1N36E

Structure of the thermus thermophilus 30s ribosomal subunit in the presence of crystallographically disordered codon and near-cognate transfer rna anticodon stem-loop mismatched at the second codon position
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
150
structure length
150
Chain Sequence
b'DFEEKMILIRRTARMQAGGRRFRFGALVVVGDRQGRVGLGFGKAPEVPLAVQKAGYYARRNMVEVPLQNGTIPHEIEVEFGASKIVLKPAAPGTGVIAGAVPRAILELAGVTDILTKELGSRNPINIAYATMEALRQLRTKADVERLRKG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S RIBOSOMAL RNA
publication title Selection of tRNA by the Ribosome Requires a Transition from an Open to a Closed Form
pubmed doi rcsb
molecule tags Ribosome
total genus 33
structure length 150
sequence length 150
ec nomenclature
pdb deposition date 2002-10-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00333 Ribosomal_S5 Ribosomal protein S5, N-terminal domain
E PF03719 Ribosomal_S5_C Ribosomal protein S5, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.20 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 1n36E01
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 1n36E02
1ZM9A 4ED4A 3VYXA 2F4VI 4B3SI 2EZ6A 4M1KA 1YYOA 4DPWA 2X36A 1A6FA 4KHPE 2VF3A 1B62A 1HNXE 4LFCE 4FWHA 4Z7CA 1H73A 1XHKA 1ZBTA 1N34I 4P52A 4WUCA 1GQEA 1N32I 1N32E 1J5EE 2ZBKB 1MG7A 1HNWE 4GKKI 1PIEA 4DU8A 1I94I 3QT6A 4WYQB 1I94E 1QZRA 1O0WA 2NA2A 1MU5A 3J7AG 2KHXA 1ELOA 3D4JA 2ZM6I 3ZZUA 2ZM6E 4K0KI 3P1XA 3K1JA 4K0KE 4NXME 4LF9I 2EFGA 3B78A 4DPYA 2HFSA 2HFUA 1X48A 1VISA 2OI2A 2UXCI 2UUCE 2UXCE 4YHHI 3LNUA 1HR0I 1XMQE 1Z0VA 1HR0E 1RREA 4DV3I 2E1RA 4LF8I 1OJ4A 1Z59A 2VQFE 2AJ4A 1J26A 4JI7I 4JI7E 4KQVA 2DMYA 3JAMQ 4AQYI 2LUPB 1UILA 2ZITA 3B82A 4JI8I 4DV5E 4M30A 4OX9I 4PRVA 4OX9E 1N36E 4JI2E 1WHQA 2R3VA 4RPFA 4DV6I 2DEJA 4MYUA 4FWGA 4DV6E 4DR4E 5FLXQ 1D6TA 1XNQE 3ZZTA 1YZ9A 4DUZI 4LF6I 1KVKA 1PKPA 4LF7E 2DIXA 4EMDA 4DR2I 1H72C 4DR2E 4JI4I 4HACA 3T1YI 4USMA 1S16A 4DPUA 2JY9A 3K17A 4DPTA 4X62E 1Z5CA 2UXDI 1X49A 2UXDE 4HY1A 2BV3A 4YY3I 2N3HA 5BR8I 1Z0CA 4LFAE 5BR8E 4DV7I 4LF5E 4DV7E 4Z7YA 4DV0E 1H74A 4DV1I 4DV1E 1IBKI 5IWAI 2VQEI 3ZM7A 5GMDA 2F4VE 2VQEE 4B3SE 3V5RA 2RS6A 4DUYI 3ZKBA 1N0UA 2UUAI 5LL6R 2UUAE 3ZZ0A 1IBLI 1Z0EA 1IBLE 2L3JA 1MX0A 1Z5AA 4ZVIA 3C4BA 1N33I 4OOGC 1N34E 1N33E 1FNMA 3CWVA 1NHIA 2N3GA 1WUUA 3Q1QA 1T4OA 2V2VA 4GKKE 5A2QQ 1H7UA 2LRSA 4DV2I 4DV2E 4NXNI 4NXNE 5IT9Q 1EKZA 2HKJA 2V34A 3H4LA 2HKEA 4LF9E 3QT8A 1YYWA 3JAMC 3J7Yp 2HK3A 2NUEA 4DXLA 2V2QA 4JV5I 2NUGA 4JV5E 2R42A 2IHR1 1ZM4A 1KIJA 4YHHE 4DKKA 1XMOI 2LJPA 4DV3E 4WFTA 4JI6I 4LF8E 1NHHA 3PYDA 2YT4A 1ZM3A 4URLA 2HK2A 2CPNA 5FLXC 1DI2A 2L2NA 4DR7I 4I3HA 4DR7E 1UHZA 4AQYE 4UT4A 2L33A 1XNRI 2L3CA 1XNRE 4JI8E 2B7VA 3T1HI 1IBMI 4WUDA 2L2KB 2E5LI 1IBME 4LFBI 3PYFA 4LFBE 1H7SA 2RS7A 1HNZI 3ADGA 3ADJA 1HNZE 1Z0WA 4DR3I 4DUZE 4LF6E 1FWKA 3LPSA 1WHNA 1X47A 2DEIA 2RSMA 4JI3I 1K47A 3J81Q 4DR6I 4JI4E 2LBSB 3T1YE 2GS8A 2CZ9A 4X66I 4JI5I 4X8WA 4FWDA 5LMNI 1ZXNA 1QU6A 5LMNE 4DU7A 1PVGA 3WU5A 4HACB 2LJHA 4YY3E 4M2ZA 4JI0I 1FJGI 4JI0E 3HTXA 4LF4I 2NPFA 4XTJA 4B3RI 3ZKDA 4B3TI 3WU3A 1B63A 1N0VC 4DR1I 4X64I 4DR1E 3WU4A 2BM0A 1IBKE 5IWAE 5GMEA 2UUBI 4PRXA 2UUBE 2L2MA 3QT7A 3QT5A 4DUYE 3J80Q 2V8PA 2B3TB 5LMUI 5A2QC 5LMUE 4HYMA 2DB2A 2X7IA 4UTGA 3B8HA 2A2CA 3PYEA 4JYAI 2JVAA 5IT9C 1RQ0A 1RC7A 3VYYA 1Z5BA 1YYKA 4P7AA 4KHPI 4LFCI 1HNXI 2UXBI 2UXBE 1ZM2A 4DPXA 2BM1A 2HHHI 4JG4A 2HHHE 1J5EI 1HNWI 2UU9I 2UU9E 3C4TA 1Z0GA 1ZXMA 1XMOE 2V2ZA 2Q2EB 3ADLA 4NXMI 3PYGA 2LUQA 4JI6E 1EI1A 2XEXA 3J7AM 2J7KA 2UUCI 4X65I 3WU6A 4X65E 3J81C 1FKAE 1XMQI 1FI4A 1STUA 1FWLA 3T1HE 1U2RA 1NHJA 2E5LE 2VQFI 2RTXA 3GONA 3OTOI 3OTOE 4DR3E 3V2UC 4HXZA 3HULA 4JI3E 1UEKA 4DV5I 2LTRA 3LTOA 4DR6E 1N36I 4B3MI 4JI2I 4B3ME 1T4NA 1EA6A 4X66E 1KKHA 4JI5E 4DR4I 1XNQI 2NUFA 2LTSA 1S4EA 4LF7I 3J80C 1Z0BA 1FJGE 1KTVA 3F0NA 4LF4E 4B3RE 2A2DA 4R1FA 4DR5I 4PU9A 4B3TE 4DR5E 4X62I 4GKJI 4GKJE 4X64E 1BKNA 5L3JA 3LLHA 3ADIA 2WW4A 2MDRA 4FN5A 4WUBA 4MYTA 5CFFE 4LFAI 4LF5I 4DV4I 2B7TA 4DV4E 3M6AA 1DARA 1T4LB 1RR9A 1NZ0A 4USKA 4JI1I 1Z0TA 4DV0I 4JI1E 4JYAE 4FW9A
chains in the Genus database with same CATH superfamily
1ZM9A 4BMJA 4ED4A 3VYXA 5JEAA 2F4VI 4B3SI 2EZ6A 5KL6A 4M1KA 3PS3A 5ADZA 2YRMA 1YYOA 4DPWA 5C0XA 1IQOA 4OO1C 1BBOA 1P47A 2YTOA 2JWOA 4FW6A 2X36A 1UBDC 1LLMC 4KHPE 1A6FA 3H09A 2GQ0A 2VF3A 1B62A 4MLQA 1EH7A 4L8NA 1HNXE 4LFCE 2YTFA 4FWHA 3EPHA 4Z7CA 5JEAB 3UK3C 1H73A 2EJ4A 1XHKA 1ZBTA 1N34I 4P52A 5C0XB 4WUCA 5F3WA 1GQEA 5A6JA 3MSWA 3B4TA 4R2AA 2FV4B 4DMIA 1Y4UA 1N32I 1R6MA 4BHCA 5C0XD 1N32E 1J5EE 4MQYA 1PDAA 2ENAA 4L5NC 5AE3A 1HNWE 1MG7A 2ZBKB 2E1MA 2LE2A 3CDJA 1A1HA 2KOUA 4GKKI 2DLQA 2K7IA 5AC5A 1PIEA 4DU8A 4MU1A 3KWRA 1I94I 4MU0A 3QT6A 2LO3A 4WYQB 1I94E 1QZRA 1O0WA 4Q35B 1JK1A 1X5WA 2NA2A 4R8OA 1MU5A 3J7AG 2KHXA 4Q28A 1ELOA 2WNRA 3D4JA 3KZYA 3EPLA 1VI7A 3ZZUA 2ZM6E 2ZM6I 2MKDA 5DNLA 4OO1A 3OMLA 3UHMA 2EOSA 4K0KI 3P1XA 3K1JA 1E3PA 4K0KE 2V89A 4NXME 1DGCA 2Q8UA 2EPKX 1OYSA 2DSYA 2YU5A 3M99B 4LF9I 2GHFA 2EFGA 3B78A 4DPYA 2HFSA 1UN6B 2HFUA 3LMLA 3AUZA 1X48A 1B69A 2EPCA 2WNRB 1XXEA 1T38A 4OO1B 1VISA 2OI2A 2UXCI 2EOZA 2UUCE 2UXCE 2BR2A 3EPKA 2EOJA 4FW4A 5T6JA 4YHHI 4LPFA 3LNUA 1HR0I 2DLKA 1XMQE 1Z0VA 1HR0E 1RREA 2WP8A 4DV3I 4OO1D 2EM2A 2YTDA 2JPAA 3KRNA 2E1RA 4LF8I 2DRPA 1OJ4A 2V83A 2VE7C 4QNKA 1Z59A 3HXLA 2VQFE 1TN9A 2AJ4A 1J26A 5DNYA 3THNA 4R2DA 4JI7I 2BR2B 1RHYA 4JI7E 4R2QA 4KQVA 2DMYA 3JAMQ 2PNZA 3PS2A 4AQYI 4IZJD 2WP8B 4OZEA 2LUPB 2L6MA 1E3HA 2O1TA 3U1YA 1UILA 2ZITA 3B82A 2I9IA 4N4RB 2ENCA 4JI8I 4DV5E 4M30A 4J3DA 4PRVA 4OX9I 2JT2A 4OX9E 1Y4SA 4FW3A 2BB8A 1N36E 1YUIA 4LU9A 4JI2E 2EPXA 1WHQA 2HGHA 2R3VA 2EOIA 4BC7A 4O43A 4RPFA 2PNZB 4DV6I 2DEJA 4MYUA 3HQ1A 2EQ3A 4FWGA 4DV6E 2FGGA 2I13A 4DR4E 3FIGA 4P78A 2LT7A 1XNQE 4BA1A 5FLXQ 4AM3A 3ZZTA 1D6TA 5IV8B 1YZ9A 2CG9A 4DUZI 2DMIA 4LF6I 2EM6A 2VF1A 3HKMA 2EOOA 1KVKA 1PKPA 4LF7E 1Y60A 4IJDA 3KZZA 1A1GA 2DIXA 2C39A 4EMDA 4DR2I 2EPNA 1H72C 2EE8A 4DR2E 2V85A 4MDTA 4JI4I 4HACA 2EN7A 3CDIA 4M0VA 3T1YI 4USMA 2EM4A 1S16A 2F1DA 4BA1B 4DPUA 2JY9A 3K17A 4DPTA 2EOXA 4X62E 2Z5CA 2EM5A 1Z5CA 2MKNA 2C38A 5A6AA 2C39B 2UXDI 1X49A 1SFEA 4R2RA 4MU4A 2UXDE 4ZYHA 4HY1A 1X6HA 2EM3A 2CSHA 2BV3A 4ZYGA 4YY3I 2N3HA 4BHBA 3Q6NA 2PO1A 1PJQA 5BR8I 2EMGA 4IFDB 1Z0CA 4LFAE 5BR8E 2Z5CB 4DV7I 4LF5E 2YSPA 4DV7E 5DROA 5A6KA 3P3GA 4Z7YA 2WBUA 2EMLA 5AC4A 3IWCA 3BF2A 4DV0E 3MHHC 2YRKA 1H74A 4DV1I 2EMXA 2YRHA 4TUGA 4DV1E 1IBKI 1PJSA 3PS1A 5IWAI 2IERA 2VQEI 2Z5EA 3ZM7A 5KL3A 5GMDA 2F4VE 2VQEE 4B3SE 2ELYA 5KL7A 4ZYDA 4X9JA 3V5RA 2RS6A 4DUYI 3ZKBA 1A1LA 2BA1D 1N0UA 1AH5A 5DRQA 2UUAI 5LL6R 5KL4A 2UUAE 3ZZ0A 1IBLI 1Z0EA 1IBLE 2L3JA 2YTPA 2K4VA 3EPJA 4FW7A 1MX0A 1Z5AA 4ZVIA 1P42A 2EL5A 3C4BA 3VK6A 2LJUA 2JEBA 1N33I 4OOGC 2YTNA 2J7JA 1N34E 1N33E 1FNMA 3CWVA 2EMYA 5KL5A 1NHIA 2EM0A 1QNTA 2N3GA 2MDGA 1WUUA 3Q1QA 1X6EA 3M7ND 1T4OA 2EM7A 2YTGA 2M9AA 2IOPA 2V2VA 1L4SA 1EH8A 4GKKE 5A2QQ 1RMDA 1H7UA 2LRSA 4KZSA 4AIDA 2EM8A 4DV2I 2EMKA 4DV2E 4NXNI 1WRJA 4NXNE 3GLLA 2EOFA 5FWKA 2EMBA 2HJJA 3HPZA 2EOYA 1EKZA 5IT9Q 2V87A 2VRDA 2YPNA 2HKJA 2V34A 3H4LA 1GTKA 2O1WA 2HKEA 4LF9E 3QT8A 3P3CA 1YYWA 3JAMC 3IWBA 3J7Yp 2GLIA 2HK3A 2VESA 2NUEA 4DXLA 4IZJA 2V2QA 2C37A 5A6BA 4JV5I 2NUGA 1USVA 1N3GA 4JV5E 2WBSA 2R42A 2CT1A 2IHR1 1ZM4A 1KIJA 2JXPA 2PNMA 4YHHE 4DKKA 1XMOI 4LOMA 2O1UA 2LJPA 5EL9A 2FTXB 2JOXA 3AV0A 4DV3E 4WFTA 4R2CA 4JI6I 4BA2A 4LF8E 1NHHA 3PYDA 1KJKA 2LMZA 3Q6MA 2YT4A 4IZJB 1ZM3A 2C37B 2CGEA 3ZOQB 2HK2A 2CPNA 5FLXC 2M4IA 4F9BB 4URLA 2EL6A 1DI2A 2L2NA 4DR7I 4I3HA 4DR7E 1UHZA 4RHBB 5A6BD 2A25A 4AQYE 4F54A 3ECRA 1A1JA 1G2FC 4F9AB 4UT4A 5ELWA 4N3OA 4BC9A 4LCFA 2EMCA 2L33A 3GCMA 4BA2B 1XNRI 2L3CA 2JR1A 2KONA 4LCHA 1XNRE 3M85G 4JI8E 2B7VA 2R1FA 5AE1A 2HC5A 2PO0A 3DF6A 4WX9A 3T1HI 1IBMI 1USUA 4WUDA 2L2KB 3P3EA 2RQLA 1IBME 2E5LI 2EN3A 4O4KA 4LFBI 3PRYA 3PYFA 4LFBE 3P76A 3TQMA 1H7SA 2RS7A 1HNZI 2ADRA 3ADGA 3ADJA 2WBTA 1HNZE 2RSIA 2EPUA 1Z0WA 3MHSC 4DR3I 2JYAA 4DUZE 4LF6E 1FWKA 4WSGA 3LPSA 1WHNA 1X47A 2DEIA 2M7QA 2RSMA 4JI3I 2PO0B 2F8BA 3GMEA 2EMWA 1K47A 1NCSA 4ISAA 2PO2A 3J81Q 4DR6I 4BS9A 4JI4E 4I8OA 2LBSB 3T1YE 2GS8A 1YUJA 3BIDA 1TF6A 2CZ9A 4X66I 4F9CB 4AIMA 2NABA 4JI5I 1WXRA 4MU3A 4X8WA 4FWDA 3EQ1A 2EN1A 1ZXNA 5LMNI 1QU6A 5LMNE 3K85A 2EMAA 4DU7A 1PVGA 3RMPA 3IWDA 4FW5A 2BA0G 2JOBA 2PO2B 4HACB 2LJHA 3JTZA 4O24A 3WU5A 4YY3E 4M2ZA 1X3CA 4JI0I 1FJGI 4JI0E 3HTXA 4LTYA 4LF4I 4F6NA 2NPFA 1Y6ZA 4XTJA 4B3RI 3ZKDA 2C38B 2LCEA 4B3TI 3WU3A 4U3DA 5K36E 1B63A 3K6QA 1N0VC 4DR1I 4X64I 2EQ0A 2YZTA 4DR1E 3WU4A 2BM0A 1OYRA 1IBKE 5EKWA 2PO1B 5IWAE 5GMEA 2UUBI 2R76A 4PRXA 2UUBE 2L2MA 3DD6A 3QT7A 3QT5A 4DUYE 2EL4A 1UDQA 3J80Q 2V8PA 2B3TB 5LMUI 5A2QC 2ELZA 4M9VC 3M7NG 5LMUE 4HYMA 4U3BA 2DB2A 5JEAF 2X7IA 1DQ3A 1Y5YA 2EQ1A 3C6MA 4UTGA 3B8HA 2A2CA 2EPRA 3PYEA 4JYAI 2N8XA 2EP3A 2GO4A 2EPOA 2JVAA 4R2SA 5IT9C 5LLQA 1YSAC 2ODRC 1RQ0A 5DRRA 1R6LA 1UDSA 1RC7A 2M1SA 3VYYA 2V88A 1Z5BA 2J65A 1YYKA 2EPPA 3H1CA 5K36C 3DJWA 4F6MA 4P7AA 2JEBB 1IQSA 4KHPI 5AASA 3JU0A 2E72A 2BA0D 4NZVA 2JE6A 4LFCI 3THOB 5A69A 1HNXI 2EOEA 1BB8A 2UXBI 2MC6A 2YSOA 1UDNA 2UXBE 1ZM2A 2PNLA 1OYPA 4DPXA 2LV2A 2WZOA 3BBGA 4LCGA 3P06A 1F2IG 2BM1A 2G7HA 5JEAD 2HHHI 3HJCA 4JG4A 3L7ZA 2HHHE 2NN6E 3NZKA 1J5EI 4WSPA 1YHCA 1HNWI 2UU9I 2CVEA 1A1FA 2AE8A 4WPYA 2JE6B 2UU9E 3C4TA 2Z5BA 1A1IA 1Z0GA 4OO1F 2EPZA 1IMUA 1NEIA 5K36F 1ZXMA 2WCC3 4IZKA 4IFDE 3L7ZB 2EPLX 4NBQA 2RPCA 4R03A 2PRTA 1EH6A 1XMOE 2EM9A 2Z5BB 2V2ZA 4R2EA 2Q2EB 2YWQA 3ADLA 5K36A 4NXMI 5AE2A 3PYGA 2LUQA 4JI6E 2IESA 1EI1A 2XEXA 2MC5A 4IZKB 4IS1C 2J7KA 3J7AM 2ENHA 2GPIA 3L00A 1MGTA 2EMFA 2L8TA 2UUCI 4X65I 1ZBQA 3BGHA 4IS9A 3WU6A 4GQUA 5KL2A 4WXCA 4X65E 2ODRD 3J81C 2NN6C 1FKAE 5DNXA 1XMQI 1A1KA 1HK7A 2YU8A 1FI4A 2JEAA 4BBYA 5JEAE 4TUIA 4RH8A 1STUA 3F6HA 3T1HE 1FWLA 1U2RA 5K36D 1TF3A 5C0XE 1NHJA 2E5LE 2VQFI 5TSEA 1X6FA 2EPAA 2V86A 3QG5C 2RTXA 4J8ZA 2EN8A 3U1KA 3GONA 2EOMA 4IFDC 2EOHA 1YPNA 4NHRA 3OTOI 2JEAB 1G2DC 3OTOE 4DR3E 4QNJA 2BBGA 3V2UC 4HEIA 4HXZA 3HULA 1ZU1A 2DGCA 4JI3E 3VHTB 1UEKA 4DV5I 1ZR9A 2LTRA 3LTOA 4DR6E 1WJPA 1N36I 4B3MI 1GZ6A 2B9DA 4B3ME 1T4NA 5IXMB 4JI2I 2EN4A 1EA6A 2NN6F 4X66E 4F2JC 1KYQA 1KKHA 2EORA 4JI5E 2BA1G 4DR4I 1XNQI 2NUFA 2LTSA 2EWLA 2GO3A 4P7DA 4OKGA 1S4EA 2NN6A 4MLVA 4LF7I 2EPMX 3HPSA 4FK5C 3J80C 1Z0BA 2EMIA 2EMHA 5JEAC 1FJGE 1KTVA 3F0NA 4IFDF 2H36X 4BCAA 4LF4E 4WXDA 5C0XC 2YTQA 4KWYA 4OO1E 4B3RE 1JK2A 2CTDA 2A2DA 4R1FA 4DR5I 2LVHA 4PU9A 1Z1BA 4DR5E 2YTIA 4HTGA 2JP9A 4B3TE 4X62I 4GKJI 4IFDA 3C6KA 2EN6A 4GKJE 2YTEA 4X64E 1YFHA 2NN6B 3M85D 1ZAAC 1UDOA 1BKNA 5L3JA 5K36B 1BBGA 3F6GA 3LLHA 2YTJA 2O3ZA 2D9HA 2NN6D 4GZNC 2EN2A 3ADIA 2WW4A 2MDRA 4FN5A 1PJTA 2EMZA 4ZYEA 4WUBA 4MYTA 2O1VA 5CFFE 4LFAI 1YH8A 4DV4I 4LF5I 2B7TA 2IOQA 4DV4E 1T39A 2V8QB 2EOQA 1SR9A 1T4LB 1DARA 3M6AA 1RR9A 1NZ0A 1AAYA 4USKA 4IFDD 4JI1I 1Z0TA 5C0XF 1MEYC 4DV0I 5DRPA 4JI1E 4GEQB 2L92A 4R2PA 4JYAE 4O5GA 4FW9A
chains in the Genus database with same CATH topology
1ZM9A 4BMJA 4ED4A 3VYXA 2F4VI 4B3SI 2EZ6A 4M1KA 5ADZA 1YYOA 4DPWA 2JWOA 2X36A 1A6FA 4KHPE 3H09A 2GQ0A 2VF3A 1B62A 4L8NA 1HNXE 4LFCE 4FWHA 4Z7CA 1H73A 1XHKA 1ZBTA 1N34I 4P52A 4WUCA 5F3WA 1GQEA 3MSWA 2FV4B 4DMIA 1Y4UA 1N32I 1N32E 1J5EE 2ZBKB 1MG7A 4L5NC 1HNWE 5AE3A 2E1MA 2LE2A 2KOUA 4GKKI 1PIEA 4DU8A 3KWRA 1I94I 3QT6A 4WYQB 1I94E 1QZRA 1O0WA 2NA2A 4R8OA 1MU5A 3J7AG 2KHXA 4Q28A 1ELOA 3D4JA 3ZZUA 2ZM6I 2ZM6E 3OMLA 4K0KI 3P1XA 3K1JA 4K0KE 2V89A 4NXME 2DSYA 4LF9I 2EFGA 3B78A 4DPYA 2HFSA 2HFUA 3LMLA 3AUZA 1X48A 1VISA 2OI2A 2UXCI 2UUCE 2UXCE 4YHHI 5T6JA 3LNUA 1HR0I 1XMQE 1Z0VA 1HR0E 1RREA 4DV3I 2E1RA 4LF8I 1OJ4A 2V83A 2VE7C 1Z59A 3HXLA 2VQFE 2AJ4A 1J26A 5DNYA 4JI7I 4JI7E 4KQVA 2DMYA 3JAMQ 4AQYI 4IZJD 2LUPB 2L6MA 2O1TA 1UILA 2ZITA 3B82A 4JI8I 4DV5E 4M30A 4OX9I 4PRVA 4OX9E 1Y4SA 1N36E 4LU9A 4JI2E 1WHQA 2R3VA 4BC7A 4RPFA 4DV6I 2DEJA 4MYUA 3HQ1A 4FWGA 4DV6E 2FGGA 4DR4E 5FLXQ 3FIGA 4P78A 1XNQE 1D6TA 3ZZTA 1YZ9A 2CG9A 4DUZI 4LF6I 2VF1A 1KVKA 1PKPA 4LF7E 2DIXA 4EMDA 4DR2I 1H72C 4DR2E 2V85A 4JI4I 4HACA 4M0VA 3T1YI 4USMA 1S16A 4DPUA 2JY9A 3K17A 4DPTA 4X62E 2Z5CA 1Z5CA 2UXDI 1X49A 2UXDE 4HY1A 2BV3A 4YY3I 2N3HA 3Q6NA 5BR8I 1Z0CA 4LFAE 5BR8E 2Z5CB 4DV7I 4LF5E 4DV7E 4Z7YA 3IWCA 4DV0E 1H74A 4DV1I 4TUGA 4DV1E 1IBKI 5IWAI 2VQEI 2Z5EA 3ZM7A 5GMDA 2F4VE 2VQEE 4B3SE 3V5RA 2RS6A 4DUYI 3ZKBA 1N0UA 2UUAI 5LL6R 2UUAE 3ZZ0A 1IBLI 1Z0EA 1IBLE 2L3JA 2K4VA 1MX0A 1Z5AA 4ZVIA 3C4BA 3VK6A 1N33I 4OOGC 1N34E 1N33E 1FNMA 3CWVA 1NHIA 2N3GA 1WUUA 3Q1QA 1T4OA 2IOPA 2V2VA 4GKKE 5A2QQ 1H7UA 2LRSA 4KZSA 4DV2I 4DV2E 4NXNI 4NXNE 5FWKA 3HPZA 5IT9Q 1EKZA 2V87A 2HKJA 2V34A 3H4LA 2O1WA 2HKEA 4LF9E 3QT8A 1YYWA 3JAMC 3IWBA 3J7Yp 2HK3A 2NUEA 4DXLA 4IZJA 2V2QA 4JV5I 2NUGA 1USVA 4JV5E 2R42A 2IHR1 1ZM4A 1KIJA 2PNMA 4YHHE 4DKKA 1XMOI 2O1UA 2LJPA 2FTXB 2JOXA 3AV0A 4DV3E 4WFTA 4JI6I 4LF8E 1NHHA 3PYDA 2LMZA 3Q6MA 2YT4A 4IZJB 1ZM3A 4URLA 2CGEA 3ZOQB 2HK2A 2CPNA 5FLXC 2M4IA 4F9BB 1DI2A 2L2NA 4DR7I 4I3HA 4DR7E 1UHZA 4AQYE 4F54A 4UT4A 4F9AB 4N3OA 4BC9A 2L33A 1XNRI 2L3CA 2JR1A 2KONA 1XNRE 4JI8E 2B7VA 5AE1A 3T1HI 3DF6A 1IBMI 1USUA 4WUDA 2L2KB 2E5LI 1IBME 4LFBI 3PRYA 3PYFA 4LFBE 1H7SA 2RS7A 1HNZI 3ADGA 3ADJA 1HNZE 1Z0WA 4DR3I 4DUZE 4LF6E 1FWKA 3LPSA 1WHNA 1X47A 2DEIA 2M7QA 2RSMA 4JI3I 2F8BA 1K47A 3J81Q 4DR6I 4BS9A 4JI4E 4I8OA 2LBSB 3T1YE 2GS8A 2CZ9A 4X66I 4F9CB 4JI5I 1WXRA 4X8WA 4FWDA 5LMNI 1ZXNA 1QU6A 5LMNE 3K85A 4DU7A 1PVGA 3RMPA 3IWDA 2JOBA 3WU5A 4HACB 2LJHA 3JTZA 4YY3E 4M2ZA 4JI0I 1FJGI 4JI0E 3HTXA 4LTYA 4LF4I 2NPFA 1Y6ZA 4XTJA 4B3RI 3ZKDA 4B3TI 3WU3A 1B63A 3K6QA 1N0VC 4DR1I 4X64I 4DR1E 2YZTA 3WU4A 2BM0A 1IBKE 5IWAE 5GMEA 2UUBI 4PRXA 2UUBE 2L2MA 3QT7A 3QT5A 4DUYE 3J80Q 2V8PA 2B3TB 5LMUI 5A2QC 5LMUE 4HYMA 2DB2A 2X7IA 1DQ3A 4UTGA 3B8HA 2A2CA 3PYEA 4JYAI 2JVAA 5IT9C 2ODRC 1RQ0A 1RC7A 2M1SA 3VYYA 2V88A 1Z5BA 1YYKA 3DJWA 4P7AA 4KHPI 5AASA 3JU0A 4LFCI 1HNXI 2UXBI 2MC6A 2PNLA 2UXBE 1ZM2A 4DPXA 2WZOA 3P06A 2BM1A 2G7HA 2HHHI 3HJCA 4JG4A 2HHHE 1J5EI 4WSPA 1HNWI 2UU9I 4WPYA 2UU9E 3C4TA 2Z5BA 1Z0GA 1ZXMA 4IZKA 4R03A 1XMOE 2Z5BB 2V2ZA 2Q2EB 3ADLA 4NXMI 5AE2A 3PYGA 2LUQA 4JI6E 1EI1A 2XEXA 2MC5A 4IZKB 3J7AM 2J7KA 2L8TA 2UUCI 4X65I 1ZBQA 3WU6A 4X65E 2ODRD 3J81C 1FKAE 1XMQI 1HK7A 1FI4A 4BBYA 4TUIA 1STUA 3F6HA 3T1HE 1FWLA 1U2RA 1NHJA 2E5LE 2VQFI 2V86A 2RTXA 4J8ZA 3GONA 3OTOI 3OTOE 4DR3E 3V2UC 4HXZA 3HULA 4JI3E 1UEKA 4DV5I 2LTRA 3LTOA 4DR6E 1N36I 4B3MI 1GZ6A 2B9DA 4B3ME 1T4NA 4JI2I 1EA6A 4X66E 1KKHA 4JI5E 4DR4I 1XNQI 2NUFA 2LTSA 2EWLA 4P7DA 1S4EA 4LF7I 3HPSA 3J80C 1Z0BA 1FJGE 1KTVA 3F0NA 2H36X 4BCAA 4LF4E 4B3RE 2A2DA 4R1FA 4DR5I 4PU9A 4B3TE 4DR5E 4X62I 4GKJI 4GKJE 4X64E 1BKNA 5L3JA 3F6GA 3LLHA 3ADIA 2WW4A 2MDRA 4FN5A 4WUBA 4MYTA 2O1VA 5CFFE 4LFAI 4LF5I 4DV4I 2B7TA 2IOQA 4DV4E 2V8QB 1DARA 1SR9A 1T4LB 3M6AA 1RR9A 1NZ0A 4USKA 4JI1I 1Z0TA 4DV0I 4JI1E 4GEQB 2L92A 4JYAE 4FW9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ZM9 A;  4ED4 A;  3VYX A;  2F4V I;  4B3S I;  2EZ6 A;  4M1K A;  1YYO A;  4DPW A;  2X36 A;  1A6F A;  4KHP E;  2VF3 A;  1B62 A;  1HNX E;  4LFC E;  4FWH A;  4Z7C A;  1H73 A;  1XHK A;  1ZBT A;  1N34 I;  4P52 A;  4WUC A;  1GQE A;  1N32 I;  1N32 E;  1J5E E;  2ZBK B;  1MG7 A;  1HNW E;  4GKK I;  1PIE A;  4DU8 A;  1I94 I;  3QT6 A;  4WYQ B;  1I94 E;  1QZR A;  1O0W A;  2NA2 A;  1MU5 A;  3J7A G;  2KHX A;  1ELO A;  3D4J A;  2ZM6 I;  3ZZU A;  2ZM6 E;  4K0K I;  3P1X A;  3K1J A;  4K0K E;  4NXM E;  4LF9 I;  2EFG A;  3B78 A;  4DPY A;  2HFS A;  2HFU A;  1X48 A;  1VIS A;  2OI2 A;  2UXC I;  2UUC E;  2UXC E;  4YHH I;  3LNU A;  1HR0 I;  1XMQ E;  1Z0V A;  1HR0 E;  1RRE A;  4DV3 I;  2E1R A;  4LF8 I;  1OJ4 A;  1Z59 A;  2VQF E;  2AJ4 A;  1J26 A;  4JI7 I;  4JI7 E;  4KQV A;  2DMY A;  3JAM Q;  4AQY I;  2LUP B;  1UIL A;  2ZIT A;  3B82 A;  4JI8 I;  4DV5 E;  4M30 A;  4OX9 I;  4PRV A;  4OX9 E;  1N36 E;  4JI2 E;  1WHQ A;  2R3V A;  4RPF A;  4DV6 I;  2DEJ A;  4MYU A;  4FWG A;  4DV6 E;  4DR4 E;  5FLX Q;  1D6T A;  1XNQ E;  3ZZT A;  1YZ9 A;  4DUZ I;  4LF6 I;  1KVK A;  1PKP A;  4LF7 E;  2DIX A;  4EMD A;  4DR2 I;  1H72 C;  4DR2 E;  4JI4 I;  4HAC A;  3T1Y I;  4USM A;  1S16 A;  4DPU A;  2JY9 A;  3K17 A;  4DPT A;  4X62 E;  1Z5C A;  2UXD I;  1X49 A;  2UXD E;  4HY1 A;  2BV3 A;  4YY3 I;  2N3H A;  5BR8 I;  1Z0C A;  4LFA E;  5BR8 E;  4DV7 I;  4LF5 E;  4DV7 E;  4Z7Y A;  4DV0 E;  1H74 A;  4DV1 I;  4DV1 E;  1IBK I;  5IWA I;  2VQE I;  3ZM7 A;  5GMD A;  2F4V E;  2VQE E;  4B3S E;  3V5R A;  2RS6 A;  4DUY I;  3ZKB A;  1N0U A;  2UUA I;  5LL6 R;  2UUA E;  3ZZ0 A;  1IBL I;  1Z0E A;  1IBL E;  2L3J A;  1MX0 A;  1Z5A A;  4ZVI A;  3C4B A;  1N33 I;  4OOG C;  1N34 E;  1N33 E;  1FNM A;  3CWV A;  1NHI A;  2N3G A;  1WUU A;  3Q1Q A;  1T4O A;  2V2V A;  4GKK E;  5A2Q Q;  1H7U A;  2LRS A;  4DV2 I;  4DV2 E;  4NXN I;  4NXN E;  5IT9 Q;  1EKZ A;  2HKJ A;  2V34 A;  3H4L A;  2HKE A;  4LF9 E;  3QT8 A;  1YYW A;  3JAM C;  3J7Y p;  2HK3 A;  2NUE A;  4DXL A;  2V2Q A;  4JV5 I;  2NUG A;  4JV5 E;  2R42 A;  2IHR 1;  1ZM4 A;  1KIJ A;  4YHH E;  4DKK A;  1XMO I;  2LJP A;  4DV3 E;  4WFT A;  4JI6 I;  4LF8 E;  1NHH A;  3PYD A;  2YT4 A;  1ZM3 A;  4URL A;  2HK2 A;  2CPN A;  5FLX C;  1DI2 A;  2L2N A;  4DR7 I;  4I3H A;  4DR7 E;  1UHZ A;  4AQY E;  4UT4 A;  2L33 A;  1XNR I;  2L3C A;  1XNR E;  4JI8 E;  2B7V A;  3T1H I;  1IBM I;  4WUD A;  2L2K B;  2E5L I;  1IBM E;  4LFB I;  3PYF A;  4LFB E;  1H7S A;  2RS7 A;  1HNZ I;  3ADG A;  3ADJ A;  1HNZ E;  1Z0W A;  4DR3 I;  4DUZ E;  4LF6 E;  1FWK A;  3LPS A;  1WHN A;  1X47 A;  2DEI A;  2RSM A;  4JI3 I;  1K47 A;  3J81 Q;  4DR6 I;  4JI4 E;  2LBS B;  3T1Y E;  2GS8 A;  2CZ9 A;  4X66 I;  4JI5 I;  4X8W A;  4FWD A;  5LMN I;  1ZXN A;  1QU6 A;  5LMN E;  4DU7 A;  1PVG A;  3WU5 A;  4HAC B;  2LJH A;  4YY3 E;  4M2Z A;  4JI0 I;  1FJG I;  4JI0 E;  3HTX A;  4LF4 I;  2NPF A;  4XTJ A;  4B3R I;  3ZKD A;  4B3T I;  3WU3 A;  1B63 A;  1N0V C;  4DR1 I;  4X64 I;  4DR1 E;  3WU4 A;  2BM0 A;  1IBK E;  5IWA E;  5GME A;  2UUB I;  4PRX A;  2UUB E;  2L2M A;  3QT7 A;  3QT5 A;  4DUY E;  3J80 Q;  2V8P A;  2B3T B;  5LMU I;  5A2Q C;  5LMU E;  4HYM A;  2DB2 A;  2X7I A;  4UTG A;  3B8H A;  2A2C A;  3PYE A;  4JYA I;  2JVA A;  5IT9 C;  1RQ0 A;  1RC7 A;  3VYY A;  1Z5B A;  1YYK A;  4P7A A;  4KHP I;  4LFC I;  1HNX I;  2UXB I;  2UXB E;  1ZM2 A;  4DPX A;  2BM1 A;  2HHH I;  4JG4 A;  2HHH E;  1J5E I;  1HNW I;  2UU9 I;  2UU9 E;  3C4T A;  1Z0G A;  1ZXM A;  1XMO E;  2V2Z A;  2Q2E B;  3ADL A;  4NXM I;  3PYG A;  2LUQ A;  4JI6 E;  1EI1 A;  2XEX A;  3J7A M;  2J7K A;  2UUC I;  4X65 I;  3WU6 A;  4X65 E;  3J81 C;  1FKA E;  1XMQ I;  1FI4 A;  1STU A;  1FWL A;  3T1H E;  1U2R A;  1NHJ A;  2E5L E;  2VQF I;  2RTX A;  3GON A;  3OTO I;  3OTO E;  4DR3 E;  3V2U C;  4HXZ A;  3HUL A;  4JI3 E;  1UEK A;  4DV5 I;  2LTR A;  3LTO A;  4DR6 E;  1N36 I;  4B3M I;  4JI2 I;  4B3M E;  1T4N A;  1EA6 A;  4X66 E;  1KKH A;  4JI5 E;  4DR4 I;  1XNQ I;  2NUF A;  2LTS A;  1S4E A;  4LF7 I;  3J80 C;  1Z0B A;  1FJG E;  1KTV A;  3F0N A;  4LF4 E;  4B3R E;  2A2D A;  4R1F A;  4DR5 I;  4PU9 A;  4B3T E;  4DR5 E;  4X62 I;  4GKJ I;  4GKJ E;  4X64 E;  1BKN A;  5L3J A;  3LLH A;  3ADI A;  2WW4 A;  2MDR A;  4FN5 A;  4WUB A;  4MYT A;  5CFF E;  4LFA I;  4LF5 I;  4DV4 I;  2B7T A;  4DV4 E;  3M6A A;  1DAR A;  1T4L B;  1RR9 A;  1NZ0 A;  4USK A;  4JI1 I;  1Z0T A;  4DV0 I;  4JI1 E;  4JYA E;  4FW9 A; 
#chains in the Genus database with same CATH topology
 1ZM9 A;  4BMJ A;  4ED4 A;  3VYX A;  5JEA A;  2F4V I;  4B3S I;  2EZ6 A;  5KL6 A;  4M1K A;  3PS3 A;  5ADZ A;  2YRM A;  1YYO A;  4DPW A;  5C0X A;  1IQO A;  4OO1 C;  1BBO A;  1P47 A;  2YTO A;  2JWO A;  4FW6 A;  2X36 A;  1UBD C;  1LLM C;  4KHP E;  1A6F A;  3H09 A;  2GQ0 A;  2VF3 A;  1B62 A;  4MLQ A;  1EH7 A;  4L8N A;  1HNX E;  4LFC E;  2YTF A;  4FWH A;  3EPH A;  4Z7C A;  5JEA B;  3UK3 C;  1H73 A;  2EJ4 A;  1XHK A;  1ZBT A;  1N34 I;  4P52 A;  5C0X B;  4WUC A;  5F3W A;  1GQE A;  5A6J A;  3MSW A;  3B4T A;  4R2A A;  2FV4 B;  4DMI A;  1Y4U A;  1N32 I;  1R6M A;  4BHC A;  5C0X D;  1N32 E;  1J5E E;  4MQY A;  1PDA A;  2ENA A;  4L5N C;  5AE3 A;  1HNW E;  1MG7 A;  2ZBK B;  2E1M A;  2LE2 A;  3CDJ A;  1A1H A;  2KOU A;  4GKK I;  2DLQ A;  2K7I A;  5AC5 A;  1PIE A;  4DU8 A;  4MU1 A;  3KWR A;  1I94 I;  4MU0 A;  3QT6 A;  2LO3 A;  4WYQ B;  1I94 E;  1QZR A;  1O0W A;  4Q35 B;  1JK1 A;  1X5W A;  2NA2 A;  4R8O A;  1MU5 A;  3J7A G;  2KHX A;  4Q28 A;  1ELO A;  2WNR A;  3D4J A;  3KZY A;  3EPL A;  1VI7 A;  3ZZU A;  2ZM6 E;  2ZM6 I;  2MKD A;  5DNL A;  4OO1 A;  3OML A;  3UHM A;  2EOS A;  4K0K I;  3P1X A;  3K1J A;  1E3P A;  4K0K E;  2V89 A;  4NXM E;  1DGC A;  2Q8U A;  2EPK X;  1OYS A;  2DSY A;  2YU5 A;  3M99 B;  4LF9 I;  2GHF A;  2EFG A;  3B78 A;  4DPY A;  2HFS A;  1UN6 B;  2HFU A;  3LML A;  3AUZ A;  1X48 A;  1B69 A;  2EPC A;  2WNR B;  1XXE A;  1T38 A;  4OO1 B;  1VIS A;  2OI2 A;  2UXC I;  2EOZ A;  2UUC E;  2UXC E;  2BR2 A;  3EPK A;  2EOJ A;  4FW4 A;  5T6J A;  4YHH I;  4LPF A;  3LNU A;  1HR0 I;  2DLK A;  1XMQ E;  1Z0V A;  1HR0 E;  1RRE A;  2WP8 A;  4DV3 I;  4OO1 D;  2EM2 A;  2YTD A;  2JPA A;  3KRN A;  2E1R A;  4LF8 I;  2DRP A;  1OJ4 A;  2V83 A;  2VE7 C;  4QNK A;  1Z59 A;  3HXL A;  2VQF E;  1TN9 A;  2AJ4 A;  1J26 A;  5DNY A;  3THN A;  4R2D A;  4JI7 I;  2BR2 B;  1RHY A;  4JI7 E;  4R2Q A;  4KQV A;  2DMY A;  3JAM Q;  2PNZ A;  3PS2 A;  4AQY I;  4IZJ D;  2WP8 B;  4OZE A;  2LUP B;  2L6M A;  1E3H A;  2O1T A;  3U1Y A;  1UIL A;  2ZIT A;  3B82 A;  2I9I A;  4N4R B;  2ENC A;  4JI8 I;  4DV5 E;  4M30 A;  4J3D A;  4PRV A;  4OX9 I;  2JT2 A;  4OX9 E;  1Y4S A;  4FW3 A;  2BB8 A;  1N36 E;  1YUI A;  4LU9 A;  4JI2 E;  2EPX A;  1WHQ A;  2HGH A;  2R3V A;  2EOI A;  4BC7 A;  4O43 A;  4RPF A;  2PNZ B;  4DV6 I;  2DEJ A;  4MYU A;  3HQ1 A;  2EQ3 A;  4FWG A;  4DV6 E;  2FGG A;  2I13 A;  4DR4 E;  3FIG A;  4P78 A;  2LT7 A;  1XNQ E;  4BA1 A;  5FLX Q;  4AM3 A;  3ZZT A;  1D6T A;  5IV8 B;  1YZ9 A;  2CG9 A;  4DUZ I;  2DMI A;  4LF6 I;  2EM6 A;  2VF1 A;  3HKM A;  2EOO A;  1KVK A;  1PKP A;  4LF7 E;  1Y60 A;  4IJD A;  3KZZ A;  1A1G A;  2DIX A;  2C39 A;  4EMD A;  4DR2 I;  2EPN A;  1H72 C;  2EE8 A;  4DR2 E;  2V85 A;  4MDT A;  4JI4 I;  4HAC A;  2EN7 A;  3CDI A;  4M0V A;  3T1Y I;  4USM A;  2EM4 A;  1S16 A;  2F1D A;  4BA1 B;  4DPU A;  2JY9 A;  3K17 A;  4DPT A;  2EOX A;  4X62 E;  2Z5C A;  2EM5 A;  1Z5C A;  2MKN A;  2C38 A;  5A6A A;  2C39 B;  2UXD I;  1X49 A;  1SFE A;  4R2R A;  4MU4 A;  2UXD E;  4ZYH A;  4HY1 A;  1X6H A;  2EM3 A;  2CSH A;  2BV3 A;  4ZYG A;  4YY3 I;  2N3H A;  4BHB A;  3Q6N A;  2PO1 A;  1PJQ A;  5BR8 I;  2EMG A;  4IFD B;  1Z0C A;  4LFA E;  5BR8 E;  2Z5C B;  4DV7 I;  4LF5 E;  2YSP A;  4DV7 E;  5DRO A;  5A6K A;  3P3G A;  4Z7Y A;  2WBU A;  2EML A;  5AC4 A;  3IWC A;  3BF2 A;  4DV0 E;  3MHH C;  2YRK A;  1H74 A;  4DV1 I;  2EMX A;  2YRH A;  4TUG A;  4DV1 E;  1IBK I;  1PJS A;  3PS1 A;  5IWA I;  2IER A;  2VQE I;  2Z5E A;  3ZM7 A;  5KL3 A;  5GMD A;  2F4V E;  2VQE E;  4B3S E;  2ELY A;  5KL7 A;  4ZYD A;  4X9J A;  3V5R A;  2RS6 A;  4DUY I;  3ZKB A;  1A1L A;  2BA1 D;  1N0U A;  1AH5 A;  5DRQ A;  2UUA I;  5LL6 R;  5KL4 A;  2UUA E;  3ZZ0 A;  1IBL I;  1Z0E A;  1IBL E;  2L3J A;  2YTP A;  2K4V A;  3EPJ A;  4FW7 A;  1MX0 A;  1Z5A A;  4ZVI A;  1P42 A;  2EL5 A;  3C4B A;  3VK6 A;  2LJU A;  2JEB A;  1N33 I;  4OOG C;  2YTN A;  2J7J A;  1N34 E;  1N33 E;  1FNM A;  3CWV A;  2EMY A;  5KL5 A;  1NHI A;  2EM0 A;  1QNT A;  2N3G A;  2MDG A;  1WUU A;  3Q1Q A;  1X6E A;  3M7N D;  1T4O A;  2EM7 A;  2YTG A;  2M9A A;  2IOP A;  2V2V A;  1L4S A;  1EH8 A;  4GKK E;  5A2Q Q;  1RMD A;  1H7U A;  2LRS A;  4KZS A;  4AID A;  2EM8 A;  4DV2 I;  2EMK A;  4DV2 E;  4NXN I;  1WRJ A;  4NXN E;  3GLL A;  2EOF A;  5FWK A;  2EMB A;  2HJJ A;  3HPZ A;  2EOY A;  1EKZ A;  5IT9 Q;  2V87 A;  2VRD A;  2YPN A;  2HKJ A;  2V34 A;  3H4L A;  1GTK A;  2O1W A;  2HKE A;  4LF9 E;  3QT8 A;  3P3C A;  1YYW A;  3JAM C;  3IWB A;  3J7Y p;  2GLI A;  2HK3 A;  2VES A;  2NUE A;  4DXL A;  4IZJ A;  2V2Q A;  2C37 A;  5A6B A;  4JV5 I;  2NUG A;  1USV A;  1N3G A;  4JV5 E;  2WBS A;  2R42 A;  2CT1 A;  2IHR 1;  1ZM4 A;  1KIJ A;  2JXP A;  2PNM A;  4YHH E;  4DKK A;  1XMO I;  4LOM A;  2O1U A;  2LJP A;  5EL9 A;  2FTX B;  2JOX A;  3AV0 A;  4DV3 E;  4WFT A;  4R2C A;  4JI6 I;  4BA2 A;  4LF8 E;  1NHH A;  3PYD A;  1KJK A;  2LMZ A;  3Q6M A;  2YT4 A;  4IZJ B;  1ZM3 A;  2C37 B;  2CGE A;  3ZOQ B;  2HK2 A;  2CPN A;  5FLX C;  2M4I A;  4F9B B;  4URL A;  2EL6 A;  1DI2 A;  2L2N A;  4DR7 I;  4I3H A;  4DR7 E;  1UHZ A;  4RHB B;  5A6B D;  2A25 A;  4AQY E;  4F54 A;  3ECR A;  1A1J A;  1G2F C;  4F9A B;  4UT4 A;  5ELW A;  4N3O A;  4BC9 A;  4LCF A;  2EMC A;  2L33 A;  3GCM A;  4BA2 B;  1XNR I;  2L3C A;  2JR1 A;  2KON A;  4LCH A;  1XNR E;  3M85 G;  4JI8 E;  2B7V A;  2R1F A;  5AE1 A;  2HC5 A;  2PO0 A;  3DF6 A;  4WX9 A;  3T1H I;  1IBM I;  1USU A;  4WUD A;  2L2K B;  3P3E A;  2RQL A;  1IBM E;  2E5L I;  2EN3 A;  4O4K A;  4LFB I;  3PRY A;  3PYF A;  4LFB E;  3P76 A;  3TQM A;  1H7S A;  2RS7 A;  1HNZ I;  2ADR A;  3ADG A;  3ADJ A;  2WBT A;  1HNZ E;  2RSI A;  2EPU A;  1Z0W A;  3MHS C;  4DR3 I;  2JYA A;  4DUZ E;  4LF6 E;  1FWK A;  4WSG A;  3LPS A;  1WHN A;  1X47 A;  2DEI A;  2M7Q A;  2RSM A;  4JI3 I;  2PO0 B;  2F8B A;  3GME A;  2EMW A;  1K47 A;  1NCS A;  4ISA A;  2PO2 A;  3J81 Q;  4DR6 I;  4BS9 A;  4JI4 E;  4I8O A;  2LBS B;  3T1Y E;  2GS8 A;  1YUJ A;  3BID A;  1TF6 A;  2CZ9 A;  4X66 I;  4F9C B;  4AIM A;  2NAB A;  4JI5 I;  1WXR A;  4MU3 A;  4X8W A;  4FWD A;  3EQ1 A;  2EN1 A;  1ZXN A;  5LMN I;  1QU6 A;  5LMN E;  3K85 A;  2EMA A;  4DU7 A;  1PVG A;  3RMP A;  3IWD A;  4FW5 A;  2BA0 G;  2JOB A;  2PO2 B;  4HAC B;  2LJH A;  3JTZ A;  4O24 A;  3WU5 A;  4YY3 E;  4M2Z A;  1X3C A;  4JI0 I;  1FJG I;  4JI0 E;  3HTX A;  4LTY A;  4LF4 I;  4F6N A;  2NPF A;  1Y6Z A;  4XTJ A;  4B3R I;  3ZKD A;  2C38 B;  2LCE A;  4B3T I;  3WU3 A;  4U3D A;  5K36 E;  1B63 A;  3K6Q A;  1N0V C;  4DR1 I;  4X64 I;  2EQ0 A;  2YZT A;  4DR1 E;  3WU4 A;  2BM0 A;  1OYR A;  1IBK E;  5EKW A;  2PO1 B;  5IWA E;  5GME A;  2UUB I;  2R76 A;  4PRX A;  2UUB E;  2L2M A;  3DD6 A;  3QT7 A;  3QT5 A;  4DUY E;  2EL4 A;  1UDQ A;  3J80 Q;  2V8P A;  2B3T B;  5LMU I;  5A2Q C;  2ELZ A;  4M9V C;  3M7N G;  5LMU E;  4HYM A;  4U3B A;  2DB2 A;  5JEA F;  2X7I A;  1DQ3 A;  1Y5Y A;  2EQ1 A;  3C6M A;  4UTG A;  3B8H A;  2A2C A;  2EPR A;  3PYE A;  4JYA I;  2N8X A;  2EP3 A;  2GO4 A;  2EPO A;  2JVA A;  4R2S A;  5IT9 C;  5LLQ A;  1YSA C;  2ODR C;  1RQ0 A;  5DRR A;  1R6L A;  1UDS A;  1RC7 A;  2M1S A;  3VYY A;  2V88 A;  1Z5B A;  2J65 A;  1YYK A;  2EPP A;  3H1C A;  5K36 C;  3DJW A;  4F6M A;  4P7A A;  2JEB B;  1IQS A;  4KHP I;  5AAS A;  3JU0 A;  2E72 A;  2BA0 D;  4NZV A;  2JE6 A;  4LFC I;  3THO B;  5A69 A;  1HNX I;  2EOE A;  1BB8 A;  2UXB I;  2MC6 A;  2YSO A;  1UDN A;  2UXB E;  1ZM2 A;  2PNL A;  1OYP A;  4DPX A;  2LV2 A;  2WZO A;  3BBG A;  4LCG A;  3P06 A;  1F2I G;  2BM1 A;  2G7H A;  5JEA D;  2HHH I;  3HJC A;  4JG4 A;  3L7Z A;  2HHH E;  2NN6 E;  3NZK A;  1J5E I;  4WSP A;  1YHC A;  1HNW I;  2UU9 I;  2CVE A;  1A1F A;  2AE8 A;  4WPY A;  2JE6 B;  2UU9 E;  3C4T A;  2Z5B A;  1A1I A;  1Z0G A;  4OO1 F;  2EPZ A;  1IMU A;  1NEI A;  5K36 F;  1ZXM A;  2WCC 3;  4IZK A;  4IFD E;  3L7Z B;  2EPL X;  4NBQ A;  2RPC A;  4R03 A;  2PRT A;  1EH6 A;  1XMO E;  2EM9 A;  2Z5B B;  2V2Z A;  4R2E A;  2Q2E B;  2YWQ A;  3ADL A;  5K36 A;  4NXM I;  5AE2 A;  3PYG A;  2LUQ A;  4JI6 E;  2IES A;  1EI1 A;  2XEX A;  2MC5 A;  4IZK B;  4IS1 C;  2J7K A;  3J7A M;  2ENH A;  2GPI A;  3L00 A;  1MGT A;  2EMF A;  2L8T A;  2UUC I;  4X65 I;  1ZBQ A;  3BGH A;  4IS9 A;  3WU6 A;  4GQU A;  5KL2 A;  4WXC A;  4X65 E;  2ODR D;  3J81 C;  2NN6 C;  1FKA E;  5DNX A;  1XMQ I;  1A1K A;  1HK7 A;  2YU8 A;  1FI4 A;  2JEA A;  4BBY A;  5JEA E;  4TUI A;  4RH8 A;  1STU A;  3F6H A;  3T1H E;  1FWL A;  1U2R A;  5K36 D;  1TF3 A;  5C0X E;  1NHJ A;  2E5L E;  2VQF I;  5TSE A;  1X6F A;  2EPA A;  2V86 A;  3QG5 C;  2RTX A;  4J8Z A;  2EN8 A;  3U1K A;  3GON A;  2EOM A;  4IFD C;  2EOH A;  1YPN A;  4NHR A;  3OTO I;  2JEA B;  1G2D C;  3OTO E;  4DR3 E;  4QNJ A;  2BBG A;  3V2U C;  4HEI A;  4HXZ A;  3HUL A;  1ZU1 A;  2DGC A;  4JI3 E;  3VHT B;  1UEK A;  4DV5 I;  1ZR9 A;  2LTR A;  3LTO A;  4DR6 E;  1WJP A;  1N36 I;  4B3M I;  1GZ6 A;  2B9D A;  4B3M E;  1T4N A;  5IXM B;  4JI2 I;  2EN4 A;  1EA6 A;  2NN6 F;  4X66 E;  4F2J C;  1KYQ A;  1KKH A;  2EOR A;  4JI5 E;  2BA1 G;  4DR4 I;  1XNQ I;  2NUF A;  2LTS A;  2EWL A;  2GO3 A;  4P7D A;  4OKG A;  1S4E A;  2NN6 A;  4MLV A;  4LF7 I;  2EPM X;  3HPS A;  4FK5 C;  3J80 C;  1Z0B A;  2EMI A;  2EMH A;  5JEA C;  1FJG E;  1KTV A;  3F0N A;  4IFD F;  2H36 X;  4BCA A;  4LF4 E;  4WXD A;  5C0X C;  2YTQ A;  4KWY A;  4OO1 E;  4B3R E;  1JK2 A;  2CTD A;  2A2D A;  4R1F A;  4DR5 I;  2LVH A;  4PU9 A;  1Z1B A;  4DR5 E;  2YTI A;  4HTG A;  2JP9 A;  4B3T E;  4X62 I;  4GKJ I;  4IFD A;  3C6K A;  2EN6 A;  4GKJ E;  2YTE A;  4X64 E;  1YFH A;  2NN6 B;  3M85 D;  1ZAA C;  1UDO A;  1BKN A;  5L3J A;  5K36 B;  1BBG A;  3F6G A;  3LLH A;  2YTJ A;  2O3Z A;  2D9H A;  2NN6 D;  4GZN C;  2EN2 A;  3ADI A;  2WW4 A;  2MDR A;  4FN5 A;  1PJT A;  2EMZ A;  4ZYE A;  4WUB A;  4MYT A;  2O1V A;  5CFF E;  4LFA I;  1YH8 A;  4DV4 I;  4LF5 I;  2B7T A;  2IOQ A;  4DV4 E;  1T39 A;  2V8Q B;  2EOQ A;  1SR9 A;  1T4L B;  1DAR A;  3M6A A;  1RR9 A;  1NZ0 A;  1AAY A;  4USK A;  4IFD D;  4JI1 I;  1Z0T A;  5C0X F;  1MEY C;  4DV0 I;  5DRP A;  4JI1 E;  4GEQ B;  2L92 A;  4R2P A;  4JYA E;  4O5G A;  4FW9 A; 
#chains in the Genus database with same CATH homology
 1ZM9 A;  4BMJ A;  4ED4 A;  3VYX A;  2F4V I;  4B3S I;  2EZ6 A;  4M1K A;  5ADZ A;  1YYO A;  4DPW A;  2JWO A;  2X36 A;  1A6F A;  4KHP E;  3H09 A;  2GQ0 A;  2VF3 A;  1B62 A;  4L8N A;  1HNX E;  4LFC E;  4FWH A;  4Z7C A;  1H73 A;  1XHK A;  1ZBT A;  1N34 I;  4P52 A;  4WUC A;  5F3W A;  1GQE A;  3MSW A;  2FV4 B;  4DMI A;  1Y4U A;  1N32 I;  1N32 E;  1J5E E;  2ZBK B;  1MG7 A;  4L5N C;  1HNW E;  5AE3 A;  2E1M A;  2LE2 A;  2KOU A;  4GKK I;  1PIE A;  4DU8 A;  3KWR A;  1I94 I;  3QT6 A;  4WYQ B;  1I94 E;  1QZR A;  1O0W A;  2NA2 A;  4R8O A;  1MU5 A;  3J7A G;  2KHX A;  4Q28 A;  1ELO A;  3D4J A;  3ZZU A;  2ZM6 I;  2ZM6 E;  3OML A;  4K0K I;  3P1X A;  3K1J A;  4K0K E;  2V89 A;  4NXM E;  2DSY A;  4LF9 I;  2EFG A;  3B78 A;  4DPY A;  2HFS A;  2HFU A;  3LML A;  3AUZ A;  1X48 A;  1VIS A;  2OI2 A;  2UXC I;  2UUC E;  2UXC E;  4YHH I;  5T6J A;  3LNU A;  1HR0 I;  1XMQ E;  1Z0V A;  1HR0 E;  1RRE A;  4DV3 I;  2E1R A;  4LF8 I;  1OJ4 A;  2V83 A;  2VE7 C;  1Z59 A;  3HXL A;  2VQF E;  2AJ4 A;  1J26 A;  5DNY A;  4JI7 I;  4JI7 E;  4KQV A;  2DMY A;  3JAM Q;  4AQY I;  4IZJ D;  2LUP B;  2L6M A;  2O1T A;  1UIL A;  2ZIT A;  3B82 A;  4JI8 I;  4DV5 E;  4M30 A;  4OX9 I;  4PRV A;  4OX9 E;  1Y4S A;  1N36 E;  4LU9 A;  4JI2 E;  1WHQ A;  2R3V A;  4BC7 A;  4RPF A;  4DV6 I;  2DEJ A;  4MYU A;  3HQ1 A;  4FWG A;  4DV6 E;  2FGG A;  4DR4 E;  5FLX Q;  3FIG A;  4P78 A;  1XNQ E;  1D6T A;  3ZZT A;  1YZ9 A;  2CG9 A;  4DUZ I;  4LF6 I;  2VF1 A;  1KVK A;  1PKP A;  4LF7 E;  2DIX A;  4EMD A;  4DR2 I;  1H72 C;  4DR2 E;  2V85 A;  4JI4 I;  4HAC A;  4M0V A;  3T1Y I;  4USM A;  1S16 A;  4DPU A;  2JY9 A;  3K17 A;  4DPT A;  4X62 E;  2Z5C A;  1Z5C A;  2UXD I;  1X49 A;  2UXD E;  4HY1 A;  2BV3 A;  4YY3 I;  2N3H A;  3Q6N A;  5BR8 I;  1Z0C A;  4LFA E;  5BR8 E;  2Z5C B;  4DV7 I;  4LF5 E;  4DV7 E;  4Z7Y A;  3IWC A;  4DV0 E;  1H74 A;  4DV1 I;  4TUG A;  4DV1 E;  1IBK I;  5IWA I;  2VQE I;  2Z5E A;  3ZM7 A;  5GMD A;  2F4V E;  2VQE E;  4B3S E;  3V5R A;  2RS6 A;  4DUY I;  3ZKB A;  1N0U A;  2UUA I;  5LL6 R;  2UUA E;  3ZZ0 A;  1IBL I;  1Z0E A;  1IBL E;  2L3J A;  2K4V A;  1MX0 A;  1Z5A A;  4ZVI A;  3C4B A;  3VK6 A;  1N33 I;  4OOG C;  1N34 E;  1N33 E;  1FNM A;  3CWV A;  1NHI A;  2N3G A;  1WUU A;  3Q1Q A;  1T4O A;  2IOP A;  2V2V A;  4GKK E;  5A2Q Q;  1H7U A;  2LRS A;  4KZS A;  4DV2 I;  4DV2 E;  4NXN I;  4NXN E;  5FWK A;  3HPZ A;  5IT9 Q;  1EKZ A;  2V87 A;  2HKJ A;  2V34 A;  3H4L A;  2O1W A;  2HKE A;  4LF9 E;  3QT8 A;  1YYW A;  3JAM C;  3IWB A;  3J7Y p;  2HK3 A;  2NUE A;  4DXL A;  4IZJ A;  2V2Q A;  4JV5 I;  2NUG A;  1USV A;  4JV5 E;  2R42 A;  2IHR 1;  1ZM4 A;  1KIJ A;  2PNM A;  4YHH E;  4DKK A;  1XMO I;  2O1U A;  2LJP A;  2FTX B;  2JOX A;  3AV0 A;  4DV3 E;  4WFT A;  4JI6 I;  4LF8 E;  1NHH A;  3PYD A;  2LMZ A;  3Q6M A;  2YT4 A;  4IZJ B;  1ZM3 A;  4URL A;  2CGE A;  3ZOQ B;  2HK2 A;  2CPN A;  5FLX C;  2M4I A;  4F9B B;  1DI2 A;  2L2N A;  4DR7 I;  4I3H A;  4DR7 E;  1UHZ A;  4AQY E;  4F54 A;  4UT4 A;  4F9A B;  4N3O A;  4BC9 A;  2L33 A;  1XNR I;  2L3C A;  2JR1 A;  2KON A;  1XNR E;  4JI8 E;  2B7V A;  5AE1 A;  3T1H I;  3DF6 A;  1IBM I;  1USU A;  4WUD A;  2L2K B;  2E5L I;  1IBM E;  4LFB I;  3PRY A;  3PYF A;  4LFB E;  1H7S A;  2RS7 A;  1HNZ I;  3ADG A;  3ADJ A;  1HNZ E;  1Z0W A;  4DR3 I;  4DUZ E;  4LF6 E;  1FWK A;  3LPS A;  1WHN A;  1X47 A;  2DEI A;  2M7Q A;  2RSM A;  4JI3 I;  2F8B A;  1K47 A;  3J81 Q;  4DR6 I;  4BS9 A;  4JI4 E;  4I8O A;  2LBS B;  3T1Y E;  2GS8 A;  2CZ9 A;  4X66 I;  4F9C B;  4JI5 I;  1WXR A;  4X8W A;  4FWD A;  5LMN I;  1ZXN A;  1QU6 A;  5LMN E;  3K85 A;  4DU7 A;  1PVG A;  3RMP A;  3IWD A;  2JOB A;  3WU5 A;  4HAC B;  2LJH A;  3JTZ A;  4YY3 E;  4M2Z A;  4JI0 I;  1FJG I;  4JI0 E;  3HTX A;  4LTY A;  4LF4 I;  2NPF A;  1Y6Z A;  4XTJ A;  4B3R I;  3ZKD A;  4B3T I;  3WU3 A;  1B63 A;  3K6Q A;  1N0V C;  4DR1 I;  4X64 I;  4DR1 E;  2YZT A;  3WU4 A;  2BM0 A;  1IBK E;  5IWA E;  5GME A;  2UUB I;  4PRX A;  2UUB E;  2L2M A;  3QT7 A;  3QT5 A;  4DUY E;  3J80 Q;  2V8P A;  2B3T B;  5LMU I;  5A2Q C;  5LMU E;  4HYM A;  2DB2 A;  2X7I A;  1DQ3 A;  4UTG A;  3B8H A;  2A2C A;  3PYE A;  4JYA I;  2JVA A;  5IT9 C;  2ODR C;  1RQ0 A;  1RC7 A;  2M1S A;  3VYY A;  2V88 A;  1Z5B A;  1YYK A;  3DJW A;  4P7A A;  4KHP I;  5AAS A;  3JU0 A;  4LFC I;  1HNX I;  2UXB I;  2MC6 A;  2PNL A;  2UXB E;  1ZM2 A;  4DPX A;  2WZO A;  3P06 A;  2BM1 A;  2G7H A;  2HHH I;  3HJC A;  4JG4 A;  2HHH E;  1J5E I;  4WSP A;  1HNW I;  2UU9 I;  4WPY A;  2UU9 E;  3C4T A;  2Z5B A;  1Z0G A;  1ZXM A;  4IZK A;  4R03 A;  1XMO E;  2Z5B B;  2V2Z A;  2Q2E B;  3ADL A;  4NXM I;  5AE2 A;  3PYG A;  2LUQ A;  4JI6 E;  1EI1 A;  2XEX A;  2MC5 A;  4IZK B;  3J7A M;  2J7K A;  2L8T A;  2UUC I;  4X65 I;  1ZBQ A;  3WU6 A;  4X65 E;  2ODR D;  3J81 C;  1FKA E;  1XMQ I;  1HK7 A;  1FI4 A;  4BBY A;  4TUI A;  1STU A;  3F6H A;  3T1H E;  1FWL A;  1U2R A;  1NHJ A;  2E5L E;  2VQF I;  2V86 A;  2RTX A;  4J8Z A;  3GON A;  3OTO I;  3OTO E;  4DR3 E;  3V2U C;  4HXZ A;  3HUL A;  4JI3 E;  1UEK A;  4DV5 I;  2LTR A;  3LTO A;  4DR6 E;  1N36 I;  4B3M I;  1GZ6 A;  2B9D A;  4B3M E;  1T4N A;  4JI2 I;  1EA6 A;  4X66 E;  1KKH A;  4JI5 E;  4DR4 I;  1XNQ I;  2NUF A;  2LTS A;  2EWL A;  4P7D A;  1S4E A;  4LF7 I;  3HPS A;  3J80 C;  1Z0B A;  1FJG E;  1KTV A;  3F0N A;  2H36 X;  4BCA A;  4LF4 E;  4B3R E;  2A2D A;  4R1F A;  4DR5 I;  4PU9 A;  4B3T E;  4DR5 E;  4X62 I;  4GKJ I;  4GKJ E;  4X64 E;  1BKN A;  5L3J A;  3F6G A;  3LLH A;  3ADI A;  2WW4 A;  2MDR A;  4FN5 A;  4WUB A;  4MYT A;  2O1V A;  5CFF E;  4LFA I;  4LF5 I;  4DV4 I;  2B7T A;  2IOQ A;  4DV4 E;  2V8Q B;  1DAR A;  1SR9 A;  1T4L B;  3M6A A;  1RR9 A;  1NZ0 A;  4USK A;  4JI1 I;  1Z0T A;  4DV0 I;  4JI1 E;  4GEQ B;  2L92 A;  4JYA E;  4FW9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...