1N36E

Structure of the thermus thermophilus 30s ribosomal subunit in the presence of crystallographically disordered codon and near-cognate transfer rna anticodon stem-loop mismatched at the second codon position
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
150
structure length
150
Chain Sequence
DFEEKMILIRRTARMQAGGRRFRFGALVVVGDRQGRVGLGFGKAPEVPLAVQKAGYYARRNMVEVPLQNGTIPHEIEVEFGASKIVLKPAAPGTGVIAGAVPRAILELAGVTDILTKELGSRNPINIAYATMEALRQLRTKADVERLRKG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Selection of tRNA by the Ribosome Requires a Transition from an Open to a Closed Form
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 16S RIBOSOMAL RNA
total genus 33
structure length 150
sequence length 150
ec nomenclature
pdb deposition date 2002-10-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00333 Ribosomal_S5 Ribosomal protein S5, N-terminal domain
E PF03719 Ribosomal_S5_C Ribosomal protein S5, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.20 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 1n36E01
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 1n36E02
4OX9E 2NPFA 4Z7YA 1T4OA 3ZZUA 5LMNE 1EKZA 4I3HA 2BM0A 5CFFE 2UXBE 2EFGA 1ZM9A 4NXME 3P1XA 2N3GA 2NUFA 4LF8I 2VF3A 4P7AA 4DR2E 1PVGA 4LF6E 2BM1A 4DR5I 2HHHI 4DV7I 1NHHA 2UUCI 4JI5I 4GKJI 4JI3I 1HR0E 1RREA 3QT5A 4USKA 4YY3I 4DKKA 2F4VI 2EZ6A 1Z0VA 4DPUA 3H4LA 4DV0I 2V34A 1XMOI 4LF6I 4B3SI 3VYYA 3WU4A 4JI6E 2V2VA 5BR8E 3J7AG 1N33E 4RPFA 4DV6E 2UUAI 2A2DA 1HNWI 3T1HE 2GS8A 4DPWA 1XMQE 1N34I 1Z0TA 1MX0A 3K17A 4DR3I 2UU9I 4B3TI 1UILA 3QT8A 1T4NA 1ZXNA 4DV3E 1FKAE 1ZBTA 1Z59A 1N32E 3ZKBA 2OI2A 4DR6E 4DV6I 3J7AM 3JAMQ 4DR1I 4HACB 3ZZ0A 4JI0E 1KTVA 1XNQE 1A6FA 1H72C 4DR3E 1FWKA 4WUCA 1KKHA 4DV7E 5GMEA 3LNUA 3ADLA 3V2UC 4DR6I 4DUZE 4JI4I 4KHPI 2ZBKB 4P52A 4DPXA 4LF5E 2ZM6E 2LTSA 4DV4I 4LF4I 1BKNA 4NXMI 2J7KA 2JVAA 1XNRE 2V8PA 4GKKI 4EMDA 1J26A 1ZM2A 3HULA 1U2RA 1RC7A 3C4TA 2B7VA 2CPNA 3LLHA 4DV1E 2VQEE 3J80Q 4LF9I 4DR4E 4FN5A 4YHHI 1DI2A 5LMUE 1HR0I 2X7IA 3OTOE 1NHIA 1K47A 3QT7A 4LFBI 3ZKDA 4LF8E 4UTGA 1B62A 1DARA 4WUDA 4XTJA 3PYGA 1X49A 4ED4A 2UXBI 4DV2I 4JYAI 1QU6A 5IWAI 2L2NA 3CWVA 4X65E 2X36A 4HYMA 1HNWE 2NUEA 1IBME 1MG7A 2CZ9A 4DR2I 4FWHA 4JI8E 4PRXA 1T4LB 4M1KA 1NHJA 1X47A 2RS7A 4HXZA 1XHKA 4JI1I 4FW9A 1Z5BA 4GKJE 1J5EE 4B3SE 2HFUA 4WUBA 1RR9A 4X8WA 1HNZE 2A2CA 1IBLE 1WUUA 2UXCI 5L3JA 2VQFE 4KQVA 1MU5A 2HK3A 2LUPB 1GQEA 4LFAE 1UHZA 4DR4I 3PYDA 2V2ZA 1X48A 4X64E 4WFTA 2NUGA 3V5RA 4X66E 1Z0CA 4JV5E 1N33I 2UUAE 4LFCE 2E5LE 4KHPE 1FJGI 3B78A 4B3RE 4K0KE 2V2QA 1FNMA 4DPTA 4FWGA 4LFAI 4DV4E 2HHHE 2L3JA 2UUCE 4JI5E 4LF4E 2HK2A 2LJPA 1ZXMA 5FLXQ 4DV3I 4Z7CA 1UEKA 4GKKE 4LFCI 4X62I 1KVKA 1N0VC 4JI0I 2L33A 1ZM4A 1RQ0A 4DV0E 2Q2EB 1HNXI 2L3CA 1XMOE 3WU6A 2B7TA 1QZRA 2R3VA 1N36E 1NZ0A 4FWDA 3ADIA 5LMUI 5A2QQ 2RS6A 1O0WA 1Z0GA 1I94I 4AQYE 2HFSA 4DUYI 2JY9A 2R42A 2XEXA 3C4BA 2UXDE 2LTRA 3VYXA 5LL6R 4LF5I 4LF7E 4YY3E 1Z0BA 3PYEA 4DXLA 4B3TE 4JI2E 1WHQA 3D4JA 4NXNI 3LPSA 2DEIA 2L2MA 1YZ9A 4WYQB 1PIEA 4X66I 1YYWA 3K1JA 4M30A 3J7Yp 4DUYE 1N0UA 2N3HA 4OOGC 4DPYA 3OTOI 5IT9Q 3B82A 3F0NA 4JI2I 4JI6I 3ADJA 2E1RA 4YHHE 3M6AA 4DR5E 2DMYA 2UUBE 2WW4A 4ZVIA 4JI7I 1YYKA 1FI4A 3ZM7A 3J81Q 1Z0EA 4DR1E 1EA6A 2YT4A 1IBKE 2KHXA 4URLA 1Z5CA 1N32I 2VQEI 3WU5A 4HY1A 2MDRA 1D6TA 1S4EA 2RTXA 5BR8I 1PKPA 4DR7E 1Z5AA 2E5LI 5LMNI 1WHNA 1ELOA 2UXDI 1IBLI 1KIJA 1OJ4A 5GMDA 3WU3A 4DV5I 4HACA 1ZM3A 1EI1A 2RSMA 1VISA 4JI4E 4DUZI 4JI3E 1HNXE 2F4VE 4DV5E 1H73A 1FJGE 2DB2A 4K0KI 4JG4A 2LUQA 4JI8I 5IWAE 3ZZTA 4PU9A 2UUBI 3QT6A 3LTOA 1S16A 3Q1QA 2LRSA 1IBMI 4MYUA 1HNZI 4B3MI 1STUA 2HKEA 4X62E 4LFBE 4NXNE 4LF9E 4USMA 3T1YI 3ADGA 2LJHA 1H74A 3GONA 1H7SA 2DEJA 4X64I 2NA2A 3T1HI 3HTXA 2VQFI 5A2QC 2LBSB 2HKJA 2UU9E 1B63A 1XNQI 1FWLA 2B3TB 1N36I 2L2KB 4DV1I 4LF7I 4X65I 2BV3A 4JI1E 4PRVA 1I94E 3JAMC 1J5EI 5FLXC 2UXCE 1YYOA 4R1FA 2DIXA 3J80C 4DU8A 1N34E 1XMQI 1IBKI 2ZM6I 5IT9C 2AJ4A 4OX9I 4UT4A 2ZITA 4DV2E 4JYAE 1H7UA 4MYTA 4DR7I 2IHR1 4JV5I 4M2ZA 4DU7A 4JI7E 4B3ME 4AQYI 3J81C 4B3RI 1Z0WA 3T1YE 3B8HA 3PYFA 1XNRI
chains in the Genus database with same CATH superfamily
4OX9E 2NPFA 2EOFA 4Z7YA 2EMGA 1T4OA 1A1KA 4WSPA 4WSGA 5FWKA 3JTZA 2MDGA 3ZZUA 2EMFA 2B9DA 2PO0B 3VHTB 5LMNE 4L5NC 1RMDA 4ZYEA 2V86A 1EKZA 2EOSA 4I3HA 1YUJA 2BM0A 2PNLA 5CFFE 1BBOA 2UXBE 2EFGA 1ZM9A 4NXME 3P1XA 4BC9A 5K36A 4FW5A 5AC4A 3HKMA 2YTIA 2N3GA 2NUFA 4LF8I 2YTJA 3EPHA 1Y6ZA 2O1TA 2VF3A 2WNRA 4WXCA 1R6MA 4P7AA 2K7IA 1JK2A 1PJSA 1G2DC 1OYRA 2JOBA 1TN9A 5KL5A 4DR2E 1PVGA 3UHMA 4LF6E 2Z5CB 2J7JA 1UDNA 2BM1A 4DR5I 3HXLA 2EQ0A 1USUA 2ELZA 1UN6B 1NHHA 4DV7I 2HHHI 2UUCI 4JI5I 1BB8A 4GKJI 4AIMA 2EM2A 2A25A 4X9JA 4JI3I 5KL6A 1HR0E 1RREA 2J65A 3QT5A 5DRRA 4MU0A 4USKA 4IFDE 4YY3I 4HTGA 2MC6A 3C6KA 5IV8B 4DKKA 2F4VI 2EOXA 2EWLA 2EZ6A 1Z0VA 2ENHA 4DPUA 3H4LA 4DV0I 2V83A 2O1VA 2V34A 1XMOI 4LF6I 4B3SI 1WXRA 3M7NG 2EN7A 3VYYA 3WU4A 4JI6E 2V2VA 2LO3A 2BR2B 4FK5C 2C38B 2EOZA 5BR8E 4DMIA 3J7AG 4WPYA 2NN6F 5K36C 3C6MA 1N33E 2C39B 2VF1A 4ZYGA 4RPFA 4DV6E 2UUAI 2A2DA 4Q35B 2R1FA 4MU3A 1A1JA 2EMKA 1HNWI 3T1HE 1TF3A 2GS8A 4DPWA 1NCSA 1Y4SA 1XMQE 1N34I 2BBGA 4IZJB 2JT2A 1Z0TA 1YPNA 1MX0A 4IZKB 3K17A 4DR3I 1MGTA 4OZEA 4HEIA 5C0XA 2UU9I 4B3TI 3ZOQB 2DLQA 1UILA 3IWCA 5JEAA 3QT8A 1BBGA 1T4NA 2YRHA 1ZXNA 4DV3E 1HK7A 1FKAE 1ZBTA 4LCHA 2G7HA 4MLQA 1N32E 1Z59A 3ZKBA 2OI2A 3U1KA 1DGCA 1SFEA 4I8OA 4DR6E 2VESA 1IQSA 4IZJD 4DV6I 3K85A 3J7AM 3Q6MA 3JAMQ 4DR1I 3GCMA 3AV0A 4HACB 3ZZ0A 2EQ1A 4JI0E 3EPJA 1KTVA 1XNQE 4AIDA 1UDOA 1RHYA 1A6FA 2JR1A 1H72C 2IESA 3DD6A 1SR9A 4DR3E 2Q8UA 4F2JC 2BA1D 1A1FA 1FWKA 4WUCA 1KKHA 4DV7E 5GMEA 2PO1B 2WZOA 3LNUA 3ADLA 1A1LA 3V2UC 4DR6I 4DUZE 4JI4I 4KHPI 2ZBKB 1X3CA 2KONA 4P52A 2N8XA 4DPXA 4MU4A 4LF5E 2ZM6E 5AE3A 3M85G 2LTSA 4DV4I 2EPUA 1BKNA 4LF4I 4NXMI 4F9BB 2J7KA 2E1MA 1ZR9A 5DNYA 4IFDC 4BHCA 1A1GA 2YU5A 2EL4A 3P76A 2JVAA 1XNRE 3DJWA 4AM3A 2V8PA 4GKKI 5KL2A 4EMDA 1J26A 1ZM2A 3HULA 2MC5A 1U2RA 1RC7A 3C4TA 2B7VA 2RPCA 2CPNA 3LLHA 5T6JA 2YSOA 2K4VA 4DV1E 4BA2A 2VQEE 4R2DA 2LT7A 1WJPA 2ELYA 3J80Q 3VK6A 4LF9I 4DR4E 4FN5A 4YHHI 1YHCA 2EPXA 4BHBA 2NN6C 2MKDA 1DI2A 5K36F 1TF6A 5AC5A 5LMUE 2GO4A 1HR0I 2X7IA 2EN1A 2YTFA 2EOHA 3OTOE 1NHIA 1K47A 3QT7A 4R2RA 2EMCA 4LPFA 4LFBI 4OO1C 2BB8A 2YTQA 4LF8E 2JOXA 4UTGA 3ZKDA 3EQ1A 2WNRB 4RHBB 1B62A 1DARA 4WUDA 4XTJA 3PYGA 1X49A 2DLKA 3CDIA 4ED4A 4R2QA 2UXBI 2JYAA 4DV2I 4JYAI 1QU6A 2GHFA 2RSIA 2EPPA 2YTOA 5A6BD 2M1SA 2WCC3 2PNZA 2WBUA 1PDAA 2ENCA 2WBSA 5IWAI 2L2NA 3CWVA 4X65E 2X36A 2EPMX 3FIGA 2EM0A 4GZNC 2EM6A 4ZYHA 2EMXA 4O43A 2NN6A 2PNMA 4HYMA 1HNWE 2WP8A 2NUEA 1IBME 2EPNA 1MG7A 2EPLX 2CVEA 2CZ9A 4DR2I 2BA1G 3NZKA 4FWHA 2EMIA 4JI8E 4PRXA 2AE8A 1T4LB 4M1KA 3K6QA 3KWRA 2Z5BB 1NHJA 1X47A 2RS7A 2FGGA 4HXZA 1XHKA 4JI1I 4FW9A 4O4KA 2JPAA 1X6HA 2YRKA 4BMJA 1J5EE 4B3SE 4GKJE 1Z5BA 2PRTA 1RR9A 2HFUA 4WUBA 5A6AA 4X8WA 1HNZE 2A2CA 1IBLE 3DF6A 4ZYDA 2LE2A 3LMLA 2L8TA 5DNXA 1WUUA 5C0XD 2UXCI 1ZU1A 3BF2A 5F3WA 5L3JA 2V89A 2EMWA 4R8OA 2JEBA 2LCEA 2VQFE 4KQVA 2YU8A 4IFDA 4NBQA 1MU5A 2HK3A 1YSAC 3KZZA 5AASA 2LUPB 1GQEA 4LFAE 1ZAAC 1UHZA 2EOQA 2CGEA 1QNTA 2PO2A 3Q6NA 4DR4I 3PYDA 3UK3C 2V2ZA 2FV4B 1DQ3A 1X48A 4WFTA 4X64E 2NUGA 2YTEA 2GLIA 5C0XB 3V5RA 4X66E 1E3PA 1Z0CA 4JV5E 2M4IA 2YTNA 4LU9A 1N33I 4P78A 3THNA 3F6GA 2UUAE 3THOB 3EPKA 3JU0A 4LFCE 4BA1A 2E5LE 2E72A 4KHPE 4U3DA 1FJGI 3B78A 4B3RE 4L8NA 4K0KE 2ODRC 1R6LA 2V2QA 4QNKA 3BIDA 1FNMA 4DPTA 3RMPA 3EPLA 4R2SA 1UDQA 2O1UA 4N4RB 2CSHA 4WXDA 1OYSA 2GPIA 4FWGA 4LFAI 4DV4E 2HHHE 2L3JA 2I13A 2UUCE 4JI5E 4LF4E 2HK2A 1G2FC 2LJPA 1ZXMA 4LOMA 5FLXQ 4LTYA 4DV3I 3AUZA 4F6NA 2EL6A 1N3GA 4Z7CA 3B4TA 1UEKA 4GKKE 4LFCI 5K36D 2EN6A 4TUGA 4X62I 2EORA 1KVKA 1N0VC 3P3GA 4IFDF 4JI0I 2L33A 1ZM4A 1RQ0A 4DV0E 2Q2EB 1HNXI 2EMLA 2L3CA 1XMOE 1UDSA 4IS9A 3WU6A 2GO3A 4LCGA 2B7TA 5ELWA 5JEAC 2F1DA 1QZRA 2M7QA 1UBDC 5C0XC 2R3VA 1N36E 1NZ0A 2NN6B 4FWDA 2VRDA 2EPOA 2YTGA 4IJDA 3IWDA 1P42A 4OO1F 5A6JA 3ADIA 5LMUI 5A2QQ 4IZKA 2JWOA 2RS6A 2WBTA 2V85A 1O0WA 1Z0GA 1I94I 2NN6E 2EM4A 2EN2A 2FTXB 4NHRA 4AQYE 2HFSA 4DUYI 2JY9A 4FW4A 2R42A 2XEXA 3C4BA 1T38A 2EMAA 2LTRA 3VYXA 2UXDE 3TQMA 5LL6R 4LF5I 3CDJA 1LLMC 4YY3E 4LF7E 1Z0BA 1E3HA 3PYEA 1T39A 4DXLA 4B3TE 4J8ZA 4JI2E 1IMUA 1WHQA 3D4JA 4NXNI 2CT1A 2R76A 2YSPA 1Y4UA 2DEIA 3L7ZA 3LPSA 2EP3A 2L2MA 1Y5YA 1YZ9A 4OO1A 4WYQB 2NABA 1PIEA 2JEAB 4X66I 2KOUA 3MHHC 2C38A 1YYWA 3K1JA 2YZTA 2JE6A 3HQ1A 4ISAA 2DMIA 2EM3A 2ENAA 1OYPA 2IERA 4M30A 3J7Yp 4DUYE 1N0UA 2C37A 2N3HA 1IQOA 5LLQA 4OOGC 4DPYA 2PO1A 2EM8A 5A6BA 3OTOI 1USVA 3M7ND 5IT9Q 3B82A 2EPAA 3F0NA 1GTKA 4JI2I 4JI6I 3ADJA 5JEAE 1AH5A 2E1RA 2JP9A 4YHHE 2YPNA 5A6KA 3M6AA 2ODRD 4DR5E 2L6MA 2DMYA 2L92A 2UUBE 4R2CA 2WW4A 4R2AA 1YYKA 4ZVIA 4JI7I 1FI4A 5JEAD 5EKWA 5AE2A 3ZM7A 1X5WA 3H1CA 2EM7A 3J81Q 1XXEA 4MQYA 1Z0EA 3PS3A 5KL7A 2H36X 2IOPA 2D9HA 2PO2B 5DROA 4IZJA 4DR1E 2LMZA 2HGHA 2ADRA 4FW7A 2YRMA 1EA6A 4R2PA 2YT4A 3OMLA 1IBKE 3KZYA 4BCAA 4BBYA 4OKGA 2KHXA 4URLA 4GEQB 1Z5CA 5JEAB 2JXPA 1N32I 2EM9A 5DRPA 3WU5A 4WX9A 4HY1A 2F8BA 2MKNA 2EN8A 2MDRA 2VQEI 3M99B 4NZVA 4IFDD 1D6TA 4MLVA 1S4EA 2RTXA 2EOMA 1NEIA 5BR8I 1PKPA 2EN4A 4DR7E 2EOEA 1Z5AA 5LMNI 2E5LI 1Z1BA 1WHNA 2EMBA 2O1WA 1ELOA 2UXDI 3BGHA 1IBLI 1VI7A 1KIJA 1OJ4A 4FW6A 5GMDA 3WU3A 5ADZA 1YFHA 4DV5I 1EH6A 2EJ4A 4BC7A 4M9VC 4P7DA 4IFDB 3H09A 4BS9A 5A69A 2C39A 4HACA 2EMZA 3M85D 2JEAA 2V8QB 3MHSC 2EOJA 1EH7A 1ZM3A 1EI1A 2RSMA 1VISA 4JI4E 4DUZI 4JI3E 5JEAF 4N3OA 4TUIA 2EE8A 2IOQA 4LCFA 2EQ3A 2PNZB 2EL5A 2YTDA 2LVHA 1HNXE 1Y60A 4IS1C 3P3CA 2V88A 2F4VE 4DV5E 1H73A 1FJGE 1X6FA 2EM5A 1P47A 2DB2A 3BBGA 4BA2B 2HC5A 4K0KI 1YH8A 3GMEA 4J3DA 1ZBQA 4JG4A 2LUQA 4JI8I 2EN3A 5IWAE 3ZZTA 4PU9A 2UUBI 3QT6A 3LTOA 2DRPA 4QNJA 1WRJA 1S16A 5C0XF 3Q1QA 2EOYA 2I9IA 2DGCA 2LRSA 1IBMI 3HPZA 4F9CB 3PS1A 2VE7C 4MYUA 1HNZI 3QG5C 1PJQA 3HJCA 4B3MI 1STUA 2HKEA 2EMYA 1F2IG 4X62E 1GZ6A 4LFBE 4MDTA 3P06A 5IXMB 4OO1B 2M9AA 1L4SA 5TSEA 4F6MA 4LF9E 2EPZA 4NXNE 2GQ0A 4USMA 2JEBB 3T1YI 3ADGA 3F6HA 2LJHA 1H74A 3GONA 2Z5CA 4MU1A 4KWYA 1H7SA 1X6EA 2C37B 2BA0D 2DEJA 4X64I 2CG9A 2EMHA 2NA2A 5AE1A 3T1HI 2Z5EA 1PJTA 1KJKA 2PO0A 3HTXA 2VQFI 5A2QC 2LBSB 2WP8B 4OO1D 5K36B 2HKJA 1A1IA 1JK1A 2YWQA 2UU9E 3U1YA 3L00A 2HJJA 1B63A 1XNQI 2EOOA 1FWLA 2B3TB 1N36I 1A1HA 2L2KB 1AAYA 2Z5BA 4O5GA 4DV1I 4LF7I 3KRNA 5KL3A 3P3EA 4X65I 1EH8A 2BV3A 4RH8A 4F54A 2NN6D 1MEYC 3L7ZB 4JI1E 2O3ZA 3PRYA 4PRVA 3JAMC 1I94E 1J5EI 5FLXC 2BA0G 3GLLA 2EPKX 5KL4A 2EPCA 2JE6B 3IWBA 3MSWA 2EOIA 2UXCE 1YYOA 4GQUA 4R1FA 2DIXA 3J80C 4DU8A 5C0XE 5EL9A 1N34E 1XMQI 1IBKI 3ECRA 4FW3A 2YTPA 4O24A 2ZM6I 1YUIA 5IT9C 2CTDA 2LV2A 2AJ4A 4OX9I 1KYQA 4UT4A 2ZITA 4DV2E 4JYAE 1H7UA 5K36E 4MYTA 4OO1E 1B69A 4DR7I 2V87A 4R2EA 5DRQA 2IHR1 4JV5I 4M2ZA 2EPRA 4JI7E 4BA1B 4DU7A 4F9AB 4R03A 4B3ME 2BR2A 4M0VA 2DSYA 3HPSA 5DNLA 4Q28A 4AQYI 4KZSA 3J81C 4B3RI 4U3BA 1Z0WA 2RQLA 2LJUA 3T1YE 3B8HA 3PS2A 3PYFA 1XNRI
chains in the Genus database with same CATH topology
4OX9E 2NPFA 4Z7YA 1T4OA 4WSPA 5FWKA 3JTZA 3ZZUA 2B9DA 5LMNE 4L5NC 1EKZA 2V86A 4I3HA 2BM0A 2PNLA 5CFFE 2UXBE 2EFGA 1ZM9A 4NXME 3P1XA 4BC9A 2N3GA 2NUFA 4LF8I 1Y6ZA 2O1TA 2VF3A 4P7AA 2JOBA 4DR2E 1PVGA 4LF6E 2Z5CB 2BM1A 4DR5I 3HXLA 1USUA 2HHHI 4DV7I 1NHHA 2UUCI 4JI5I 4GKJI 4JI3I 1HR0E 1RREA 3QT5A 4USKA 4YY3I 2MC6A 4DKKA 2F4VI 2EWLA 2EZ6A 1Z0VA 4DPUA 3H4LA 4DV0I 2V83A 2O1VA 2V34A 1XMOI 4LF6I 4B3SI 1WXRA 3VYYA 3WU4A 4JI6E 2V2VA 5BR8E 4DMIA 3J7AG 4WPYA 1N33E 2VF1A 4RPFA 4DV6E 2UUAI 2A2DA 1HNWI 3T1HE 2GS8A 4DPWA 1Y4SA 1XMQE 1N34I 4IZJB 1Z0TA 1MX0A 4IZKB 3K17A 4DR3I 2UU9I 4B3TI 3ZOQB 3IWCA 1UILA 3QT8A 1T4NA 1ZXNA 4DV3E 1HK7A 1FKAE 1ZBTA 2G7HA 1N32E 1Z59A 3ZKBA 2OI2A 4I8OA 4DR6E 4IZJD 4DV6I 3K85A 3J7AM 3Q6MA 3JAMQ 4DR1I 3AV0A 4HACB 3ZZ0A 4JI0E 1KTVA 1XNQE 1A6FA 2JR1A 1H72C 1SR9A 4DR3E 1FWKA 4WUCA 1KKHA 4DV7E 5GMEA 2WZOA 3LNUA 3ADLA 3V2UC 4DR6I 4DUZE 4JI4I 4KHPI 2ZBKB 2KONA 4P52A 4DPXA 4LF5E 2ZM6E 5AE3A 2LTSA 4DV4I 4LF4I 1BKNA 4NXMI 4F9BB 2J7KA 2E1MA 5DNYA 2JVAA 1XNRE 3DJWA 2V8PA 4GKKI 4EMDA 1J26A 1ZM2A 3HULA 2MC5A 1U2RA 1RC7A 3C4TA 2B7VA 2CPNA 3LLHA 5T6JA 4DV1E 2K4VA 2VQEE 3J80Q 3VK6A 4LF9I 4DR4E 4FN5A 4YHHI 1DI2A 5LMUE 1HR0I 2X7IA 3OTOE 1NHIA 1K47A 3QT7A 4LFBI 3ZKDA 4LF8E 2JOXA 4UTGA 1B62A 1DARA 4WUDA 4XTJA 3PYGA 1X49A 4ED4A 2UXBI 4DV2I 4JYAI 1QU6A 2M1SA 5IWAI 2L2NA 3CWVA 4X65E 2X36A 3FIGA 2PNMA 4HYMA 1HNWE 2NUEA 1IBME 1MG7A 2CZ9A 4DR2I 4FWHA 4JI8E 4PRXA 1T4LB 4M1KA 3K6QA 3KWRA 2Z5BB 1NHJA 1X47A 2RS7A 2FGGA 4HXZA 1XHKA 4JI1I 4FW9A 1Z5BA 4BMJA 1J5EE 4B3SE 4GKJE 2HFUA 4WUBA 1RR9A 4X8WA 1HNZE 2A2CA 1IBLE 3DF6A 2LE2A 3LMLA 2L8TA 1WUUA 2UXCI 5F3WA 5L3JA 2V89A 4R8OA 2VQFE 4KQVA 1MU5A 2HK3A 5AASA 2LUPB 1GQEA 4LFAE 3Q6NA 1UHZA 2CGEA 4DR4I 3PYDA 2V2ZA 2FV4B 1DQ3A 1X48A 4WFTA 4X64E 2NUGA 3V5RA 4X66E 1Z0CA 4JV5E 2M4IA 4LU9A 1N33I 4P78A 3F6GA 2UUAE 3JU0A 4LFCE 2E5LE 4KHPE 1FJGI 3B78A 4B3RE 4L8NA 4K0KE 2ODRC 2V2QA 1FNMA 4DPTA 3RMPA 2O1UA 4FWGA 4LFAI 4DV4E 2HHHE 2L3JA 2UUCE 4JI5E 4LF4E 2HK2A 2LJPA 1ZXMA 5FLXQ 4LTYA 4DV3I 3AUZA 4Z7CA 1UEKA 4GKKE 4LFCI 4X62I 4TUGA 1KVKA 1N0VC 4JI0I 2L33A 1ZM4A 1RQ0A 4DV0E 2Q2EB 1HNXI 2L3CA 1XMOE 3WU6A 2B7TA 1QZRA 2M7QA 2R3VA 1N36E 1NZ0A 4FWDA 3IWDA 3ADIA 5LMUI 5A2QQ 4IZKA 2JWOA 2RS6A 2V85A 1O0WA 1Z0GA 1I94I 2FTXB 4AQYE 2HFSA 4DUYI 2JY9A 2R42A 2XEXA 3C4BA 2UXDE 2LTRA 3VYXA 5LL6R 4LF5I 4LF7E 4YY3E 1Z0BA 3PYEA 4DXLA 4B3TE 4J8ZA 4JI2E 1WHQA 3D4JA 4NXNI 1Y4UA 3LPSA 2DEIA 2L2MA 1YZ9A 4WYQB 1PIEA 4X66I 2KOUA 1YYWA 3K1JA 2YZTA 3HQ1A 4M30A 3J7Yp 4DUYE 1N0UA 2N3HA 4OOGC 4DPYA 3OTOI 1USVA 5IT9Q 3B82A 3F0NA 4JI2I 4JI6I 3ADJA 2E1RA 4YHHE 3M6AA 2ODRD 4DR5E 2L6MA 2DMYA 2L92A 2UUBE 2WW4A 4ZVIA 4JI7I 1YYKA 1FI4A 5AE2A 3ZM7A 3J81Q 1Z0EA 2H36X 2IOPA 4IZJA 4DR1E 2LMZA 1EA6A 2YT4A 3OMLA 1IBKE 4BCAA 4BBYA 2KHXA 4URLA 4GEQB 1Z5CA 1N32I 2VQEI 3WU5A 4HY1A 2F8BA 2MDRA 1D6TA 1S4EA 2RTXA 5BR8I 1PKPA 4DR7E 1Z5AA 2E5LI 5LMNI 1WHNA 2O1WA 1ELOA 2UXDI 1IBLI 1KIJA 1OJ4A 5GMDA 3WU3A 5ADZA 4DV5I 4BC7A 4P7DA 3H09A 4BS9A 4HACA 2V8QB 1ZM3A 1EI1A 2RSMA 1VISA 4JI4E 4DUZI 4JI3E 4N3OA 4TUIA 2IOQA 1HNXE 2V88A 2F4VE 4DV5E 1H73A 1FJGE 2DB2A 4K0KI 1ZBQA 4JG4A 2LUQA 4JI8I 5IWAE 3ZZTA 4PU9A 2UUBI 3QT6A 3LTOA 1S16A 3Q1QA 2LRSA 1IBMI 3HPZA 4F9CB 4MYUA 2VE7C 1HNZI 3HJCA 4B3MI 1STUA 2HKEA 4X62E 1GZ6A 4LFBE 3P06A 4NXNE 4LF9E 2GQ0A 4USMA 3T1YI 3ADGA 3F6HA 2LJHA 1H74A 3GONA 2Z5CA 1H7SA 2DEJA 4X64I 2CG9A 2NA2A 5AE1A 3T1HI 2Z5EA 3HTXA 2VQFI 5A2QC 2LBSB 2HKJA 2UU9E 1B63A 1XNQI 1FWLA 2B3TB 1N36I 2L2KB 2Z5BA 4DV1I 4LF7I 4X65I 2BV3A 4F54A 4JI1E 3PRYA 4PRVA 3JAMC 1I94E 1J5EI 5FLXC 3IWBA 3MSWA 2UXCE 1YYOA 4R1FA 2DIXA 3J80C 4DU8A 1N34E 1XMQI 1IBKI 2ZM6I 5IT9C 2AJ4A 4OX9I 4UT4A 2ZITA 4DV2E 4JYAE 1H7UA 4MYTA 4DR7I 2V87A 2IHR1 4JV5I 4M2ZA 4DU7A 4JI7E 4F9AB 4R03A 4B3ME 4M0VA 2DSYA 3HPSA 4Q28A 4AQYI 4KZSA 3J81C 4B3RI 1Z0WA 3T1YE 3B8HA 3PYFA 1XNRI
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4OX9 E;  2NPF A;  4Z7Y A;  1T4O A;  3ZZU A;  5LMN E;  1EKZ A;  4I3H A;  2BM0 A;  5CFF E;  2UXB E;  2EFG A;  1ZM9 A;  4NXM E;  3P1X A;  2N3G A;  2NUF A;  4LF8 I;  2VF3 A;  4P7A A;  4DR2 E;  1PVG A;  4LF6 E;  2BM1 A;  4DR5 I;  2HHH I;  4DV7 I;  1NHH A;  2UUC I;  4JI5 I;  4GKJ I;  4JI3 I;  1HR0 E;  1RRE A;  3QT5 A;  4USK A;  4YY3 I;  4DKK A;  2F4V I;  2EZ6 A;  1Z0V A;  4DPU A;  3H4L A;  4DV0 I;  2V34 A;  1XMO I;  4LF6 I;  4B3S I;  3VYY A;  3WU4 A;  4JI6 E;  2V2V A;  5BR8 E;  3J7A G;  1N33 E;  4RPF A;  4DV6 E;  2UUA I;  2A2D A;  1HNW I;  3T1H E;  2GS8 A;  4DPW A;  1XMQ E;  1N34 I;  1Z0T A;  1MX0 A;  3K17 A;  4DR3 I;  2UU9 I;  4B3T I;  1UIL A;  3QT8 A;  1T4N A;  1ZXN A;  4DV3 E;  1FKA E;  1ZBT A;  1Z59 A;  1N32 E;  3ZKB A;  2OI2 A;  4DR6 E;  4DV6 I;  3J7A M;  3JAM Q;  4DR1 I;  4HAC B;  3ZZ0 A;  4JI0 E;  1KTV A;  1XNQ E;  1A6F A;  1H72 C;  4DR3 E;  1FWK A;  4WUC A;  1KKH A;  4DV7 E;  5GME A;  3LNU A;  3ADL A;  3V2U C;  4DR6 I;  4DUZ E;  4JI4 I;  4KHP I;  2ZBK B;  4P52 A;  4DPX A;  4LF5 E;  2ZM6 E;  2LTS A;  4DV4 I;  4LF4 I;  1BKN A;  4NXM I;  2J7K A;  2JVA A;  1XNR E;  2V8P A;  4GKK I;  4EMD A;  1J26 A;  1ZM2 A;  3HUL A;  1U2R A;  1RC7 A;  3C4T A;  2B7V A;  2CPN A;  3LLH A;  4DV1 E;  2VQE E;  3J80 Q;  4LF9 I;  4DR4 E;  4FN5 A;  4YHH I;  1DI2 A;  5LMU E;  1HR0 I;  2X7I A;  3OTO E;  1NHI A;  1K47 A;  3QT7 A;  4LFB I;  3ZKD A;  4LF8 E;  4UTG A;  1B62 A;  1DAR A;  4WUD A;  4XTJ A;  3PYG A;  1X49 A;  4ED4 A;  2UXB I;  4DV2 I;  4JYA I;  1QU6 A;  5IWA I;  2L2N A;  3CWV A;  4X65 E;  2X36 A;  4HYM A;  1HNW E;  2NUE A;  1IBM E;  1MG7 A;  2CZ9 A;  4DR2 I;  4FWH A;  4JI8 E;  4PRX A;  1T4L B;  4M1K A;  1NHJ A;  1X47 A;  2RS7 A;  4HXZ A;  1XHK A;  4JI1 I;  4FW9 A;  1Z5B A;  4GKJ E;  1J5E E;  4B3S E;  2HFU A;  4WUB A;  1RR9 A;  4X8W A;  1HNZ E;  2A2C A;  1IBL E;  1WUU A;  2UXC I;  5L3J A;  2VQF E;  4KQV A;  1MU5 A;  2HK3 A;  2LUP B;  1GQE A;  4LFA E;  1UHZ A;  4DR4 I;  3PYD A;  2V2Z A;  1X48 A;  4X64 E;  4WFT A;  2NUG A;  3V5R A;  4X66 E;  1Z0C A;  4JV5 E;  1N33 I;  2UUA E;  4LFC E;  2E5L E;  4KHP E;  1FJG I;  3B78 A;  4B3R E;  4K0K E;  2V2Q A;  1FNM A;  4DPT A;  4FWG A;  4LFA I;  4DV4 E;  2HHH E;  2L3J A;  2UUC E;  4JI5 E;  4LF4 E;  2HK2 A;  2LJP A;  1ZXM A;  5FLX Q;  4DV3 I;  4Z7C A;  1UEK A;  4GKK E;  4LFC I;  4X62 I;  1KVK A;  1N0V C;  4JI0 I;  2L33 A;  1ZM4 A;  1RQ0 A;  4DV0 E;  2Q2E B;  1HNX I;  2L3C A;  1XMO E;  3WU6 A;  2B7T A;  1QZR A;  2R3V A;  1N36 E;  1NZ0 A;  4FWD A;  3ADI A;  5LMU I;  5A2Q Q;  2RS6 A;  1O0W A;  1Z0G A;  1I94 I;  4AQY E;  2HFS A;  4DUY I;  2JY9 A;  2R42 A;  2XEX A;  3C4B A;  2UXD E;  2LTR A;  3VYX A;  5LL6 R;  4LF5 I;  4LF7 E;  4YY3 E;  1Z0B A;  3PYE A;  4DXL A;  4B3T E;  4JI2 E;  1WHQ A;  3D4J A;  4NXN I;  3LPS A;  2DEI A;  2L2M A;  1YZ9 A;  4WYQ B;  1PIE A;  4X66 I;  1YYW A;  3K1J A;  4M30 A;  3J7Y p;  4DUY E;  1N0U A;  2N3H A;  4OOG C;  4DPY A;  3OTO I;  5IT9 Q;  3B82 A;  3F0N A;  4JI2 I;  4JI6 I;  3ADJ A;  2E1R A;  4YHH E;  3M6A A;  4DR5 E;  2DMY A;  2UUB E;  2WW4 A;  4ZVI A;  4JI7 I;  1YYK A;  1FI4 A;  3ZM7 A;  3J81 Q;  1Z0E A;  4DR1 E;  1EA6 A;  2YT4 A;  1IBK E;  2KHX A;  4URL A;  1Z5C A;  1N32 I;  2VQE I;  3WU5 A;  4HY1 A;  2MDR A;  1D6T A;  1S4E A;  2RTX A;  5BR8 I;  1PKP A;  4DR7 E;  1Z5A A;  2E5L I;  5LMN I;  1WHN A;  1ELO A;  2UXD I;  1IBL I;  1KIJ A;  1OJ4 A;  5GMD A;  3WU3 A;  4DV5 I;  4HAC A;  1ZM3 A;  1EI1 A;  2RSM A;  1VIS A;  4JI4 E;  4DUZ I;  4JI3 E;  1HNX E;  2F4V E;  4DV5 E;  1H73 A;  1FJG E;  2DB2 A;  4K0K I;  4JG4 A;  2LUQ A;  4JI8 I;  5IWA E;  3ZZT A;  4PU9 A;  2UUB I;  3QT6 A;  3LTO A;  1S16 A;  3Q1Q A;  2LRS A;  1IBM I;  4MYU A;  1HNZ I;  4B3M I;  1STU A;  2HKE A;  4X62 E;  4LFB E;  4NXN E;  4LF9 E;  4USM A;  3T1Y I;  3ADG A;  2LJH A;  1H74 A;  3GON A;  1H7S A;  2DEJ A;  4X64 I;  2NA2 A;  3T1H I;  3HTX A;  2VQF I;  5A2Q C;  2LBS B;  2HKJ A;  2UU9 E;  1B63 A;  1XNQ I;  1FWL A;  2B3T B;  1N36 I;  2L2K B;  4DV1 I;  4LF7 I;  4X65 I;  2BV3 A;  4JI1 E;  4PRV A;  1I94 E;  3JAM C;  1J5E I;  5FLX C;  2UXC E;  1YYO A;  4R1F A;  2DIX A;  3J80 C;  4DU8 A;  1N34 E;  1XMQ I;  1IBK I;  2ZM6 I;  5IT9 C;  2AJ4 A;  4OX9 I;  4UT4 A;  2ZIT A;  4DV2 E;  4JYA E;  1H7U A;  4MYT A;  4DR7 I;  2IHR 1;  4JV5 I;  4M2Z A;  4DU7 A;  4JI7 E;  4B3M E;  4AQY I;  3J81 C;  4B3R I;  1Z0W A;  3T1Y E;  3B8H A;  3PYF A;  1XNR I; 
#chains in the Genus database with same CATH topology
 4OX9 E;  2NPF A;  2EOF A;  4Z7Y A;  2EMG A;  1T4O A;  1A1K A;  4WSP A;  4WSG A;  5FWK A;  3JTZ A;  2MDG A;  3ZZU A;  2EMF A;  2B9D A;  2PO0 B;  3VHT B;  5LMN E;  4L5N C;  1RMD A;  4ZYE A;  2V86 A;  1EKZ A;  2EOS A;  4I3H A;  1YUJ A;  2BM0 A;  2PNL A;  5CFF E;  1BBO A;  2UXB E;  2EFG A;  1ZM9 A;  4NXM E;  3P1X A;  4BC9 A;  5K36 A;  4FW5 A;  5AC4 A;  3HKM A;  2YTI A;  2N3G A;  2NUF A;  4LF8 I;  2YTJ A;  3EPH A;  1Y6Z A;  2O1T A;  2VF3 A;  2WNR A;  4WXC A;  1R6M A;  4P7A A;  2K7I A;  1JK2 A;  1PJS A;  1G2D C;  1OYR A;  2JOB A;  1TN9 A;  5KL5 A;  4DR2 E;  1PVG A;  3UHM A;  4LF6 E;  2Z5C B;  2J7J A;  1UDN A;  2BM1 A;  4DR5 I;  3HXL A;  2EQ0 A;  1USU A;  2ELZ A;  1UN6 B;  1NHH A;  4DV7 I;  2HHH I;  2UUC I;  4JI5 I;  1BB8 A;  4GKJ I;  4AIM A;  2EM2 A;  2A25 A;  4X9J A;  4JI3 I;  5KL6 A;  1HR0 E;  1RRE A;  2J65 A;  3QT5 A;  5DRR A;  4MU0 A;  4USK A;  4IFD E;  4YY3 I;  4HTG A;  2MC6 A;  3C6K A;  5IV8 B;  4DKK A;  2F4V I;  2EOX A;  2EWL A;  2EZ6 A;  1Z0V A;  2ENH A;  4DPU A;  3H4L A;  4DV0 I;  2V83 A;  2O1V A;  2V34 A;  1XMO I;  4LF6 I;  4B3S I;  1WXR A;  3M7N G;  2EN7 A;  3VYY A;  3WU4 A;  4JI6 E;  2V2V A;  2LO3 A;  2BR2 B;  4FK5 C;  2C38 B;  2EOZ A;  5BR8 E;  4DMI A;  3J7A G;  4WPY A;  2NN6 F;  5K36 C;  3C6M A;  1N33 E;  2C39 B;  2VF1 A;  4ZYG A;  4RPF A;  4DV6 E;  2UUA I;  2A2D A;  4Q35 B;  2R1F A;  4MU3 A;  1A1J A;  2EMK A;  1HNW I;  3T1H E;  1TF3 A;  2GS8 A;  4DPW A;  1NCS A;  1Y4S A;  1XMQ E;  1N34 I;  2BBG A;  4IZJ B;  2JT2 A;  1Z0T A;  1YPN A;  1MX0 A;  4IZK B;  3K17 A;  4DR3 I;  1MGT A;  4OZE A;  4HEI A;  5C0X A;  2UU9 I;  4B3T I;  3ZOQ B;  2DLQ A;  1UIL A;  3IWC A;  5JEA A;  3QT8 A;  1BBG A;  1T4N A;  2YRH A;  1ZXN A;  4DV3 E;  1HK7 A;  1FKA E;  1ZBT A;  4LCH A;  2G7H A;  4MLQ A;  1N32 E;  1Z59 A;  3ZKB A;  2OI2 A;  3U1K A;  1DGC A;  1SFE A;  4I8O A;  4DR6 E;  2VES A;  1IQS A;  4IZJ D;  4DV6 I;  3K85 A;  3J7A M;  3Q6M A;  3JAM Q;  4DR1 I;  3GCM A;  3AV0 A;  4HAC B;  3ZZ0 A;  2EQ1 A;  4JI0 E;  3EPJ A;  1KTV A;  1XNQ E;  4AID A;  1UDO A;  1RHY A;  1A6F A;  2JR1 A;  1H72 C;  2IES A;  3DD6 A;  1SR9 A;  4DR3 E;  2Q8U A;  4F2J C;  2BA1 D;  1A1F A;  1FWK A;  4WUC A;  1KKH A;  4DV7 E;  5GME A;  2PO1 B;  2WZO A;  3LNU A;  3ADL A;  1A1L A;  3V2U C;  4DR6 I;  4DUZ E;  4JI4 I;  4KHP I;  2ZBK B;  1X3C A;  2KON A;  4P52 A;  2N8X A;  4DPX A;  4MU4 A;  4LF5 E;  2ZM6 E;  5AE3 A;  3M85 G;  2LTS A;  4DV4 I;  2EPU A;  1BKN A;  4LF4 I;  4NXM I;  4F9B B;  2J7K A;  2E1M A;  1ZR9 A;  5DNY A;  4IFD C;  4BHC A;  1A1G A;  2YU5 A;  2EL4 A;  3P76 A;  2JVA A;  1XNR E;  3DJW A;  4AM3 A;  2V8P A;  4GKK I;  5KL2 A;  4EMD A;  1J26 A;  1ZM2 A;  3HUL A;  2MC5 A;  1U2R A;  1RC7 A;  3C4T A;  2B7V A;  2RPC A;  2CPN A;  3LLH A;  5T6J A;  2YSO A;  2K4V A;  4DV1 E;  4BA2 A;  2VQE E;  4R2D A;  2LT7 A;  1WJP A;  2ELY A;  3J80 Q;  3VK6 A;  4LF9 I;  4DR4 E;  4FN5 A;  4YHH I;  1YHC A;  2EPX A;  4BHB A;  2NN6 C;  2MKD A;  1DI2 A;  5K36 F;  1TF6 A;  5AC5 A;  5LMU E;  2GO4 A;  1HR0 I;  2X7I A;  2EN1 A;  2YTF A;  2EOH A;  3OTO E;  1NHI A;  1K47 A;  3QT7 A;  4R2R A;  2EMC A;  4LPF A;  4LFB I;  4OO1 C;  2BB8 A;  2YTQ A;  4LF8 E;  2JOX A;  4UTG A;  3ZKD A;  3EQ1 A;  2WNR B;  4RHB B;  1B62 A;  1DAR A;  4WUD A;  4XTJ A;  3PYG A;  1X49 A;  2DLK A;  3CDI A;  4ED4 A;  4R2Q A;  2UXB I;  2JYA A;  4DV2 I;  4JYA I;  1QU6 A;  2GHF A;  2RSI A;  2EPP A;  2YTO A;  5A6B D;  2M1S A;  2WCC 3;  2PNZ A;  2WBU A;  1PDA A;  2ENC A;  2WBS A;  5IWA I;  2L2N A;  3CWV A;  4X65 E;  2X36 A;  2EPM X;  3FIG A;  2EM0 A;  4GZN C;  2EM6 A;  4ZYH A;  2EMX A;  4O43 A;  2NN6 A;  2PNM A;  4HYM A;  1HNW E;  2WP8 A;  2NUE A;  1IBM E;  2EPN A;  1MG7 A;  2EPL X;  2CVE A;  2CZ9 A;  4DR2 I;  2BA1 G;  3NZK A;  4FWH A;  2EMI A;  4JI8 E;  4PRX A;  2AE8 A;  1T4L B;  4M1K A;  3K6Q A;  3KWR A;  2Z5B B;  1NHJ A;  1X47 A;  2RS7 A;  2FGG A;  4HXZ A;  1XHK A;  4JI1 I;  4FW9 A;  4O4K A;  2JPA A;  1X6H A;  2YRK A;  4BMJ A;  1J5E E;  4B3S E;  4GKJ E;  1Z5B A;  2PRT A;  1RR9 A;  2HFU A;  4WUB A;  5A6A A;  4X8W A;  1HNZ E;  2A2C A;  1IBL E;  3DF6 A;  4ZYD A;  2LE2 A;  3LML A;  2L8T A;  5DNX A;  1WUU A;  5C0X D;  2UXC I;  1ZU1 A;  3BF2 A;  5F3W A;  5L3J A;  2V89 A;  2EMW A;  4R8O A;  2JEB A;  2LCE A;  2VQF E;  4KQV A;  2YU8 A;  4IFD A;  4NBQ A;  1MU5 A;  2HK3 A;  1YSA C;  3KZZ A;  5AAS A;  2LUP B;  1GQE A;  4LFA E;  1ZAA C;  1UHZ A;  2EOQ A;  2CGE A;  1QNT A;  2PO2 A;  3Q6N A;  4DR4 I;  3PYD A;  3UK3 C;  2V2Z A;  2FV4 B;  1DQ3 A;  1X48 A;  4WFT A;  4X64 E;  2NUG A;  2YTE A;  2GLI A;  5C0X B;  3V5R A;  4X66 E;  1E3P A;  1Z0C A;  4JV5 E;  2M4I A;  2YTN A;  4LU9 A;  1N33 I;  4P78 A;  3THN A;  3F6G A;  2UUA E;  3THO B;  3EPK A;  3JU0 A;  4LFC E;  4BA1 A;  2E5L E;  2E72 A;  4KHP E;  4U3D A;  1FJG I;  3B78 A;  4B3R E;  4L8N A;  4K0K E;  2ODR C;  1R6L A;  2V2Q A;  4QNK A;  3BID A;  1FNM A;  4DPT A;  3RMP A;  3EPL A;  4R2S A;  1UDQ A;  2O1U A;  4N4R B;  2CSH A;  4WXD A;  1OYS A;  2GPI A;  4FWG A;  4LFA I;  4DV4 E;  2HHH E;  2L3J A;  2I13 A;  2UUC E;  4JI5 E;  4LF4 E;  2HK2 A;  1G2F C;  2LJP A;  1ZXM A;  4LOM A;  5FLX Q;  4LTY A;  4DV3 I;  3AUZ A;  4F6N A;  2EL6 A;  1N3G A;  4Z7C A;  3B4T A;  1UEK A;  4GKK E;  4LFC I;  5K36 D;  2EN6 A;  4TUG A;  4X62 I;  2EOR A;  1KVK A;  1N0V C;  3P3G A;  4IFD F;  4JI0 I;  2L33 A;  1ZM4 A;  1RQ0 A;  4DV0 E;  2Q2E B;  1HNX I;  2EML A;  2L3C A;  1XMO E;  1UDS A;  4IS9 A;  3WU6 A;  2GO3 A;  4LCG A;  2B7T A;  5ELW A;  5JEA C;  2F1D A;  1QZR A;  2M7Q A;  1UBD C;  5C0X C;  2R3V A;  1N36 E;  1NZ0 A;  2NN6 B;  4FWD A;  2VRD A;  2EPO A;  2YTG A;  4IJD A;  3IWD A;  1P42 A;  4OO1 F;  5A6J A;  3ADI A;  5LMU I;  5A2Q Q;  4IZK A;  2JWO A;  2RS6 A;  2WBT A;  2V85 A;  1O0W A;  1Z0G A;  1I94 I;  2NN6 E;  2EM4 A;  2EN2 A;  2FTX B;  4NHR A;  4AQY E;  2HFS A;  4DUY I;  2JY9 A;  4FW4 A;  2R42 A;  2XEX A;  3C4B A;  1T38 A;  2EMA A;  2LTR A;  3VYX A;  2UXD E;  3TQM A;  5LL6 R;  4LF5 I;  3CDJ A;  1LLM C;  4YY3 E;  4LF7 E;  1Z0B A;  1E3H A;  3PYE A;  1T39 A;  4DXL A;  4B3T E;  4J8Z A;  4JI2 E;  1IMU A;  1WHQ A;  3D4J A;  4NXN I;  2CT1 A;  2R76 A;  2YSP A;  1Y4U A;  2DEI A;  3L7Z A;  3LPS A;  2EP3 A;  2L2M A;  1Y5Y A;  1YZ9 A;  4OO1 A;  4WYQ B;  2NAB A;  1PIE A;  2JEA B;  4X66 I;  2KOU A;  3MHH C;  2C38 A;  1YYW A;  3K1J A;  2YZT A;  2JE6 A;  3HQ1 A;  4ISA A;  2DMI A;  2EM3 A;  2ENA A;  1OYP A;  2IER A;  4M30 A;  3J7Y p;  4DUY E;  1N0U A;  2C37 A;  2N3H A;  1IQO A;  5LLQ A;  4OOG C;  4DPY A;  2PO1 A;  2EM8 A;  5A6B A;  3OTO I;  1USV A;  3M7N D;  5IT9 Q;  3B82 A;  2EPA A;  3F0N A;  1GTK A;  4JI2 I;  4JI6 I;  3ADJ A;  5JEA E;  1AH5 A;  2E1R A;  2JP9 A;  4YHH E;  2YPN A;  5A6K A;  3M6A A;  2ODR D;  4DR5 E;  2L6M A;  2DMY A;  2L92 A;  2UUB E;  4R2C A;  2WW4 A;  4R2A A;  1YYK A;  4ZVI A;  4JI7 I;  1FI4 A;  5JEA D;  5EKW A;  5AE2 A;  3ZM7 A;  1X5W A;  3H1C A;  2EM7 A;  3J81 Q;  1XXE A;  4MQY A;  1Z0E A;  3PS3 A;  5KL7 A;  2H36 X;  2IOP A;  2D9H A;  2PO2 B;  5DRO A;  4IZJ A;  4DR1 E;  2LMZ A;  2HGH A;  2ADR A;  4FW7 A;  2YRM A;  1EA6 A;  4R2P A;  2YT4 A;  3OML A;  1IBK E;  3KZY A;  4BCA A;  4BBY A;  4OKG A;  2KHX A;  4URL A;  4GEQ B;  1Z5C A;  5JEA B;  2JXP A;  1N32 I;  2EM9 A;  5DRP A;  3WU5 A;  4WX9 A;  4HY1 A;  2F8B A;  2MKN A;  2EN8 A;  2MDR A;  2VQE I;  3M99 B;  4NZV A;  4IFD D;  1D6T A;  4MLV A;  1S4E A;  2RTX A;  2EOM A;  1NEI A;  5BR8 I;  1PKP A;  2EN4 A;  4DR7 E;  2EOE A;  1Z5A A;  5LMN I;  2E5L I;  1Z1B A;  1WHN A;  2EMB A;  2O1W A;  1ELO A;  2UXD I;  3BGH A;  1IBL I;  1VI7 A;  1KIJ A;  1OJ4 A;  4FW6 A;  5GMD A;  3WU3 A;  5ADZ A;  1YFH A;  4DV5 I;  1EH6 A;  2EJ4 A;  4BC7 A;  4M9V C;  4P7D A;  4IFD B;  3H09 A;  4BS9 A;  5A69 A;  2C39 A;  4HAC A;  2EMZ A;  3M85 D;  2JEA A;  2V8Q B;  3MHS C;  2EOJ A;  1EH7 A;  1ZM3 A;  1EI1 A;  2RSM A;  1VIS A;  4JI4 E;  4DUZ I;  4JI3 E;  5JEA F;  4N3O A;  4TUI A;  2EE8 A;  2IOQ A;  4LCF A;  2EQ3 A;  2PNZ B;  2EL5 A;  2YTD A;  2LVH A;  1HNX E;  1Y60 A;  4IS1 C;  3P3C A;  2V88 A;  2F4V E;  4DV5 E;  1H73 A;  1FJG E;  1X6F A;  2EM5 A;  1P47 A;  2DB2 A;  3BBG A;  4BA2 B;  2HC5 A;  4K0K I;  1YH8 A;  3GME A;  4J3D A;  1ZBQ A;  4JG4 A;  2LUQ A;  4JI8 I;  2EN3 A;  5IWA E;  3ZZT A;  4PU9 A;  2UUB I;  3QT6 A;  3LTO A;  2DRP A;  4QNJ A;  1WRJ A;  1S16 A;  5C0X F;  3Q1Q A;  2EOY A;  2I9I A;  2DGC A;  2LRS A;  1IBM I;  3HPZ A;  4F9C B;  3PS1 A;  2VE7 C;  4MYU A;  1HNZ I;  3QG5 C;  1PJQ A;  3HJC A;  4B3M I;  1STU A;  2HKE A;  2EMY A;  1F2I G;  4X62 E;  1GZ6 A;  4LFB E;  4MDT A;  3P06 A;  5IXM B;  4OO1 B;  2M9A A;  1L4S A;  5TSE A;  4F6M A;  4LF9 E;  2EPZ A;  4NXN E;  2GQ0 A;  4USM A;  2JEB B;  3T1Y I;  3ADG A;  3F6H A;  2LJH A;  1H74 A;  3GON A;  2Z5C A;  4MU1 A;  4KWY A;  1H7S A;  1X6E A;  2C37 B;  2BA0 D;  2DEJ A;  4X64 I;  2CG9 A;  2EMH A;  2NA2 A;  5AE1 A;  3T1H I;  2Z5E A;  1PJT A;  1KJK A;  2PO0 A;  3HTX A;  2VQF I;  5A2Q C;  2LBS B;  2WP8 B;  4OO1 D;  5K36 B;  2HKJ A;  1A1I A;  1JK1 A;  2YWQ A;  2UU9 E;  3U1Y A;  3L00 A;  2HJJ A;  1B63 A;  1XNQ I;  2EOO A;  1FWL A;  2B3T B;  1N36 I;  1A1H A;  2L2K B;  1AAY A;  2Z5B A;  4O5G A;  4DV1 I;  4LF7 I;  3KRN A;  5KL3 A;  3P3E A;  4X65 I;  1EH8 A;  2BV3 A;  4RH8 A;  4F54 A;  2NN6 D;  1MEY C;  3L7Z B;  4JI1 E;  2O3Z A;  3PRY A;  4PRV A;  3JAM C;  1I94 E;  1J5E I;  5FLX C;  2BA0 G;  3GLL A;  2EPK X;  5KL4 A;  2EPC A;  2JE6 B;  3IWB A;  3MSW A;  2EOI A;  2UXC E;  1YYO A;  4GQU A;  4R1F A;  2DIX A;  3J80 C;  4DU8 A;  5C0X E;  5EL9 A;  1N34 E;  1XMQ I;  1IBK I;  3ECR A;  4FW3 A;  2YTP A;  4O24 A;  2ZM6 I;  1YUI A;  5IT9 C;  2CTD A;  2LV2 A;  2AJ4 A;  4OX9 I;  1KYQ A;  4UT4 A;  2ZIT A;  4DV2 E;  4JYA E;  1H7U A;  5K36 E;  4MYT A;  4OO1 E;  1B69 A;  4DR7 I;  2V87 A;  4R2E A;  5DRQ A;  2IHR 1;  4JV5 I;  4M2Z A;  2EPR A;  4JI7 E;  4BA1 B;  4DU7 A;  4F9A B;  4R03 A;  4B3M E;  2BR2 A;  4M0V A;  2DSY A;  3HPS A;  5DNL A;  4Q28 A;  4AQY I;  4KZS A;  3J81 C;  4B3R I;  4U3B A;  1Z0W A;  2RQL A;  2LJU A;  3T1Y E;  3B8H A;  3PS2 A;  3PYF A;  1XNR I; 
#chains in the Genus database with same CATH homology
 4OX9 E;  2NPF A;  4Z7Y A;  1T4O A;  4WSP A;  5FWK A;  3JTZ A;  3ZZU A;  2B9D A;  5LMN E;  4L5N C;  1EKZ A;  2V86 A;  4I3H A;  2BM0 A;  2PNL A;  5CFF E;  2UXB E;  2EFG A;  1ZM9 A;  4NXM E;  3P1X A;  4BC9 A;  2N3G A;  2NUF A;  4LF8 I;  1Y6Z A;  2O1T A;  2VF3 A;  4P7A A;  2JOB A;  4DR2 E;  1PVG A;  4LF6 E;  2Z5C B;  2BM1 A;  4DR5 I;  3HXL A;  1USU A;  2HHH I;  4DV7 I;  1NHH A;  2UUC I;  4JI5 I;  4GKJ I;  4JI3 I;  1HR0 E;  1RRE A;  3QT5 A;  4USK A;  4YY3 I;  2MC6 A;  4DKK A;  2F4V I;  2EWL A;  2EZ6 A;  1Z0V A;  4DPU A;  3H4L A;  4DV0 I;  2V83 A;  2O1V A;  2V34 A;  1XMO I;  4LF6 I;  4B3S I;  1WXR A;  3VYY A;  3WU4 A;  4JI6 E;  2V2V A;  5BR8 E;  4DMI A;  3J7A G;  4WPY A;  1N33 E;  2VF1 A;  4RPF A;  4DV6 E;  2UUA I;  2A2D A;  1HNW I;  3T1H E;  2GS8 A;  4DPW A;  1Y4S A;  1XMQ E;  1N34 I;  4IZJ B;  1Z0T A;  1MX0 A;  4IZK B;  3K17 A;  4DR3 I;  2UU9 I;  4B3T I;  3ZOQ B;  3IWC A;  1UIL A;  3QT8 A;  1T4N A;  1ZXN A;  4DV3 E;  1HK7 A;  1FKA E;  1ZBT A;  2G7H A;  1N32 E;  1Z59 A;  3ZKB A;  2OI2 A;  4I8O A;  4DR6 E;  4IZJ D;  4DV6 I;  3K85 A;  3J7A M;  3Q6M A;  3JAM Q;  4DR1 I;  3AV0 A;  4HAC B;  3ZZ0 A;  4JI0 E;  1KTV A;  1XNQ E;  1A6F A;  2JR1 A;  1H72 C;  1SR9 A;  4DR3 E;  1FWK A;  4WUC A;  1KKH A;  4DV7 E;  5GME A;  2WZO A;  3LNU A;  3ADL A;  3V2U C;  4DR6 I;  4DUZ E;  4JI4 I;  4KHP I;  2ZBK B;  2KON A;  4P52 A;  4DPX A;  4LF5 E;  2ZM6 E;  5AE3 A;  2LTS A;  4DV4 I;  4LF4 I;  1BKN A;  4NXM I;  4F9B B;  2J7K A;  2E1M A;  5DNY A;  2JVA A;  1XNR E;  3DJW A;  2V8P A;  4GKK I;  4EMD A;  1J26 A;  1ZM2 A;  3HUL A;  2MC5 A;  1U2R A;  1RC7 A;  3C4T A;  2B7V A;  2CPN A;  3LLH A;  5T6J A;  4DV1 E;  2K4V A;  2VQE E;  3J80 Q;  3VK6 A;  4LF9 I;  4DR4 E;  4FN5 A;  4YHH I;  1DI2 A;  5LMU E;  1HR0 I;  2X7I A;  3OTO E;  1NHI A;  1K47 A;  3QT7 A;  4LFB I;  3ZKD A;  4LF8 E;  2JOX A;  4UTG A;  1B62 A;  1DAR A;  4WUD A;  4XTJ A;  3PYG A;  1X49 A;  4ED4 A;  2UXB I;  4DV2 I;  4JYA I;  1QU6 A;  2M1S A;  5IWA I;  2L2N A;  3CWV A;  4X65 E;  2X36 A;  3FIG A;  2PNM A;  4HYM A;  1HNW E;  2NUE A;  1IBM E;  1MG7 A;  2CZ9 A;  4DR2 I;  4FWH A;  4JI8 E;  4PRX A;  1T4L B;  4M1K A;  3K6Q A;  3KWR A;  2Z5B B;  1NHJ A;  1X47 A;  2RS7 A;  2FGG A;  4HXZ A;  1XHK A;  4JI1 I;  4FW9 A;  1Z5B A;  4BMJ A;  1J5E E;  4B3S E;  4GKJ E;  2HFU A;  4WUB A;  1RR9 A;  4X8W A;  1HNZ E;  2A2C A;  1IBL E;  3DF6 A;  2LE2 A;  3LML A;  2L8T A;  1WUU A;  2UXC I;  5F3W A;  5L3J A;  2V89 A;  4R8O A;  2VQF E;  4KQV A;  1MU5 A;  2HK3 A;  5AAS A;  2LUP B;  1GQE A;  4LFA E;  3Q6N A;  1UHZ A;  2CGE A;  4DR4 I;  3PYD A;  2V2Z A;  2FV4 B;  1DQ3 A;  1X48 A;  4WFT A;  4X64 E;  2NUG A;  3V5R A;  4X66 E;  1Z0C A;  4JV5 E;  2M4I A;  4LU9 A;  1N33 I;  4P78 A;  3F6G A;  2UUA E;  3JU0 A;  4LFC E;  2E5L E;  4KHP E;  1FJG I;  3B78 A;  4B3R E;  4L8N A;  4K0K E;  2ODR C;  2V2Q A;  1FNM A;  4DPT A;  3RMP A;  2O1U A;  4FWG A;  4LFA I;  4DV4 E;  2HHH E;  2L3J A;  2UUC E;  4JI5 E;  4LF4 E;  2HK2 A;  2LJP A;  1ZXM A;  5FLX Q;  4LTY A;  4DV3 I;  3AUZ A;  4Z7C A;  1UEK A;  4GKK E;  4LFC I;  4X62 I;  4TUG A;  1KVK A;  1N0V C;  4JI0 I;  2L33 A;  1ZM4 A;  1RQ0 A;  4DV0 E;  2Q2E B;  1HNX I;  2L3C A;  1XMO E;  3WU6 A;  2B7T A;  1QZR A;  2M7Q A;  2R3V A;  1N36 E;  1NZ0 A;  4FWD A;  3IWD A;  3ADI A;  5LMU I;  5A2Q Q;  4IZK A;  2JWO A;  2RS6 A;  2V85 A;  1O0W A;  1Z0G A;  1I94 I;  2FTX B;  4AQY E;  2HFS A;  4DUY I;  2JY9 A;  2R42 A;  2XEX A;  3C4B A;  2UXD E;  2LTR A;  3VYX A;  5LL6 R;  4LF5 I;  4LF7 E;  4YY3 E;  1Z0B A;  3PYE A;  4DXL A;  4B3T E;  4J8Z A;  4JI2 E;  1WHQ A;  3D4J A;  4NXN I;  1Y4U A;  3LPS A;  2DEI A;  2L2M A;  1YZ9 A;  4WYQ B;  1PIE A;  4X66 I;  2KOU A;  1YYW A;  3K1J A;  2YZT A;  3HQ1 A;  4M30 A;  3J7Y p;  4DUY E;  1N0U A;  2N3H A;  4OOG C;  4DPY A;  3OTO I;  1USV A;  5IT9 Q;  3B82 A;  3F0N A;  4JI2 I;  4JI6 I;  3ADJ A;  2E1R A;  4YHH E;  3M6A A;  2ODR D;  4DR5 E;  2L6M A;  2DMY A;  2L92 A;  2UUB E;  2WW4 A;  4ZVI A;  4JI7 I;  1YYK A;  1FI4 A;  5AE2 A;  3ZM7 A;  3J81 Q;  1Z0E A;  2H36 X;  2IOP A;  4IZJ A;  4DR1 E;  2LMZ A;  1EA6 A;  2YT4 A;  3OML A;  1IBK E;  4BCA A;  4BBY A;  2KHX A;  4URL A;  4GEQ B;  1Z5C A;  1N32 I;  2VQE I;  3WU5 A;  4HY1 A;  2F8B A;  2MDR A;  1D6T A;  1S4E A;  2RTX A;  5BR8 I;  1PKP A;  4DR7 E;  1Z5A A;  2E5L I;  5LMN I;  1WHN A;  2O1W A;  1ELO A;  2UXD I;  1IBL I;  1KIJ A;  1OJ4 A;  5GMD A;  3WU3 A;  5ADZ A;  4DV5 I;  4BC7 A;  4P7D A;  3H09 A;  4BS9 A;  4HAC A;  2V8Q B;  1ZM3 A;  1EI1 A;  2RSM A;  1VIS A;  4JI4 E;  4DUZ I;  4JI3 E;  4N3O A;  4TUI A;  2IOQ A;  1HNX E;  2V88 A;  2F4V E;  4DV5 E;  1H73 A;  1FJG E;  2DB2 A;  4K0K I;  1ZBQ A;  4JG4 A;  2LUQ A;  4JI8 I;  5IWA E;  3ZZT A;  4PU9 A;  2UUB I;  3QT6 A;  3LTO A;  1S16 A;  3Q1Q A;  2LRS A;  1IBM I;  3HPZ A;  4F9C B;  4MYU A;  2VE7 C;  1HNZ I;  3HJC A;  4B3M I;  1STU A;  2HKE A;  4X62 E;  1GZ6 A;  4LFB E;  3P06 A;  4NXN E;  4LF9 E;  2GQ0 A;  4USM A;  3T1Y I;  3ADG A;  3F6H A;  2LJH A;  1H74 A;  3GON A;  2Z5C A;  1H7S A;  2DEJ A;  4X64 I;  2CG9 A;  2NA2 A;  5AE1 A;  3T1H I;  2Z5E A;  3HTX A;  2VQF I;  5A2Q C;  2LBS B;  2HKJ A;  2UU9 E;  1B63 A;  1XNQ I;  1FWL A;  2B3T B;  1N36 I;  2L2K B;  2Z5B A;  4DV1 I;  4LF7 I;  4X65 I;  2BV3 A;  4F54 A;  4JI1 E;  3PRY A;  4PRV A;  3JAM C;  1I94 E;  1J5E I;  5FLX C;  3IWB A;  3MSW A;  2UXC E;  1YYO A;  4R1F A;  2DIX A;  3J80 C;  4DU8 A;  1N34 E;  1XMQ I;  1IBK I;  2ZM6 I;  5IT9 C;  2AJ4 A;  4OX9 I;  4UT4 A;  2ZIT A;  4DV2 E;  4JYA E;  1H7U A;  4MYT A;  4DR7 I;  2V87 A;  2IHR 1;  4JV5 I;  4M2Z A;  4DU7 A;  4JI7 E;  4F9A B;  4R03 A;  4B3M E;  4M0V A;  2DSY A;  3HPS A;  4Q28 A;  4AQY I;  4KZS A;  3J81 C;  4B3R I;  1Z0W A;  3T1Y E;  3B8H A;  3PYF A;  1XNR I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...