  4GC5 A;  4IBK A;  3ZH9 B;  1KYI A;  3AOG A;  3GLI A;  2DXI A;  2KW0 A;  4LRT A;  2RGO A;  3TPZ A;  3SYK A;  5ITQ A;  3CF0 A;  2X49 A;  3FUT A;  1XC8 A;  4GHL A;  2YQZ A;  3UMM A;  3CF6 E;  4B08 A;  2Z3X A;  3SMP A;  3SAR A;  3UZU A;  1PJI A;  3SBJ A;  3WHK A;  3HJ8 A;  1Q39 A;  4GMQ A;  4PDI A;  4JI4 M;  2L09 A;  2CHQ A;  2Z4R A;  1R2Z A;  3VK7 A;  3SHF A;  3T38 A;  4NSR A;  4PD2 A;  1DGH B;  1NNU C;  2HL7 A;  3AV0 A;  1GLN A;  4JI0 M;  4GIT A;  2V1C A;  3J2P B;  4FVM A;  3UGJ A;  2Q2E B;  4MM3 B;  2EUC A;  4AQY M;  4FWD A;  3HKP A;  3KVW A;  4A3V B;  4FW9 A;  3M0E A;  1G59 A;  1UM8 A;  1NJG A;  3CF2 A;  1IN7 A;  1L1Z A;  3GRV A;  1D2N A;  3KSJ A;  3L27 A;  4KLN A;  1IY0 A;  4RNA A;  4I4L A;  3AOE C;  1XHB A;  5E6J A;  4NXM M;  4QOZ C;  3HHX A;  3VKH A;  4NSO B;  1HNZ M;  5H37 D;  2R46 A;  4YY3 M;  1IN4 A;  4II7 A;  2D7H A;  5JI2 E;  3H4M A;  3PXG A;  3U5Z B;  3UJN A;  1XNQ M;  4BB9 A;  1C1K A;  4AG6 A;  1H6U A;  3PNV A;  3GPU A;  2W82 A;  5FTL A;  3FUU A;  3L25 A;  5EJC A;  4GIP A;  3HU2 A;  4BBA A;  2HHH M;  2R4J A;  4LZJ A;  1LV7 A;  3E4R A;  1K3W A;  2UUB M;  5EXP A;  1QAM A;  4FWH A;  2VQF M;  1IY2 A;  5FTN A;  5A2Q S;  7CAT A;  5IZ7 D;  4LF4 M;  4DR2 M;  2NQ8 C;  2J7O A;  3GQ5 A;  2UUA M;  1YE9 A;  4DR6 M;  1TGU A;  3OTO M;  4OW0 A;  4QNM A;  5FTJ A;  3VFD A;  5EP1 A;  3PFI A;  1IN6 A;  5FSW A;  4DR4 M;  1XXH A;  5LMN M;  4GH9 A;  3SAU A;  1HNX M;  2UXB M;  2QPA A;  4XBO A;  2XGN A;  1JQJ C;  1TDH A;  4W5W A;  4KOD A;  4WW0 A;  1K82 A;  2I7P A;  5KO3 A;  4K0K M;  1MU5 A;  2HKJ A;  4MH0 E;  2LXE A;  2QCU A;  3DA1 A;  4IBD A;  3KS4 A;  4EIW A;  4LJ9 A;  1N36 M;  3HJS A;  4LJ6 A;  4LJ7 A;  3UK6 A;  1ORY B;  1N34 M;  3CTW B;  1HT1 E;  2R18 A;  4KHP M;  2D7E A;  1QAO A;  1J7K A;  5BR8 M;  3J7A S;  1YUB A;  2UXC M;  4JXJ A;  3U6O A;  1NJF A;  2F5S A;  4TUW A;  4DUY M;  4M9Z A;  3M7G A;  2QBY B;  1L1T A;  3TQS A;  3U60 A;  3SMS A;  1GL7 A;  1Z5C A;  2C96 A;  4FCV A;  5ITX A;  4S12 A;  3A46 A;  3KXE C;  3MK6 A;  1XMQ M;  4G4Q A;  2V6Z M;  4LZZ A;  1HR0 M;  2XLJ A;  2L7H A;  4LFB M;  3BOS A;  2KRU A;  1IY1 A;  3L29 A;  3RGP A;  5EP2 A;  4DV7 M;  1JR3 A;  4L8R C;  4WUR A;  3AL0 C;  3HJQ A;  4IJF A;  3VDU A;  3QWL A;  4L4U A;  3PNY A;  4Z6Y A;  2CV0 A;  4X64 M;  3VDP A;  4AZF A;  3J27 B;  3KOX E;  4MGI E;  1TDZ A;  1Q3B A;  2BJW A;  2CUZ A;  4DV3 M;  3SYL A;  4JI7 M;  4LF9 M;  4HL4 A;  4D80 A;  2F5P A;  2G5G X;  3FTE A;  4L15 A;  1R2Y A;  3KP0 E;  3IG8 A;  1L2D A;  4NL4 H;  1QAQ A;  2HCB A;  3K1J A;  1QQW A;  2C9C A;  4IBF A;  3U6L A;  4LJ4 A;  1FJG M;  4P16 A;  4R7G A;  3PVS A;  3E9S A;  4IBG A;  5EXS A;  3HWS A;  3SFZ A;  2XZF A;  4DV0 M;  4LFA M;  3U61 A;  3GLH A;  3FKE A;  1SXJ A;  2YNM D;  2C99 A;  4JYA M;  3HGI A;  3SC3 A;  4M9S A;  1WXQ A;  4JI2 M;  4IBE A;  3HU3 A;  1DGB A;  4NOO B;  5C18 A;  4ZPX A;  1PJJ A;  5LMU M;  5DYI A;  3GP1 A;  3GLF B;  1XXH B;  3GRU A;  3JR5 A;  3LVW A;  2DWZ B;  2ZAM A;  4JI5 M;  1QYR A;  2XFS A;  4CGY B;  2XSZ D;  2DWM A;  4FCW A;  2VII A;  3K2L A;  1L8Q A;  3HU1 A;  2F5O A;  5FTK A;  3GRR A;  4QNR A;  2KXE A;  3IG5 A;  4Z8X A;  4MGZ E;  1N33 M;  1GKI A;  4NRV A;  4PDG A;  4G4O A;  1GL6 A;  2XEP A;  1IN5 A;  2FE8 A;  3HHW A;  4DR5 M;  4GHA A;  3WHL A;  5KQ8 A;  2ZAN A;  4FWG A;  2DWL A;  4JV5 M;  1E9S A;  2J7N A;  3AJI B;  4LF8 M;  4B7F A;  4FCT A;  4OU7 A;  3J81 S;  2C5R A;  2CEA A;  4D81 A;  4R3D A;  2A5Y B;  5KQD A;  4JN6 A;  3FUW A;  3GO8 A;  3FTD A;  3GLG B;  3VKG A;  3LQR A;  3DZD A;  1DGG A;  3SHG B;  2ZM6 M;  1L2C A;  2UUC M;  3K8Z A;  2KZU A;  5EQT A;  3A42 A;  1X37 A;  3JAM S;  2I7N A;  3THG A;  4X66 M;  2Y0Q A;  3EIH A;  1NY5 A;  5ITT A;  1IXS B;  1G8P A;  5IT9 S;  1HQY E;  2R65 A;  3NBI A;  3TWK A;  4PT5 A;  3A98 B;  3L26 A;  4AI6 A;  2FOI C;  4RF1 A;  1J5E M;  1HT2 E;  2EA0 A;  4BLC A;  2QZ4 A;  4NRW A;  3GLI B;  4GKJ M;  1Z5B A;  4L78 A;  2OQ4 A;  2XF3 A;  1TH3 A;  3I4V A;  2QP9 X;  1MX0 A;  4QHT A;  1DGH A;  3FYD A;  1S3S A;  1ZAE A;  2XFT A;  4RF0 A;  4HLQ A;  1Z5A A;  3ZCB B;  1NVM A;  1W5S A;  4X65 M;  3U6E A;  2R4E A;  4CIS A;  1IBK M;  3SAV A;  3R9X B;  4DR3 M;  4X62 M;  3ZC7 B;  3AFH A;  3JR4 A;  3SAS A;  3VK8 A;  3U61 B;  3FTF A;  4QOS A;  3TE6 A;  1SXJ B;  1E9R A;  8CAT A;  4FD2 A;  4JI8 M;  2DZN B;  4LY6 A;  3KOZ E;  2AHM A;  3J80 S;  3U6S A;  3T15 A;  3U5Z A;  4AKG A;  2R62 A;  1ZQ9 A;  1OJL A;  3GPY A;  3K92 A;  4AKI A;  2RGH A;  3GRY A;  4MGY E;  4DV1 M;  3RE8 A;  1HNW M;  2KEB A;  2UXD M;  5E26 A;  1TH4 A;  1G3I A;  2KA6 B;  3W0L B;  1IBL M;  1NY6 A;  2V1U A;  3KS8 A;  1NHG C;  1IM2 A;  1OFH A;  1IN8 A;  5EXX A;  1Z59 A;  3KW6 A;  4IJE A;  4KO8 A;  3HHZ A;  3U6P A;  1VDD A;  4B3M M;  3B9P A;  1T3T A;  4DUZ M;  2Y20 A;  2R45 A;  4IBI A;  2H1R A;  1IXR C;  2JA2 A;  4LGM A;  2EO2 A;  3DOA A;  4LFC M;  3DFZ A;  4IIW A;  1DO2 A;  3T1H M;  1NNJ A;  1N78 A;  2LWX A;  4B7G A;  4DR7 M;  5BPV A;  3LVV A;  3MJ5 A;  2M60 A;  1NSF A;  3U6D A;  1K3X A;  3R8F A;  5ITR A;  4YHH M;  3A45 A;  5KPZ A;  4XGI A;  2Z7J A;  4PCZ A;  1XWI A;  2LH0 A;  1I94 M;  2YR0 A;  4DV2 M;  3RFW A;  3GPP A;  2VQE M;  2P5T A;  3RGS A;  1YSY A;  2FFJ A;  3L2A A;  1SXJ C;  2ZAO A;  2CHG A;  4DV5 M;  1KSF X;  1PM5 A;  3KOY E;  1G4A E;  2DWN A;  4M0D A;  3HHY A;  1GVN A;  3LQQ A;  2QBY A;  2M5Z A;  4LJA A;  1L2B A;  3EIE A;  4CHT B;  3L28 A;  5FLX S;  3FTC A;  5FTM A;  5KPT A;  2C9O A;  4B3T M;  4OVZ A;  1R7R A;  1QZM A;  1N75 A;  2CE7 A;  1EE8 A;  2F5N A;  4JI1 M;  1E32 A;  3AOE A;  3GPX A;  2ZBK B;  2G8L A;  4G6Z A;  2C98 A;  3MHV C;  4LGY A;  1IQP A;  4I8O A;  4OX9 M;  3VLF B;  4GRI A;  2F5Q A;  4L16 A;  3TWM A;  3U60 B;  1JR3 D;  5IRE B;  3ILK A;  4JI3 M;  1XMO M;  4JI6 M;  3KFU G;  5JI3 E;  2XZU A;  4AW4 A;  2E5L M;  5GKN A;  1DO0 A;  2OPF A;  3KDS E;  2BNK A;  4LF7 M;  1IXZ A;  2FNA A;  4LRS A;  4GKK M;  2DZO B;  1TH2 A;  3FUX A;  4ITQ A;  2YFQ A;  3NWL A;  3QAU A;  3J7B A;  3W0F A;  3C58 A;  5C1B A;  3U6C A;  4MGK E;  1W5T A;  2D7G A;  3D8B A;  1HQC A;  4IBC A;  5ITU A;  2BJV A;  2Z4S A;  2CFO A;  2L7I A;  2CV2 A;  2L6O A;  1J09 A;  2O5R A;  3FUV A;  5DNY A;  4IBB A;  2RKO A;  5ITY A;  4NXN M;  2KRK A;  4DV4 M;  1OFI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...