1N34Q

Structure of the thermus thermophilus 30s ribosomal subunit in the presence of codon and crystallographically disordered near-cognate transfer rna anticodon stem-loop mismatched at the first codon position
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
104
structure length
104
Chain Sequence
PKKVLTGVVVSDKMQKTVTVLVERQFPHPLYGKVIKRSKKYLAHDPEEKYKLGDVVEIIESRPISKRKRFRVLRLVESGRMDLVEKYLIRRQNYQSLSKRGGKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S RIBOSOMAL RNA
publication title Selection of tRNA by the Ribosome Requires a Transition from an Open to a Closed Form
pubmed doi rcsb
molecule tags Ribosome
total genus 18
structure length 104
sequence length 104
ec nomenclature
pdb deposition date 2002-10-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Q PF00366 Ribosomal_S17 Ribosomal protein S17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 1n34Q00
2VUMG 1K8GA 4GKKQ 3KDFA 1VQHA 1YHQA 4X65Q 2R7FA 1VQ5A 2OCEA 5M3MH 1BKBA 1X3FA 3KF6B 2IX0A 1X55A 3I2ZA 4FDBA 4DR3Q 4GLVB 1IL2A 4IPDA 3MEFA 1NJIC 4A3GH 2UUAL 4BA1I 2E8GA 1Q81C 3I4NH 4B3TL 5JJKA 3KDFB 4AQYL 2AWNA 1EFWA 1X65A 4DK3C 1VQJA 4DR1Q 1FVIA 4OWXB 2R6GA 2K5VA 1K73C 1LUZA 4PMWA 2K5NA 3L0OA 3U50C 4DV4L 2OTLA 3PO3G 1HH2P 1IXRA 2NVQH 1LTLA 4A93G 2K75A 1U0LA 4L5QA 4DV0Q 2MFIA 1J5EQ 1G51A 4GNXA 2Q2UA 1VQNA 5ELOA 5IE8A 1IBLL 1EOVA 4LUVA 4DUZQ 3HOYH 4DR2Q 2A19A 4MZ9A 5M3FG 3U58A 4DNIA 3J81j 3PSIA 4RMFA 4GNXB 1Q86C 2Y0SG 2OWOA 2VZAA 4JI6Q 2H5XA 4A3BG 1QZHA 2EXDA 4IJLA 1VQ6A 5FLMH 1NBWA 3I4MH 4IFDI 1VQ8A 1K8AC 3J7A5 2MNAA 3EIVA 3OYYA 1XMOL 1XMQL 1HZ9A 1Y1VG 3S24A 1NY4A 2JJQA 4AYBG 4JI1L 3UDXA 1VQKA 2UUCL 4LF7Q 1HNWQ 4OWTB 3T1HL 1AE2A 4A3LG 4QGUA 2VUMH 4BY7G 2B63H 3F8TA 1EWIA 1VQDA 5EAYA 4JI2Q 4BY1H 3ICEA 3EN2A 1EQQA 2NZOA 1BBUA 5C3EH 2KHJA 4L5TA 1CSQA 2F3IA 1WCMH 1U5KA 4DR5L 1CKNB 3KJOA 4A3EH 4UP9A 3J81i 1X54A 1CUKA 1PH5A 1KQSA 1KRSA 4JI5Q 2NVTH 1D8LA 2Q2IA 3PO3H 2VQEL 3RNUA 2NVYH 4JI0Q 1YJNA 4A93H 4JYAQ 1N33Q 3B6YA 4DR3L 3GDEA 1Q82C 2Z0SA 2PI2E 4IO9A 1KC8C 1IYJB 2IY5B 1Q46A 3CCMA 4HIOA 4GLXA 3M4QA 1VQGA 3I7FA 4LF6Q 1V43A 1VQ9A 3GTJH 1VQ7A 4JI3Q 2RF4A 5FJ8G 1S72A 2IHFA 1N34L 3AQQA 3HOWG 1HZAA 4JI4Q 1J6QA 2F52A 1L0WA 2UUBL 1K83H 4DV0L 2B29A 1J5EL 1VCIA 2MQHA 2QGQA 1HR0Q 3CC2A 3NBHB 3M85A 2JA5G 2R92H 5HY6A 3GTMH 4DR4L 4YCVA 2FXQA 3ERSX 4JI7Q 2PQAA 4DUZL 3BU2A 4DR7Q 3HFZB 4HJ8A 4A3IG 3RLNA 3AYHB 4QIWE 3U4VA 4X64Q 4IPHA 2QA4A 4GOPA 4OO1G 2VS1A 1CSPA 2ALYB 1PH7A 1XPUA 1SRUA 1HR0W 1VQEA 4KHPQ 1PVOA 2GN5A 1XTDA 2XGTA 1JMCA 2HQLA 4LF4Q 3CXCA 4GNXC 4PZ6A 4MNOA 4H02A 1WI5A 4JBJA 3W1GA 2JA9A 4LFBL 4YCUA 4X62Q 3F2CA 3HOZH 4GN3B 4B3ML 2UXBQ 4TVAB 2OTJA 1OTCA 3K7AH 4JI2L 2NN6G 3J7ZC 2VW9A 3BZCA 4B3RQ 5IYCG 3A0JA 3HOVG 2AMCB 3AFQA 4A3DH 2BH2A 3G71A 4DV6Q 1HZBA 1NMGA 4C3HH 5C44H 5C0XI 1Y1WH 1PH3A 4JBKA 2JA7G 1ASZA 1A0IA 4JBWA 1L2FA 5C4XH 3NENA 4Y7NH 2I0QA 3K81C 1S3OA 3NEMA 4JI5L 5FJ8H 4DV2L 3KOJA 4QY7A 1RL2A 1IBKL 4OWWB 2AWOA 2E2HH 4YY3L 3H3VH 4BA2I 4K0KL 2JA6G 2CWAA 2MO0A 1MJCA 3SGIA 2HIXA 4DV7L 1WJJA 5J3BA 2LXJA 4WJ3M 3HOXG 1KL9A 3M4PA 2BH8A 2E2IH 4JG2A 3AEVA 2HT1A 2VY3A 1XNQL 4DR6Q 4JI3L 5IY0A 3GTKH 1B8AA 5AJ3L 3GTPH 3S16H 1C0AA 1M1KC 4XIGS 4NXMQ 2E2JH 3PF4A 1JJ2A 4BBSG 3S17H 4EQ5A 2D0OA 3UDFA 3PUZA 1GM5A 4LF8L 4YHHQ 4JV5Q 2KBNA 3CAMA 3CP0A 1EYGA 1XNRQ 1I94Q 1GO3E 2B3GA 1KIXA 1MIUA 2IHEA 3JC66 1JB7A 2HHHL 3TRZA 4DR7L 1YHBA 5IP7G 1QVGA 1JJCB 3RR5A 1E24A 2YU9H 3CPFA 2QEXA 3OW2A 3D31A 1OXVA 4GS3A 4R4OA 1N36L 2R7ZH 3HKZE 2WAQG 4RG1A 1IBML 4YWKA 1X3GA 1EQRA 3FP9A 2NZHA 3CC4A 1E3PA 1VQAA 3U4ZA 5IWAQ 5IP9G 3A5UA 3CCJA 1Q8KA 1HNZL 1KHIA 2K5HA 2F4VQ 1QVCA 4OX9L 4JC0A 4IFDG 2I5HA 2JK8A 4PZ8A 4WJ4A 1BBWA 1EIFA 4GN5A 3ULPA 4IOAA 4PG3A 3PCOB 3BJUA 4LF9Q 2JA6H 1Q1EA 2YTVA 5IT9c 4DV1L 1YNXA 4GOPC 1L1OA 3A74A 3K8AA 1HNXQ 4NPSA 5IYBH 3HOXH 3CCSA 1UE7A 1TXYA 4BBRG 4DV5Q 3PIPA 1VQLA 4A3CG 4IFDJ 4DV3L 2N49A 2UXCQ 3D0FA 4YWLA 3G6EA 4QQBX 3CCQA 4B3SQ 4JI8L 1C7YA 1MJEA 1DGSA 3PUWA 2NVXH 3CD6A 1L1OB 4HJ7A 1GVPA 1CKOA 3ULJA 3MXNB 1VQ4A 4HIKA 2C35B 1XPOA 5BR8Q 4HJAA 3ER0A 3K7UC 4R4QA 1TWGH 1C9OA 2ZJRA 1N8RC 3S2HH 2UXDQ 1VQPA 5LMNQ 2VQFL 4DUYQ 2CWPA 2LXKA 4LF5Q 4GKKL 1VQIA 2I5LX 4EX5A 3KF8B 4X65L 1ASYA 4IJHA 4GN4B 2BA1A 2CKZB 4NXML 1YJWA 3TS2A 3Q8DA 4UPAA 2UU9Q 1UEBA 2WB1E 1FGUA 1I3QH 4JV5L 5LMNW 4DR1L 5M3FH 1PH6A 2R93G 2K4KA 1G291 3RLFA 2ZTEA 3TQYA 4A75A 1PH8A 3S14H 4A3BH 3HKZG 1PV4A 1V9PA 1YIJA 5JJIA 3K0XA 1UWVA 1Y1VH 1MKHA 3E0EA 4HIMA 2PI2A 4BBRH 3JAMc 3RN2A 4A3LH 3FKIG 4XTCS 4DR2L 4BY7H 4P74A 2YYZA 1YI2A 3FHWA 4A3JG 3OTOQ 3CCEA 1Y14B 4JI6L 4LNQA 1N32Q 1OXTA 5K36G 4ME3A 3LGJA 2PQAB 4P75A 1YITA 3GTGH 3KYHC 2N78A 3ULLA 2ES2A 3H3VI 3KJPA 1A8VA 1JT8A 4R4CA 2UUAQ 3S2DH 3CQZH 2CCZA 1UE6A 4LF7L 1HNWL 1PYBA 5C4JH 1O7IA 4GLAC 4GOPB 3PF5A 2UXCL 2VNUD 4J15A 5JEAG 1A63A 1X6OA 1SROA 1Z9FA 5HGQA 3G48A 2Q2TA 1P8LA 1SMXA 3CPWA 1YZ6A 3J80c 4HJ9A 5JEAJ 1Q1BA 1UE1A 1VQFA 3L2PA 3UE1A 2KCTA 4A76A 5GAGC 4A3GG 1K3RA 1L1OC 3W5OA 3HOWH 3I4NG 2R93H 3T1YQ 3UE0A 4DUYL 1H95A 2XTIA 1K9MC 4LF5L 4APVA 3CCUA 1X56A 4JI0L 4JYAL 3DLLA 2A8VA 1HJPA 3F2BA 3PIOA 1N33L 4AIMA 2JA5H 4A4IA 3K80C 2E5LQ 4YWMA 2OQ0A 1FJGQ 1XMOQ 1XMQQ 1E7ZA 3FKIH 3CMAA 4LF6L 4PZ7A 4OONA 4R4TA 1KD1C 4LUZA 4R4IA 4A3IH 4JOIA 4JBMA 5M5YH 3T1HQ 4NXNQ 3I55A 2YTYA 5GROA 4KLKA 3W1BA 3HOYG 4JI4L 4Y52H 3A5ZB 3M9BA 1QUQA 4P71A 1PH2A 1EUJA 1HZCA 2CFMA 1HR0L 2JEAI 2N8NA 2DUDA 5FLMG 4POGA 3M7NA 1EIYB 1I5FA 3CC7A 4JI7L 1KRTA 5IYDG 1W3SA 4X64L 3S1NH 3TS0A 3HOUG 1WFQA 2RCNA 5GADC 5IYCH 2B63G 4BY1G 4A3FG 1WOCA 3HOVH 4KHPL 1NTGA 4MTNA 1K0RA 3CW2C 4P73A 4HJ5A 5C3EG 4ALPA 4L5RC 2YV5A 4LF4L 4X66Q 2JA7H 3E9HA 1KXLA 3IRBA 1PH1A 2JA8G 3DM3A 4L5SA 1WCMG 3CCLA 3S15H 1SE8A 2YTXA 4A3EG 4X62L 3I4OA 1A62A 2UXBL 5DLQE 3PGZA 2V1CC 1VQOA 1N34Q 4LFCQ 1PFSA 3CCVA 1LYLA 2RHQB 1YBYA 1E22A 5LMUQ 4B3RL 2UUBQ 3UDIA 4GKJQ 4DV6L 5GAEC 1B7YB 4DR4Q 1B70B 2BA0A 2WP8J 3NELA 3T1YL 2D0PA 1VS0A 4LFAQ 4BBSH 4UP7A 4KI0A 4AH6A 3RZDH 2Z6KA 3RZOH 1X3EA 2PNHA 2ZM6Q 1NMFA 2WFWA 3J81c 2JEBI 1YHAA 4C3IH 2ASBA 3S1RH 1PYSB 2K52A 4LW1A 1T9HA 1YVCA 4LUOA 5FLXc 1VQBA 2E5LL 1FJGL 5IYDH 3I56A 3E9IA 5ELNA 4C2MH 2R92G 3S1QH 2IT1A 5IP7H 5H1SE 1XJVA 3PUYA 2OQKA 4DR6L 1SR3A 2VL6A 4NXNL 1E1OA 1GKHA 2DGYA 4IOCA 3HOUH 3UDGA 4LFBQ 3WWVA 2D62A 1CKNA 4IPGA 4DKAC 4B3MQ 4A3FH 1M90C 2ZJQA 3GTOH 2GVAA 5GQOA 4LWCA 4DAYB 4YHHL 3GTQH 5IP9H 3CCRA 4A3MG 1OXUA 2JA8H 1XNRL 3GD7A 3RLOA 5JJLA 1I6HH 1I94L 1P16A 1LM0A 1R9TH 3RN5A 1V1QA 1CKMA 4DV2Q 4O0AA 3STBD 4A3KG 4JOIC 2GVBA 2Q2HA 1IBKQ 4K0KQ 3F1ZA 4YY3Q 1SFOH 3HOZG 4A3CH 1I50H 1TWCH 2I5MX 4DV7Q 2ZTCA 4X66L 4DK6C 5IWAL 1JE5A 4KHZA 1N9WA 2ID0A 1PH9A 3CF5A 2F4VL 4BXXG 4A3DG 1Y1WG 1VQCA 3PUXA 5C44G 2JE6I 5E7NA 1TWFH 2N3SA 1NE3A 1YEZA 1XNQQ 5C4XG 4QJFA 1OXXK 2MO1A 4LFCL 3TEHB 5AJ3Q 2L15A 4LF9L 3KLWA 5LMUL 1PHJA 2JQOA 1HNXL 1FL0A 1SLJA 1SN8A 2PMZE 4DV5L 3S1MH 4R1JA 4C3JH 4GKJL 1TWHH 3STBC 4B3TQ 4LF8Q 3HKSA 1GD7A 4AQYQ 3KFUA 2EQSA 2K50A 4B3SL 1AE3A 3H0GG 4POFA 1WYDA 3BZKA 5GAHC 1IZ6A 1D7QA 4UY8C 4P72A 3JAMi 2ZJPA 1PH4A 1OXSC 1TWAH 4DV4Q 2HHHQ 3GTLH 3PO2G 5M5XH 4LFAL 4YCWA 2K14A 4X6AH 5M3MG 5C0XG 2KENA 1YJ9A 1N36Q 4QL5A 5BR8L 2ZM6L 3PV0A 4OO1I 2RHSB 4A3MH 2UXDL 3F2DA 1Q7YC 1IBMQ 1IBLQ 2KHIA 3PUVA 5LMNL 1BVSA 4DPGA 4O2DA 1UE5A 2WAQE 5C0XJ 1HNZQ 2WB1G 4A3KH 4OX9Q 4DAMA 1X9NA 1KAWA 1E1TA 3L7ZC 4NB3A 2R7DA 2CQOA 2IX1A 2KCMA 4UP8A 1Z47A 2AHOB 2UU9L 2NN6I 2Y0SE 2AKWB 2ATWA 4DV1Q 1XPRA 1PA6A 2Z6KC 2R7ZG 1QZGA 3EBEA 2HIVA 1W2BA 4JI1Q 2UUCQ 3J80i 3ZJYC 4TQUS 4BXXH 4A3JH 4IPCA 4DV3Q 2A1AA 1RIPA 2ZTDA 1G6PA 4AYBE 1AH9A 4JI8Q 1S40A 1JJGA 2EIFA 3M4OH 3CMEA 1Q12A 3M3YH 4HIDA 3I4MG 4OXPA 1VQMA 5M5WH 4DR5Q 3KF6A 3TREA 1QUQB 3H15A 5IYBG 1QVFA 3GO5A 3AFPA 3H0GH 1N32L 2LSSA 3OTOL 4JCVE 3G4SA 3VDYA 3PO2H 2VQFQ 2VQEQ
chains in the Genus database with same CATH superfamily
5JJZA 2XNAC 1A3VA 1VQHA 2KQ3A 1BBXC 1S5DD 5M3MH 1X3FA 1B2TA 3SR1A 4GLVB 2EY2A 3NBIA 1LTTD 1NJIC 2GA4B 2E8GA 2R92B 3KDFB 4AQYL 3NTHA 3MFYA 2BDOA 1K73C 1LUZA 4PMWA 2K5NA 4DV4L 4R8NA 2A6HD 2OTLA 2K75A 4RHSA 1DYQA 2MPMA 4PV1C 4G7ZC 4EQOA 2A19A 4H44C 1WD1A 2WIIB 3J81j 4RMFA 4JI6Q 4A3BG 1LACA 1NBWA 3RUZA 1VQ8A 2EVBA 1D2BA 3SK8A 2MNAA 1HZ9A 5D14A 2JJQA 4EQNA 4ZLTF 1HRJA 1Y1WB 3MVVA 1EWIA 4CKEA 1EQQA 2OF1A 4R9WA 2B2WA 1DONA 1QWYA 3K59A 1U5KA 4DR5L 1CKNB 4A3EH 2XRQD 3J81i 4CBVA 1PH5A 5ELFA 1KRSA 2B8FA 2M9VA 2Z4IA 1A15A 4NW2A 1PZKD 4XYOA 3J7YW 4JYAQ 3AU7A 1E2VA 3B6YA 3OWFA 3GDEA 4B08A 2JP1A 2PI2E 1KC8C 4DNTB 2R3ZA 4LF6Q 3GTJH 3NBHA 2F0PA 2IHFA 1N34L 5DM73 1RDPD 1L0WA 1H9KA 3FPUB 4F88A 3CC2A 2QGQA 5I9OA 4NMZA 2KUMA 3M85A 3GTMH 2B39A 2Z4HA 3HOYB 2FXQA 2PQAA 3MXPA 3BU2A 4DR7Q 3Q24A 3AYHB 4QIWE 3U4VA 2NTTA 1PH7A 1SRUA 2SDFA 1HR0W 2GN5A 1XTDA 2XGTA 4DXFA 1FYCA 4PZ6A 3TDQA 3C1FA 3BVGA 3NK9A 1V1OA 2JA9A 3P1HA 4HAEA 5IOCA 4KD3A 4TVAB 2NVXB 3D4DA 5C3EB 2JN4A 3BZCA 4B3RQ 5IYCG 3I72A 3H6MA 3WOFA 3G71A 4DV6Q 4C3HH 4JBKA 5C0XI 4ZCKA 4IUUA 1A0IA 3NENA 3NEMA 5FJ8H 2DN8A 1FD7D 3H3VH 2NZ1D 3PO3B 2E2HH 2CWAA 2HIXA 5JPNC 4DV7L 5C4ZA 1K8OA 1L0XB 3M4PA 2BH8A 2B2WC 2X6LA 2A68D 2NB0A 2VY3A 1XNQL 4JI3L 1SNPA 5IY0A 2Y0SB 1B8AA 4K6DA 4KTAA 1EIGA 5LL6S 5AJ3L 3S16H 4ID6A 4NXMQ 2E2JH 1K83B 4RFBA 4LF8L 4RH6A 1DXMA 4YHHQ 3D6CA 4C3IG 2J0TD 1PFMA 4BY7B 1GUNA 1JJCB 2K5QA 3R3OA 3RR5A 2ZXOA 1KDBA 2NUCA 2R7ZH 3OW2A 1SNDA 1EEFD 2WAQG 4RG1A 1W6KA 2RSOA 2A68C 3LWUA 1E3PA 3U4ZA 5IWAQ 5IP9G 3S2DB 1HA5A 4OX9L 4NKLA 1CA5A 2JK8A 1JB3A 4XT1B 3TN2A 1BBWA 1SJHD 3I4LA 1B4OA 4PG3A 4CJ0B 1Q1EA 1LT5D 1A3UA 2KCNA 2LKVA 4H0LC 5IYBH 3HOXH 1UE7A 3BS1A 2UXCQ 2EY1A 2SEBD 4QQBX 3CCQA 4FXGC 4B3SQ 1SYGA 1K28A 3HOWB 4K5XA 2O4XA 1VQ4A 2CH4W 2L0CA 2C35B 4ABNA 5JVH3 1XPOA 4EQPA 4R4QA 1TWGH 4H13C 2F0EA 3QR8A 2L9HA 4X3UA 1YNJD 4C3JG 3K58A 3VR5A 2CWPA 2E2DC 1VQIA 2I5LX 4X65L 2F0LA 3TSSA 3TS2A 4G7OC 4G4KA 2UU9Q 3ONAB 2MHVA 1HUNA 4G57A 4JV5L 5FO7B 3H09A 5M3FH 1B44D 3MTSA 1A3TA 1G91A 2ZTEA 1PV4A 1D5XC 1YNJC 1K0SA 2Q8RE 4P2CB 1MKHA 3E0EA 4BBRH 4A3LH 3U9OA 3FKIG 4DGZA 1WTVA 4P74A 1N32Q 3FHWA 5T1IA 4A3JG 3CCEA 1FR3A 1Y14B 2C9OA 4JVZA 3EJIA 2JA6B 2PQAB 3GTGH 2AQ2B 1EY6A 3KJPA 1SNCA 4WJWA 1UE6A 1FNVA 4GLAC 1Z9FA 2PMZB 2XSCA 4K8IA 2K33A 2Q2TA 1O7YA 1DJRD 1SMXA 1STYA 4HJ9A 2L5TA 5JEAJ 2PW7A 1UE1A 4IALA 2EOTA 5CGKA 1K3RA 3MC0B 5EJWA 3PQIA 3T1YQ 2MP1A 4DUYL 2DJGC 4APVA 3CCUA 2A8VA 3F2BA 1NSNS 3OHXC 3QOLA 2JA5H 1IHZA 1EWHA 3A56A 1XMOQ 1F9QA 3CMAA 1SYBA 4IURA 4A3IH 1I6HB 4JOIA 1EIHA 3T1HQ 1ET6A 1R9TB 5GROA 4FVMA 1B9MA 2RDGA 2PZUA 5I2YA 4JI4L 4OO1H 3T4AC 4G7HC 3M7NA 1TWCB 2N88A 4QMGA 1D5ZC 1QNUA 3CC7A 4JI7L 1JE4A 3MEHA 3URYA 1B3AA 1W3SA 4X64L 2NN6H 2RCNA 1SMYD 5KIXA 5GADC 3N6RA 4KHPL 4A3FG 3HOVH 2PNRC 4ALPA 2DY8A 5A2QL 4LF4L 1GOZA 1TKWB 4I65A 1KXLA 1GUTA 1PH1A 3DM3A 4L5SA 3CCLA 1VMPA 4A3EG 3PGZA 4LFCQ 1G2SA 1LYLA 2RHQB 2A69D 1E22A 1NCVA 4H7BA 2FINB 4KY6A 2K6AA 1B7YB 1EEID 5ISRA 1ZYRD 1KLUD 2PQEA 2R93B 1D1KA 4J6HA 4BBSH 1GXDC 1HFGA 1DCZA 1EQTA 2DNCA 2WFWA 4DN4M 4KMUC 3S1RH 2K52A 1D6EC 2WINB 4LW1A 5FLXc 5IYDH 4C2MH 2F0OA 1BCPC 2A69C 4CKBA 5IP7H 3FPPA 3PUYA 4NXNL 1E1OA 1GKHA 3UDGA 1I4RA 4B3MQ 4HN7A 2O2LD 1ZYRC 1AFPA 4DAYB 5FOBB 3GTQH 1OXUA 5EPKA 2DJFC 2JYOA 3GD7A 4DNRB 1XNRL 3LNNA 3KLRA 4KY5A 3FRPB 1FNWA 4N8FA 1X32A 4KJOA 4DV2Q 3S1NB 3A8KE 2F3WA 4JOIC 4K0KQ 2RA4A 3F1ZA 1EYDA 3KK7A 3VR6A 1PZID 3L3OC 1C4QA 4BWGB 4DK6C 4BXXG 3D3RA 4C3HG 1VQCA 2JE6I 2EYLA 2N3SA 1YEZA 3BDLA 1RF2D 1X3QA 3KLWA 1SYFA 1PHJA 3P20A 2F0SA 2QW7A 1SLJA 1SN8A 1EWCA 2EYOA 2PMZE 2F3VA 4GKJL 4IQZA 3BYTB 3H0GG 4POFA 4FYDA 2QDLA 1IZ6A 4ZAIA 1OXSC 3A55A 2B2UA 2SOBA 3T53B 1IKLA 4X3SA 2K14A 2E75C 4X6AH 3RZOB 1OO9B 1WTXA 1JCKB 2UXDL 3VYTA 3I90A 4KKSA 4X3TA 5LMNL 1BVSA 4LAAA 5NUCA 5BN3A 1BCPB 2B63B 2SNMA 2R7DA 2CQOA 1ZXTA 2R7ZG 3A7LA 1JOOA 1PA6A 3EBEA 2HIVA 1W2BA 4K2KA 3J80i 3ZJYC 1WCMB 4EVOA 4XT3B 5BN4A 4BS9A 2ZTDA 1G6PA 4AYBE 3FDTA 1JJGA 3SEBA 2NVYB 4HIDA 2F0WA 1VQMA 4I7AA 2HDMA 5JEAH 5IYBG 1EY4A 2QEJC 5IGDA 3OTOL 3G4SA 3VDYA 1TWFB 5J22A 3M7GA 2VUMG 4Q5VA 3KDFA 2R7FA 1BKBA 2IX0A 1X55A 5C0XH 3QO2A 4ZRZA 5CC4A 1EYAA 2F0IA 4B3TL 5JJKA 1X65A 4DK3C 1V8QA 1GHKA 1MSGA 3U50C 1IXRA 1JOKA 4DV0Q 4A93G 5ELEA 1J5EQ 1G51A 4DK0A 3MXUA 5IGEA 4A3MB 1F9PA 2Q2UA 2IWHA 1VQNA 3J7AV 1EOVA 3HOYH 1EYCA 1TS5A 4DR2Q 1ZKOA 4MZ9A 5D3IB 5M3FG 3U58A 3GV3A 1Q86C 1HA6A 4IFDI 1QZHA 4IJLA 5FLMH 2B2UC 2RQXA 4K2LA 4CKCA 3OYYA 1XMQL 3CKIB 5FLXL 2UUCL 4A3DB 1HNWQ 4LF7Q 5C44B 4A3LG 4X3KA 1SDFA 5C4XB 3F8TA 1VQDA 3IFDA 4O1NA 5EAYA 4JI2Q 2NZOA 5C3EH 4KV6A 3J7AF 1AN8A 1CSQA 1CHQD 3KJOA 2PYKA 5FLXE 3WDNA 2NVTH 3PO2B 1D8LA 3PO3H 3LX0A 1EZ8A 3GTKB 5HGTA 3GTPB 3GV6A 4UHVA 3OIPA 2D5DA 5JOBA 5FO9B 1IYJB 1Q46A 3MWYW 2Q8TA 4IN3A 1VQGA 1V43A 3MXGA 1VQ9A 5T1GA 5KYIA 2WB1B 4WORA 1BOSA 1J6QA 1XX8A 2YU9B 2UUBL 3PIO3 1K83H 1TS2A 4OIKA 1VCIA 2PCFB 5KNBA 2F03A 3NPPA 2JA5G 5FK9C 1A2UA 5FO8B 1HHVA 3HFZB 1EY5A 3P7JA 4CDCC 4A3IG 2P5ZX 4OO1G 3I4MB 3SDZA 1XPUA 3NUCA 2HQLA 3CXCA 3QOJA 2F0MA 3EROA 3H94A 5F2DA 4LFBL 1JOQA 3EA6A 1STHA 2F0TA 3ERQA 4X62Q 3F2CA 3HOZH 2UXBQ 2OTJA 2NN6G 3NSWA 3J80E 3J7ZC 1I4GA 2VW9A 3HOVG 2J7ZA 4N9PA 1SNQA 1HZBA 1DOKA 1ENFA 2TSSA 4KKTA 2Z6BA 1PDQA 4Y7NH 1QE6A 2L4NA 1IBKL 4BA2I 5ELDA 3E5SA 1H9MA 1MJCA 1WJJA 1ML0D 1ILQA 1KDAA 2CW0D 2LXJA 5J39A 2PZTA 4Q0FA 3AEVA 1SNMA 1QJOA 4DR6Q 3VR2A 4ZK9B 5C4HA 1ICWA 3S14B 4A3BB 4XIGS 4BBSG 2A74C 2F1MA 3S17H 3VA7A 1GM5A 2EY6A 3CAMA 1Z6HA 2EYPA 2HHHL 3P75A 4DR7L 1JB7A 5IP7G 1KABA 2CW0C 1SEBD 5C5MA 2QEXA 3D31A 4GS3A 4R4OA 5I2XA 1N36L 3HKZE 3E0JA 2LS01 3IL8A 3FP9A 3NP8A 4IUVA 2Q8IB 3CC4A 3TP7A 2B2TA 3HP3A 1HNZL 1Q8KA 2F4VQ 5C4JB 4OHJA 1QVCA 1CA6A 2EYHA 1CQFA 1JR0D 5CV9A 3K57A 4GN5A 4IOAA 2JA6H 3PCOB 4LF9Q 2V4DA 4DV1L 4ILWA 3A74A 3MHBA 4IFDJ 3D4WA 2K5WA 4YWLA 2Z8LA 4MN3A 1MJEA 4TRDA 2OXPA 1GVPA 2F0QA 3ULJA 1HUMA 5DEHA 5IGGA 2R61A 4HJAA 1A2TA 3ER0A 4RGNA 5JPMC 1C9OA 2K5DA 1N8RC 3S2HH 2IW3A 2E2IB 1EU4A 1VQPA 2NWGA 4UDUC 5CBAE 3E3XA 2VQFL 2NYZD 4LF5Q 4GKKL 3N52A 3KF8B 1ASYA 2IX3A 4IJHA 1H9SA 5IGBA 2BA1A 4NXML 1YJWA 1BO0A 2XWBB 1UEBA 2WB1E 2EYJA 1FGUA 1I3QH 3TP5A 2F0DA 4DR1L 1PH6A 3WOEA 1C8CA 2K4KA 2K28A 1SJED 1V9PA 1YIJA 5JJIA 4F87A 1Y1VH 4HIMA 1TY0A 3JAMc 3RN2A 4MIUA 4B9XA 4XTCS 2A73B 3F2UA 3GP7A 2YYZA 4LNQA 1VMCA 1LT3D 1YNNC 2KJXA 1HFNA 1A8VA 4IUQA 3CU7A 3CQZH 1PYBA 4ZKBB 2UXCL 5JEAG 5J1ZA 1X6OA 2B2TC 1A6XA 3W3AA 4DAPA 3DEPA 1Q1BA 3KLSA 3L2PA 3VYRA 2KCTA 4C3IB 2SNSA 2R93H 4RWSC 3S1QB 1NUCA 2KHSA 2XTIA 4JI0L 1UEAB 3DLLA 2QDBA 3PIOA 1N33L 1BDOA 4AIMA 2WAQB 1EOTA 2E5LQ 5LL6X 4YWMA 1FJGQ 1S5ED 2FFKB 1ET9A 1KD1C 4LUZA 3TP8A 5M5YH 3HOYG 3H91A 4KLKA 3T51B 3W1BA 4ZYSA 1PH2A 1EUJA 4C1NI 2BCOA 1HR0L 2CFMA 5FLMG 5COYA 1AP0A 2F0VA 1TQOA 2KVMA 1KRTA 1MI2A 2B2YA 4IUPA 3S1NH 3OMCA 3HOUG 4KK7A 1LV9A 2BE5D 4MTNA 1K0RA 5D65A 5C3EG 2JA7H 3E9HA 2JA8G 3I73A 4C3JB 1EU3A 3C46A 3DEOA 1A62A 2V1CC 1N34Q 1PFSA 1TWAB 3CCVA 5LMUQ 4RGOS 5M5XB 1EZ6A 2K05A 2RBMA 3Q0AA 3VR4A 3TZDA 4DXGA 1CI3M 3QB3A 2C5CA 4TKOB 2BA0A 2WP8J 2BE5C 3NELA 3T1YL 1VS0A 4LFAQ 4U68A 4UP7A 3RZOH 2PNHA 1HQMC 2ASBA 1PYSB 4LUOA 3FKIB 1F2LA 5ELNA 4DAYA 4A3JB 2OQKA 1L0YB 2DGYA 2KEDA 2E74C 2D62A 4IPGA 3GTOH 1M90C 1WVLA 2FJ2A 3M3YB 2EYMA 1MHWC 1T5XD 4RGMA 5JJLA 3RLOA 1H9SB 1I94L 5CV6A 1PTOD 1LM0A 4IFDH 1DZ1A 4A3KG 1SFOH 3R2IA 3HOZG 3BG3A 3JAML 4DV7Q 1XTCD 1N9WA 3CF5A 1Q3LA 3PUXA 1C48A 5E7NA 2ICEC 1TWFH 1ICFB 1NE3A 1XNQQ 3Q22A 2PO4A 3I8ZA 4QJFA 1OXXK 2B2YC 4LFCL 5AJ3Q 1I4HA 2HQEA 1PTOC 2JQOA 4RCOA 1HNXL 4C56C 2K32A 4DV5L 1BF4A 3S1MH 4L63B 4LF8Q 3KFUA 2K50A 3JAME 2VB2X 1WYDA 2HCCA 4CHTB 1PH4A 3GTLH 1E2WA 1SAPA 4YCWA 3L9AX 3RZDB 5M3MG 5BR8L 4ZKCB 3PV0A 2HDLA 1QCBD 4A3MH 3F2DA 1IBLQ 1E2ZA 1MBYA 3Q6SA 2LFNA 4DPGA 1W6JA 2WAQE 5C0XJ 1B9NA 4DAMA 1CTMA 5E4WC 4OX9Q 4A3FB 1KAWA 3L7ZC 4FF4A 2F0JA 1Z47A 2ATWA 2Y0SE 1TVXA 1QZGA 1FGBD 4JI1Q 2E76C 4TQUS 2KEEA 2A1AA 4A3EB 1RIPA 1VF7A 3I3CA 3C3LA 1DOMA 4FP5D 1S40A 2Z9HA 3NTKA 2CVRA 3MA2B 1Q12A 4XQNA 5KYLA 2FHTA 3PIP3 2M2LA 1PLFA 4JCVE 3PO2H 2VQEQ 2XWJB 3GTJB 1YHQA 4X65Q 4DR3Q 4FDBA 2MGSA 4A3GH 2UUAL 4BA1I 1PTOB 1RD9D 3I4NH 2KA7A 4RKBA 4ZUJA 3V2TA 3GTMB 2QILA 4OWXB 5EKKA 3NQIA 3ICEA 1BCPD 3L0OA 1HH2P 2F0FA 1LTLA 1EY0A 2MFIA 2N55A 4XXEA 1CZGA 1KAAA 5A2QE 5ELOA 5JVG3 4DUZQ 1F2ZA 2M00A 1BXTA 4DNIA 3BVMA 4GNXB 2VZAA 2H5XA 5A35A 1VQ6A 3I4MH 3J7A5 1BCPF 3EIVA 4QUCA 1Y1VG 3S24A 1NY4A 4AYBG 1VQKA 2FMMA 4C3HB 1F9RA 1LT4D 3MXNA 4QB4A 4QGUA 1E0BA 1NAPA 3EN2A 2E2HB 2KHJA 3PMFA 2DNEA 3LWEA 1G6ZA 5M5WB 1AW7A 1Q8IA 4UP9A 3H0GB 1X54A 1WTPA 4JI5Q 5IIFA 4OELB 3ND9A 3RNUA 1YJNA 3S16B 3OMGA 1Q82C 4IO9A 4HIOA 1GUSA 3KBGA 2RF4A 1Y8OB 5FJ8G 1O78A 1S72A 4JI4Q 2NVQB 2F52A 2ICIA 5CV7A 1HTLD 4DV0L 2R7ZB 2WV6D 1J5EL 3OOCA 2R92H 4DR4L 5HY6A 4YCVA 4JI7Q 5LHY1 1T5EA 3G7LA 4HCSA 4HJ8A 3RLNA 4J8QA 4X64Q 1O7ZA 4IPHA 4GOPA 2EY5A 1CSPA 2ALYB 4KN7C 4KHPQ 1VQEA 2K01A 1PVOA 5EBCA 1JMCA 3I70A 4LF4Q 3BDCA 4XQJA 1WI5A 1SYEA 2VUMB 4U673 4BY1B 3C2PA 4GN3B 4JI2L 2L11A 1NR4A 1O80A 4NDXA 1K8MA 3M4YA 1SE3A 3A0JA 3RMHA 2AMCB 1BQQT 2G9HD 1Y1WH 1NMGA 1F2YA 1PH3A 1IL8A 1TWGB 2JA7G 3KOJA 1RL2A 3HEJA 2AWOA 4MTKA 4KKUA 4YY3L 3W2DA 4A93B 3MAQA 3SGIA 2EJMA 3RD4A 5J3BA 1STAA 1EY7A 3S9WA 4WJ3M 3HOXG 1MGSA 2E2IH 1UAPA 1F77A 5M3FB 5D3DA 1S5FD 3MZ5A 3HRZC 1JJ2A 1J9OA 2K03A 2D0OA 4O42A 3UDFA 3PUZA 5KNCA 1MD2D 1LTBD 3CP0A 2EE1A 1XNRQ 1GHJA 2NBFA 1ZEQX 2B3GA 3TRZA 1MIUA 1MSHA 1PZJD 1YHBA 2F0KA 1E24A 1OXVA 5ELCA 3SVMA 1IBML 3GTGB 1EQRA 1EL0A 3CCJA 5M9OA 2AUJD 1JWSD 4IFDG 4JC0A 4ZUIA 2I5HA 4MHEA 3K7AB 4CDFC 3A8IE 4DU9A 3ULPA 2HCIA 5IT9c 4OEMB 4GOPC 2NTSA 4NPSA 2EJGC 3UI2A 4BBRG 3PIPA 1WTHA 4DV3L 2EJFC 2N49A 4JI8L 2NVXH 1DGSA 3PUWA 1L1OB 2I07B 2PW5A 2RDFA 3MXNB 3DXJC 2G5DA 4DFAA 3KF8A 2TMPA 2JA5B 3BYYB 4CDEC 2UXDQ 1PMRA 5CBEE 1M8AA 1XYIA 5LMNQ 4IZ8A 2LXKA 4A3IB 2QF7A 1RTNA 4GN4B 2CKZB 2MUYA 4UPAA 5EQ0A 1LTSD 2IL8A 4K6LA 4KY7A 2D9UA 4FNFA 4EGVA 2RKSA 5C3XA 4A75A 1R4QB 1GUWA 3HKZG 2L12A 3D6WA 4L8JA 5EKLA 2OT2A 5C6AA 1TU2B 1GUOA 1UWVA 3HOVB 3NWTA 4BY7H 3OTOQ 4JI6L 3T16A 4OGQC 2F0GA 4P75A 1YITA 4RGTA 2N78A 3Q23A 1JT8A 3NWSA 2O5IC 4R4CA 3S2DH 2CCZA 3G6JB 5I4DA 4GOPB 1O7IA 5K5PA 1A63A 4J15A 3GQBA 1SROA 5HGQA 1RKNA 3G48A 4OIJA 1P8LA 4FF2A 2ZT9C 4PMCA 3CPWA 1PRTB 1YZ6A 4BBSB 1SSOA 2CH4A 4XDXA 1O7LA 5GAGC 4A3GG 3HOWH 3I4NG 1F9SA 1H95A 1B1ZA 4LF5L 4M1UB 4JYAL 3D4RA 1HJPA 1TIID 1TS3A 5EGTA 1RCVD 5CYUA 3K80C 4JK1C 1XMQQ 1E7ZA 1JWUD 3FKIH 4LF6L 4PZ7A 4FF1A 4S3SA 4OONA 3I55A 2YTYA 3VR3A 1STBA 3A5ZB 4K5WA 1CHPD 2EPBA 4P71A 4DK1A 1GJXA 2H1EA 1EIYB 4KJNA 3V96A 3NTIA 5IYDG 1QNKA 2MJ8A 4LJZC 4CJ2C 1TT2A 1QG7A 1WOCA 1NTGA 1UNSA 3TMEA 4HJ5A 4P73A 1LT6D 4L5RC 2YV5A 2DY7A 4X66Q 2I46A 4FXKC 3T56B 5ELBA 1SE8A 2YTXA 1PFBA 3I4OA 1SNOA 1YBYA 4B3RL 1II3A 5IT9L 2UUBQ 3UDIA 4DV6L 4M8AA 2J4XA 1WD0A 3MFGA 4ODGA 2LMCB 4RHRA 5DM63 2D0PA 2K7VA 5I9PA 3RZDH 4KI0A 1U9RA 4AH6A 1X3EA 2ZM6Q 2X6GA 3J81c 1TS4A 5IT9E 2E5LL 1T9HA 1VQBA 1FJGL 4ME5A 1B50A 2R92G 2IT1A 2A6HC 5H1SE 1XJVA 4ULLA 1SR3A 2VL6A 1CZWA 4LFBQ 3EFXD 4FF3A 3O13A 1IKMA 5KEEA 4A3FH 2ZJQA 2GVAA 5GQOA 1U4PA 2O5JC 2G9DA 4YHHL 1PXUA 1YNND 2K1BA 4PMBA 1I6HH 3TZUA 1R9TH 1CKMA 3STBD 3QWNA 5DNFA 1IBKQ 2Q2HA 3KLSX 3V05A 3NQTA 3U9SA 5CV4A 4A3CH 1TWCH 1ESRA 5IWAL 2XVSA 1JE5A 4KHZA 2WKDA 1PH9A 1Y1WG 3S15B 3SXHA 1M4VA 3DUZA 3TBIB 3VYSA 2L15A 5LMUL 3R8BA 3SK6A 3VA5A 1WTQA 4R1JA 1S5BD 1DD2A 1PTOH 3STBC 3DWAA 3HKSA 1STNA 4AQYQ 2EQSA 4DA2A 4B3SL 1D7QA 4P72A 5JAVA 4N9TA 3JAMi 2WACA 4DV4Q 2HHHQ 4LFAL 3HZXA 5C0XG 2KENA 1N36Q 4QL5A 2RHSB 1Q7YC 2KHIA 1UUPA 2EZVA 1ENAA 1HNZQ 5FKAC 1Y8NB 3HOUB 4KN4C 1CT1D 1X9NA 1S5CD 3DWPA 4NB3A 2IX1A 3K5OA 2UU9L 2AHOB 1ESFA 2AKWB 1V1PB 4DV1Q 2JA8B 1PFNA 3K6OA 1TR5A 4BXXH 4IPCA 5K36H 4WRDA 2NVTB 1B53A 3CHBD 5E4XA 1I50B 3DHQA 2F4IA 2F0NA 5M5WH 4DR5Q 3H15A 2EYFA 1QVFA 3H0GH 3AFPA 1N32L 1BUVT 2VQFQ 1WTRA 1K8GA 4GKKQ 5AFWA 1DOLA 1QOHA 1VQ5A 2OCEA 1RTOA 3KF6B 3I2ZA 1WTOA 1IL2A 4IPDA 3MEFA 3A7AB 4LMQD 1TWHB 1Q81C 3ND8A 2CHBD 1EFWA 1RHPA 2AWNA 4DR1Q 1VQJA 1FVIA 3DMUA 2K5VA 2R6GA 1Y8PB 3AMUA 3PO3G 3CRKC 2NVQH 3X3NA 1U0LA 4L5QA 2AQ3B 1HXYD 4GNXA 3NHHA 1I4QA 5IE8A 1IBLL 4LUVA 1WTWA 2HD3A 3QG1A 1RODA 4A3KB 3PSIA 2OWOA 2Y0SG 2EXDA 3HOZB 1Z7TA 4K8JA 3J81L 1K8AC 4HEDA 1XMOL 4C1NK 1IYVA 1H9RA 4HMIA 4JI1L 3UDXA 3HS0C 4OWTB 3T1HL 1AE2A 1JICA 2PPBC 4Y7NB 2VUMH 2B63H 4BY1H 4BY7G 2EXZA 3M4OB 1SXTA 1BBUA 1AEXA 1LLRD 3K0YA 1I4XA 4L5TA 2KECA 2F3IA 1WCMH 3J81E 1HTPA 3X3MA 1CUKA 1KQSA 2Q2IA 2VQEL 2NVYH 1JORA 4JI0Q 5M3MB 4A93H 4I7ZC 1LO5D 1N33Q 4DR3L 4CDDC 2Z0SA 3S17B 1EFID 2IY5B 3CCMA 4GLXA 3M4QA 3I7FA 4OL7A 1I4PA 4DAVA 1PTOF 1VQ7A 4JI3Q 3FVQA 3AQQA 3HOWG 4XQQA 5IGCA 1HZAA 1LTAD 4V0BA 4HSPA 1LTRD 3SHLA 2B29A 5CV5A 2MQHA 1HR0Q 3NBHB 2VXWA 3ERSX 4DUZL 1ONLA 2BDNA 3KUPA 2QA4A 2VS1A 1RJTA 5KGUA 1EY9A 4GNXC 4MNOA 4H02A 4JBJA 3KBXA 3W1GA 1STEA 4YCUA 4B3ML 1OTCA 3K7AH 5CV8A 1VDZA 3K5LA 1H9JA 2H4OA 3R2TA 2OEOA 3AFQA 4A3DH 2BH2A 5C44H 3H3VC 3SE0A 3HG9A 2AQ1B 4KHVA 1ASZA 3S2HB 4JBWA 1L2FA 5C4XH 2I0QA 3K81C 1S3OA 4JI5L 4DV2L 4UY8C 4QY7A 4OWWB 1X3PA 4K0KL 3SK5A 1U4LA 4N8X1 2JA6G 2MO0A 1PYWD 3NXWA 1KLGD 1QB5D 2A6ED 1KL9A 1CFMA 5L37A 1I3QB 2Z1CA 4JG2A 2HT1A 3GTKH 3K5NA 3GTPH 1C0AA 1KNAA 1M1KC 2VB3X 2JXMB 1CM9A 1U4RA 3PF4A 3TP6A 5I6YA 4EQ5A 2AUKA 4JV5Q 1Y1VB 3OW7A 4AYBB 5DAUA 2KBNA 1EYGA 1I94Q 5EBDA 1GO3E 1KIXA 2RDHA 3JC66 2IHEA 1QVGA 2A6EC 2YU9H 2B8GA 3CPFA 5E3FA 1R4PB 3CRLC 1HQRD 2RVLA 4QF4A 4RKLA 3BZDB 4L6TB 1X3GA 4HCEA 4YWKA 2NZHA 1VQAA 3CQZB 3A5UA 1F2MA 1KHIA 2K5HA 1LABA 4JPBW 2F0HA 1FNUA 4PZ8A 4WJ4A 1EIFA 2JSOA 3FEWX 1ENCA 3BJUA 1STGA 2YTVA 2WKCA 1YNXA 1L1OA 3K8AA 4DF7A 5IODA 1HNXQ 1VQLA 3CCSA 4DV5Q 1TXYA 2XRSD 1IW7D 5E1FA 1SBBB 1AZPA 4A3CG 3D0FA 3G6EA 3IKJA 4FO2A 2B2VA 5EPJA 1SMYC 1C7YA 3CD6A 4HJ7A 1CKOA 1SYCA 4HIKA 5EPLA 5BR8Q 3ITPA 3K7UC 2ZJRA 1BNZA 1ILPA 2KOLA 3AB9A 5IGFA 4DUYQ 3DM1A 5M5YB 4EX5A 1IW7C 2E2JB 5HURA 3E6ZX 4QUFA 3Q8DA 1XWEA 4E6IA 1JC7A 5C5LA 5LMNW 1DM0B 2R93G 1G291 3RLFA 3TQYA 2QCPX 3S14H 1PH8A 4A3BH 3HGBA 5I6WA 3BVZA 3EQLC 4XYQA 2XN9C 3T13A 3K0XA 3D8GA 2PI2A 3BDOA 2RCFA 4Z9CB 2JA7B 1NNXA 4DR2L 1CQVA 2FMCA 1YI2A 4QCLA 3OSOA 1OXTA 5K36G 4ME3A 3LGJA 2KCCA 3KYHC 3ULLA 1LTID 1B3QA 2ES2A 3H3VI 1Q90A 4RCNA 3HOXB 2UUAQ 1HNWL 5KNDA 4LF7L 5C4JH 2VNUD 3PF5A 3OIQA 4PNYA 4GZYC 2L1BA 4B9WA 1CK1A 2D2CC 3J80c 3A8JE 2ENBA 1VQFA 1S4ZA 3UE1A 4A76A 1VF5C 1L1OC 3W5OA 1BR9A 4HSVA 2K04A 3UE0A 1K9MC 2B2VC 1X56A 4R8IA 3GTOB 4YIJA 4A4IA 1XXGA 3C1EA 5KRUA 2OQ0A 5BN5A 4R4TA 4JBMA 4R4IA 3K5MA 4NXNQ 1EQVA 1I6VC 4Y52H 4JW0A 3M9BA 1QUQA 1TY2A 1SFOB 1HZCA 2JEAI 2N8NA 2DUDA 4POGA 4BBRB 1I5FA 4WFN3 5CR3A 5EKIA 2BOSA 1G8ZD 3TS0A 1WFQA 1PRTD 5IYCH 4HR7B 4BY1G 2B63G 1D1IA 4KD4A 3CW2C 4TSSA 5CMDA 1Y69U 3IRBA 5C3WA 2PZWA 3S1MB 1WCMG 3S15H 2X69A 3DWQA 4X62L 2UXBL 5DLQE 1VQOA 3GTLB 4UAIA 2IPKD 1U4MA 1J8IA 4GKJQ 4HTHA 1PRTF 5CORA 5GAEC 3FMCA 3SK4A 4V190 1G2TA 4DR4Q 1PRTC 3ZYYX 1B70B 3OWEB 3QJYA 3HKZB 1NR2A 2Z6KA 1NMFA 4IUNA 1SYDA 1YHAA 2JEBI 4C3IH 1SE4A 3VYUA 1YVCA 4LK1C 5TSSA 3I56A 3E9IA 3S1QH 4DR6L 4NP5A 3HOUH 4IOCA 2IJ0A 3WWVA 1LTGD 1CKNA 1SE2A 4PQXA 4DKAC 3I91A 4LWCA 1QILA 5G3LD 5IP9H 2LY7A 3CCRA 4A3MG 2JA8H 1JWMD 1P16A 3RN5A 1V1QA 1JQYD 4O0AA 2GVBA 4YY3Q 1GUGA 4CJ1B 1I50H 3R93A 2I5MX 1HCZA 1KDCA 2ZTCA 4X66L 4A3GB 2ID0A 2F4VL 4A3DG 3I4NB 2QKIC 4K5VA 5C44G 5G3LF 4F8MA 5C4XG 1EY8A 2MO1A 4RAUC 3TEHB 4LF9L 2F0UA 1FL0A 2EDGA 4HMJA 4IUTA 4C3JH 1TWHH 4CGYB 4B3TQ 1GD7A 2HUGA 1AE3A 5GAHC 3BZKA 2ZJPA 1TWAH 3PO2G 1HPCA 2ZXRA 5M5XH 3EVQA 3J80L 1D5MC 3NE5B 1YJ9A 3IFTA 2ZM6L 4OO1I 3S1RB 3QIAA 1IBMQ 1KTKA 4QIWB 4ZQ3A 3PUVA 4C2MB 1V1PA 4O2DA 1UE5A 1AZQA 2WB1G 4A3KH 1KNEA 1E1TA 1K3BC 3A54A 2KCMA 4UP8A 2NN6I 1XPRA 2Z6KC 3GTQB 2UUCQ 2CQAA 4A3JH 4DV3Q 2RSNA 4F7XA 1AH9A 4JI8Q 4FXDA 2EIFA 3M4OH 3CMEA 3M3YH 1IYUA 2A5HA 2XIWA 3I4MG 4OXPA 3IAYA 3OPOA 4RA8A 3KF6A 3TREA 2ZXPA 1QUQB 2L55A 3GO5A 4K14A 2LSSA 4J1MA
chains in the Genus database with same CATH topology
2VUMG 1K8GA 4GKKQ 3KDFA 1VQHA 1YHQA 4X65Q 2R7FA 1VQ5A 2OCEA 5M3MH 1BKBA 1X3FA 3KF6B 2IX0A 1X55A 3I2ZA 4FDBA 4DR3Q 4GLVB 1IL2A 4IPDA 3MEFA 1NJIC 4A3GH 2UUAL 4BA1I 2E8GA 1Q81C 3I4NH 4B3TL 5JJKA 3KDFB 4AQYL 2AWNA 1EFWA 1X65A 4DK3C 1VQJA 4DR1Q 1FVIA 4OWXB 2R6GA 2K5VA 1K73C 1LUZA 4PMWA 2K5NA 3L0OA 3U50C 4DV4L 2OTLA 3PO3G 1HH2P 1IXRA 2NVQH 1LTLA 4A93G 2K75A 1U0LA 4L5QA 4DV0Q 2MFIA 1J5EQ 1G51A 4GNXA 2Q2UA 1VQNA 5ELOA 5IE8A 1IBLL 1EOVA 4LUVA 4DUZQ 3HOYH 4DR2Q 2A19A 4MZ9A 5M3FG 3U58A 4DNIA 3J81j 3PSIA 4RMFA 4GNXB 1Q86C 2Y0SG 2OWOA 2VZAA 4JI6Q 2H5XA 4A3BG 1QZHA 2EXDA 4IJLA 1VQ6A 5FLMH 1NBWA 3I4MH 4IFDI 1VQ8A 1K8AC 3J7A5 2MNAA 3EIVA 3OYYA 1XMOL 1XMQL 1HZ9A 1Y1VG 3S24A 1NY4A 2JJQA 4AYBG 4JI1L 3UDXA 1VQKA 2UUCL 4LF7Q 1HNWQ 4OWTB 3T1HL 1AE2A 4A3LG 4QGUA 2VUMH 4BY7G 2B63H 3F8TA 1EWIA 1VQDA 5EAYA 4JI2Q 4BY1H 3ICEA 3EN2A 1EQQA 2NZOA 1BBUA 5C3EH 2KHJA 4L5TA 1CSQA 2F3IA 1WCMH 1U5KA 4DR5L 1CKNB 3KJOA 4A3EH 4UP9A 3J81i 1X54A 1CUKA 1PH5A 1KQSA 1KRSA 4JI5Q 2NVTH 1D8LA 2Q2IA 3PO3H 2VQEL 3RNUA 2NVYH 4JI0Q 1YJNA 4A93H 4JYAQ 1N33Q 3B6YA 4DR3L 3GDEA 1Q82C 2Z0SA 2PI2E 4IO9A 1KC8C 1IYJB 2IY5B 1Q46A 3CCMA 4HIOA 4GLXA 3M4QA 1VQGA 3I7FA 4LF6Q 1V43A 1VQ9A 3GTJH 1VQ7A 4JI3Q 2RF4A 5FJ8G 1S72A 2IHFA 1N34L 3AQQA 3HOWG 1HZAA 4JI4Q 1J6QA 2F52A 1L0WA 2UUBL 1K83H 4DV0L 2B29A 1J5EL 1VCIA 2MQHA 2QGQA 1HR0Q 3CC2A 3NBHB 3M85A 2JA5G 2R92H 5HY6A 3GTMH 4DR4L 4YCVA 2FXQA 3ERSX 4JI7Q 2PQAA 4DUZL 3BU2A 4DR7Q 3HFZB 4HJ8A 4A3IG 3RLNA 3AYHB 4QIWE 3U4VA 4X64Q 4IPHA 2QA4A 4GOPA 4OO1G 2VS1A 1CSPA 2ALYB 1PH7A 1XPUA 1SRUA 1HR0W 1VQEA 4KHPQ 1PVOA 2GN5A 1XTDA 2XGTA 1JMCA 2HQLA 4LF4Q 3CXCA 4GNXC 4PZ6A 4MNOA 4H02A 1WI5A 4JBJA 3W1GA 2JA9A 4LFBL 4YCUA 4X62Q 3F2CA 3HOZH 4GN3B 4B3ML 2UXBQ 4TVAB 2OTJA 1OTCA 3K7AH 4JI2L 2NN6G 3J7ZC 2VW9A 3BZCA 4B3RQ 5IYCG 3A0JA 3HOVG 2AMCB 3AFQA 4A3DH 2BH2A 3G71A 4DV6Q 1HZBA 1NMGA 4C3HH 5C44H 5C0XI 1Y1WH 1PH3A 4JBKA 2JA7G 1ASZA 1A0IA 4JBWA 1L2FA 5C4XH 3NENA 4Y7NH 2I0QA 3K81C 1S3OA 3NEMA 4JI5L 5FJ8H 4DV2L 3KOJA 4QY7A 1RL2A 1IBKL 4OWWB 2AWOA 2E2HH 4YY3L 3H3VH 4BA2I 4K0KL 2JA6G 2CWAA 2MO0A 1MJCA 3SGIA 2HIXA 4DV7L 1WJJA 5J3BA 2LXJA 4WJ3M 3HOXG 1KL9A 3M4PA 2BH8A 2E2IH 4JG2A 3AEVA 2HT1A 2VY3A 1XNQL 4DR6Q 4JI3L 5IY0A 3GTKH 1B8AA 5AJ3L 3GTPH 3S16H 1C0AA 1M1KC 4XIGS 4NXMQ 2E2JH 3PF4A 1JJ2A 4BBSG 3S17H 4EQ5A 2D0OA 3UDFA 3PUZA 1GM5A 4LF8L 4YHHQ 4JV5Q 2KBNA 3CAMA 3CP0A 1EYGA 1XNRQ 1I94Q 1GO3E 2B3GA 1KIXA 1MIUA 2IHEA 3JC66 1JB7A 2HHHL 3TRZA 4DR7L 1YHBA 5IP7G 1QVGA 1JJCB 3RR5A 1E24A 2YU9H 3CPFA 2QEXA 3OW2A 3D31A 1OXVA 4GS3A 4R4OA 1N36L 2R7ZH 3HKZE 2WAQG 4RG1A 1IBML 4YWKA 1X3GA 1EQRA 3FP9A 2NZHA 3CC4A 1E3PA 1VQAA 3U4ZA 5IWAQ 5IP9G 3A5UA 3CCJA 1Q8KA 1HNZL 1KHIA 2K5HA 2F4VQ 1QVCA 4OX9L 4JC0A 4IFDG 2I5HA 2JK8A 4PZ8A 4WJ4A 1BBWA 1EIFA 4GN5A 3ULPA 4IOAA 4PG3A 3PCOB 3BJUA 4LF9Q 2JA6H 1Q1EA 2YTVA 5IT9c 4DV1L 1YNXA 4GOPC 1L1OA 3A74A 3K8AA 1HNXQ 4NPSA 5IYBH 3HOXH 3CCSA 1UE7A 1TXYA 4BBRG 4DV5Q 3PIPA 1VQLA 4A3CG 4IFDJ 4DV3L 2N49A 2UXCQ 3D0FA 4YWLA 3G6EA 4QQBX 3CCQA 4B3SQ 4JI8L 1C7YA 1MJEA 1DGSA 3PUWA 2NVXH 3CD6A 1L1OB 4HJ7A 1GVPA 1CKOA 3ULJA 3MXNB 1VQ4A 4HIKA 2C35B 1XPOA 5BR8Q 4HJAA 3ER0A 3K7UC 4R4QA 1TWGH 1C9OA 2ZJRA 1N8RC 3S2HH 2UXDQ 1VQPA 5LMNQ 2VQFL 4DUYQ 2CWPA 2LXKA 4LF5Q 4GKKL 1VQIA 2I5LX 4EX5A 3KF8B 4X65L 1ASYA 4IJHA 4GN4B 2BA1A 2CKZB 4NXML 1YJWA 3TS2A 3Q8DA 4UPAA 2UU9Q 1UEBA 2WB1E 1FGUA 1I3QH 4JV5L 5LMNW 4DR1L 5M3FH 1PH6A 2R93G 2K4KA 1G291 3RLFA 2ZTEA 3TQYA 4A75A 1PH8A 3S14H 4A3BH 3HKZG 1PV4A 1V9PA 1YIJA 5JJIA 3K0XA 1UWVA 1Y1VH 1MKHA 3E0EA 4HIMA 2PI2A 4BBRH 3JAMc 3RN2A 4A3LH 3FKIG 4XTCS 4DR2L 4BY7H 4P74A 2YYZA 1YI2A 3FHWA 4A3JG 3OTOQ 3CCEA 1Y14B 4JI6L 4LNQA 1N32Q 1OXTA 5K36G 4ME3A 3LGJA 2PQAB 4P75A 1YITA 3GTGH 3KYHC 2N78A 3ULLA 2ES2A 3H3VI 3KJPA 1A8VA 1JT8A 4R4CA 2UUAQ 3S2DH 3CQZH 2CCZA 1UE6A 4LF7L 1HNWL 1PYBA 5C4JH 1O7IA 4GLAC 4GOPB 3PF5A 2UXCL 2VNUD 4J15A 5JEAG 1A63A 1X6OA 1SROA 1Z9FA 5HGQA 3G48A 2Q2TA 1P8LA 1SMXA 3CPWA 1YZ6A 3J80c 4HJ9A 5JEAJ 1Q1BA 1UE1A 1VQFA 3L2PA 3UE1A 2KCTA 4A76A 5GAGC 4A3GG 1K3RA 1L1OC 3W5OA 3HOWH 3I4NG 2R93H 3T1YQ 3UE0A 4DUYL 1H95A 2XTIA 1K9MC 4LF5L 4APVA 3CCUA 1X56A 4JI0L 4JYAL 3DLLA 2A8VA 1HJPA 3F2BA 3PIOA 1N33L 4AIMA 2JA5H 4A4IA 3K80C 2E5LQ 4YWMA 2OQ0A 1FJGQ 1XMOQ 1XMQQ 1E7ZA 3FKIH 3CMAA 4LF6L 4PZ7A 4OONA 4R4TA 1KD1C 4LUZA 4R4IA 4A3IH 4JOIA 4JBMA 5M5YH 3T1HQ 4NXNQ 3I55A 2YTYA 5GROA 4KLKA 3W1BA 3HOYG 4JI4L 4Y52H 3A5ZB 3M9BA 1QUQA 4P71A 1PH2A 1EUJA 1HZCA 2CFMA 1HR0L 2JEAI 2N8NA 2DUDA 5FLMG 4POGA 3M7NA 1EIYB 1I5FA 3CC7A 4JI7L 1KRTA 5IYDG 1W3SA 4X64L 3S1NH 3TS0A 3HOUG 1WFQA 2RCNA 5GADC 5IYCH 2B63G 4BY1G 4A3FG 1WOCA 3HOVH 4KHPL 1NTGA 4MTNA 1K0RA 3CW2C 4P73A 4HJ5A 5C3EG 4ALPA 4L5RC 2YV5A 4LF4L 4X66Q 2JA7H 3E9HA 1KXLA 3IRBA 1PH1A 2JA8G 3DM3A 4L5SA 1WCMG 3CCLA 3S15H 1SE8A 2YTXA 4A3EG 4X62L 3I4OA 1A62A 2UXBL 5DLQE 3PGZA 2V1CC 1VQOA 1N34Q 4LFCQ 1PFSA 3CCVA 1LYLA 2RHQB 1YBYA 1E22A 5LMUQ 4B3RL 2UUBQ 3UDIA 4GKJQ 4DV6L 5GAEC 1B7YB 4DR4Q 1B70B 2BA0A 2WP8J 3NELA 3T1YL 2D0PA 1VS0A 4LFAQ 4BBSH 4UP7A 4KI0A 4AH6A 3RZDH 2Z6KA 3RZOH 1X3EA 2PNHA 2ZM6Q 1NMFA 2WFWA 3J81c 2JEBI 1YHAA 4C3IH 2ASBA 3S1RH 1PYSB 2K52A 4LW1A 1T9HA 1YVCA 4LUOA 5FLXc 1VQBA 2E5LL 1FJGL 5IYDH 3I56A 3E9IA 5ELNA 4C2MH 2R92G 3S1QH 2IT1A 5IP7H 5H1SE 1XJVA 3PUYA 2OQKA 4DR6L 1SR3A 2VL6A 4NXNL 1E1OA 1GKHA 2DGYA 4IOCA 3HOUH 3UDGA 4LFBQ 3WWVA 2D62A 1CKNA 4IPGA 4DKAC 4B3MQ 4A3FH 1M90C 2ZJQA 3GTOH 2GVAA 5GQOA 4LWCA 4DAYB 4YHHL 3GTQH 5IP9H 3CCRA 4A3MG 1OXUA 2JA8H 1XNRL 3GD7A 3RLOA 5JJLA 1I6HH 1I94L 1P16A 1LM0A 1R9TH 3RN5A 1V1QA 1CKMA 4DV2Q 4O0AA 3STBD 4A3KG 4JOIC 2GVBA 2Q2HA 1IBKQ 4K0KQ 3F1ZA 4YY3Q 1SFOH 3HOZG 4A3CH 1I50H 1TWCH 2I5MX 4DV7Q 2ZTCA 4X66L 4DK6C 5IWAL 1JE5A 4KHZA 1N9WA 2ID0A 1PH9A 3CF5A 2F4VL 4BXXG 4A3DG 1Y1WG 1VQCA 3PUXA 5C44G 2JE6I 5E7NA 1TWFH 2N3SA 1NE3A 1YEZA 1XNQQ 5C4XG 4QJFA 1OXXK 2MO1A 4LFCL 3TEHB 5AJ3Q 2L15A 4LF9L 3KLWA 5LMUL 1PHJA 2JQOA 1HNXL 1FL0A 1SLJA 1SN8A 2PMZE 4DV5L 3S1MH 4R1JA 4C3JH 4GKJL 1TWHH 3STBC 4B3TQ 4LF8Q 3HKSA 1GD7A 4AQYQ 3KFUA 2EQSA 2K50A 4B3SL 1AE3A 3H0GG 4POFA 1WYDA 3BZKA 5GAHC 1IZ6A 1D7QA 4UY8C 4P72A 3JAMi 2ZJPA 1PH4A 1OXSC 1TWAH 4DV4Q 2HHHQ 3GTLH 3PO2G 5M5XH 4LFAL 4YCWA 2K14A 4X6AH 5M3MG 5C0XG 2KENA 1YJ9A 1N36Q 4QL5A 5BR8L 2ZM6L 3PV0A 4OO1I 2RHSB 4A3MH 2UXDL 3F2DA 1Q7YC 1IBMQ 1IBLQ 2KHIA 3PUVA 5LMNL 1BVSA 4DPGA 4O2DA 1UE5A 2WAQE 5C0XJ 1HNZQ 2WB1G 4A3KH 4OX9Q 4DAMA 1X9NA 1KAWA 1E1TA 3L7ZC 4NB3A 2R7DA 2CQOA 2IX1A 2KCMA 4UP8A 1Z47A 2AHOB 2UU9L 2NN6I 2Y0SE 2AKWB 2ATWA 4DV1Q 1XPRA 1PA6A 2Z6KC 2R7ZG 1QZGA 3EBEA 2HIVA 1W2BA 4JI1Q 2UUCQ 3J80i 3ZJYC 4TQUS 4BXXH 4A3JH 4IPCA 4DV3Q 2A1AA 1RIPA 2ZTDA 1G6PA 4AYBE 1AH9A 4JI8Q 1S40A 1JJGA 2EIFA 3M4OH 3CMEA 1Q12A 3M3YH 4HIDA 3I4MG 4OXPA 1VQMA 5M5WH 4DR5Q 3KF6A 3TREA 1QUQB 3H15A 5IYBG 1QVFA 3GO5A 3AFPA 3H0GH 1N32L 2LSSA 3OTOL 4JCVE 3G4SA 3VDYA 3PO2H 2VQFQ 2VQEQ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2VUM G;  1K8G A;  4GKK Q;  3KDF A;  1VQH A;  1YHQ A;  4X65 Q;  2R7F A;  1VQ5 A;  2OCE A;  5M3M H;  1BKB A;  1X3F A;  3KF6 B;  2IX0 A;  1X55 A;  3I2Z A;  4FDB A;  4DR3 Q;  4GLV B;  1IL2 A;  4IPD A;  3MEF A;  1NJI C;  4A3G H;  2UUA L;  4BA1 I;  2E8G A;  1Q81 C;  3I4N H;  4B3T L;  5JJK A;  3KDF B;  4AQY L;  2AWN A;  1EFW A;  1X65 A;  4DK3 C;  1VQJ A;  4DR1 Q;  1FVI A;  4OWX B;  2R6G A;  2K5V A;  1K73 C;  1LUZ A;  4PMW A;  2K5N A;  3L0O A;  3U50 C;  4DV4 L;  2OTL A;  3PO3 G;  1HH2 P;  1IXR A;  2NVQ H;  1LTL A;  4A93 G;  2K75 A;  1U0L A;  4L5Q A;  4DV0 Q;  2MFI A;  1J5E Q;  1G51 A;  4GNX A;  2Q2U A;  1VQN A;  5ELO A;  5IE8 A;  1IBL L;  1EOV A;  4LUV A;  4DUZ Q;  3HOY H;  4DR2 Q;  2A19 A;  4MZ9 A;  5M3F G;  3U58 A;  4DNI A;  3J81 j;  3PSI A;  4RMF A;  4GNX B;  1Q86 C;  2Y0S G;  2OWO A;  2VZA A;  4JI6 Q;  2H5X A;  4A3B G;  1QZH A;  2EXD A;  4IJL A;  1VQ6 A;  5FLM H;  1NBW A;  3I4M H;  4IFD I;  1VQ8 A;  1K8A C;  3J7A 5;  2MNA A;  3EIV A;  3OYY A;  1XMO L;  1XMQ L;  1HZ9 A;  1Y1V G;  3S24 A;  1NY4 A;  2JJQ A;  4AYB G;  4JI1 L;  3UDX A;  1VQK A;  2UUC L;  4LF7 Q;  1HNW Q;  4OWT B;  3T1H L;  1AE2 A;  4A3L G;  4QGU A;  2VUM H;  4BY7 G;  2B63 H;  3F8T A;  1EWI A;  1VQD A;  5EAY A;  4JI2 Q;  4BY1 H;  3ICE A;  3EN2 A;  1EQQ A;  2NZO A;  1BBU A;  5C3E H;  2KHJ A;  4L5T A;  1CSQ A;  2F3I A;  1WCM H;  1U5K A;  4DR5 L;  1CKN B;  3KJO A;  4A3E H;  4UP9 A;  3J81 i;  1X54 A;  1CUK A;  1PH5 A;  1KQS A;  1KRS A;  4JI5 Q;  2NVT H;  1D8L A;  2Q2I A;  3PO3 H;  2VQE L;  3RNU A;  2NVY H;  4JI0 Q;  1YJN A;  4A93 H;  4JYA Q;  1N33 Q;  3B6Y A;  4DR3 L;  3GDE A;  1Q82 C;  2Z0S A;  2PI2 E;  4IO9 A;  1KC8 C;  1IYJ B;  2IY5 B;  1Q46 A;  3CCM A;  4HIO A;  4GLX A;  3M4Q A;  1VQG A;  3I7F A;  4LF6 Q;  1V43 A;  1VQ9 A;  3GTJ H;  1VQ7 A;  4JI3 Q;  2RF4 A;  5FJ8 G;  1S72 A;  2IHF A;  1N34 L;  3AQQ A;  3HOW G;  1HZA A;  4JI4 Q;  1J6Q A;  2F52 A;  1L0W A;  2UUB L;  1K83 H;  4DV0 L;  2B29 A;  1J5E L;  1VCI A;  2MQH A;  2QGQ A;  1HR0 Q;  3CC2 A;  3NBH B;  3M85 A;  2JA5 G;  2R92 H;  5HY6 A;  3GTM H;  4DR4 L;  4YCV A;  2FXQ A;  3ERS X;  4JI7 Q;  2PQA A;  4DUZ L;  3BU2 A;  4DR7 Q;  3HFZ B;  4HJ8 A;  4A3I G;  3RLN A;  3AYH B;  4QIW E;  3U4V A;  4X64 Q;  4IPH A;  2QA4 A;  4GOP A;  4OO1 G;  2VS1 A;  1CSP A;  2ALY B;  1PH7 A;  1XPU A;  1SRU A;  1HR0 W;  1VQE A;  4KHP Q;  1PVO A;  2GN5 A;  1XTD A;  2XGT A;  1JMC A;  2HQL A;  4LF4 Q;  3CXC A;  4GNX C;  4PZ6 A;  4MNO A;  4H02 A;  1WI5 A;  4JBJ A;  3W1G A;  2JA9 A;  4LFB L;  4YCU A;  4X62 Q;  3F2C A;  3HOZ H;  4GN3 B;  4B3M L;  2UXB Q;  4TVA B;  2OTJ A;  1OTC A;  3K7A H;  4JI2 L;  2NN6 G;  3J7Z C;  2VW9 A;  3BZC A;  4B3R Q;  5IYC G;  3A0J A;  3HOV G;  2AMC B;  3AFQ A;  4A3D H;  2BH2 A;  3G71 A;  4DV6 Q;  1HZB A;  1NMG A;  4C3H H;  5C44 H;  5C0X I;  1Y1W H;  1PH3 A;  4JBK A;  2JA7 G;  1ASZ A;  1A0I A;  4JBW A;  1L2F A;  5C4X H;  3NEN A;  4Y7N H;  2I0Q A;  3K81 C;  1S3O A;  3NEM A;  4JI5 L;  5FJ8 H;  4DV2 L;  3KOJ A;  4QY7 A;  1RL2 A;  1IBK L;  4OWW B;  2AWO A;  2E2H H;  4YY3 L;  3H3V H;  4BA2 I;  4K0K L;  2JA6 G;  2CWA A;  2MO0 A;  1MJC A;  3SGI A;  2HIX A;  4DV7 L;  1WJJ A;  5J3B A;  2LXJ A;  4WJ3 M;  3HOX G;  1KL9 A;  3M4P A;  2BH8 A;  2E2I H;  4JG2 A;  3AEV A;  2HT1 A;  2VY3 A;  1XNQ L;  4DR6 Q;  4JI3 L;  5IY0 A;  3GTK H;  1B8A A;  5AJ3 L;  3GTP H;  3S16 H;  1C0A A;  1M1K C;  4XIG S;  4NXM Q;  2E2J H;  3PF4 A;  1JJ2 A;  4BBS G;  3S17 H;  4EQ5 A;  2D0O A;  3UDF A;  3PUZ A;  1GM5 A;  4LF8 L;  4YHH Q;  4JV5 Q;  2KBN A;  3CAM A;  3CP0 A;  1EYG A;  1XNR Q;  1I94 Q;  1GO3 E;  2B3G A;  1KIX A;  1MIU A;  2IHE A;  3JC6 6;  1JB7 A;  2HHH L;  3TRZ A;  4DR7 L;  1YHB A;  5IP7 G;  1QVG A;  1JJC B;  3RR5 A;  1E24 A;  2YU9 H;  3CPF A;  2QEX A;  3OW2 A;  3D31 A;  1OXV A;  4GS3 A;  4R4O A;  1N36 L;  2R7Z H;  3HKZ E;  2WAQ G;  4RG1 A;  1IBM L;  4YWK A;  1X3G A;  1EQR A;  3FP9 A;  2NZH A;  3CC4 A;  1E3P A;  1VQA A;  3U4Z A;  5IWA Q;  5IP9 G;  3A5U A;  3CCJ A;  1Q8K A;  1HNZ L;  1KHI A;  2K5H A;  2F4V Q;  1QVC A;  4OX9 L;  4JC0 A;  4IFD G;  2I5H A;  2JK8 A;  4PZ8 A;  4WJ4 A;  1BBW A;  1EIF A;  4GN5 A;  3ULP A;  4IOA A;  4PG3 A;  3PCO B;  3BJU A;  4LF9 Q;  2JA6 H;  1Q1E A;  2YTV A;  5IT9 c;  4DV1 L;  1YNX A;  4GOP C;  1L1O A;  3A74 A;  3K8A A;  1HNX Q;  4NPS A;  5IYB H;  3HOX H;  3CCS A;  1UE7 A;  1TXY A;  4BBR G;  4DV5 Q;  3PIP A;  1VQL A;  4A3C G;  4IFD J;  4DV3 L;  2N49 A;  2UXC Q;  3D0F A;  4YWL A;  3G6E A;  4QQB X;  3CCQ A;  4B3S Q;  4JI8 L;  1C7Y A;  1MJE A;  1DGS A;  3PUW A;  2NVX H;  3CD6 A;  1L1O B;  4HJ7 A;  1GVP A;  1CKO A;  3ULJ A;  3MXN B;  1VQ4 A;  4HIK A;  2C35 B;  1XPO A;  5BR8 Q;  4HJA A;  3ER0 A;  3K7U C;  4R4Q A;  1TWG H;  1C9O A;  2ZJR A;  1N8R C;  3S2H H;  2UXD Q;  1VQP A;  5LMN Q;  2VQF L;  4DUY Q;  2CWP A;  2LXK A;  4LF5 Q;  4GKK L;  1VQI A;  2I5L X;  4EX5 A;  3KF8 B;  4X65 L;  1ASY A;  4IJH A;  4GN4 B;  2BA1 A;  2CKZ B;  4NXM L;  1YJW A;  3TS2 A;  3Q8D A;  4UPA A;  2UU9 Q;  1UEB A;  2WB1 E;  1FGU A;  1I3Q H;  4JV5 L;  5LMN W;  4DR1 L;  5M3F H;  1PH6 A;  2R93 G;  2K4K A;  1G29 1;  3RLF A;  2ZTE A;  3TQY A;  4A75 A;  1PH8 A;  3S14 H;  4A3B H;  3HKZ G;  1PV4 A;  1V9P A;  1YIJ A;  5JJI A;  3K0X A;  1UWV A;  1Y1V H;  1MKH A;  3E0E A;  4HIM A;  2PI2 A;  4BBR H;  3JAM c;  3RN2 A;  4A3L H;  3FKI G;  4XTC S;  4DR2 L;  4BY7 H;  4P74 A;  2YYZ A;  1YI2 A;  3FHW A;  4A3J G;  3OTO Q;  3CCE A;  1Y14 B;  4JI6 L;  4LNQ A;  1N32 Q;  1OXT A;  5K36 G;  4ME3 A;  3LGJ A;  2PQA B;  4P75 A;  1YIT A;  3GTG H;  3KYH C;  2N78 A;  3ULL A;  2ES2 A;  3H3V I;  3KJP A;  1A8V A;  1JT8 A;  4R4C A;  2UUA Q;  3S2D H;  3CQZ H;  2CCZ A;  1UE6 A;  4LF7 L;  1HNW L;  1PYB A;  5C4J H;  1O7I A;  4GLA C;  4GOP B;  3PF5 A;  2UXC L;  2VNU D;  4J15 A;  5JEA G;  1A63 A;  1X6O A;  1SRO A;  1Z9F A;  5HGQ A;  3G48 A;  2Q2T A;  1P8L A;  1SMX A;  3CPW A;  1YZ6 A;  3J80 c;  4HJ9 A;  5JEA J;  1Q1B A;  1UE1 A;  1VQF A;  3L2P A;  3UE1 A;  2KCT A;  4A76 A;  5GAG C;  4A3G G;  1K3R A;  1L1O C;  3W5O A;  3HOW H;  3I4N G;  2R93 H;  3T1Y Q;  3UE0 A;  4DUY L;  1H95 A;  2XTI A;  1K9M C;  4LF5 L;  4APV A;  3CCU A;  1X56 A;  4JI0 L;  4JYA L;  3DLL A;  2A8V A;  1HJP A;  3F2B A;  3PIO A;  1N33 L;  4AIM A;  2JA5 H;  4A4I A;  3K80 C;  2E5L Q;  4YWM A;  2OQ0 A;  1FJG Q;  1XMO Q;  1XMQ Q;  1E7Z A;  3FKI H;  3CMA A;  4LF6 L;  4PZ7 A;  4OON A;  4R4T A;  1KD1 C;  4LUZ A;  4R4I A;  4A3I H;  4JOI A;  4JBM A;  5M5Y H;  3T1H Q;  4NXN Q;  3I55 A;  2YTY A;  5GRO A;  4KLK A;  3W1B A;  3HOY G;  4JI4 L;  4Y52 H;  3A5Z B;  3M9B A;  1QUQ A;  4P71 A;  1PH2 A;  1EUJ A;  1HZC A;  2CFM A;  1HR0 L;  2JEA I;  2N8N A;  2DUD A;  5FLM G;  4POG A;  3M7N A;  1EIY B;  1I5F A;  3CC7 A;  4JI7 L;  1KRT A;  5IYD G;  1W3S A;  4X64 L;  3S1N H;  3TS0 A;  3HOU G;  1WFQ A;  2RCN A;  5GAD C;  5IYC H;  2B63 G;  4BY1 G;  4A3F G;  1WOC A;  3HOV H;  4KHP L;  1NTG A;  4MTN A;  1K0R A;  3CW2 C;  4P73 A;  4HJ5 A;  5C3E G;  4ALP A;  4L5R C;  2YV5 A;  4LF4 L;  4X66 Q;  2JA7 H;  3E9H A;  1KXL A;  3IRB A;  1PH1 A;  2JA8 G;  3DM3 A;  4L5S A;  1WCM G;  3CCL A;  3S15 H;  1SE8 A;  2YTX A;  4A3E G;  4X62 L;  3I4O A;  1A62 A;  2UXB L;  5DLQ E;  3PGZ A;  2V1C C;  1VQO A;  1N34 Q;  4LFC Q;  1PFS A;  3CCV A;  1LYL A;  2RHQ B;  1YBY A;  1E22 A;  5LMU Q;  4B3R L;  2UUB Q;  3UDI A;  4GKJ Q;  4DV6 L;  5GAE C;  1B7Y B;  4DR4 Q;  1B70 B;  2BA0 A;  2WP8 J;  3NEL A;  3T1Y L;  2D0P A;  1VS0 A;  4LFA Q;  4BBS H;  4UP7 A;  4KI0 A;  4AH6 A;  3RZD H;  2Z6K A;  3RZO H;  1X3E A;  2PNH A;  2ZM6 Q;  1NMF A;  2WFW A;  3J81 c;  2JEB I;  1YHA A;  4C3I H;  2ASB A;  3S1R H;  1PYS B;  2K52 A;  4LW1 A;  1T9H A;  1YVC A;  4LUO A;  5FLX c;  1VQB A;  2E5L L;  1FJG L;  5IYD H;  3I56 A;  3E9I A;  5ELN A;  4C2M H;  2R92 G;  3S1Q H;  2IT1 A;  5IP7 H;  5H1S E;  1XJV A;  3PUY A;  2OQK A;  4DR6 L;  1SR3 A;  2VL6 A;  4NXN L;  1E1O A;  1GKH A;  2DGY A;  4IOC A;  3HOU H;  3UDG A;  4LFB Q;  3WWV A;  2D62 A;  1CKN A;  4IPG A;  4DKA C;  4B3M Q;  4A3F H;  1M90 C;  2ZJQ A;  3GTO H;  2GVA A;  5GQO A;  4LWC A;  4DAY B;  4YHH L;  3GTQ H;  5IP9 H;  3CCR A;  4A3M G;  1OXU A;  2JA8 H;  1XNR L;  3GD7 A;  3RLO A;  5JJL A;  1I6H H;  1I94 L;  1P16 A;  1LM0 A;  1R9T H;  3RN5 A;  1V1Q A;  1CKM A;  4DV2 Q;  4O0A A;  3STB D;  4A3K G;  4JOI C;  2GVB A;  2Q2H A;  1IBK Q;  4K0K Q;  3F1Z A;  4YY3 Q;  1SFO H;  3HOZ G;  4A3C H;  1I50 H;  1TWC H;  2I5M X;  4DV7 Q;  2ZTC A;  4X66 L;  4DK6 C;  5IWA L;  1JE5 A;  4KHZ A;  1N9W A;  2ID0 A;  1PH9 A;  3CF5 A;  2F4V L;  4BXX G;  4A3D G;  1Y1W G;  1VQC A;  3PUX A;  5C44 G;  2JE6 I;  5E7N A;  1TWF H;  2N3S A;  1NE3 A;  1YEZ A;  1XNQ Q;  5C4X G;  4QJF A;  1OXX K;  2MO1 A;  4LFC L;  3TEH B;  5AJ3 Q;  2L15 A;  4LF9 L;  3KLW A;  5LMU L;  1PHJ A;  2JQO A;  1HNX L;  1FL0 A;  1SLJ A;  1SN8 A;  2PMZ E;  4DV5 L;  3S1M H;  4R1J A;  4C3J H;  4GKJ L;  1TWH H;  3STB C;  4B3T Q;  4LF8 Q;  3HKS A;  1GD7 A;  4AQY Q;  3KFU A;  2EQS A;  2K50 A;  4B3S L;  1AE3 A;  3H0G G;  4POF A;  1WYD A;  3BZK A;  5GAH C;  1IZ6 A;  1D7Q A;  4UY8 C;  4P72 A;  3JAM i;  2ZJP A;  1PH4 A;  1OXS C;  1TWA H;  4DV4 Q;  2HHH Q;  3GTL H;  3PO2 G;  5M5X H;  4LFA L;  4YCW A;  2K14 A;  4X6A H;  5M3M G;  5C0X G;  2KEN A;  1YJ9 A;  1N36 Q;  4QL5 A;  5BR8 L;  2ZM6 L;  3PV0 A;  4OO1 I;  2RHS B;  4A3M H;  2UXD L;  3F2D A;  1Q7Y C;  1IBM Q;  1IBL Q;  2KHI A;  3PUV A;  5LMN L;  1BVS A;  4DPG A;  4O2D A;  1UE5 A;  2WAQ E;  5C0X J;  1HNZ Q;  2WB1 G;  4A3K H;  4OX9 Q;  4DAM A;  1X9N A;  1KAW A;  1E1T A;  3L7Z C;  4NB3 A;  2R7D A;  2CQO A;  2IX1 A;  2KCM A;  4UP8 A;  1Z47 A;  2AHO B;  2UU9 L;  2NN6 I;  2Y0S E;  2AKW B;  2ATW A;  4DV1 Q;  1XPR A;  1PA6 A;  2Z6K C;  2R7Z G;  1QZG A;  3EBE A;  2HIV A;  1W2B A;  4JI1 Q;  2UUC Q;  3J80 i;  3ZJY C;  4TQU S;  4BXX H;  4A3J H;  4IPC A;  4DV3 Q;  2A1A A;  1RIP A;  2ZTD A;  1G6P A;  4AYB E;  1AH9 A;  4JI8 Q;  1S40 A;  1JJG A;  2EIF A;  3M4O H;  3CME A;  1Q12 A;  3M3Y H;  4HID A;  3I4M G;  4OXP A;  1VQM A;  5M5W H;  4DR5 Q;  3KF6 A;  3TRE A;  1QUQ B;  3H15 A;  5IYB G;  1QVF A;  3GO5 A;  3AFP A;  3H0G H;  1N32 L;  2LSS A;  3OTO L;  4JCV E;  3G4S A;  3VDY A;  3PO2 H;  2VQF Q;  2VQE Q; 
#chains in the Genus database with same CATH topology
 5JJZ A;  2XNA C;  1A3V A;  1VQH A;  2KQ3 A;  1BBX C;  1S5D D;  5M3M H;  1X3F A;  1B2T A;  3SR1 A;  4GLV B;  2EY2 A;  3NBI A;  1LTT D;  1NJI C;  2GA4 B;  2E8G A;  2R92 B;  3KDF B;  4AQY L;  3NTH A;  3MFY A;  2BDO A;  1K73 C;  1LUZ A;  4PMW A;  2K5N A;  4DV4 L;  4R8N A;  2A6H D;  2OTL A;  2K75 A;  4RHS A;  1DYQ A;  2MPM A;  4PV1 C;  4G7Z C;  4EQO A;  2A19 A;  4H44 C;  1WD1 A;  2WII B;  3J81 j;  4RMF A;  4JI6 Q;  4A3B G;  1LAC A;  1NBW A;  3RUZ A;  1VQ8 A;  2EVB A;  1D2B A;  3SK8 A;  2MNA A;  1HZ9 A;  5D14 A;  2JJQ A;  4EQN A;  4ZLT F;  1HRJ A;  1Y1W B;  3MVV A;  1EWI A;  4CKE A;  1EQQ A;  2OF1 A;  4R9W A;  2B2W A;  1DON A;  1QWY A;  3K59 A;  1U5K A;  4DR5 L;  1CKN B;  4A3E H;  2XRQ D;  3J81 i;  4CBV A;  1PH5 A;  5ELF A;  1KRS A;  2B8F A;  2M9V A;  2Z4I A;  1A15 A;  4NW2 A;  1PZK D;  4XYO A;  3J7Y W;  4JYA Q;  3AU7 A;  1E2V A;  3B6Y A;  3OWF A;  3GDE A;  4B08 A;  2JP1 A;  2PI2 E;  1KC8 C;  4DNT B;  2R3Z A;  4LF6 Q;  3GTJ H;  3NBH A;  2F0P A;  2IHF A;  1N34 L;  5DM7 3;  1RDP D;  1L0W A;  1H9K A;  3FPU B;  4F88 A;  3CC2 A;  2QGQ A;  5I9O A;  4NMZ A;  2KUM A;  3M85 A;  3GTM H;  2B39 A;  2Z4H A;  3HOY B;  2FXQ A;  2PQA A;  3MXP A;  3BU2 A;  4DR7 Q;  3Q24 A;  3AYH B;  4QIW E;  3U4V A;  2NTT A;  1PH7 A;  1SRU A;  2SDF A;  1HR0 W;  2GN5 A;  1XTD A;  2XGT A;  4DXF A;  1FYC A;  4PZ6 A;  3TDQ A;  3C1F A;  3BVG A;  3NK9 A;  1V1O A;  2JA9 A;  3P1H A;  4HAE A;  5IOC A;  4KD3 A;  4TVA B;  2NVX B;  3D4D A;  5C3E B;  2JN4 A;  3BZC A;  4B3R Q;  5IYC G;  3I72 A;  3H6M A;  3WOF A;  3G71 A;  4DV6 Q;  4C3H H;  4JBK A;  5C0X I;  4ZCK A;  4IUU A;  1A0I A;  3NEN A;  3NEM A;  5FJ8 H;  2DN8 A;  1FD7 D;  3H3V H;  2NZ1 D;  3PO3 B;  2E2H H;  2CWA A;  2HIX A;  5JPN C;  4DV7 L;  5C4Z A;  1K8O A;  1L0X B;  3M4P A;  2BH8 A;  2B2W C;  2X6L A;  2A68 D;  2NB0 A;  2VY3 A;  1XNQ L;  4JI3 L;  1SNP A;  5IY0 A;  2Y0S B;  1B8A A;  4K6D A;  4KTA A;  1EIG A;  5LL6 S;  5AJ3 L;  3S16 H;  4ID6 A;  4NXM Q;  2E2J H;  1K83 B;  4RFB A;  4LF8 L;  4RH6 A;  1DXM A;  4YHH Q;  3D6C A;  4C3I G;  2J0T D;  1PFM A;  4BY7 B;  1GUN A;  1JJC B;  2K5Q A;  3R3O A;  3RR5 A;  2ZXO A;  1KDB A;  2NUC A;  2R7Z H;  3OW2 A;  1SND A;  1EEF D;  2WAQ G;  4RG1 A;  1W6K A;  2RSO A;  2A68 C;  3LWU A;  1E3P A;  3U4Z A;  5IWA Q;  5IP9 G;  3S2D B;  1HA5 A;  4OX9 L;  4NKL A;  1CA5 A;  2JK8 A;  1JB3 A;  4XT1 B;  3TN2 A;  1BBW A;  1SJH D;  3I4L A;  1B4O A;  4PG3 A;  4CJ0 B;  1Q1E A;  1LT5 D;  1A3U A;  2KCN A;  2LKV A;  4H0L C;  5IYB H;  3HOX H;  1UE7 A;  3BS1 A;  2UXC Q;  2EY1 A;  2SEB D;  4QQB X;  3CCQ A;  4FXG C;  4B3S Q;  1SYG A;  1K28 A;  3HOW B;  4K5X A;  2O4X A;  1VQ4 A;  2CH4 W;  2L0C A;  2C35 B;  4ABN A;  5JVH 3;  1XPO A;  4EQP A;  4R4Q A;  1TWG H;  4H13 C;  2F0E A;  3QR8 A;  2L9H A;  4X3U A;  1YNJ D;  4C3J G;  3K58 A;  3VR5 A;  2CWP A;  2E2D C;  1VQI A;  2I5L X;  4X65 L;  2F0L A;  3TSS A;  3TS2 A;  4G7O C;  4G4K A;  2UU9 Q;  3ONA B;  2MHV A;  1HUN A;  4G57 A;  4JV5 L;  5FO7 B;  3H09 A;  5M3F H;  1B44 D;  3MTS A;  1A3T A;  1G91 A;  2ZTE A;  1PV4 A;  1D5X C;  1YNJ C;  1K0S A;  2Q8R E;  4P2C B;  1MKH A;  3E0E A;  4BBR H;  4A3L H;  3U9O A;  3FKI G;  4DGZ A;  1WTV A;  4P74 A;  1N32 Q;  3FHW A;  5T1I A;  4A3J G;  3CCE A;  1FR3 A;  1Y14 B;  2C9O A;  4JVZ A;  3EJI A;  2JA6 B;  2PQA B;  3GTG H;  2AQ2 B;  1EY6 A;  3KJP A;  1SNC A;  4WJW A;  1UE6 A;  1FNV A;  4GLA C;  1Z9F A;  2PMZ B;  2XSC A;  4K8I A;  2K33 A;  2Q2T A;  1O7Y A;  1DJR D;  1SMX A;  1STY A;  4HJ9 A;  2L5T A;  5JEA J;  2PW7 A;  1UE1 A;  4IAL A;  2EOT A;  5CGK A;  1K3R A;  3MC0 B;  5EJW A;  3PQI A;  3T1Y Q;  2MP1 A;  4DUY L;  2DJG C;  4APV A;  3CCU A;  2A8V A;  3F2B A;  1NSN S;  3OHX C;  3QOL A;  2JA5 H;  1IHZ A;  1EWH A;  3A56 A;  1XMO Q;  1F9Q A;  3CMA A;  1SYB A;  4IUR A;  4A3I H;  1I6H B;  4JOI A;  1EIH A;  3T1H Q;  1ET6 A;  1R9T B;  5GRO A;  4FVM A;  1B9M A;  2RDG A;  2PZU A;  5I2Y A;  4JI4 L;  4OO1 H;  3T4A C;  4G7H C;  3M7N A;  1TWC B;  2N88 A;  4QMG A;  1D5Z C;  1QNU A;  3CC7 A;  4JI7 L;  1JE4 A;  3MEH A;  3URY A;  1B3A A;  1W3S A;  4X64 L;  2NN6 H;  2RCN A;  1SMY D;  5KIX A;  5GAD C;  3N6R A;  4KHP L;  4A3F G;  3HOV H;  2PNR C;  4ALP A;  2DY8 A;  5A2Q L;  4LF4 L;  1GOZ A;  1TKW B;  4I65 A;  1KXL A;  1GUT A;  1PH1 A;  3DM3 A;  4L5S A;  3CCL A;  1VMP A;  4A3E G;  3PGZ A;  4LFC Q;  1G2S A;  1LYL A;  2RHQ B;  2A69 D;  1E22 A;  1NCV A;  4H7B A;  2FIN B;  4KY6 A;  2K6A A;  1B7Y B;  1EEI D;  5ISR A;  1ZYR D;  1KLU D;  2PQE A;  2R93 B;  1D1K A;  4J6H A;  4BBS H;  1GXD C;  1HFG A;  1DCZ A;  1EQT A;  2DNC A;  2WFW A;  4DN4 M;  4KMU C;  3S1R H;  2K52 A;  1D6E C;  2WIN B;  4LW1 A;  5FLX c;  5IYD H;  4C2M H;  2F0O A;  1BCP C;  2A69 C;  4CKB A;  5IP7 H;  3FPP A;  3PUY A;  4NXN L;  1E1O A;  1GKH A;  3UDG A;  1I4R A;  4B3M Q;  4HN7 A;  2O2L D;  1ZYR C;  1AFP A;  4DAY B;  5FOB B;  3GTQ H;  1OXU A;  5EPK A;  2DJF C;  2JYO A;  3GD7 A;  4DNR B;  1XNR L;  3LNN A;  3KLR A;  4KY5 A;  3FRP B;  1FNW A;  4N8F A;  1X32 A;  4KJO A;  4DV2 Q;  3S1N B;  3A8K E;  2F3W A;  4JOI C;  4K0K Q;  2RA4 A;  3F1Z A;  1EYD A;  3KK7 A;  3VR6 A;  1PZI D;  3L3O C;  1C4Q A;  4BWG B;  4DK6 C;  4BXX G;  3D3R A;  4C3H G;  1VQC A;  2JE6 I;  2EYL A;  2N3S A;  1YEZ A;  3BDL A;  1RF2 D;  1X3Q A;  3KLW A;  1SYF A;  1PHJ A;  3P20 A;  2F0S A;  2QW7 A;  1SLJ A;  1SN8 A;  1EWC A;  2EYO A;  2PMZ E;  2F3V A;  4GKJ L;  4IQZ A;  3BYT B;  3H0G G;  4POF A;  4FYD A;  2QDL A;  1IZ6 A;  4ZAI A;  1OXS C;  3A55 A;  2B2U A;  2SOB A;  3T53 B;  1IKL A;  4X3S A;  2K14 A;  2E75 C;  4X6A H;  3RZO B;  1OO9 B;  1WTX A;  1JCK B;  2UXD L;  3VYT A;  3I90 A;  4KKS A;  4X3T A;  5LMN L;  1BVS A;  4LAA A;  5NUC A;  5BN3 A;  1BCP B;  2B63 B;  2SNM A;  2R7D A;  2CQO A;  1ZXT A;  2R7Z G;  3A7L A;  1JOO A;  1PA6 A;  3EBE A;  2HIV A;  1W2B A;  4K2K A;  3J80 i;  3ZJY C;  1WCM B;  4EVO A;  4XT3 B;  5BN4 A;  4BS9 A;  2ZTD A;  1G6P A;  4AYB E;  3FDT A;  1JJG A;  3SEB A;  2NVY B;  4HID A;  2F0W A;  1VQM A;  4I7A A;  2HDM A;  5JEA H;  5IYB G;  1EY4 A;  2QEJ C;  5IGD A;  3OTO L;  3G4S A;  3VDY A;  1TWF B;  5J22 A;  3M7G A;  2VUM G;  4Q5V A;  3KDF A;  2R7F A;  1BKB A;  2IX0 A;  1X55 A;  5C0X H;  3QO2 A;  4ZRZ A;  5CC4 A;  1EYA A;  2F0I A;  4B3T L;  5JJK A;  1X65 A;  4DK3 C;  1V8Q A;  1GHK A;  1MSG A;  3U50 C;  1IXR A;  1JOK A;  4DV0 Q;  4A93 G;  5ELE A;  1J5E Q;  1G51 A;  4DK0 A;  3MXU A;  5IGE A;  4A3M B;  1F9P A;  2Q2U A;  2IWH A;  1VQN A;  3J7A V;  1EOV A;  3HOY H;  1EYC A;  1TS5 A;  4DR2 Q;  1ZKO A;  4MZ9 A;  5D3I B;  5M3F G;  3U58 A;  3GV3 A;  1Q86 C;  1HA6 A;  4IFD I;  1QZH A;  4IJL A;  5FLM H;  2B2U C;  2RQX A;  4K2L A;  4CKC A;  3OYY A;  1XMQ L;  3CKI B;  5FLX L;  2UUC L;  4A3D B;  1HNW Q;  4LF7 Q;  5C44 B;  4A3L G;  4X3K A;  1SDF A;  5C4X B;  3F8T A;  1VQD A;  3IFD A;  4O1N A;  5EAY A;  4JI2 Q;  2NZO A;  5C3E H;  4KV6 A;  3J7A F;  1AN8 A;  1CSQ A;  1CHQ D;  3KJO A;  2PYK A;  5FLX E;  3WDN A;  2NVT H;  3PO2 B;  1D8L A;  3PO3 H;  3LX0 A;  1EZ8 A;  3GTK B;  5HGT A;  3GTP B;  3GV6 A;  4UHV A;  3OIP A;  2D5D A;  5JOB A;  5FO9 B;  1IYJ B;  1Q46 A;  3MWY W;  2Q8T A;  4IN3 A;  1VQG A;  1V43 A;  3MXG A;  1VQ9 A;  5T1G A;  5KYI A;  2WB1 B;  4WOR A;  1BOS A;  1J6Q A;  1XX8 A;  2YU9 B;  2UUB L;  3PIO 3;  1K83 H;  1TS2 A;  4OIK A;  1VCI A;  2PCF B;  5KNB A;  2F03 A;  3NPP A;  2JA5 G;  5FK9 C;  1A2U A;  5FO8 B;  1HHV A;  3HFZ B;  1EY5 A;  3P7J A;  4CDC C;  4A3I G;  2P5Z X;  4OO1 G;  3I4M B;  3SDZ A;  1XPU A;  3NUC A;  2HQL A;  3CXC A;  3QOJ A;  2F0M A;  3ERO A;  3H94 A;  5F2D A;  4LFB L;  1JOQ A;  3EA6 A;  1STH A;  2F0T A;  3ERQ A;  4X62 Q;  3F2C A;  3HOZ H;  2UXB Q;  2OTJ A;  2NN6 G;  3NSW A;  3J80 E;  3J7Z C;  1I4G A;  2VW9 A;  3HOV G;  2J7Z A;  4N9P A;  1SNQ A;  1HZB A;  1DOK A;  1ENF A;  2TSS A;  4KKT A;  2Z6B A;  1PDQ A;  4Y7N H;  1QE6 A;  2L4N A;  1IBK L;  4BA2 I;  5ELD A;  3E5S A;  1H9M A;  1MJC A;  1WJJ A;  1ML0 D;  1ILQ A;  1KDA A;  2CW0 D;  2LXJ A;  5J39 A;  2PZT A;  4Q0F A;  3AEV A;  1SNM A;  1QJO A;  4DR6 Q;  3VR2 A;  4ZK9 B;  5C4H A;  1ICW A;  3S14 B;  4A3B B;  4XIG S;  4BBS G;  2A74 C;  2F1M A;  3S17 H;  3VA7 A;  1GM5 A;  2EY6 A;  3CAM A;  1Z6H A;  2EYP A;  2HHH L;  3P75 A;  4DR7 L;  1JB7 A;  5IP7 G;  1KAB A;  2CW0 C;  1SEB D;  5C5M A;  2QEX A;  3D31 A;  4GS3 A;  4R4O A;  5I2X A;  1N36 L;  3HKZ E;  3E0J A;  2LS0 1;  3IL8 A;  3FP9 A;  3NP8 A;  4IUV A;  2Q8I B;  3CC4 A;  3TP7 A;  2B2T A;  3HP3 A;  1HNZ L;  1Q8K A;  2F4V Q;  5C4J B;  4OHJ A;  1QVC A;  1CA6 A;  2EYH A;  1CQF A;  1JR0 D;  5CV9 A;  3K57 A;  4GN5 A;  4IOA A;  2JA6 H;  3PCO B;  4LF9 Q;  2V4D A;  4DV1 L;  4ILW A;  3A74 A;  3MHB A;  4IFD J;  3D4W A;  2K5W A;  4YWL A;  2Z8L A;  4MN3 A;  1MJE A;  4TRD A;  2OXP A;  1GVP A;  2F0Q A;  3ULJ A;  1HUM A;  5DEH A;  5IGG A;  2R61 A;  4HJA A;  1A2T A;  3ER0 A;  4RGN A;  5JPM C;  1C9O A;  2K5D A;  1N8R C;  3S2H H;  2IW3 A;  2E2I B;  1EU4 A;  1VQP A;  2NWG A;  4UDU C;  5CBA E;  3E3X A;  2VQF L;  2NYZ D;  4LF5 Q;  4GKK L;  3N52 A;  3KF8 B;  1ASY A;  2IX3 A;  4IJH A;  1H9S A;  5IGB A;  2BA1 A;  4NXM L;  1YJW A;  1BO0 A;  2XWB B;  1UEB A;  2WB1 E;  2EYJ A;  1FGU A;  1I3Q H;  3TP5 A;  2F0D A;  4DR1 L;  1PH6 A;  3WOE A;  1C8C A;  2K4K A;  2K28 A;  1SJE D;  1V9P A;  1YIJ A;  5JJI A;  4F87 A;  1Y1V H;  4HIM A;  1TY0 A;  3JAM c;  3RN2 A;  4MIU A;  4B9X A;  4XTC S;  2A73 B;  3F2U A;  3GP7 A;  2YYZ A;  4LNQ A;  1VMC A;  1LT3 D;  1YNN C;  2KJX A;  1HFN A;  1A8V A;  4IUQ A;  3CU7 A;  3CQZ H;  1PYB A;  4ZKB B;  2UXC L;  5JEA G;  5J1Z A;  1X6O A;  2B2T C;  1A6X A;  3W3A A;  4DAP A;  3DEP A;  1Q1B A;  3KLS A;  3L2P A;  3VYR A;  2KCT A;  4C3I B;  2SNS A;  2R93 H;  4RWS C;  3S1Q B;  1NUC A;  2KHS A;  2XTI A;  4JI0 L;  1UEA B;  3DLL A;  2QDB A;  3PIO A;  1N33 L;  1BDO A;  4AIM A;  2WAQ B;  1EOT A;  2E5L Q;  5LL6 X;  4YWM A;  1FJG Q;  1S5E D;  2FFK B;  1ET9 A;  1KD1 C;  4LUZ A;  3TP8 A;  5M5Y H;  3HOY G;  3H91 A;  4KLK A;  3T51 B;  3W1B A;  4ZYS A;  1PH2 A;  1EUJ A;  4C1N I;  2BCO A;  1HR0 L;  2CFM A;  5FLM G;  5COY A;  1AP0 A;  2F0V A;  1TQO A;  2KVM A;  1KRT A;  1MI2 A;  2B2Y A;  4IUP A;  3S1N H;  3OMC A;  3HOU G;  4KK7 A;  1LV9 A;  2BE5 D;  4MTN A;  1K0R A;  5D65 A;  5C3E G;  2JA7 H;  3E9H A;  2JA8 G;  3I73 A;  4C3J B;  1EU3 A;  3C46 A;  3DEO A;  1A62 A;  2V1C C;  1N34 Q;  1PFS A;  1TWA B;  3CCV A;  5LMU Q;  4RGO S;  5M5X B;  1EZ6 A;  2K05 A;  2RBM A;  3Q0A A;  3VR4 A;  3TZD A;  4DXG A;  1CI3 M;  3QB3 A;  2C5C A;  4TKO B;  2BA0 A;  2WP8 J;  2BE5 C;  3NEL A;  3T1Y L;  1VS0 A;  4LFA Q;  4U68 A;  4UP7 A;  3RZO H;  2PNH A;  1HQM C;  2ASB A;  1PYS B;  4LUO A;  3FKI B;  1F2L A;  5ELN A;  4DAY A;  4A3J B;  2OQK A;  1L0Y B;  2DGY A;  2KED A;  2E74 C;  2D62 A;  4IPG A;  3GTO H;  1M90 C;  1WVL A;  2FJ2 A;  3M3Y B;  2EYM A;  1MHW C;  1T5X D;  4RGM A;  5JJL A;  3RLO A;  1H9S B;  1I94 L;  5CV6 A;  1PTO D;  1LM0 A;  4IFD H;  1DZ1 A;  4A3K G;  1SFO H;  3R2I A;  3HOZ G;  3BG3 A;  3JAM L;  4DV7 Q;  1XTC D;  1N9W A;  3CF5 A;  1Q3L A;  3PUX A;  1C48 A;  5E7N A;  2ICE C;  1TWF H;  1ICF B;  1NE3 A;  1XNQ Q;  3Q22 A;  2PO4 A;  3I8Z A;  4QJF A;  1OXX K;  2B2Y C;  4LFC L;  5AJ3 Q;  1I4H A;  2HQE A;  1PTO C;  2JQO A;  4RCO A;  1HNX L;  4C56 C;  2K32 A;  4DV5 L;  1BF4 A;  3S1M H;  4L63 B;  4LF8 Q;  3KFU A;  2K50 A;  3JAM E;  2VB2 X;  1WYD A;  2HCC A;  4CHT B;  1PH4 A;  3GTL H;  1E2W A;  1SAP A;  4YCW A;  3L9A X;  3RZD B;  5M3M G;  5BR8 L;  4ZKC B;  3PV0 A;  2HDL A;  1QCB D;  4A3M H;  3F2D A;  1IBL Q;  1E2Z A;  1MBY A;  3Q6S A;  2LFN A;  4DPG A;  1W6J A;  2WAQ E;  5C0X J;  1B9N A;  4DAM A;  1CTM A;  5E4W C;  4OX9 Q;  4A3F B;  1KAW A;  3L7Z C;  4FF4 A;  2F0J A;  1Z47 A;  2ATW A;  2Y0S E;  1TVX A;  1QZG A;  1FGB D;  4JI1 Q;  2E76 C;  4TQU S;  2KEE A;  2A1A A;  4A3E B;  1RIP A;  1VF7 A;  3I3C A;  3C3L A;  1DOM A;  4FP5 D;  1S40 A;  2Z9H A;  3NTK A;  2CVR A;  3MA2 B;  1Q12 A;  4XQN A;  5KYL A;  2FHT A;  3PIP 3;  2M2L A;  1PLF A;  4JCV E;  3PO2 H;  2VQE Q;  2XWJ B;  3GTJ B;  1YHQ A;  4X65 Q;  4DR3 Q;  4FDB A;  2MGS A;  4A3G H;  2UUA L;  4BA1 I;  1PTO B;  1RD9 D;  3I4N H;  2KA7 A;  4RKB A;  4ZUJ A;  3V2T A;  3GTM B;  2QIL A;  4OWX B;  5EKK A;  3NQI A;  3ICE A;  1BCP D;  3L0O A;  1HH2 P;  2F0F A;  1LTL A;  1EY0 A;  2MFI A;  2N55 A;  4XXE A;  1CZG A;  1KAA A;  5A2Q E;  5ELO A;  5JVG 3;  4DUZ Q;  1F2Z A;  2M00 A;  1BXT A;  4DNI A;  3BVM A;  4GNX B;  2VZA A;  2H5X A;  5A35 A;  1VQ6 A;  3I4M H;  3J7A 5;  1BCP F;  3EIV A;  4QUC A;  1Y1V G;  3S24 A;  1NY4 A;  4AYB G;  1VQK A;  2FMM A;  4C3H B;  1F9R A;  1LT4 D;  3MXN A;  4QB4 A;  4QGU A;  1E0B A;  1NAP A;  3EN2 A;  2E2H B;  2KHJ A;  3PMF A;  2DNE A;  3LWE A;  1G6Z A;  5M5W B;  1AW7 A;  1Q8I A;  4UP9 A;  3H0G B;  1X54 A;  1WTP A;  4JI5 Q;  5IIF A;  4OEL B;  3ND9 A;  3RNU A;  1YJN A;  3S16 B;  3OMG A;  1Q82 C;  4IO9 A;  4HIO A;  1GUS A;  3KBG A;  2RF4 A;  1Y8O B;  5FJ8 G;  1O78 A;  1S72 A;  4JI4 Q;  2NVQ B;  2F52 A;  2ICI A;  5CV7 A;  1HTL D;  4DV0 L;  2R7Z B;  2WV6 D;  1J5E L;  3OOC A;  2R92 H;  4DR4 L;  5HY6 A;  4YCV A;  4JI7 Q;  5LHY 1;  1T5E A;  3G7L A;  4HCS A;  4HJ8 A;  3RLN A;  4J8Q A;  4X64 Q;  1O7Z A;  4IPH A;  4GOP A;  2EY5 A;  1CSP A;  2ALY B;  4KN7 C;  4KHP Q;  1VQE A;  2K01 A;  1PVO A;  5EBC A;  1JMC A;  3I70 A;  4LF4 Q;  3BDC A;  4XQJ A;  1WI5 A;  1SYE A;  2VUM B;  4U67 3;  4BY1 B;  3C2P A;  4GN3 B;  4JI2 L;  2L11 A;  1NR4 A;  1O80 A;  4NDX A;  1K8M A;  3M4Y A;  1SE3 A;  3A0J A;  3RMH A;  2AMC B;  1BQQ T;  2G9H D;  1Y1W H;  1NMG A;  1F2Y A;  1PH3 A;  1IL8 A;  1TWG B;  2JA7 G;  3KOJ A;  1RL2 A;  3HEJ A;  2AWO A;  4MTK A;  4KKU A;  4YY3 L;  3W2D A;  4A93 B;  3MAQ A;  3SGI A;  2EJM A;  3RD4 A;  5J3B A;  1STA A;  1EY7 A;  3S9W A;  4WJ3 M;  3HOX G;  1MGS A;  2E2I H;  1UAP A;  1F77 A;  5M3F B;  5D3D A;  1S5F D;  3MZ5 A;  3HRZ C;  1JJ2 A;  1J9O A;  2K03 A;  2D0O A;  4O42 A;  3UDF A;  3PUZ A;  5KNC A;  1MD2 D;  1LTB D;  3CP0 A;  2EE1 A;  1XNR Q;  1GHJ A;  2NBF A;  1ZEQ X;  2B3G A;  3TRZ A;  1MIU A;  1MSH A;  1PZJ D;  1YHB A;  2F0K A;  1E24 A;  1OXV A;  5ELC A;  3SVM A;  1IBM L;  3GTG B;  1EQR A;  1EL0 A;  3CCJ A;  5M9O A;  2AUJ D;  1JWS D;  4IFD G;  4JC0 A;  4ZUI A;  2I5H A;  4MHE A;  3K7A B;  4CDF C;  3A8I E;  4DU9 A;  3ULP A;  2HCI A;  5IT9 c;  4OEM B;  4GOP C;  2NTS A;  4NPS A;  2EJG C;  3UI2 A;  4BBR G;  3PIP A;  1WTH A;  4DV3 L;  2EJF C;  2N49 A;  4JI8 L;  2NVX H;  1DGS A;  3PUW A;  1L1O B;  2I07 B;  2PW5 A;  2RDF A;  3MXN B;  3DXJ C;  2G5D A;  4DFA A;  3KF8 A;  2TMP A;  2JA5 B;  3BYY B;  4CDE C;  2UXD Q;  1PMR A;  5CBE E;  1M8A A;  1XYI A;  5LMN Q;  4IZ8 A;  2LXK A;  4A3I B;  2QF7 A;  1RTN A;  4GN4 B;  2CKZ B;  2MUY A;  4UPA A;  5EQ0 A;  1LTS D;  2IL8 A;  4K6L A;  4KY7 A;  2D9U A;  4FNF A;  4EGV A;  2RKS A;  5C3X A;  4A75 A;  1R4Q B;  1GUW A;  3HKZ G;  2L12 A;  3D6W A;  4L8J A;  5EKL A;  2OT2 A;  5C6A A;  1TU2 B;  1GUO A;  1UWV A;  3HOV B;  3NWT A;  4BY7 H;  3OTO Q;  4JI6 L;  3T16 A;  4OGQ C;  2F0G A;  4P75 A;  1YIT A;  4RGT A;  2N78 A;  3Q23 A;  1JT8 A;  3NWS A;  2O5I C;  4R4C A;  3S2D H;  2CCZ A;  3G6J B;  5I4D A;  4GOP B;  1O7I A;  5K5P A;  1A63 A;  4J15 A;  3GQB A;  1SRO A;  5HGQ A;  1RKN A;  3G48 A;  4OIJ A;  1P8L A;  4FF2 A;  2ZT9 C;  4PMC A;  3CPW A;  1PRT B;  1YZ6 A;  4BBS B;  1SSO A;  2CH4 A;  4XDX A;  1O7L A;  5GAG C;  4A3G G;  3HOW H;  3I4N G;  1F9S A;  1H95 A;  1B1Z A;  4LF5 L;  4M1U B;  4JYA L;  3D4R A;  1HJP A;  1TII D;  1TS3 A;  5EGT A;  1RCV D;  5CYU A;  3K80 C;  4JK1 C;  1XMQ Q;  1E7Z A;  1JWU D;  3FKI H;  4LF6 L;  4PZ7 A;  4FF1 A;  4S3S A;  4OON A;  3I55 A;  2YTY A;  3VR3 A;  1STB A;  3A5Z B;  4K5W A;  1CHP D;  2EPB A;  4P71 A;  4DK1 A;  1GJX A;  2H1E A;  1EIY B;  4KJN A;  3V96 A;  3NTI A;  5IYD G;  1QNK A;  2MJ8 A;  4LJZ C;  4CJ2 C;  1TT2 A;  1QG7 A;  1WOC A;  1NTG A;  1UNS A;  3TME A;  4HJ5 A;  4P73 A;  1LT6 D;  4L5R C;  2YV5 A;  2DY7 A;  4X66 Q;  2I46 A;  4FXK C;  3T56 B;  5ELB A;  1SE8 A;  2YTX A;  1PFB A;  3I4O A;  1SNO A;  1YBY A;  4B3R L;  1II3 A;  5IT9 L;  2UUB Q;  3UDI A;  4DV6 L;  4M8A A;  2J4X A;  1WD0 A;  3MFG A;  4ODG A;  2LMC B;  4RHR A;  5DM6 3;  2D0P A;  2K7V A;  5I9P A;  3RZD H;  4KI0 A;  1U9R A;  4AH6 A;  1X3E A;  2ZM6 Q;  2X6G A;  3J81 c;  1TS4 A;  5IT9 E;  2E5L L;  1T9H A;  1VQB A;  1FJG L;  4ME5 A;  1B50 A;  2R92 G;  2IT1 A;  2A6H C;  5H1S E;  1XJV A;  4ULL A;  1SR3 A;  2VL6 A;  1CZW A;  4LFB Q;  3EFX D;  4FF3 A;  3O13 A;  1IKM A;  5KEE A;  4A3F H;  2ZJQ A;  2GVA A;  5GQO A;  1U4P A;  2O5J C;  2G9D A;  4YHH L;  1PXU A;  1YNN D;  2K1B A;  4PMB A;  1I6H H;  3TZU A;  1R9T H;  1CKM A;  3STB D;  3QWN A;  5DNF A;  1IBK Q;  2Q2H A;  3KLS X;  3V05 A;  3NQT A;  3U9S A;  5CV4 A;  4A3C H;  1TWC H;  1ESR A;  5IWA L;  2XVS A;  1JE5 A;  4KHZ A;  2WKD A;  1PH9 A;  1Y1W G;  3S15 B;  3SXH A;  1M4V A;  3DUZ A;  3TBI B;  3VYS A;  2L15 A;  5LMU L;  3R8B A;  3SK6 A;  3VA5 A;  1WTQ A;  4R1J A;  1S5B D;  1DD2 A;  1PTO H;  3STB C;  3DWA A;  3HKS A;  1STN A;  4AQY Q;  2EQS A;  4DA2 A;  4B3S L;  1D7Q A;  4P72 A;  5JAV A;  4N9T A;  3JAM i;  2WAC A;  4DV4 Q;  2HHH Q;  4LFA L;  3HZX A;  5C0X G;  2KEN A;  1N36 Q;  4QL5 A;  2RHS B;  1Q7Y C;  2KHI A;  1UUP A;  2EZV A;  1ENA A;  1HNZ Q;  5FKA C;  1Y8N B;  3HOU B;  4KN4 C;  1CT1 D;  1X9N A;  1S5C D;  3DWP A;  4NB3 A;  2IX1 A;  3K5O A;  2UU9 L;  2AHO B;  1ESF A;  2AKW B;  1V1P B;  4DV1 Q;  2JA8 B;  1PFN A;  3K6O A;  1TR5 A;  4BXX H;  4IPC A;  5K36 H;  4WRD A;  2NVT B;  1B53 A;  3CHB D;  5E4X A;  1I50 B;  3DHQ A;  2F4I A;  2F0N A;  5M5W H;  4DR5 Q;  3H15 A;  2EYF A;  1QVF A;  3H0G H;  3AFP A;  1N32 L;  1BUV T;  2VQF Q;  1WTR A;  1K8G A;  4GKK Q;  5AFW A;  1DOL A;  1QOH A;  1VQ5 A;  2OCE A;  1RTO A;  3KF6 B;  3I2Z A;  1WTO A;  1IL2 A;  4IPD A;  3MEF A;  3A7A B;  4LMQ D;  1TWH B;  1Q81 C;  3ND8 A;  2CHB D;  1EFW A;  1RHP A;  2AWN A;  4DR1 Q;  1VQJ A;  1FVI A;  3DMU A;  2K5V A;  2R6G A;  1Y8P B;  3AMU A;  3PO3 G;  3CRK C;  2NVQ H;  3X3N A;  1U0L A;  4L5Q A;  2AQ3 B;  1HXY D;  4GNX A;  3NHH A;  1I4Q A;  5IE8 A;  1IBL L;  4LUV A;  1WTW A;  2HD3 A;  3QG1 A;  1ROD A;  4A3K B;  3PSI A;  2OWO A;  2Y0S G;  2EXD A;  3HOZ B;  1Z7T A;  4K8J A;  3J81 L;  1K8A C;  4HED A;  1XMO L;  4C1N K;  1IYV A;  1H9R A;  4HMI A;  4JI1 L;  3UDX A;  3HS0 C;  4OWT B;  3T1H L;  1AE2 A;  1JIC A;  2PPB C;  4Y7N B;  2VUM H;  2B63 H;  4BY1 H;  4BY7 G;  2EXZ A;  3M4O B;  1SXT A;  1BBU A;  1AEX A;  1LLR D;  3K0Y A;  1I4X A;  4L5T A;  2KEC A;  2F3I A;  1WCM H;  3J81 E;  1HTP A;  3X3M A;  1CUK A;  1KQS A;  2Q2I A;  2VQE L;  2NVY H;  1JOR A;  4JI0 Q;  5M3M B;  4A93 H;  4I7Z C;  1LO5 D;  1N33 Q;  4DR3 L;  4CDD C;  2Z0S A;  3S17 B;  1EFI D;  2IY5 B;  3CCM A;  4GLX A;  3M4Q A;  3I7F A;  4OL7 A;  1I4P A;  4DAV A;  1PTO F;  1VQ7 A;  4JI3 Q;  3FVQ A;  3AQQ A;  3HOW G;  4XQQ A;  5IGC A;  1HZA A;  1LTA D;  4V0B A;  4HSP A;  1LTR D;  3SHL A;  2B29 A;  5CV5 A;  2MQH A;  1HR0 Q;  3NBH B;  2VXW A;  3ERS X;  4DUZ L;  1ONL A;  2BDN A;  3KUP A;  2QA4 A;  2VS1 A;  1RJT A;  5KGU A;  1EY9 A;  4GNX C;  4MNO A;  4H02 A;  4JBJ A;  3KBX A;  3W1G A;  1STE A;  4YCU A;  4B3M L;  1OTC A;  3K7A H;  5CV8 A;  1VDZ A;  3K5L A;  1H9J A;  2H4O A;  3R2T A;  2OEO A;  3AFQ A;  4A3D H;  2BH2 A;  5C44 H;  3H3V C;  3SE0 A;  3HG9 A;  2AQ1 B;  4KHV A;  1ASZ A;  3S2H B;  4JBW A;  1L2F A;  5C4X H;  2I0Q A;  3K81 C;  1S3O A;  4JI5 L;  4DV2 L;  4UY8 C;  4QY7 A;  4OWW B;  1X3P A;  4K0K L;  3SK5 A;  1U4L A;  4N8X 1;  2JA6 G;  2MO0 A;  1PYW D;  3NXW A;  1KLG D;  1QB5 D;  2A6E D;  1KL9 A;  1CFM A;  5L37 A;  1I3Q B;  2Z1C A;  4JG2 A;  2HT1 A;  3GTK H;  3K5N A;  3GTP H;  1C0A A;  1KNA A;  1M1K C;  2VB3 X;  2JXM B;  1CM9 A;  1U4R A;  3PF4 A;  3TP6 A;  5I6Y A;  4EQ5 A;  2AUK A;  4JV5 Q;  1Y1V B;  3OW7 A;  4AYB B;  5DAU A;  2KBN A;  1EYG A;  1I94 Q;  5EBD A;  1GO3 E;  1KIX A;  2RDH A;  3JC6 6;  2IHE A;  1QVG A;  2A6E C;  2YU9 H;  2B8G A;  3CPF A;  5E3F A;  1R4P B;  3CRL C;  1HQR D;  2RVL A;  4QF4 A;  4RKL A;  3BZD B;  4L6T B;  1X3G A;  4HCE A;  4YWK A;  2NZH A;  1VQA A;  3CQZ B;  3A5U A;  1F2M A;  1KHI A;  2K5H A;  1LAB A;  4JPB W;  2F0H A;  1FNU A;  4PZ8 A;  4WJ4 A;  1EIF A;  2JSO A;  3FEW X;  1ENC A;  3BJU A;  1STG A;  2YTV A;  2WKC A;  1YNX A;  1L1O A;  3K8A A;  4DF7 A;  5IOD A;  1HNX Q;  1VQL A;  3CCS A;  4DV5 Q;  1TXY A;  2XRS D;  1IW7 D;  5E1F A;  1SBB B;  1AZP A;  4A3C G;  3D0F A;  3G6E A;  3IKJ A;  4FO2 A;  2B2V A;  5EPJ A;  1SMY C;  1C7Y A;  3CD6 A;  4HJ7 A;  1CKO A;  1SYC A;  4HIK A;  5EPL A;  5BR8 Q;  3ITP A;  3K7U C;  2ZJR A;  1BNZ A;  1ILP A;  2KOL A;  3AB9 A;  5IGF A;  4DUY Q;  3DM1 A;  5M5Y B;  4EX5 A;  1IW7 C;  2E2J B;  5HUR A;  3E6Z X;  4QUF A;  3Q8D A;  1XWE A;  4E6I A;  1JC7 A;  5C5L A;  5LMN W;  1DM0 B;  2R93 G;  1G29 1;  3RLF A;  3TQY A;  2QCP X;  3S14 H;  1PH8 A;  4A3B H;  3HGB A;  5I6W A;  3BVZ A;  3EQL C;  4XYQ A;  2XN9 C;  3T13 A;  3K0X A;  3D8G A;  2PI2 A;  3BDO A;  2RCF A;  4Z9C B;  2JA7 B;  1NNX A;  4DR2 L;  1CQV A;  2FMC A;  1YI2 A;  4QCL A;  3OSO A;  1OXT A;  5K36 G;  4ME3 A;  3LGJ A;  2KCC A;  3KYH C;  3ULL A;  1LTI D;  1B3Q A;  2ES2 A;  3H3V I;  1Q90 A;  4RCN A;  3HOX B;  2UUA Q;  1HNW L;  5KND A;  4LF7 L;  5C4J H;  2VNU D;  3PF5 A;  3OIQ A;  4PNY A;  4GZY C;  2L1B A;  4B9W A;  1CK1 A;  2D2C C;  3J80 c;  3A8J E;  2ENB A;  1VQF A;  1S4Z A;  3UE1 A;  4A76 A;  1VF5 C;  1L1O C;  3W5O A;  1BR9 A;  4HSV A;  2K04 A;  3UE0 A;  1K9M C;  2B2V C;  1X56 A;  4R8I A;  3GTO B;  4YIJ A;  4A4I A;  1XXG A;  3C1E A;  5KRU A;  2OQ0 A;  5BN5 A;  4R4T A;  4JBM A;  4R4I A;  3K5M A;  4NXN Q;  1EQV A;  1I6V C;  4Y52 H;  4JW0 A;  3M9B A;  1QUQ A;  1TY2 A;  1SFO B;  1HZC A;  2JEA I;  2N8N A;  2DUD A;  4POG A;  4BBR B;  1I5F A;  4WFN 3;  5CR3 A;  5EKI A;  2BOS A;  1G8Z D;  3TS0 A;  1WFQ A;  1PRT D;  5IYC H;  4HR7 B;  4BY1 G;  2B63 G;  1D1I A;  4KD4 A;  3CW2 C;  4TSS A;  5CMD A;  1Y69 U;  3IRB A;  5C3W A;  2PZW A;  3S1M B;  1WCM G;  3S15 H;  2X69 A;  3DWQ A;  4X62 L;  2UXB L;  5DLQ E;  1VQO A;  3GTL B;  4UAI A;  2IPK D;  1U4M A;  1J8I A;  4GKJ Q;  4HTH A;  1PRT F;  5COR A;  5GAE C;  3FMC A;  3SK4 A;  4V19 0;  1G2T A;  4DR4 Q;  1PRT C;  3ZYY X;  1B70 B;  3OWE B;  3QJY A;  3HKZ B;  1NR2 A;  2Z6K A;  1NMF A;  4IUN A;  1SYD A;  1YHA A;  2JEB I;  4C3I H;  1SE4 A;  3VYU A;  1YVC A;  4LK1 C;  5TSS A;  3I56 A;  3E9I A;  3S1Q H;  4DR6 L;  4NP5 A;  3HOU H;  4IOC A;  2IJ0 A;  3WWV A;  1LTG D;  1CKN A;  1SE2 A;  4PQX A;  4DKA C;  3I91 A;  4LWC A;  1QIL A;  5G3L D;  5IP9 H;  2LY7 A;  3CCR A;  4A3M G;  2JA8 H;  1JWM D;  1P16 A;  3RN5 A;  1V1Q A;  1JQY D;  4O0A A;  2GVB A;  4YY3 Q;  1GUG A;  4CJ1 B;  1I50 H;  3R93 A;  2I5M X;  1HCZ A;  1KDC A;  2ZTC A;  4X66 L;  4A3G B;  2ID0 A;  2F4V L;  4A3D G;  3I4N B;  2QKI C;  4K5V A;  5C44 G;  5G3L F;  4F8M A;  5C4X G;  1EY8 A;  2MO1 A;  4RAU C;  3TEH B;  4LF9 L;  2F0U A;  1FL0 A;  2EDG A;  4HMJ A;  4IUT A;  4C3J H;  1TWH H;  4CGY B;  4B3T Q;  1GD7 A;  2HUG A;  1AE3 A;  5GAH C;  3BZK A;  2ZJP A;  1TWA H;  3PO2 G;  1HPC A;  2ZXR A;  5M5X H;  3EVQ A;  3J80 L;  1D5M C;  3NE5 B;  1YJ9 A;  3IFT A;  2ZM6 L;  4OO1 I;  3S1R B;  3QIA A;  1IBM Q;  1KTK A;  4QIW B;  4ZQ3 A;  3PUV A;  4C2M B;  1V1P A;  4O2D A;  1UE5 A;  1AZQ A;  2WB1 G;  4A3K H;  1KNE A;  1E1T A;  1K3B C;  3A54 A;  2KCM A;  4UP8 A;  2NN6 I;  1XPR A;  2Z6K C;  3GTQ B;  2UUC Q;  2CQA A;  4A3J H;  4DV3 Q;  2RSN A;  4F7X A;  1AH9 A;  4JI8 Q;  4FXD A;  2EIF A;  3M4O H;  3CME A;  3M3Y H;  1IYU A;  2A5H A;  2XIW A;  3I4M G;  4OXP A;  3IAY A;  3OPO A;  4RA8 A;  3KF6 A;  3TRE A;  2ZXP A;  1QUQ B;  2L55 A;  3GO5 A;  4K14 A;  2LSS A;  4J1M A; 
#chains in the Genus database with same CATH homology
 2VUM G;  1K8G A;  4GKK Q;  3KDF A;  1VQH A;  1YHQ A;  4X65 Q;  2R7F A;  1VQ5 A;  2OCE A;  5M3M H;  1BKB A;  1X3F A;  3KF6 B;  2IX0 A;  1X55 A;  3I2Z A;  4FDB A;  4DR3 Q;  4GLV B;  1IL2 A;  4IPD A;  3MEF A;  1NJI C;  4A3G H;  2UUA L;  4BA1 I;  2E8G A;  1Q81 C;  3I4N H;  4B3T L;  5JJK A;  3KDF B;  4AQY L;  2AWN A;  1EFW A;  1X65 A;  4DK3 C;  1VQJ A;  4DR1 Q;  1FVI A;  4OWX B;  2R6G A;  2K5V A;  1K73 C;  1LUZ A;  4PMW A;  2K5N A;  3L0O A;  3U50 C;  4DV4 L;  2OTL A;  3PO3 G;  1HH2 P;  1IXR A;  2NVQ H;  1LTL A;  4A93 G;  2K75 A;  1U0L A;  4L5Q A;  4DV0 Q;  2MFI A;  1J5E Q;  1G51 A;  4GNX A;  2Q2U A;  1VQN A;  5ELO A;  5IE8 A;  1IBL L;  1EOV A;  4LUV A;  4DUZ Q;  3HOY H;  4DR2 Q;  2A19 A;  4MZ9 A;  5M3F G;  3U58 A;  4DNI A;  3J81 j;  3PSI A;  4RMF A;  4GNX B;  1Q86 C;  2Y0S G;  2OWO A;  2VZA A;  4JI6 Q;  2H5X A;  4A3B G;  1QZH A;  2EXD A;  4IJL A;  1VQ6 A;  5FLM H;  1NBW A;  3I4M H;  4IFD I;  1VQ8 A;  1K8A C;  3J7A 5;  2MNA A;  3EIV A;  3OYY A;  1XMO L;  1XMQ L;  1HZ9 A;  1Y1V G;  3S24 A;  1NY4 A;  2JJQ A;  4AYB G;  4JI1 L;  3UDX A;  1VQK A;  2UUC L;  4LF7 Q;  1HNW Q;  4OWT B;  3T1H L;  1AE2 A;  4A3L G;  4QGU A;  2VUM H;  4BY7 G;  2B63 H;  3F8T A;  1EWI A;  1VQD A;  5EAY A;  4JI2 Q;  4BY1 H;  3ICE A;  3EN2 A;  1EQQ A;  2NZO A;  1BBU A;  5C3E H;  2KHJ A;  4L5T A;  1CSQ A;  2F3I A;  1WCM H;  1U5K A;  4DR5 L;  1CKN B;  3KJO A;  4A3E H;  4UP9 A;  3J81 i;  1X54 A;  1CUK A;  1PH5 A;  1KQS A;  1KRS A;  4JI5 Q;  2NVT H;  1D8L A;  2Q2I A;  3PO3 H;  2VQE L;  3RNU A;  2NVY H;  4JI0 Q;  1YJN A;  4A93 H;  4JYA Q;  1N33 Q;  3B6Y A;  4DR3 L;  3GDE A;  1Q82 C;  2Z0S A;  2PI2 E;  4IO9 A;  1KC8 C;  1IYJ B;  2IY5 B;  1Q46 A;  3CCM A;  4HIO A;  4GLX A;  3M4Q A;  1VQG A;  3I7F A;  4LF6 Q;  1V43 A;  1VQ9 A;  3GTJ H;  1VQ7 A;  4JI3 Q;  2RF4 A;  5FJ8 G;  1S72 A;  2IHF A;  1N34 L;  3AQQ A;  3HOW G;  1HZA A;  4JI4 Q;  1J6Q A;  2F52 A;  1L0W A;  2UUB L;  1K83 H;  4DV0 L;  2B29 A;  1J5E L;  1VCI A;  2MQH A;  2QGQ A;  1HR0 Q;  3CC2 A;  3NBH B;  3M85 A;  2JA5 G;  2R92 H;  5HY6 A;  3GTM H;  4DR4 L;  4YCV A;  2FXQ A;  3ERS X;  4JI7 Q;  2PQA A;  4DUZ L;  3BU2 A;  4DR7 Q;  3HFZ B;  4HJ8 A;  4A3I G;  3RLN A;  3AYH B;  4QIW E;  3U4V A;  4X64 Q;  4IPH A;  2QA4 A;  4GOP A;  4OO1 G;  2VS1 A;  1CSP A;  2ALY B;  1PH7 A;  1XPU A;  1SRU A;  1HR0 W;  1VQE A;  4KHP Q;  1PVO A;  2GN5 A;  1XTD A;  2XGT A;  1JMC A;  2HQL A;  4LF4 Q;  3CXC A;  4GNX C;  4PZ6 A;  4MNO A;  4H02 A;  1WI5 A;  4JBJ A;  3W1G A;  2JA9 A;  4LFB L;  4YCU A;  4X62 Q;  3F2C A;  3HOZ H;  4GN3 B;  4B3M L;  2UXB Q;  4TVA B;  2OTJ A;  1OTC A;  3K7A H;  4JI2 L;  2NN6 G;  3J7Z C;  2VW9 A;  3BZC A;  4B3R Q;  5IYC G;  3A0J A;  3HOV G;  2AMC B;  3AFQ A;  4A3D H;  2BH2 A;  3G71 A;  4DV6 Q;  1HZB A;  1NMG A;  4C3H H;  5C44 H;  5C0X I;  1Y1W H;  1PH3 A;  4JBK A;  2JA7 G;  1ASZ A;  1A0I A;  4JBW A;  1L2F A;  5C4X H;  3NEN A;  4Y7N H;  2I0Q A;  3K81 C;  1S3O A;  3NEM A;  4JI5 L;  5FJ8 H;  4DV2 L;  3KOJ A;  4QY7 A;  1RL2 A;  1IBK L;  4OWW B;  2AWO A;  2E2H H;  4YY3 L;  3H3V H;  4BA2 I;  4K0K L;  2JA6 G;  2CWA A;  2MO0 A;  1MJC A;  3SGI A;  2HIX A;  4DV7 L;  1WJJ A;  5J3B A;  2LXJ A;  4WJ3 M;  3HOX G;  1KL9 A;  3M4P A;  2BH8 A;  2E2I H;  4JG2 A;  3AEV A;  2HT1 A;  2VY3 A;  1XNQ L;  4DR6 Q;  4JI3 L;  5IY0 A;  3GTK H;  1B8A A;  5AJ3 L;  3GTP H;  3S16 H;  1C0A A;  1M1K C;  4XIG S;  4NXM Q;  2E2J H;  3PF4 A;  1JJ2 A;  4BBS G;  3S17 H;  4EQ5 A;  2D0O A;  3UDF A;  3PUZ A;  1GM5 A;  4LF8 L;  4YHH Q;  4JV5 Q;  2KBN A;  3CAM A;  3CP0 A;  1EYG A;  1XNR Q;  1I94 Q;  1GO3 E;  2B3G A;  1KIX A;  1MIU A;  2IHE A;  3JC6 6;  1JB7 A;  2HHH L;  3TRZ A;  4DR7 L;  1YHB A;  5IP7 G;  1QVG A;  1JJC B;  3RR5 A;  1E24 A;  2YU9 H;  3CPF A;  2QEX A;  3OW2 A;  3D31 A;  1OXV A;  4GS3 A;  4R4O A;  1N36 L;  2R7Z H;  3HKZ E;  2WAQ G;  4RG1 A;  1IBM L;  4YWK A;  1X3G A;  1EQR A;  3FP9 A;  2NZH A;  3CC4 A;  1E3P A;  1VQA A;  3U4Z A;  5IWA Q;  5IP9 G;  3A5U A;  3CCJ A;  1Q8K A;  1HNZ L;  1KHI A;  2K5H A;  2F4V Q;  1QVC A;  4OX9 L;  4JC0 A;  4IFD G;  2I5H A;  2JK8 A;  4PZ8 A;  4WJ4 A;  1BBW A;  1EIF A;  4GN5 A;  3ULP A;  4IOA A;  4PG3 A;  3PCO B;  3BJU A;  4LF9 Q;  2JA6 H;  1Q1E A;  2YTV A;  5IT9 c;  4DV1 L;  1YNX A;  4GOP C;  1L1O A;  3A74 A;  3K8A A;  1HNX Q;  4NPS A;  5IYB H;  3HOX H;  3CCS A;  1UE7 A;  1TXY A;  4BBR G;  4DV5 Q;  3PIP A;  1VQL A;  4A3C G;  4IFD J;  4DV3 L;  2N49 A;  2UXC Q;  3D0F A;  4YWL A;  3G6E A;  4QQB X;  3CCQ A;  4B3S Q;  4JI8 L;  1C7Y A;  1MJE A;  1DGS A;  3PUW A;  2NVX H;  3CD6 A;  1L1O B;  4HJ7 A;  1GVP A;  1CKO A;  3ULJ A;  3MXN B;  1VQ4 A;  4HIK A;  2C35 B;  1XPO A;  5BR8 Q;  4HJA A;  3ER0 A;  3K7U C;  4R4Q A;  1TWG H;  1C9O A;  2ZJR A;  1N8R C;  3S2H H;  2UXD Q;  1VQP A;  5LMN Q;  2VQF L;  4DUY Q;  2CWP A;  2LXK A;  4LF5 Q;  4GKK L;  1VQI A;  2I5L X;  4EX5 A;  3KF8 B;  4X65 L;  1ASY A;  4IJH A;  4GN4 B;  2BA1 A;  2CKZ B;  4NXM L;  1YJW A;  3TS2 A;  3Q8D A;  4UPA A;  2UU9 Q;  1UEB A;  2WB1 E;  1FGU A;  1I3Q H;  4JV5 L;  5LMN W;  4DR1 L;  5M3F H;  1PH6 A;  2R93 G;  2K4K A;  1G29 1;  3RLF A;  2ZTE A;  3TQY A;  4A75 A;  1PH8 A;  3S14 H;  4A3B H;  3HKZ G;  1PV4 A;  1V9P A;  1YIJ A;  5JJI A;  3K0X A;  1UWV A;  1Y1V H;  1MKH A;  3E0E A;  4HIM A;  2PI2 A;  4BBR H;  3JAM c;  3RN2 A;  4A3L H;  3FKI G;  4XTC S;  4DR2 L;  4BY7 H;  4P74 A;  2YYZ A;  1YI2 A;  3FHW A;  4A3J G;  3OTO Q;  3CCE A;  1Y14 B;  4JI6 L;  4LNQ A;  1N32 Q;  1OXT A;  5K36 G;  4ME3 A;  3LGJ A;  2PQA B;  4P75 A;  1YIT A;  3GTG H;  3KYH C;  2N78 A;  3ULL A;  2ES2 A;  3H3V I;  3KJP A;  1A8V A;  1JT8 A;  4R4C A;  2UUA Q;  3S2D H;  3CQZ H;  2CCZ A;  1UE6 A;  4LF7 L;  1HNW L;  1PYB A;  5C4J H;  1O7I A;  4GLA C;  4GOP B;  3PF5 A;  2UXC L;  2VNU D;  4J15 A;  5JEA G;  1A63 A;  1X6O A;  1SRO A;  1Z9F A;  5HGQ A;  3G48 A;  2Q2T A;  1P8L A;  1SMX A;  3CPW A;  1YZ6 A;  3J80 c;  4HJ9 A;  5JEA J;  1Q1B A;  1UE1 A;  1VQF A;  3L2P A;  3UE1 A;  2KCT A;  4A76 A;  5GAG C;  4A3G G;  1K3R A;  1L1O C;  3W5O A;  3HOW H;  3I4N G;  2R93 H;  3T1Y Q;  3UE0 A;  4DUY L;  1H95 A;  2XTI A;  1K9M C;  4LF5 L;  4APV A;  3CCU A;  1X56 A;  4JI0 L;  4JYA L;  3DLL A;  2A8V A;  1HJP A;  3F2B A;  3PIO A;  1N33 L;  4AIM A;  2JA5 H;  4A4I A;  3K80 C;  2E5L Q;  4YWM A;  2OQ0 A;  1FJG Q;  1XMO Q;  1XMQ Q;  1E7Z A;  3FKI H;  3CMA A;  4LF6 L;  4PZ7 A;  4OON A;  4R4T A;  1KD1 C;  4LUZ A;  4R4I A;  4A3I H;  4JOI A;  4JBM A;  5M5Y H;  3T1H Q;  4NXN Q;  3I55 A;  2YTY A;  5GRO A;  4KLK A;  3W1B A;  3HOY G;  4JI4 L;  4Y52 H;  3A5Z B;  3M9B A;  1QUQ A;  4P71 A;  1PH2 A;  1EUJ A;  1HZC A;  2CFM A;  1HR0 L;  2JEA I;  2N8N A;  2DUD A;  5FLM G;  4POG A;  3M7N A;  1EIY B;  1I5F A;  3CC7 A;  4JI7 L;  1KRT A;  5IYD G;  1W3S A;  4X64 L;  3S1N H;  3TS0 A;  3HOU G;  1WFQ A;  2RCN A;  5GAD C;  5IYC H;  2B63 G;  4BY1 G;  4A3F G;  1WOC A;  3HOV H;  4KHP L;  1NTG A;  4MTN A;  1K0R A;  3CW2 C;  4P73 A;  4HJ5 A;  5C3E G;  4ALP A;  4L5R C;  2YV5 A;  4LF4 L;  4X66 Q;  2JA7 H;  3E9H A;  1KXL A;  3IRB A;  1PH1 A;  2JA8 G;  3DM3 A;  4L5S A;  1WCM G;  3CCL A;  3S15 H;  1SE8 A;  2YTX A;  4A3E G;  4X62 L;  3I4O A;  1A62 A;  2UXB L;  5DLQ E;  3PGZ A;  2V1C C;  1VQO A;  1N34 Q;  4LFC Q;  1PFS A;  3CCV A;  1LYL A;  2RHQ B;  1YBY A;  1E22 A;  5LMU Q;  4B3R L;  2UUB Q;  3UDI A;  4GKJ Q;  4DV6 L;  5GAE C;  1B7Y B;  4DR4 Q;  1B70 B;  2BA0 A;  2WP8 J;  3NEL A;  3T1Y L;  2D0P A;  1VS0 A;  4LFA Q;  4BBS H;  4UP7 A;  4KI0 A;  4AH6 A;  3RZD H;  2Z6K A;  3RZO H;  1X3E A;  2PNH A;  2ZM6 Q;  1NMF A;  2WFW A;  3J81 c;  2JEB I;  1YHA A;  4C3I H;  2ASB A;  3S1R H;  1PYS B;  2K52 A;  4LW1 A;  1T9H A;  1YVC A;  4LUO A;  5FLX c;  1VQB A;  2E5L L;  1FJG L;  5IYD H;  3I56 A;  3E9I A;  5ELN A;  4C2M H;  2R92 G;  3S1Q H;  2IT1 A;  5IP7 H;  5H1S E;  1XJV A;  3PUY A;  2OQK A;  4DR6 L;  1SR3 A;  2VL6 A;  4NXN L;  1E1O A;  1GKH A;  2DGY A;  4IOC A;  3HOU H;  3UDG A;  4LFB Q;  3WWV A;  2D62 A;  1CKN A;  4IPG A;  4DKA C;  4B3M Q;  4A3F H;  1M90 C;  2ZJQ A;  3GTO H;  2GVA A;  5GQO A;  4LWC A;  4DAY B;  4YHH L;  3GTQ H;  5IP9 H;  3CCR A;  4A3M G;  1OXU A;  2JA8 H;  1XNR L;  3GD7 A;  3RLO A;  5JJL A;  1I6H H;  1I94 L;  1P16 A;  1LM0 A;  1R9T H;  3RN5 A;  1V1Q A;  1CKM A;  4DV2 Q;  4O0A A;  3STB D;  4A3K G;  4JOI C;  2GVB A;  2Q2H A;  1IBK Q;  4K0K Q;  3F1Z A;  4YY3 Q;  1SFO H;  3HOZ G;  4A3C H;  1I50 H;  1TWC H;  2I5M X;  4DV7 Q;  2ZTC A;  4X66 L;  4DK6 C;  5IWA L;  1JE5 A;  4KHZ A;  1N9W A;  2ID0 A;  1PH9 A;  3CF5 A;  2F4V L;  4BXX G;  4A3D G;  1Y1W G;  1VQC A;  3PUX A;  5C44 G;  2JE6 I;  5E7N A;  1TWF H;  2N3S A;  1NE3 A;  1YEZ A;  1XNQ Q;  5C4X G;  4QJF A;  1OXX K;  2MO1 A;  4LFC L;  3TEH B;  5AJ3 Q;  2L15 A;  4LF9 L;  3KLW A;  5LMU L;  1PHJ A;  2JQO A;  1HNX L;  1FL0 A;  1SLJ A;  1SN8 A;  2PMZ E;  4DV5 L;  3S1M H;  4R1J A;  4C3J H;  4GKJ L;  1TWH H;  3STB C;  4B3T Q;  4LF8 Q;  3HKS A;  1GD7 A;  4AQY Q;  3KFU A;  2EQS A;  2K50 A;  4B3S L;  1AE3 A;  3H0G G;  4POF A;  1WYD A;  3BZK A;  5GAH C;  1IZ6 A;  1D7Q A;  4UY8 C;  4P72 A;  3JAM i;  2ZJP A;  1PH4 A;  1OXS C;  1TWA H;  4DV4 Q;  2HHH Q;  3GTL H;  3PO2 G;  5M5X H;  4LFA L;  4YCW A;  2K14 A;  4X6A H;  5M3M G;  5C0X G;  2KEN A;  1YJ9 A;  1N36 Q;  4QL5 A;  5BR8 L;  2ZM6 L;  3PV0 A;  4OO1 I;  2RHS B;  4A3M H;  2UXD L;  3F2D A;  1Q7Y C;  1IBM Q;  1IBL Q;  2KHI A;  3PUV A;  5LMN L;  1BVS A;  4DPG A;  4O2D A;  1UE5 A;  2WAQ E;  5C0X J;  1HNZ Q;  2WB1 G;  4A3K H;  4OX9 Q;  4DAM A;  1X9N A;  1KAW A;  1E1T A;  3L7Z C;  4NB3 A;  2R7D A;  2CQO A;  2IX1 A;  2KCM A;  4UP8 A;  1Z47 A;  2AHO B;  2UU9 L;  2NN6 I;  2Y0S E;  2AKW B;  2ATW A;  4DV1 Q;  1XPR A;  1PA6 A;  2Z6K C;  2R7Z G;  1QZG A;  3EBE A;  2HIV A;  1W2B A;  4JI1 Q;  2UUC Q;  3J80 i;  3ZJY C;  4TQU S;  4BXX H;  4A3J H;  4IPC A;  4DV3 Q;  2A1A A;  1RIP A;  2ZTD A;  1G6P A;  4AYB E;  1AH9 A;  4JI8 Q;  1S40 A;  1JJG A;  2EIF A;  3M4O H;  3CME A;  1Q12 A;  3M3Y H;  4HID A;  3I4M G;  4OXP A;  1VQM A;  5M5W H;  4DR5 Q;  3KF6 A;  3TRE A;  1QUQ B;  3H15 A;  5IYB G;  1QVF A;  3GO5 A;  3AFP A;  3H0G H;  1N32 L;  2LSS A;  3OTO L;  4JCV E;  3G4S A;  3VDY A;  3PO2 H;  2VQF Q;  2VQE Q; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...