1N36E

Structure of the thermus thermophilus 30s ribosomal subunit in the presence of crystallographically disordered codon and near-cognate transfer rna anticodon stem-loop mismatched at the second codon position
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
150
structure length
150
Chain Sequence
DFEEKMILIRRTARMQAGGRRFRFGALVVVGDRQGRVGLGFGKAPEVPLAVQKAGYYARRNMVEVPLQNGTIPHEIEVEFGASKIVLKPAAPGTGVIAGAVPRAILELAGVTDILTKELGSRNPINIAYATMEALRQLRTKADVERLRKG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S RIBOSOMAL RNA
publication title Selection of tRNA by the Ribosome Requires a Transition from an Open to a Closed Form
pubmed doi rcsb
molecule tags Ribosome
total genus 33
structure length 150
sequence length 150
ec nomenclature
pdb deposition date 2002-10-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00333 Ribosomal_S5 Ribosomal protein S5, N-terminal domain
E PF03719 Ribosomal_S5_C Ribosomal protein S5, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.20 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 1n36E01
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 1n36E02
4JI3E 1X48A 3LTOA 3HULA 2VQEE 4USMA 2UU9I 5FLXC 4NXME 1ZBTA 4LF4I 4PRVA 4HACA 4GKKI 2LJPA 3K17A 1NZ0A 3D4JA 3ADGA 2UXDI 5GMDA 2L2MA 2J7KA 2LUPB 1HNXE 1ZXNA 4AQYE 4DR3I 3H4LA 5LL6R 3T1YE 2R42A 4DR2E 1YYWA 3ZZTA 4B3RE 4JI7E 2XEXA 1PVGA 5IWAI 1HNWI 4LF6E 4DV0I 3ADIA 2V2QA 4DV3I 4JI1I 1QZRA 4KQVA 2CPNA 1N34I 2UU9E 1U2RA 4DUYE 4MYTA 4PU9A 2LTSA 3ZZ0A 4DR6I 3QT8A 3V5RA 4LF4E 3WU3A 4GKKE 4R1FA 2UXDE 1IBLI 2HFUA 1UHZA 4LF8E 1T4LB 2HFSA 5CFFE 1DARA 4HXZA 4GKJI 3QT6A 2F4VI 2X7IA 2UUCI 1A6FA 2IHR1 1HNWE 4DV0E 3PYFA 4JI1E 4FWHA 4DPWA 4JI5I 4M1KA 4ED4A 1I94I 1NHHA 4HACB 3J7Yp 2V2VA 1FWKA 5BR8I 4DR6E 4JI6I 4X62I 2NA2A 2EFGA 4X8WA 2DMYA 4EMDA 3Q1QA 5FLXQ 4JI2I 4NXMI 1IBLE 2Q2EB 1BKNA 4GKJE 1Z0VA 1ELOA 2UUCE 2NUGA 3LPSA 1HNXI 4AQYI 3T1YI 4JI5E 4X66I 3C4TA 1NHIA 4B3RI 3LNUA 3B8HA 1I94E 1H74A 4JI4E 1FNMA 1H73A 2R3VA 2VQFI 4DKKA 2DEJA 5BR8E 4HY1A 4JI6E 4X62E 1YYOA 1ZM3A 3F0NA 3WU4A 1PKPA 4DUYI 4LFBI 4JI2E 4USKA 4JYAI 3M6AA 1K47A 4UT4A 2NUFA 1Z59A 4K0KI 1NHJA 4WUDA 1X49A 4DV1E 4LF8I 4B3SE 1Z5AA 4X66E 3ADJA 2ZM6I 1STUA 4FW9A 2VQFE 1T4OA 2E5LI 4URLA 2NPFA 1RREA 1XNQI 1FJGI 1GQEA 1XMOI 3ZKDA 2JVAA 1HNZI 4P7AA 4LFBE 4X65I 2BV3A 4DPYA 4JYAE 2V2ZA 2LRSA 1WHNA 4Z7YA 1J5EE 3C4BA 4JI8I 4LFCE 2NUEA 4K0KE 1J26A 2LBSB 4NXNE 1Z0EA 3J81Q 5LMNE 4LF5E 2UUBE 2ZM6E 3WU5A 4FWDA 4YY3I 2E5LE 4DUZE 1IBKI 3J80Q 4B3TI 1XNQE 3WU6A 1FJGE 2L3JA 1XMOE 4DR1I 4JG4A 4JI4I 2ZBKB 1HNZE 2L2NA 4X65E 3T1HI 4DXLA 1S4EA 5A2QQ 2RS6A 2E1RA 1Z0CA 3ZM7A 4JI8E 2RSMA 3P1XA 2BM1A 4DR5E 4X64I 3J81C 1B62A 4YHHE 3QT7A 2MDRA 5LMUI 4M2ZA 4DPTA 1HR0E 4DV1I 4YY3E 3ADLA 1IBKE 3J80C 3K1JA 4B3SI 1IBMI 2KHXA 4XTJA 4B3TE 2UXBI 3ZKBA 4DR4E 4DR1E 4KHPE 2HK2A 1T4NA 3T1HE 1O0WA 1Z0BA 2HK3A 1OJ4A 1N32I 4OOGC 4DV6E 1N33I 2CZ9A 5A2QC 1X47A 2DIXA 1XHKA 4Z7CA 1XMQI 2RTXA 2AJ4A 2WW4A 1MX0A 4LFAE 4I3HA 3J7AG 1D6TA 4DV7E 4WFTA 4X64E 4DPXA 1RR9A 1J5EI 2UXCI 2HHHI 4DV5E 1N36I 3VYYA 1S16A 1YYKA 5LMUE 1KTVA 4LFCI 2V8PA 3ZZUA 1FI4A 3PYDA 4NXNI 2X36A 1Z0TA 1DI2A 1ZM4A 5LMNI 1H72C 1H7UA 4LF5I 3VYXA 1IBME 2B7TA 2L3CA 4P52A 1WHQA 1RC7A 4DV4I 4B3ME 3CWVA 2UXBE 2UUBI 1N0VC 4LF9I 2GS8A 3J7AM 3B82A 4DUZI 1PIEA 2ZITA 4MYUA 2EZ6A 1N32E 1N33E 2A2CA 2A2DA 2B7VA 1XMQE 2RS7A 1H7SA 3PYGA 4JV5I 2UXCE 2VF3A 2HHHE 1MG7A 4OX9E 1RQ0A 1N36E 2HKEA 1N0UA 1MU5A 2B3TB 4FN5A 3JAMQ 4DR5I 2V34A 4JI0I 4ZVIA 4YHHI 2BM0A 1YZ9A 2JY9A 4DV4E 4LF9E 1KKHA 3PYEA 2HKJA 4UTGA 2L33A 1HR0I 1ZM2A 1VISA 1XNRI 2YT4A 4DU8A 1Z0GA 1QU6A 4DR4I 4KHPI 1FKAE 3B78A 1KVKA 4FWGA 1Z5CA 4DR3E 4DV6I 4JV5E 4DU7A 2UUAI 3OTOI 5IWAE 4HYMA 1KIJA 1B63A 4LFAI 1FWLA 1EKZA 1WUUA 4DV7I 3JAMC 4DV3E 4DV2I 2LUQA 5IT9Q 4DR7I 1ZM9A 4JI0E 4WUCA 4DV5I 4M30A 2DEIA 1N34E 5L3JA 3QT5A 3V2UC 4LF7I 4JI3I 1XNRE 2VQEI 1UILA 2N3GA 3GONA 4B3MI 1Z0WA 1Z5BA 2F4VE 2UUAE 3HTXA 4WUBA 4DPUA 3OTOE 2OI2A 4RPFA 5GMEA 2N3HA 2LTRA 1UEKA 1EI1A 4PRXA 3LLHA 5IT9C 2L2KB 4DV2E 4DR2I 4DR7E 2LJHA 1EA6A 4JI7I 4OX9I 4WYQB 4LF6I 2DB2A 4LF7E 1ZXMA
chains in the Genus database with same CATH superfamily
4M9VC 5KL3A 4LCFA 4MU0A 1T39A 2E72A 2M7QA 4JI3E 1X48A 3HKMA 3Q6NA 2EQ3A 1TF6A 3LTOA 3HULA 4TUIA 2VQEE 2YTPA 4USMA 2UU9I 5DNYA 4Q28A 2DRPA 2R1FA 2WNRA 1UDNA 5FLXC 4IFDA 5EKWA 2ENCA 2V89A 2MC5A 4ZYDA 1Y4UA 1JK1A 4NXME 4I8OA 4IFDC 5TSEA 4BHCA 4U3DA 2E1MA 1ZBTA 3GMEA 2EN1A 4LF4I 4PRVA 2GO3A 4HACA 4GKKI 2LJPA 3BF2A 3K17A 5AC5A 2VE7C 2EMKA 2J7JA 1Z1BA 1NZ0A 3D4JA 2EPZA 3ADGA 3L7ZA 2UXDI 2PRTA 2O3ZA 5GMDA 1E3PA 1UDSA 1PJSA 2L2MA 2J7KA 3C6KA 2LUPB 1HNXE 5IXMB 2JEAB 1ZXNA 4AQYE 1P42A 2O1TA 5LLQA 4DR3I 2DLKA 5LL6R 3T1YE 2EJ4A 2R42A 3H4LA 4IJDA 4DR2E 1YYWA 3ZZTA 5C0XB 1T38A 4B3RE 2WP8B 4JI7E 2XEXA 1PVGA 2BA0G 5IWAI 2YWQA 1HNWI 2V86A 4LF6E 1UDOA 4MQYA 4DV0I 3ADIA 2V2QA 3QG5C 2BA1G 4DV3I 4JI1I 2MC6A 1QZRA 2C38A 4KQVA 4MU1A 5JEAB 2CPNA 3AUZA 2UU9E 1U2RA 4DUYE 1N34I 2EM3A 4MYTA 4F6MA 4PU9A 4ISAA 1EH7A 2ENHA 2LTSA 2R76A 3ZZ0A 4DR6I 1AH5A 4R2SA 4BBYA 3QT8A 2EM5A 4AIDA 3V5RA 4R2PA 2EOEA 4LF4E 2PNLA 2PNZA 3PRYA 3WU3A 2EOJA 4GKKE 1YFHA 4R1FA 1BB8A 1A1LA 1X6HA 4LCHA 3VK6A 2NN6E 2UXDE 1X6FA 4WXCA 1A1JA 1UHZA 2CG9A 4WPYA 1UBDC 2HFUA 4LF8E 1IBLI 2LO3A 5F3WA 1T4LB 5KL6A 2EP3A 1R6LA 5CFFE 1DARA 2HFSA 4HXZA 4GKJI 1ZU1A 3QT6A 2F4VI 4GEQB 2VF1A 4R2EA 3HQ1A 2JXPA 2X7IA 2UUCI 1A6FA 2IHR1 2BB8A 2ODRD 1HNWE 1PDAA 2IESA 5AE3A 4P7DA 2YTEA 1YH8A 4DV0E 2WNRB 3PYFA 5KL5A 4OZEA 5DNLA 3K6QA 4JI1E 5C0XD 2EMLA 4FWHA 4DPWA 4JI5I 4Q35B 4M1KA 2MKNA 4ED4A 1I94I 4ZYHA 2EMIA 1NHHA 4HACB 4OO1A 2ODRC 3VHTB 5A6BD 3F6GA 3J7Yp 1FWKA 2V2VA 5BR8I 5K36A 3L7ZB 4DR6E 4JI6I 4X62I 1GZ6A 1Y60A 2NA2A 2EFGA 4MU4A 5C0XC 4F6NA 4X8WA 2EPLX 2EPRA 2DMYA 5JEAD 4IS9A 4EMDA 2WCC3 1VI7A 3Q1QA 5A69A 2G7HA 3KWRA 1UDQA 2MKDA 5K36E 4HEIA 3PS2A 5FLXQ 4JI2I 4WX9A 4NXMI 1IBLE 2Q2EB 2A25A 4BHBA 2JE6A 1Y4SA 1BKNA 1BBOA 2LMZA 3U1KA 2FV4B 2B9DA 4BC7A 4GKJE 5KL7A 1Z0VA 5C0XF 5T6JA 2C38B 3IWBA 2YSPA 4KZSA 1NCSA 1ELOA 2UUCE 2V88A 2GPIA 3BBGA 2YRMA 2NUGA 4MLQA 3LPSA 2IOQA 4IZJD 1HNXI 4AQYI 2LCEA 1TF3A 1OYSA 2LT7A 3T1YI 4JI5E 4X66I 2WBTA 2EPOA 3C4TA 1NHIA 4B3RI 3LNUA 1P47A 1I94E 4RHBB 1H74A 3B8HA 2PNZB 4JI4E 3ZOQB 1FNMA 1H73A 4BC9A 1Y6ZA 2R3VA 2L92A 4DKKA 1MEYC 3DD6A 2YU8A 3MSWA 1A1FA 2LVHA 2DEJA 5BR8E 4HY1A 3B4TA 4JI6E 3KZYA 1WRJA 4X62E 2DSYA 1YYOA 2WBUA 1ZM3A 4R2DA 2EM8A 3F0NA 3EPJA 3NZKA 3WU4A 1PKPA 4J3DA 2YSOA 4DUYI 2GQ0A 2JP9A 2EMCA 4GZNC 4LFBI 4JI2E 4USKA 2RSIA 4JYAI 4FW7A 3M6AA 4BA1A 3PS3A 1QNTA 1K47A 4UT4A 2NUFA 5AC4A 4R8OA 3CDIA 3HPZA 1Z59A 2C39A 4K0KI 2EN8A 1NHJA 2JWOA 4WUDA 2EPUA 2CVEA 1X49A 4DV1E 2EQ0A 2BA0D 4LF8I 4OO1B 2EMXA 4M0VA 4IFDF 4B3SE 1Z5AA 3P76A 4X66E 2EOHA 3ADJA 1DGCA 5ELWA 2YU5A 3JTZA 2ZM6I 2EMZA 1STUA 2YTFA 1IMUA 1TN9A 2EMBA 4FW9A 2VQFE 2MDGA 1T4OA 2E5LI 2EL4A 4URLA 4U3BA 2NPFA 1EH8A 2JR1A 2PO0A 4IFDE 1RREA 1XNQI 1IQSA 2N8XA 2JE6B 2Z5CA 1FJGI 1PJTA 1GQEA 1XMOI 3ZKDA 1KJKA 2JVAA 1HNZI 1A1KA 4F9AB 1Y5YA 4P7AA 4LFBE 4X65I 2BV3A 2JYAA 2I9IA 4JYAE 4DPYA 1EH6A 4WSPA 1ZBQA 2V2ZA 2LRSA 2NN6A 1WHNA 4Z7YA 1J5EE 2DGCA 2ELZA 2VRDA 3C4BA 4BMJA 4JI8I 2LV2A 4LFCE 2NUEA 1IQOA 4L5NC 5KL2A 5EL9A 1A1HA 4K0KE 4N4RB 4LOMA 1OYRA 5DROA 1JK2A 1J26A 2LBSB 4NXNE 1Z0EA 3M85D 2EMGA 3J81Q 5LMNE 2D9HA 3JU0A 4LF5E 3EQ1A 2GLIA 4F9BB 2EPNA 2UUBE 2ZM6E 1USUA 3WU5A 1G2DC 2Z5BA 4ZYEA 4FWDA 4BA2A 4OO1D 4YY3I 2E5LE 4DUZE 1IBKI 3J80Q 2L6MA 1E3HA 2EOXA 4O4KA 2EM9A 3M7ND 4B3TI 4F54A 5DRRA 5AE2A 1XNQE 4BA1B 2HC5A 1FJGE 3WU6A 2L3JA 1XMOE 4DR1I 4JG4A 4JI4I 2ZBKB 3THNA 2L2NA 1HNZE 2K7IA 2C39B 4X65E 3T1HI 3L00A 4DXLA 1S4EA 2EN2A 4O24A 2EWLA 5A2QQ 1RHYA 2RS6A 1NEIA 2JOXA 2YTNA 1Z0CA 2E1RA 2YRKA 3ZM7A 4JI8E 2EOOA 2EPAA 2RSMA 3P1XA 4FK5C 2BM1A 4F2JC 2BR2A 4NBQA 4DR5E 4X64I 2K4VA 3J81C 1B62A 4YHHE 1BBGA 5KL4A 3QT7A 2EORA 2MDRA 2PO0B 5JEAC 5LMUI 2I13A 4M2ZA 4DPTA 2EPKX 1ZR9A 2Z5CB 5A6AA 2YPNA 3F6HA 3CDJA 1HR0E 4DV1I 2CTDA 4YY3E 2EM7A 2YTGA 3J80C 4BS9A 1IBKE 1B69A 3ADLA 2IOPA 3K1JA 4B3SI 3MHSC 2KHXA 3P3EA 4LCGA 1IBMI 2CT1A 4XTJA 4B3TE 3ECRA 3U1YA 2NN6B 2UXBI 5C0XE 1AAYA 3H09A 3ZKBA 4DR4E 4DR1E 4KHPE 2HK2A 4MU3A 1T4NA 3IWCA 1USVA 2CGEA 5DRQA 2YTOA 5JEAF 2HJJA 2M9AA 1YHCA 1ZAAC 2C37A 3T1HE 1O0WA 1F2IG 1Z0BA 2HK3A 1OJ4A 1N32I 4OOGC 4DV6E 1N33I 2CZ9A 4R03A 5A2QC 2H36X 1X47A 2DIXA 2YZTA 1XHKA 4Z7CA 3M99B 2RTXA 1XMQI 4AIMA 2AJ4A 4L8NA 2EN3A 2O1WA 2WW4A 1MX0A 2EMHA 1RMDA 4LFAE 4I3HA 3J7AG 5JEAE 1D6TA 3DF6A 4DV7E 4WFTA 1R6MA 2JEBA 3AV0A 1SFEA 4MLVA 4IS1C 2EOIA 4X64E 2Z5BB 4DPXA 1RR9A 4BA2B 2EPXA 1J5EI 2UXCI 2HHHI 4DV5E 1N36I 4LU9A 2EM6A 1X6EA 2YTIA 3VYYA 3LMLA 1S16A 4FW4A 2F1DA 1YYKA 4QNJA 5LMUE 4DMIA 1KTVA 4LFCI 2V8PA 4IZJA 3BGHA 3ZZUA 1FI4A 3PYDA 2PO1A 1A1IA 4NXNI 4J8ZA 2X36A 3P3CA 1X5WA 1Z0TA 4LPFA 1DI2A 1ZM4A 5LMNI 1H72C 1H7UA 2V8QB 2EPPA 3VYXA 2LE2A 2B7TA 1IBME 2AE8A 2JT2A 2GHFA 2KOUA 1WHQA 2L3CA 3UK3C 1RC7A 4P52A 4DV4I 2BA1D 4B3ME 2UXBE 3CWVA 2FTXB 1N0VC 2UUBI 2GS8A 4LF9I 3J7AM 2V85A 4OKGA 2PO2A 2GO4A 2VESA 3B82A 4FW6A 4DUZI 1PIEA 2ZITA 4MYUA 2JOBA 2EZ6A 4F9CB 1N32E 1N33E 2A2CA 2A2DA 2B7VA 1WXRA 2BR2B 2NN6D 2EMYA 1XMQE 4IZKA 2ENAA 1A1GA 4FW3A 4R2CA 2EOSA 2EMAA 2RS7A 2CSHA 4R2QA 2YTQA 1H7SA 3PYGA 2EMWA 3HJCA 3K85A 2EN6A 4JV5I 2WBSA 3P06A 1X3CA 2UXCE 2HHHE 2VF3A 1MG7A 2NN6C 4OX9E 1RQ0A 1N36E 2HKEA 1YSAC 1N0UA 1MGTA 4R2RA 4MDTA 3PS1A 4N3OA 4GQUA 1MU5A 2B3TB 4FN5A 2EOQA 3JAMQ 4DR5I 1N3GA 4LTYA 2J65A 2V34A 2C37B 4JI0I 4ZVIA 4YHHI 4BCAA 3BIDA 4R2AA 1YZ9A 2JY9A 2BM0A 4HTGA 3EPHA 2EOMA 4DV4E 2NN6F 2EN4A 4LF9E 1KKHA 5K36B 3PYEA 2HKJA 4UTGA 4RH8A 4QNKA 2L33A 1OYPA 1HR0I 1ZM2A 1VISA 3GCMA 2M1SA 1XNRI 2YT4A 5K36D 2JEBB 4LF5I 5A6KA 4DU8A 1XXEA 1Z0GA 2EPMX 1QU6A 4TUGA 4DR4I 4KHPI 1FKAE 2ELYA 2RPCA 4FW5A 3GLLA 3C6MA 3HPSA 3B78A 1KVKA 4IZJB 4OO1C 2EL6A 2F8BA 4FWGA 1Z5CA 2RQLA 4DR3E 4DV6I 2PO1B 1SR9A 4JV5E 4DU7A 4WXDA 2UUAI 4X9JA 5K36C 3M85G 3OTOI 3IWDA 4ZYGA 5IWAE 2YRHA 2ADRA 2WZOA 4HYMA 1KIJA 5DNXA 1B63A 4LFAI 2DLQA 1EKZA 1YUJA 1FWLA 1WUUA 4IFDB 4DV7I 1DQ3A 2EM4A 3JAMC 1PJQA 4DV3E 4DV2I 2LUQA 5IT9Q 2PO2B 2PNMA 3Q6MA 4DR7I 4OO1F 1ZM9A 1LLMC 2EL5A 4JI0E 4WUCA 4DV5I 4M30A 1HK7A 2YTJA 2M4IA 1YUIA 2DEIA 5K36F 1N34E 5L3JA 3OMLA 3QT5A 3V2UC 2JEAA 1YPNA 4NHRA 4IZKB 3M7NG 5AASA 4LF7I 2EPCA 3KRNA 5C0XA 3THOB 4JI3I 2EM0A 2WP8A 5IV8B 2EN7A 1XNRE 3P3GA 1GTKA 2EM2A 1G2FC 4KWYA 2DMIA 5DRPA 2VQEI 2IERA 4OO1E 1UILA 2N3GA 3GONA 2YTDA 5A6BA 4B3MI 1Z0WA 4O5GA 3TQMA 2O1UA 3DJWA 3UHMA 2EOZA 1Z5BA 1WJPA 2V83A 3FIGA 5JEAA 4AM3A 2EE8A 3HXLA 2BBGA 4NZVA 3EPKA 2LJUA 2O1VA 2F4VE 2KONA 2UUAE 3HTXA 4WUBA 4DPUA 3OTOE 2OI2A 4RPFA 5GMEA 2N3HA 2LTRA 4WSGA 1UN6B 2EMFA 3EPLA 1L4SA 5ADZA 1UEKA 2EOFA 3RMPA 1EI1A 2EQ1A 4PRXA 3LLHA 4O43A 2L2KB 4DV2E 5IT9C 2Q8UA 2NABA 2HGHA 2VQFI 4DR7E 5FWKA 5A6JA 4DR2I 2LJHA 2JPAA 1EA6A 4JI7I 4OX9I 3KZZA 2Z5EA 4P78A 4WYQB 2EOYA 2FGGA 5AE1A 3MHHC 3H1CA 4LF6I 1KYQA 2L8TA 2V87A 4IFDD 2DB2A 4LF7E 1ZXMA
chains in the Genus database with same CATH topology
2M7QA 4JI3E 1X48A 3Q6NA 3LTOA 3HULA 4TUIA 2VQEE 4USMA 2UU9I 5DNYA 4Q28A 5FLXC 2V89A 2MC5A 1Y4UA 4NXME 4I8OA 2E1MA 1ZBTA 4LF4I 4PRVA 4HACA 4GKKI 2LJPA 3K17A 2VE7C 1NZ0A 3D4JA 3ADGA 2UXDI 5GMDA 2L2MA 2J7KA 2LUPB 1HNXE 1ZXNA 4AQYE 2O1TA 4DR3I 3H4LA 5LL6R 3T1YE 2R42A 4DR2E 1YYWA 3ZZTA 4B3RE 4JI7E 2XEXA 1PVGA 5IWAI 1HNWI 2V86A 4LF6E 4DV0I 3ADIA 2V2QA 4DV3I 4JI1I 2MC6A 1QZRA 4KQVA 2CPNA 3AUZA 2UU9E 1U2RA 4DUYE 1N34I 4MYTA 4PU9A 2LTSA 3ZZ0A 4DR6I 4BBYA 3QT8A 3V5RA 2PNLA 4LF4E 3PRYA 3WU3A 4GKKE 4R1FA 3VK6A 2UXDE 2CG9A 2HFUA 1UHZA 1IBLI 4WPYA 4LF8E 5F3WA 1T4LB 2HFSA 5CFFE 1DARA 4HXZA 4GKJI 3QT6A 2F4VI 4GEQB 2VF1A 3HQ1A 2X7IA 2UUCI 1A6FA 2IHR1 2ODRD 1HNWE 5AE3A 4P7DA 4DV0E 3PYFA 3K6QA 4JI1E 4FWHA 4DPWA 4JI5I 4M1KA 4ED4A 1I94I 1NHHA 4HACB 2ODRC 3J7Yp 3F6GA 2V2VA 1FWKA 5BR8I 4DR6E 4JI6I 4X62I 1GZ6A 2NA2A 2EFGA 4X8WA 2DMYA 4EMDA 3Q1QA 2G7HA 3KWRA 5FLXQ 4JI2I 4NXMI 1IBLE 2Q2EB 1Y4SA 1BKNA 2LMZA 2FV4B 2B9DA 4BC7A 4GKJE 1Z0VA 5T6JA 3IWBA 4KZSA 1ELOA 2UUCE 2V88A 2NUGA 3LPSA 4IZJD 2IOQA 1HNXI 4AQYI 3T1YI 4JI5E 4X66I 3C4TA 1NHIA 4B3RI 3LNUA 3B8HA 1I94E 1H74A 4JI4E 3ZOQB 1FNMA 1H73A 4BC9A 1Y6ZA 2R3VA 2L92A 4DKKA 2VQFI 3MSWA 2DEJA 5BR8E 4HY1A 4JI6E 4X62E 2DSYA 1YYOA 1ZM3A 3F0NA 3WU4A 1PKPA 4DUYI 2GQ0A 4LFBI 4JI2E 4USKA 4JYAI 3M6AA 1K47A 4UT4A 2NUFA 4R8OA 3HPZA 1Z59A 4K0KI 1NHJA 2JWOA 4WUDA 1X49A 4DV1E 4LF8I 4M0VA 4B3SE 1Z5AA 4X66E 3ADJA 3JTZA 2ZM6I 1STUA 4FW9A 2VQFE 1T4OA 2E5LI 4URLA 2NPFA 2JR1A 1RREA 1XNQI 1FJGI 2Z5CA 1GQEA 1XMOI 3ZKDA 2JVAA 1HNZI 4F9AB 4P7AA 4LFBE 4X65I 2BV3A 4DPYA 4JYAE 2V2ZA 4WSPA 1ZBQA 2LRSA 1WHNA 4Z7YA 1J5EE 3C4BA 4BMJA 4JI8I 4LFCE 2NUEA 4L5NC 4K0KE 1J26A 2LBSB 4NXNE 1Z0EA 3J81Q 5LMNE 4LF5E 3JU0A 4F9BB 2UUBE 2ZM6E 1USUA 3WU5A 2Z5BA 4FWDA 4YY3I 2E5LE 4DUZE 1IBKI 3J80Q 2L6MA 4B3TI 4F54A 5AE2A 1XNQE 3WU6A 1FJGE 2L3JA 1XMOE 4DR1I 4JG4A 4JI4I 2ZBKB 1HNZE 2L2NA 4X65E 3T1HI 4DXLA 1S4EA 2EWLA 5A2QQ 2RS6A 2JOXA 2E1RA 1Z0CA 3ZM7A 4JI8E 2RSMA 3P1XA 2BM1A 4DR5E 4X64I 2K4VA 3J81C 1B62A 4YHHE 3QT7A 2MDRA 5LMUI 4M2ZA 4DPTA 2Z5CB 3F6HA 1HR0E 4DV1I 4YY3E 3ADLA 1IBKE 3J80C 4BS9A 3K1JA 2IOPA 4B3SI 1IBMI 2KHXA 4XTJA 4B3TE 2UXBI 3H09A 3ZKBA 4DR4E 4DR1E 4KHPE 2HK2A 1T4NA 3IWCA 1USVA 2CGEA 3T1HE 1O0WA 1Z0BA 2HK3A 1OJ4A 1N32I 4OOGC 4DV6E 1N33I 2CZ9A 4R03A 5A2QC 2H36X 1X47A 2DIXA 2YZTA 1XHKA 4Z7CA 1XMQI 2RTXA 2AJ4A 4L8NA 2O1WA 2WW4A 1MX0A 4LFAE 4I3HA 3J7AG 1D6TA 3DF6A 4DV7E 4WFTA 3AV0A 4X64E 2Z5BB 4DPXA 1RR9A 1J5EI 2UXCI 2HHHI 4DV5E 1N36I 4LU9A 3VYYA 3LMLA 1S16A 1YYKA 5LMUE 4DMIA 1KTVA 4LFCI 2V8PA 4IZJA 3ZZUA 1FI4A 3PYDA 4NXNI 4J8ZA 2X36A 1Z0TA 1DI2A 1ZM4A 5LMNI 1H72C 1H7UA 2V8QB 3VYXA 4LF5I 2LE2A 2B7TA 1IBME 2L3CA 2KOUA 1WHQA 1RC7A 4P52A 4DV4I 4B3ME 2UXBE 3CWVA 2FTXB 1N0VC 2UUBI 2GS8A 4LF9I 3J7AM 2V85A 3B82A 4DUZI 1PIEA 2ZITA 4MYUA 2JOBA 2EZ6A 4F9CB 1N32E 1N33E 2A2CA 2A2DA 2B7VA 1WXRA 1XMQE 4IZKA 2RS7A 1H7SA 3PYGA 3HJCA 3K85A 4JV5I 3P06A 2UXCE 2VF3A 2HHHE 1MG7A 4OX9E 1RQ0A 1N36E 2HKEA 1N0UA 4N3OA 1MU5A 2B3TB 4FN5A 3JAMQ 4DR5I 4LTYA 2V34A 4JI0I 4ZVIA 4YHHI 4BCAA 2BM0A 1YZ9A 2JY9A 4DV4E 4LF9E 1KKHA 3PYEA 2HKJA 4UTGA 2L33A 1HR0I 1ZM2A 1VISA 1XNRI 2M1SA 2YT4A 4DU8A 1Z0GA 1QU6A 4TUGA 4DR4I 4KHPI 1FKAE 3HPSA 3B78A 1KVKA 4IZJB 2F8BA 4FWGA 1Z5CA 4DR3E 4DV6I 1SR9A 4JV5E 4DU7A 2UUAI 3OTOI 3IWDA 5IWAE 2WZOA 4HYMA 1KIJA 1B63A 4LFAI 1FWLA 1EKZA 1WUUA 4DV7I 1DQ3A 3JAMC 4DV3E 4DV2I 2LUQA 5IT9Q 2PNMA 3Q6MA 4DR7I 1ZM9A 4JI0E 4WUCA 4DV5I 4M30A 1HK7A 2DEIA 2M4IA 1N34E 5L3JA 3OMLA 3QT5A 3V2UC 4IZKB 5AASA 4LF7I 4JI3I 1XNRE 2VQEI 1UILA 2N3GA 3GONA 4B3MI 1Z0WA 2O1UA 3DJWA 1Z5BA 2V83A 3FIGA 3HXLA 2O1VA 2F4VE 2KONA 2UUAE 3HTXA 4WUBA 4DPUA 3OTOE 2OI2A 4RPFA 5GMEA 2N3HA 2LTRA 5ADZA 1UEKA 3RMPA 1EI1A 4PRXA 3LLHA 5IT9C 2L2KB 4DV2E 4DR2I 4DR7E 5FWKA 2LJHA 1EA6A 4JI7I 4OX9I 2Z5EA 4P78A 4WYQB 2FGGA 5AE1A 4LF6I 2L8TA 2V87A 2DB2A 4LF7E 1ZXMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JI3 E;  1X48 A;  3LTO A;  3HUL A;  2VQE E;  4USM A;  2UU9 I;  5FLX C;  4NXM E;  1ZBT A;  4LF4 I;  4PRV A;  4HAC A;  4GKK I;  2LJP A;  3K17 A;  1NZ0 A;  3D4J A;  3ADG A;  2UXD I;  5GMD A;  2L2M A;  2J7K A;  2LUP B;  1HNX E;  1ZXN A;  4AQY E;  4DR3 I;  3H4L A;  5LL6 R;  3T1Y E;  2R42 A;  4DR2 E;  1YYW A;  3ZZT A;  4B3R E;  4JI7 E;  2XEX A;  1PVG A;  5IWA I;  1HNW I;  4LF6 E;  4DV0 I;  3ADI A;  2V2Q A;  4DV3 I;  4JI1 I;  1QZR A;  4KQV A;  2CPN A;  1N34 I;  2UU9 E;  1U2R A;  4DUY E;  4MYT A;  4PU9 A;  2LTS A;  3ZZ0 A;  4DR6 I;  3QT8 A;  3V5R A;  4LF4 E;  3WU3 A;  4GKK E;  4R1F A;  2UXD E;  1IBL I;  2HFU A;  1UHZ A;  4LF8 E;  1T4L B;  2HFS A;  5CFF E;  1DAR A;  4HXZ A;  4GKJ I;  3QT6 A;  2F4V I;  2X7I A;  2UUC I;  1A6F A;  2IHR 1;  1HNW E;  4DV0 E;  3PYF A;  4JI1 E;  4FWH A;  4DPW A;  4JI5 I;  4M1K A;  4ED4 A;  1I94 I;  1NHH A;  4HAC B;  3J7Y p;  2V2V A;  1FWK A;  5BR8 I;  4DR6 E;  4JI6 I;  4X62 I;  2NA2 A;  2EFG A;  4X8W A;  2DMY A;  4EMD A;  3Q1Q A;  5FLX Q;  4JI2 I;  4NXM I;  1IBL E;  2Q2E B;  1BKN A;  4GKJ E;  1Z0V A;  1ELO A;  2UUC E;  2NUG A;  3LPS A;  1HNX I;  4AQY I;  3T1Y I;  4JI5 E;  4X66 I;  3C4T A;  1NHI A;  4B3R I;  3LNU A;  3B8H A;  1I94 E;  1H74 A;  4JI4 E;  1FNM A;  1H73 A;  2R3V A;  2VQF I;  4DKK A;  2DEJ A;  5BR8 E;  4HY1 A;  4JI6 E;  4X62 E;  1YYO A;  1ZM3 A;  3F0N A;  3WU4 A;  1PKP A;  4DUY I;  4LFB I;  4JI2 E;  4USK A;  4JYA I;  3M6A A;  1K47 A;  4UT4 A;  2NUF A;  1Z59 A;  4K0K I;  1NHJ A;  4WUD A;  1X49 A;  4DV1 E;  4LF8 I;  4B3S E;  1Z5A A;  4X66 E;  3ADJ A;  2ZM6 I;  1STU A;  4FW9 A;  2VQF E;  1T4O A;  2E5L I;  4URL A;  2NPF A;  1RRE A;  1XNQ I;  1FJG I;  1GQE A;  1XMO I;  3ZKD A;  2JVA A;  1HNZ I;  4P7A A;  4LFB E;  4X65 I;  2BV3 A;  4DPY A;  4JYA E;  2V2Z A;  2LRS A;  1WHN A;  4Z7Y A;  1J5E E;  3C4B A;  4JI8 I;  4LFC E;  2NUE A;  4K0K E;  1J26 A;  2LBS B;  4NXN E;  1Z0E A;  3J81 Q;  5LMN E;  4LF5 E;  2UUB E;  2ZM6 E;  3WU5 A;  4FWD A;  4YY3 I;  2E5L E;  4DUZ E;  1IBK I;  3J80 Q;  4B3T I;  1XNQ E;  3WU6 A;  1FJG E;  2L3J A;  1XMO E;  4DR1 I;  4JG4 A;  4JI4 I;  2ZBK B;  1HNZ E;  2L2N A;  4X65 E;  3T1H I;  4DXL A;  1S4E A;  5A2Q Q;  2RS6 A;  2E1R A;  1Z0C A;  3ZM7 A;  4JI8 E;  2RSM A;  3P1X A;  2BM1 A;  4DR5 E;  4X64 I;  3J81 C;  1B62 A;  4YHH E;  3QT7 A;  2MDR A;  5LMU I;  4M2Z A;  4DPT A;  1HR0 E;  4DV1 I;  4YY3 E;  3ADL A;  1IBK E;  3J80 C;  3K1J A;  4B3S I;  1IBM I;  2KHX A;  4XTJ A;  4B3T E;  2UXB I;  3ZKB A;  4DR4 E;  4DR1 E;  4KHP E;  2HK2 A;  1T4N A;  3T1H E;  1O0W A;  1Z0B A;  2HK3 A;  1OJ4 A;  1N32 I;  4OOG C;  4DV6 E;  1N33 I;  2CZ9 A;  5A2Q C;  1X47 A;  2DIX A;  1XHK A;  4Z7C A;  1XMQ I;  2RTX A;  2AJ4 A;  2WW4 A;  1MX0 A;  4LFA E;  4I3H A;  3J7A G;  1D6T A;  4DV7 E;  4WFT A;  4X64 E;  4DPX A;  1RR9 A;  1J5E I;  2UXC I;  2HHH I;  4DV5 E;  1N36 I;  3VYY A;  1S16 A;  1YYK A;  5LMU E;  1KTV A;  4LFC I;  2V8P A;  3ZZU A;  1FI4 A;  3PYD A;  4NXN I;  2X36 A;  1Z0T A;  1DI2 A;  1ZM4 A;  5LMN I;  1H72 C;  1H7U A;  4LF5 I;  3VYX A;  1IBM E;  2B7T A;  2L3C A;  4P52 A;  1WHQ A;  1RC7 A;  4DV4 I;  4B3M E;  3CWV A;  2UXB E;  2UUB I;  1N0V C;  4LF9 I;  2GS8 A;  3J7A M;  3B82 A;  4DUZ I;  1PIE A;  2ZIT A;  4MYU A;  2EZ6 A;  1N32 E;  1N33 E;  2A2C A;  2A2D A;  2B7V A;  1XMQ E;  2RS7 A;  1H7S A;  3PYG A;  4JV5 I;  2UXC E;  2VF3 A;  2HHH E;  1MG7 A;  4OX9 E;  1RQ0 A;  1N36 E;  2HKE A;  1N0U A;  1MU5 A;  2B3T B;  4FN5 A;  3JAM Q;  4DR5 I;  2V34 A;  4JI0 I;  4ZVI A;  4YHH I;  2BM0 A;  1YZ9 A;  2JY9 A;  4DV4 E;  4LF9 E;  1KKH A;  3PYE A;  2HKJ A;  4UTG A;  2L33 A;  1HR0 I;  1ZM2 A;  1VIS A;  1XNR I;  2YT4 A;  4DU8 A;  1Z0G A;  1QU6 A;  4DR4 I;  4KHP I;  1FKA E;  3B78 A;  1KVK A;  4FWG A;  1Z5C A;  4DR3 E;  4DV6 I;  4JV5 E;  4DU7 A;  2UUA I;  3OTO I;  5IWA E;  4HYM A;  1KIJ A;  1B63 A;  4LFA I;  1FWL A;  1EKZ A;  1WUU A;  4DV7 I;  3JAM C;  4DV3 E;  4DV2 I;  2LUQ A;  5IT9 Q;  4DR7 I;  1ZM9 A;  4JI0 E;  4WUC A;  4DV5 I;  4M30 A;  2DEI A;  1N34 E;  5L3J A;  3QT5 A;  3V2U C;  4LF7 I;  4JI3 I;  1XNR E;  2VQE I;  1UIL A;  2N3G A;  3GON A;  4B3M I;  1Z0W A;  1Z5B A;  2F4V E;  2UUA E;  3HTX A;  4WUB A;  4DPU A;  3OTO E;  2OI2 A;  4RPF A;  5GME A;  2N3H A;  2LTR A;  1UEK A;  1EI1 A;  4PRX A;  3LLH A;  5IT9 C;  2L2K B;  4DV2 E;  4DR2 I;  4DR7 E;  2LJH A;  1EA6 A;  4JI7 I;  4OX9 I;  4WYQ B;  4LF6 I;  2DB2 A;  4LF7 E;  1ZXM A; 
#chains in the Genus database with same CATH topology
 4M9V C;  5KL3 A;  4LCF A;  4MU0 A;  1T39 A;  2E72 A;  2M7Q A;  4JI3 E;  1X48 A;  3HKM A;  3Q6N A;  2EQ3 A;  1TF6 A;  3LTO A;  3HUL A;  4TUI A;  2VQE E;  2YTP A;  4USM A;  2UU9 I;  5DNY A;  4Q28 A;  2DRP A;  2R1F A;  2WNR A;  1UDN A;  5FLX C;  4IFD A;  5EKW A;  2ENC A;  2V89 A;  2MC5 A;  4ZYD A;  1Y4U A;  1JK1 A;  4NXM E;  4I8O A;  4IFD C;  5TSE A;  4BHC A;  4U3D A;  2E1M A;  1ZBT A;  3GME A;  2EN1 A;  4LF4 I;  4PRV A;  2GO3 A;  4HAC A;  4GKK I;  2LJP A;  3BF2 A;  3K17 A;  5AC5 A;  2VE7 C;  2EMK A;  2J7J A;  1Z1B A;  1NZ0 A;  3D4J A;  2EPZ A;  3ADG A;  3L7Z A;  2UXD I;  2PRT A;  2O3Z A;  5GMD A;  1E3P A;  1UDS A;  1PJS A;  2L2M A;  2J7K A;  3C6K A;  2LUP B;  1HNX E;  5IXM B;  2JEA B;  1ZXN A;  4AQY E;  1P42 A;  2O1T A;  5LLQ A;  4DR3 I;  2DLK A;  5LL6 R;  3T1Y E;  2EJ4 A;  2R42 A;  3H4L A;  4IJD A;  4DR2 E;  1YYW A;  3ZZT A;  5C0X B;  1T38 A;  4B3R E;  2WP8 B;  4JI7 E;  2XEX A;  1PVG A;  2BA0 G;  5IWA I;  2YWQ A;  1HNW I;  2V86 A;  4LF6 E;  1UDO A;  4MQY A;  4DV0 I;  3ADI A;  2V2Q A;  3QG5 C;  2BA1 G;  4DV3 I;  4JI1 I;  2MC6 A;  1QZR A;  2C38 A;  4KQV A;  4MU1 A;  5JEA B;  2CPN A;  3AUZ A;  2UU9 E;  1U2R A;  4DUY E;  1N34 I;  2EM3 A;  4MYT A;  4F6M A;  4PU9 A;  4ISA A;  1EH7 A;  2ENH A;  2LTS A;  2R76 A;  3ZZ0 A;  4DR6 I;  1AH5 A;  4R2S A;  4BBY A;  3QT8 A;  2EM5 A;  4AID A;  3V5R A;  4R2P A;  2EOE A;  4LF4 E;  2PNL A;  2PNZ A;  3PRY A;  3WU3 A;  2EOJ A;  4GKK E;  1YFH A;  4R1F A;  1BB8 A;  1A1L A;  1X6H A;  4LCH A;  3VK6 A;  2NN6 E;  2UXD E;  1X6F A;  4WXC A;  1A1J A;  1UHZ A;  2CG9 A;  4WPY A;  1UBD C;  2HFU A;  4LF8 E;  1IBL I;  2LO3 A;  5F3W A;  1T4L B;  5KL6 A;  2EP3 A;  1R6L A;  5CFF E;  1DAR A;  2HFS A;  4HXZ A;  4GKJ I;  1ZU1 A;  3QT6 A;  2F4V I;  4GEQ B;  2VF1 A;  4R2E A;  3HQ1 A;  2JXP A;  2X7I A;  2UUC I;  1A6F A;  2IHR 1;  2BB8 A;  2ODR D;  1HNW E;  1PDA A;  2IES A;  5AE3 A;  4P7D A;  2YTE A;  1YH8 A;  4DV0 E;  2WNR B;  3PYF A;  5KL5 A;  4OZE A;  5DNL A;  3K6Q A;  4JI1 E;  5C0X D;  2EML A;  4FWH A;  4DPW A;  4JI5 I;  4Q35 B;  4M1K A;  2MKN A;  4ED4 A;  1I94 I;  4ZYH A;  2EMI A;  1NHH A;  4HAC B;  4OO1 A;  2ODR C;  3VHT B;  5A6B D;  3F6G A;  3J7Y p;  1FWK A;  2V2V A;  5BR8 I;  5K36 A;  3L7Z B;  4DR6 E;  4JI6 I;  4X62 I;  1GZ6 A;  1Y60 A;  2NA2 A;  2EFG A;  4MU4 A;  5C0X C;  4F6N A;  4X8W A;  2EPL X;  2EPR A;  2DMY A;  5JEA D;  4IS9 A;  4EMD A;  2WCC 3;  1VI7 A;  3Q1Q A;  5A69 A;  2G7H A;  3KWR A;  1UDQ A;  2MKD A;  5K36 E;  4HEI A;  3PS2 A;  5FLX Q;  4JI2 I;  4WX9 A;  4NXM I;  1IBL E;  2Q2E B;  2A25 A;  4BHB A;  2JE6 A;  1Y4S A;  1BKN A;  1BBO A;  2LMZ A;  3U1K A;  2FV4 B;  2B9D A;  4BC7 A;  4GKJ E;  5KL7 A;  1Z0V A;  5C0X F;  5T6J A;  2C38 B;  3IWB A;  2YSP A;  4KZS A;  1NCS A;  1ELO A;  2UUC E;  2V88 A;  2GPI A;  3BBG A;  2YRM A;  2NUG A;  4MLQ A;  3LPS A;  2IOQ A;  4IZJ D;  1HNX I;  4AQY I;  2LCE A;  1TF3 A;  1OYS A;  2LT7 A;  3T1Y I;  4JI5 E;  4X66 I;  2WBT A;  2EPO A;  3C4T A;  1NHI A;  4B3R I;  3LNU A;  1P47 A;  1I94 E;  4RHB B;  1H74 A;  3B8H A;  2PNZ B;  4JI4 E;  3ZOQ B;  1FNM A;  1H73 A;  4BC9 A;  1Y6Z A;  2R3V A;  2L92 A;  4DKK A;  1MEY C;  3DD6 A;  2YU8 A;  3MSW A;  1A1F A;  2LVH A;  2DEJ A;  5BR8 E;  4HY1 A;  3B4T A;  4JI6 E;  3KZY A;  1WRJ A;  4X62 E;  2DSY A;  1YYO A;  2WBU A;  1ZM3 A;  4R2D A;  2EM8 A;  3F0N A;  3EPJ A;  3NZK A;  3WU4 A;  1PKP A;  4J3D A;  2YSO A;  4DUY I;  2GQ0 A;  2JP9 A;  2EMC A;  4GZN C;  4LFB I;  4JI2 E;  4USK A;  2RSI A;  4JYA I;  4FW7 A;  3M6A A;  4BA1 A;  3PS3 A;  1QNT A;  1K47 A;  4UT4 A;  2NUF A;  5AC4 A;  4R8O A;  3CDI A;  3HPZ A;  1Z59 A;  2C39 A;  4K0K I;  2EN8 A;  1NHJ A;  2JWO A;  4WUD A;  2EPU A;  2CVE A;  1X49 A;  4DV1 E;  2EQ0 A;  2BA0 D;  4LF8 I;  4OO1 B;  2EMX A;  4M0V A;  4IFD F;  4B3S E;  1Z5A A;  3P76 A;  4X66 E;  2EOH A;  3ADJ A;  1DGC A;  5ELW A;  2YU5 A;  3JTZ A;  2ZM6 I;  2EMZ A;  1STU A;  2YTF A;  1IMU A;  1TN9 A;  2EMB A;  4FW9 A;  2VQF E;  2MDG A;  1T4O A;  2E5L I;  2EL4 A;  4URL A;  4U3B A;  2NPF A;  1EH8 A;  2JR1 A;  2PO0 A;  4IFD E;  1RRE A;  1XNQ I;  1IQS A;  2N8X A;  2JE6 B;  2Z5C A;  1FJG I;  1PJT A;  1GQE A;  1XMO I;  3ZKD A;  1KJK A;  2JVA A;  1HNZ I;  1A1K A;  4F9A B;  1Y5Y A;  4P7A A;  4LFB E;  4X65 I;  2BV3 A;  2JYA A;  2I9I A;  4JYA E;  4DPY A;  1EH6 A;  4WSP A;  1ZBQ A;  2V2Z A;  2LRS A;  2NN6 A;  1WHN A;  4Z7Y A;  1J5E E;  2DGC A;  2ELZ A;  2VRD A;  3C4B A;  4BMJ A;  4JI8 I;  2LV2 A;  4LFC E;  2NUE A;  1IQO A;  4L5N C;  5KL2 A;  5EL9 A;  1A1H A;  4K0K E;  4N4R B;  4LOM A;  1OYR A;  5DRO A;  1JK2 A;  1J26 A;  2LBS B;  4NXN E;  1Z0E A;  3M85 D;  2EMG A;  3J81 Q;  5LMN E;  2D9H A;  3JU0 A;  4LF5 E;  3EQ1 A;  2GLI A;  4F9B B;  2EPN A;  2UUB E;  2ZM6 E;  1USU A;  3WU5 A;  1G2D C;  2Z5B A;  4ZYE A;  4FWD A;  4BA2 A;  4OO1 D;  4YY3 I;  2E5L E;  4DUZ E;  1IBK I;  3J80 Q;  2L6M A;  1E3H A;  2EOX A;  4O4K A;  2EM9 A;  3M7N D;  4B3T I;  4F54 A;  5DRR A;  5AE2 A;  1XNQ E;  4BA1 B;  2HC5 A;  1FJG E;  3WU6 A;  2L3J A;  1XMO E;  4DR1 I;  4JG4 A;  4JI4 I;  2ZBK B;  3THN A;  2L2N A;  1HNZ E;  2K7I A;  2C39 B;  4X65 E;  3T1H I;  3L00 A;  4DXL A;  1S4E A;  2EN2 A;  4O24 A;  2EWL A;  5A2Q Q;  1RHY A;  2RS6 A;  1NEI A;  2JOX A;  2YTN A;  1Z0C A;  2E1R A;  2YRK A;  3ZM7 A;  4JI8 E;  2EOO A;  2EPA A;  2RSM A;  3P1X A;  4FK5 C;  2BM1 A;  4F2J C;  2BR2 A;  4NBQ A;  4DR5 E;  4X64 I;  2K4V A;  3J81 C;  1B62 A;  4YHH E;  1BBG A;  5KL4 A;  3QT7 A;  2EOR A;  2MDR A;  2PO0 B;  5JEA C;  5LMU I;  2I13 A;  4M2Z A;  4DPT A;  2EPK X;  1ZR9 A;  2Z5C B;  5A6A A;  2YPN A;  3F6H A;  3CDJ A;  1HR0 E;  4DV1 I;  2CTD A;  4YY3 E;  2EM7 A;  2YTG A;  3J80 C;  4BS9 A;  1IBK E;  1B69 A;  3ADL A;  2IOP A;  3K1J A;  4B3S I;  3MHS C;  2KHX A;  3P3E A;  4LCG A;  1IBM I;  2CT1 A;  4XTJ A;  4B3T E;  3ECR A;  3U1Y A;  2NN6 B;  2UXB I;  5C0X E;  1AAY A;  3H09 A;  3ZKB A;  4DR4 E;  4DR1 E;  4KHP E;  2HK2 A;  4MU3 A;  1T4N A;  3IWC A;  1USV A;  2CGE A;  5DRQ A;  2YTO A;  5JEA F;  2HJJ A;  2M9A A;  1YHC A;  1ZAA C;  2C37 A;  3T1H E;  1O0W A;  1F2I G;  1Z0B A;  2HK3 A;  1OJ4 A;  1N32 I;  4OOG C;  4DV6 E;  1N33 I;  2CZ9 A;  4R03 A;  5A2Q C;  2H36 X;  1X47 A;  2DIX A;  2YZT A;  1XHK A;  4Z7C A;  3M99 B;  2RTX A;  1XMQ I;  4AIM A;  2AJ4 A;  4L8N A;  2EN3 A;  2O1W A;  2WW4 A;  1MX0 A;  2EMH A;  1RMD A;  4LFA E;  4I3H A;  3J7A G;  5JEA E;  1D6T A;  3DF6 A;  4DV7 E;  4WFT A;  1R6M A;  2JEB A;  3AV0 A;  1SFE A;  4MLV A;  4IS1 C;  2EOI A;  4X64 E;  2Z5B B;  4DPX A;  1RR9 A;  4BA2 B;  2EPX A;  1J5E I;  2UXC I;  2HHH I;  4DV5 E;  1N36 I;  4LU9 A;  2EM6 A;  1X6E A;  2YTI A;  3VYY A;  3LML A;  1S16 A;  4FW4 A;  2F1D A;  1YYK A;  4QNJ A;  5LMU E;  4DMI A;  1KTV A;  4LFC I;  2V8P A;  4IZJ A;  3BGH A;  3ZZU A;  1FI4 A;  3PYD A;  2PO1 A;  1A1I A;  4NXN I;  4J8Z A;  2X36 A;  3P3C A;  1X5W A;  1Z0T A;  4LPF A;  1DI2 A;  1ZM4 A;  5LMN I;  1H72 C;  1H7U A;  2V8Q B;  2EPP A;  3VYX A;  2LE2 A;  2B7T A;  1IBM E;  2AE8 A;  2JT2 A;  2GHF A;  2KOU A;  1WHQ A;  2L3C A;  3UK3 C;  1RC7 A;  4P52 A;  4DV4 I;  2BA1 D;  4B3M E;  2UXB E;  3CWV A;  2FTX B;  1N0V C;  2UUB I;  2GS8 A;  4LF9 I;  3J7A M;  2V85 A;  4OKG A;  2PO2 A;  2GO4 A;  2VES A;  3B82 A;  4FW6 A;  4DUZ I;  1PIE A;  2ZIT A;  4MYU A;  2JOB A;  2EZ6 A;  4F9C B;  1N32 E;  1N33 E;  2A2C A;  2A2D A;  2B7V A;  1WXR A;  2BR2 B;  2NN6 D;  2EMY A;  1XMQ E;  4IZK A;  2ENA A;  1A1G A;  4FW3 A;  4R2C A;  2EOS A;  2EMA A;  2RS7 A;  2CSH A;  4R2Q A;  2YTQ A;  1H7S A;  3PYG A;  2EMW A;  3HJC A;  3K85 A;  2EN6 A;  4JV5 I;  2WBS A;  3P06 A;  1X3C A;  2UXC E;  2HHH E;  2VF3 A;  1MG7 A;  2NN6 C;  4OX9 E;  1RQ0 A;  1N36 E;  2HKE A;  1YSA C;  1N0U A;  1MGT A;  4R2R A;  4MDT A;  3PS1 A;  4N3O A;  4GQU A;  1MU5 A;  2B3T B;  4FN5 A;  2EOQ A;  3JAM Q;  4DR5 I;  1N3G A;  4LTY A;  2J65 A;  2V34 A;  2C37 B;  4JI0 I;  4ZVI A;  4YHH I;  4BCA A;  3BID A;  4R2A A;  1YZ9 A;  2JY9 A;  2BM0 A;  4HTG A;  3EPH A;  2EOM A;  4DV4 E;  2NN6 F;  2EN4 A;  4LF9 E;  1KKH A;  5K36 B;  3PYE A;  2HKJ A;  4UTG A;  4RH8 A;  4QNK A;  2L33 A;  1OYP A;  1HR0 I;  1ZM2 A;  1VIS A;  3GCM A;  2M1S A;  1XNR I;  2YT4 A;  5K36 D;  2JEB B;  4LF5 I;  5A6K A;  4DU8 A;  1XXE A;  1Z0G A;  2EPM X;  1QU6 A;  4TUG A;  4DR4 I;  4KHP I;  1FKA E;  2ELY A;  2RPC A;  4FW5 A;  3GLL A;  3C6M A;  3HPS A;  3B78 A;  1KVK A;  4IZJ B;  4OO1 C;  2EL6 A;  2F8B A;  4FWG A;  1Z5C A;  2RQL A;  4DR3 E;  4DV6 I;  2PO1 B;  1SR9 A;  4JV5 E;  4DU7 A;  4WXD A;  2UUA I;  4X9J A;  5K36 C;  3M85 G;  3OTO I;  3IWD A;  4ZYG A;  5IWA E;  2YRH A;  2ADR A;  2WZO A;  4HYM A;  1KIJ A;  5DNX A;  1B63 A;  4LFA I;  2DLQ A;  1EKZ A;  1YUJ A;  1FWL A;  1WUU A;  4IFD B;  4DV7 I;  1DQ3 A;  2EM4 A;  3JAM C;  1PJQ A;  4DV3 E;  4DV2 I;  2LUQ A;  5IT9 Q;  2PO2 B;  2PNM A;  3Q6M A;  4DR7 I;  4OO1 F;  1ZM9 A;  1LLM C;  2EL5 A;  4JI0 E;  4WUC A;  4DV5 I;  4M30 A;  1HK7 A;  2YTJ A;  2M4I A;  1YUI A;  2DEI A;  5K36 F;  1N34 E;  5L3J A;  3OML A;  3QT5 A;  3V2U C;  2JEA A;  1YPN A;  4NHR A;  4IZK B;  3M7N G;  5AAS A;  4LF7 I;  2EPC A;  3KRN A;  5C0X A;  3THO B;  4JI3 I;  2EM0 A;  2WP8 A;  5IV8 B;  2EN7 A;  1XNR E;  3P3G A;  1GTK A;  2EM2 A;  1G2F C;  4KWY A;  2DMI A;  5DRP A;  2VQE I;  2IER A;  4OO1 E;  1UIL A;  2N3G A;  3GON A;  2YTD A;  5A6B A;  4B3M I;  1Z0W A;  4O5G A;  3TQM A;  2O1U A;  3DJW A;  3UHM A;  2EOZ A;  1Z5B A;  1WJP A;  2V83 A;  3FIG A;  5JEA A;  4AM3 A;  2EE8 A;  3HXL A;  2BBG A;  4NZV A;  3EPK A;  2LJU A;  2O1V A;  2F4V E;  2KON A;  2UUA E;  3HTX A;  4WUB A;  4DPU A;  3OTO E;  2OI2 A;  4RPF A;  5GME A;  2N3H A;  2LTR A;  4WSG A;  1UN6 B;  2EMF A;  3EPL A;  1L4S A;  5ADZ A;  1UEK A;  2EOF A;  3RMP A;  1EI1 A;  2EQ1 A;  4PRX A;  3LLH A;  4O43 A;  2L2K B;  4DV2 E;  5IT9 C;  2Q8U A;  2NAB A;  2HGH A;  2VQF I;  4DR7 E;  5FWK A;  5A6J A;  4DR2 I;  2LJH A;  2JPA A;  1EA6 A;  4JI7 I;  4OX9 I;  3KZZ A;  2Z5E A;  4P78 A;  4WYQ B;  2EOY A;  2FGG A;  5AE1 A;  3MHH C;  3H1C A;  4LF6 I;  1KYQ A;  2L8T A;  2V87 A;  4IFD D;  2DB2 A;  4LF7 E;  1ZXM A; 
#chains in the Genus database with same CATH homology
 2M7Q A;  4JI3 E;  1X48 A;  3Q6N A;  3LTO A;  3HUL A;  4TUI A;  2VQE E;  4USM A;  2UU9 I;  5DNY A;  4Q28 A;  5FLX C;  2V89 A;  2MC5 A;  1Y4U A;  4NXM E;  4I8O A;  2E1M A;  1ZBT A;  4LF4 I;  4PRV A;  4HAC A;  4GKK I;  2LJP A;  3K17 A;  2VE7 C;  1NZ0 A;  3D4J A;  3ADG A;  2UXD I;  5GMD A;  2L2M A;  2J7K A;  2LUP B;  1HNX E;  1ZXN A;  4AQY E;  2O1T A;  4DR3 I;  3H4L A;  5LL6 R;  3T1Y E;  2R42 A;  4DR2 E;  1YYW A;  3ZZT A;  4B3R E;  4JI7 E;  2XEX A;  1PVG A;  5IWA I;  1HNW I;  2V86 A;  4LF6 E;  4DV0 I;  3ADI A;  2V2Q A;  4DV3 I;  4JI1 I;  2MC6 A;  1QZR A;  4KQV A;  2CPN A;  3AUZ A;  2UU9 E;  1U2R A;  4DUY E;  1N34 I;  4MYT A;  4PU9 A;  2LTS A;  3ZZ0 A;  4DR6 I;  4BBY A;  3QT8 A;  3V5R A;  2PNL A;  4LF4 E;  3PRY A;  3WU3 A;  4GKK E;  4R1F A;  3VK6 A;  2UXD E;  2CG9 A;  2HFU A;  1UHZ A;  1IBL I;  4WPY A;  4LF8 E;  5F3W A;  1T4L B;  2HFS A;  5CFF E;  1DAR A;  4HXZ A;  4GKJ I;  3QT6 A;  2F4V I;  4GEQ B;  2VF1 A;  3HQ1 A;  2X7I A;  2UUC I;  1A6F A;  2IHR 1;  2ODR D;  1HNW E;  5AE3 A;  4P7D A;  4DV0 E;  3PYF A;  3K6Q A;  4JI1 E;  4FWH A;  4DPW A;  4JI5 I;  4M1K A;  4ED4 A;  1I94 I;  1NHH A;  4HAC B;  2ODR C;  3J7Y p;  3F6G A;  2V2V A;  1FWK A;  5BR8 I;  4DR6 E;  4JI6 I;  4X62 I;  1GZ6 A;  2NA2 A;  2EFG A;  4X8W A;  2DMY A;  4EMD A;  3Q1Q A;  2G7H A;  3KWR A;  5FLX Q;  4JI2 I;  4NXM I;  1IBL E;  2Q2E B;  1Y4S A;  1BKN A;  2LMZ A;  2FV4 B;  2B9D A;  4BC7 A;  4GKJ E;  1Z0V A;  5T6J A;  3IWB A;  4KZS A;  1ELO A;  2UUC E;  2V88 A;  2NUG A;  3LPS A;  4IZJ D;  2IOQ A;  1HNX I;  4AQY I;  3T1Y I;  4JI5 E;  4X66 I;  3C4T A;  1NHI A;  4B3R I;  3LNU A;  3B8H A;  1I94 E;  1H74 A;  4JI4 E;  3ZOQ B;  1FNM A;  1H73 A;  4BC9 A;  1Y6Z A;  2R3V A;  2L92 A;  4DKK A;  2VQF I;  3MSW A;  2DEJ A;  5BR8 E;  4HY1 A;  4JI6 E;  4X62 E;  2DSY A;  1YYO A;  1ZM3 A;  3F0N A;  3WU4 A;  1PKP A;  4DUY I;  2GQ0 A;  4LFB I;  4JI2 E;  4USK A;  4JYA I;  3M6A A;  1K47 A;  4UT4 A;  2NUF A;  4R8O A;  3HPZ A;  1Z59 A;  4K0K I;  1NHJ A;  2JWO A;  4WUD A;  1X49 A;  4DV1 E;  4LF8 I;  4M0V A;  4B3S E;  1Z5A A;  4X66 E;  3ADJ A;  3JTZ A;  2ZM6 I;  1STU A;  4FW9 A;  2VQF E;  1T4O A;  2E5L I;  4URL A;  2NPF A;  2JR1 A;  1RRE A;  1XNQ I;  1FJG I;  2Z5C A;  1GQE A;  1XMO I;  3ZKD A;  2JVA A;  1HNZ I;  4F9A B;  4P7A A;  4LFB E;  4X65 I;  2BV3 A;  4DPY A;  4JYA E;  2V2Z A;  4WSP A;  1ZBQ A;  2LRS A;  1WHN A;  4Z7Y A;  1J5E E;  3C4B A;  4BMJ A;  4JI8 I;  4LFC E;  2NUE A;  4L5N C;  4K0K E;  1J26 A;  2LBS B;  4NXN E;  1Z0E A;  3J81 Q;  5LMN E;  4LF5 E;  3JU0 A;  4F9B B;  2UUB E;  2ZM6 E;  1USU A;  3WU5 A;  2Z5B A;  4FWD A;  4YY3 I;  2E5L E;  4DUZ E;  1IBK I;  3J80 Q;  2L6M A;  4B3T I;  4F54 A;  5AE2 A;  1XNQ E;  3WU6 A;  1FJG E;  2L3J A;  1XMO E;  4DR1 I;  4JG4 A;  4JI4 I;  2ZBK B;  1HNZ E;  2L2N A;  4X65 E;  3T1H I;  4DXL A;  1S4E A;  2EWL A;  5A2Q Q;  2RS6 A;  2JOX A;  2E1R A;  1Z0C A;  3ZM7 A;  4JI8 E;  2RSM A;  3P1X A;  2BM1 A;  4DR5 E;  4X64 I;  2K4V A;  3J81 C;  1B62 A;  4YHH E;  3QT7 A;  2MDR A;  5LMU I;  4M2Z A;  4DPT A;  2Z5C B;  3F6H A;  1HR0 E;  4DV1 I;  4YY3 E;  3ADL A;  1IBK E;  3J80 C;  4BS9 A;  3K1J A;  2IOP A;  4B3S I;  1IBM I;  2KHX A;  4XTJ A;  4B3T E;  2UXB I;  3H09 A;  3ZKB A;  4DR4 E;  4DR1 E;  4KHP E;  2HK2 A;  1T4N A;  3IWC A;  1USV A;  2CGE A;  3T1H E;  1O0W A;  1Z0B A;  2HK3 A;  1OJ4 A;  1N32 I;  4OOG C;  4DV6 E;  1N33 I;  2CZ9 A;  4R03 A;  5A2Q C;  2H36 X;  1X47 A;  2DIX A;  2YZT A;  1XHK A;  4Z7C A;  1XMQ I;  2RTX A;  2AJ4 A;  4L8N A;  2O1W A;  2WW4 A;  1MX0 A;  4LFA E;  4I3H A;  3J7A G;  1D6T A;  3DF6 A;  4DV7 E;  4WFT A;  3AV0 A;  4X64 E;  2Z5B B;  4DPX A;  1RR9 A;  1J5E I;  2UXC I;  2HHH I;  4DV5 E;  1N36 I;  4LU9 A;  3VYY A;  3LML A;  1S16 A;  1YYK A;  5LMU E;  4DMI A;  1KTV A;  4LFC I;  2V8P A;  4IZJ A;  3ZZU A;  1FI4 A;  3PYD A;  4NXN I;  4J8Z A;  2X36 A;  1Z0T A;  1DI2 A;  1ZM4 A;  5LMN I;  1H72 C;  1H7U A;  2V8Q B;  3VYX A;  4LF5 I;  2LE2 A;  2B7T A;  1IBM E;  2L3C A;  2KOU A;  1WHQ A;  1RC7 A;  4P52 A;  4DV4 I;  4B3M E;  2UXB E;  3CWV A;  2FTX B;  1N0V C;  2UUB I;  2GS8 A;  4LF9 I;  3J7A M;  2V85 A;  3B82 A;  4DUZ I;  1PIE A;  2ZIT A;  4MYU A;  2JOB A;  2EZ6 A;  4F9C B;  1N32 E;  1N33 E;  2A2C A;  2A2D A;  2B7V A;  1WXR A;  1XMQ E;  4IZK A;  2RS7 A;  1H7S A;  3PYG A;  3HJC A;  3K85 A;  4JV5 I;  3P06 A;  2UXC E;  2VF3 A;  2HHH E;  1MG7 A;  4OX9 E;  1RQ0 A;  1N36 E;  2HKE A;  1N0U A;  4N3O A;  1MU5 A;  2B3T B;  4FN5 A;  3JAM Q;  4DR5 I;  4LTY A;  2V34 A;  4JI0 I;  4ZVI A;  4YHH I;  4BCA A;  2BM0 A;  1YZ9 A;  2JY9 A;  4DV4 E;  4LF9 E;  1KKH A;  3PYE A;  2HKJ A;  4UTG A;  2L33 A;  1HR0 I;  1ZM2 A;  1VIS A;  1XNR I;  2M1S A;  2YT4 A;  4DU8 A;  1Z0G A;  1QU6 A;  4TUG A;  4DR4 I;  4KHP I;  1FKA E;  3HPS A;  3B78 A;  1KVK A;  4IZJ B;  2F8B A;  4FWG A;  1Z5C A;  4DR3 E;  4DV6 I;  1SR9 A;  4JV5 E;  4DU7 A;  2UUA I;  3OTO I;  3IWD A;  5IWA E;  2WZO A;  4HYM A;  1KIJ A;  1B63 A;  4LFA I;  1FWL A;  1EKZ A;  1WUU A;  4DV7 I;  1DQ3 A;  3JAM C;  4DV3 E;  4DV2 I;  2LUQ A;  5IT9 Q;  2PNM A;  3Q6M A;  4DR7 I;  1ZM9 A;  4JI0 E;  4WUC A;  4DV5 I;  4M30 A;  1HK7 A;  2DEI A;  2M4I A;  1N34 E;  5L3J A;  3OML A;  3QT5 A;  3V2U C;  4IZK B;  5AAS A;  4LF7 I;  4JI3 I;  1XNR E;  2VQE I;  1UIL A;  2N3G A;  3GON A;  4B3M I;  1Z0W A;  2O1U A;  3DJW A;  1Z5B A;  2V83 A;  3FIG A;  3HXL A;  2O1V A;  2F4V E;  2KON A;  2UUA E;  3HTX A;  4WUB A;  4DPU A;  3OTO E;  2OI2 A;  4RPF A;  5GME A;  2N3H A;  2LTR A;  5ADZ A;  1UEK A;  3RMP A;  1EI1 A;  4PRX A;  3LLH A;  5IT9 C;  2L2K B;  4DV2 E;  4DR2 I;  4DR7 E;  5FWK A;  2LJH A;  1EA6 A;  4JI7 I;  4OX9 I;  2Z5E A;  4P78 A;  4WYQ B;  2FGG A;  5AE1 A;  4LF6 I;  2L8T A;  2V87 A;  2DB2 A;  4LF7 E;  1ZXM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...