1N36E

Structure of the thermus thermophilus 30s ribosomal subunit in the presence of crystallographically disordered codon and near-cognate transfer rna anticodon stem-loop mismatched at the second codon position
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
150
structure length
150
Chain Sequence
DFEEKMILIRRTARMQAGGRRFRFGALVVVGDRQGRVGLGFGKAPEVPLAVQKAGYYARRNMVEVPLQNGTIPHEIEVEFGASKIVLKPAAPGTGVIAGAVPRAILELAGVTDILTKELGSRNPINIAYATMEALRQLRTKADVERLRKG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Selection of tRNA by the Ribosome Requires a Transition from an Open to a Closed Form
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 16S RIBOSOMAL RNA
total genus 33
structure length 150
sequence length 150
ec nomenclature
pdb deposition date 2002-10-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00333 Ribosomal_S5 Ribosomal protein S5, N-terminal domain
E PF03719 Ribosomal_S5_C Ribosomal protein S5, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.20 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 1n36E01
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 1n36E02
4LF4E 1Z5BA 3V2UC 4EMDA 1Z0VA 2A2DA 1XNQI 4YY3I 2UUCE 1FI4A 4LFBI 2E1RA 2B7VA 4HACA 2EZ6A 1HNXI 4JI8E 2RTXA 1ZM4A 4DR1I 3ADLA 3QT8A 5IWAE 4LFAI 1PIEA 1XNRI 4WFTA 1N36I 4X66I 3LPSA 1T4OA 1EI1A 2BV3A 2HKEA 2LBSB 3F0NA 4X8WA 1N33E 4UT4A 3J7AG 4AQYE 3K1JA 1MG7A 1I94I 5FLXQ 1NHIA 4DR5E 2NUFA 2OI2A 1Z0WA 1PVGA 3D4JA 4DPYA 4DV6I 2HFUA 4YY3E 4JI5E 2DB2A 1T4LB 4LFBE 4PRVA 2L2KB 1HNXE 3HTXA 2V34A 1Z0GA 2L3JA 4JI7I 1MU5A 3V5RA 3ZZTA 4JI7E 1H72C 1YYKA 2Q2EB 2RS6A 3M6AA 3Q1QA 1XMQE 3T1HE 2R42A 3QT6A 5IWAI 3J81Q 2ZBKB 1XNRE 2WW4A 2NA2A 1QU6A 4DV4E 1N0VC 3WU6A 4DV1E 2HHHE 2UUCI 1YZ9A 2LUPB 1DI2A 4JI8I 2XEXA 3JAMC 2LTRA 4DR6I 4DR1E 2LTSA 4FW9A 1N32I 4HACB 1N36E 1Z5AA 1XNQE 2NUEA 3ZKDA 4JYAI 4JI2I 4FWGA 5GMEA 2DEIA 1BKNA 4JI2E 4AQYI 4B3ME 4DU8A 3HULA 4DPXA 4JI0I 3J7AM 4Z7YA 1VISA 4JI5I 2HHHI 1UHZA 1XMOI 1RQ0A 2E5LE 4DV1I 4USMA 1I94E 2DMYA 2LUQA 4DUZI 3J80C 2V8PA 4DV7E 2YT4A 2F4VE 4Z7CA 4DR2E 2UXDI 1XMQI 4LF9I 4RPFA 1S4EA 1O0WA 4WUCA 3VYXA 2UUAI 1ELOA 4DU7A 4JV5E 1U2RA 4DV4I 2JY9A 2HFSA 4OOGC 4GKJI 4JI4E 3B8HA 4JI4I 4B3MI 3J7Yp 1N33I 3CWVA 1Z0CA 3J81C 1RR9A 1HNWI 3WU5A 2E5LI 2EFGA 3ZZUA 1NHJA 1ZXNA 1HR0E 4FWHA 4DV7I 2F4VI 5IT9C 4DV5I 4B3TE 1Z0EA 4LF7I 4DV5E 2UXBI 1UEKA 4DUYI 4GKJE 1N0UA 5A2QC 4DUYE 5A2QQ 3C4TA 3OTOI 3PYFA 3T1YE 2VF3A 4M30A 4DV3E 2NUGA 3PYDA 1RC7A 4I3HA 4PRXA 5L3JA 2UU9I 4DR5I 2UU9E 3LTOA 1FJGI 4DXLA 2L3CA 1FNMA 5LMUI 4JI3E 2BM1A 1H74A 4HY1A 5LMNI 2JVAA 4LF5E 4DR6E 4JI3I 4FN5A 1Z5CA 2DEJA 1WHQA 1FWKA 4JV5I 1J5EI 1Z0BA 2RS7A 4LF9E 1ZM2A 1IBLI 1DARA 1KVKA 3QT7A 2N3GA 1J26A 3T1YI 4NXNI 4P52A 4NXME 4NXNE 4R1FA 2UXCI 1RREA 3PYEA 2IHR1 4JI0E 2UXBE 3B78A 2UXCE 1EKZA 1T4NA 1ZM9A 1X49A 1HNWE 4LF8E 1X47A 4JG4A 1WHNA 4GKKE 4X65E 3WU4A 3ZM7A 1XMOE 4B3SE 4X65I 4WUBA 1YYOA 1HR0I 4B3SI 3LLHA 2V2VA 3QT5A 5BR8I 1NHHA 1HNZE 5BR8E 2L2NA 2L33A 1ZM3A 3H4LA 3P1XA 1D6TA 4YHHI 3OTOE 2DIXA 5LMNE 4JYAE 4B3RE 4DV0I 4HXZA 2UUAE 2RSMA 3ADJA 4NXMI 4LF8I 4LFCI 1A6FA 4GKKI 3ZKBA 2HKJA 2N3HA 2LRSA 1WUUA 2X36A 4X64I 2ZITA 2X7IA 4JI1I 4JI1E 2CZ9A 1K47A 3ADIA 1HNZI 2KHXA 4DR4E 1STUA 4K0KE 1ZXMA 5LMUE 1H7SA 1KKHA 4X66E 1FKAE 3T1HI 4LF6I 4YHHE 4ZVIA 1ZBTA 4DR3I 4OX9E 4JI6I 3ADGA 4P7AA 1J5EE 1N34I 1NZ0A 5IT9Q 4LF7E 4M2ZA 2LJHA 4PU9A 2VQFI 4LFCE 3LNUA 4M1KA 1X48A 1IBME 4XTJA 4DV6E 1B62A 4UTGA 4KHPE 4WYQB 4DPWA 3C4BA 4WUDA 2V2QA 1GQEA 2HK2A 3PYGA 2ZM6E 4DKKA 4HYMA 2ZM6I 2UUBI 1H73A 4DR4I 1FJGE 4X62E 4KQVA 4ED4A 4DR7E 3JAMQ 3ZZ0A 4DV2E 2B3TB 4JI6E 2HK3A 4FWDA 4B3TI 2AJ4A 1EA6A 2CPNA 3VYYA 1IBLE 4LF6E 4MYUA 1OJ4A 2MDRA 4DR3E 3B82A 2VQFE 1UILA 1N34E 1XHKA 4DV3I 1FWLA 2L2MA 1S16A 1Z59A 2NPFA 4URLA 2UUBE 2LJPA 4K0KI 4X62I 1N32E 2UXDE 4DR2I 4X64E 4LFAE 4MYTA 5GMDA 5CFFE 4USKA 4DV2I 4DPTA 1KTVA 4LF5I 4DR7I 2VQEI 2V2ZA 4DPUA 1YYWA 2VQEE 2A2CA 1B63A 1PKPA 3WU3A 2BM0A 2B7TA 1Z0TA 1IBMI 4DV0E 4B3RI 4OX9I 2J7KA 4KHPI 3K17A 5LL6R 1QZRA 1IBKE 1MX0A 3GONA 2R3VA 1IBKI 1KIJA 4DUZE 1H7UA 5FLXC 2GS8A 3J80Q 4LF4I
chains in the Genus database with same CATH superfamily
4LF4E 1Z5BA 3V2UC 5JEAE 4EMDA 3QG5C 1Z0VA 2A2DA 1XNQI 4YY3I 2UUCE 1FI4A 4LFBI 2E1RA 4OZEA 2DLQA 2B7VA 1HK7A 2EZ6A 4HACA 4JI8E 2RTXA 1HNXI 2EWLA 1ZM4A 4DR1I 2LV2A 1A1LA 2LMZA 5K36F 2RQLA 3ADLA 3QT8A 4N3OA 4OO1D 3GMEA 5IWAE 4LFAI 4BMJA 2WNRB 2A25A 2C39A 1PIEA 2EPXA 1AAYA 1XNRI 4WFTA 1N36I 3THOB 4X66I 3LPSA 5AE1A 2JE6A 3P3GA 1T4OA 1EI1A 2EN8A 2BV3A 5K36C 4WPYA 2HKEA 1OYSA 2LBSB 1P47A 3F0NA 4X8WA 3HQ1A 3J7AG 1N33E 4UT4A 1PJQA 5KL3A 4AQYE 3K1JA 2JEAB 1MG7A 1I94I 3PS3A 5DROA 1F2IG 5IXMB 1MEYC 1T39A 1NHIA 2H36X 5FLXQ 4HTGA 4WX9A 4WXDA 4DR5E 2EMLA 2NUFA 2OI2A 2YTFA 3P76A 2EMFA 1BB8A 5KL5A 1PVGA 1Z0WA 3D4JA 3P3CA 4DPYA 2HFUA 4DV6I 4YY3E 4JI5E 2DB2A 1T4LB 4M9VC 4LFBE 5C0XE 2EN1A 4PRVA 2EQ1A 2BA0G 5K36A 2L2KB 1HNXE 4BA2A 3HTXA 2V34A 1Z0GA 3P06A 2BB8A 2L3JA 2RPCA 5DRRA 4Q28A 4JI7I 5JEAD 1MU5A 3MHHC 1P42A 2EMBA 3GCMA 3V5RA 3ZZTA 2WCC3 4JI7E 1YUIA 1H72C 1YYKA 2Q2EB 3P3EA 2RS6A 1DGCA 3M6AA 2YSOA 1X5WA 4LCGA 4AM3A 3Q1QA 2LJUA 1BBGA 1XMQE 1USUA 3Q6NA 4FW5A 2GHFA 3LMLA 3T1HE 1LLMC 2R42A 5F3WA 3QT6A 2JR1A 2I9IA 2PO2A 2D9HA 5IWAI 2PO1A 2YPNA 3J81Q 4IFDA 2ZBKB 1XNRE 4LCHA 2KONA 2JP9A 3VHTB 2WW4A 2V86A 2NA2A 4IFDD 1QU6A 4DV4E 1N0VC 2EM0A 2C37A 3B4TA 2Z5CA 3WU6A 2EOJA 4J8ZA 4DV1E 1YFHA 2JE6B 2HHHE 2UUCI 4P78A 1YZ9A 2KOUA 2LUPB 4FW6A 1DI2A 1G2DC 4JI8I 2XEXA 3JAMC 2LTRA 5C0XA 4DR6I 2PNZA 2ENHA 4DR1E 2LTSA 5C0XD 3RMPA 2YTGA 4IFDC 4FW9A 1N32I 3K85A 4HACB 3DF6A 1N36E 2Z5EA 1Z5AA 2YTJA 1XNQE 2NUEA 2WBUA 3ZKDA 1WJPA 2FTXB 2Q8UA 4JYAI 1PJTA 2BA1D 3DD6A 3PS2A 2EOQA 4JI2I 4FWGA 5GMEA 4IFDF 2DEIA 2O3ZA 1BKNA 2YTQA 2IERA 4JI2E 1KYQA 1UBDC 2LE2A 2E1MA 4AQYI 4B3ME 4DU8A 3HULA 2IOQA 4DPXA 2EOIA 4IS1C 3BGHA 4JI0I 2YU8A 3J7AM 4U3DA 2EM7A 1UDNA 4L5NC 4N4RB 1A1KA 4Z7YA 4ZYEA 4QNKA 2YTNA 2WBSA 1A1JA 3EPJA 1VISA 2JEAA 3M7NG 2ODRC 2EPCA 4IS9A 3ZOQB 4U3BA 3Q6MA 1UHZA 2HHHI 1XMOI 1RQ0A 1YHCA 4JI5I 2E5LE 4DV1I 3BBGA 1A1IA 2GO4A 4FW3A 2DGCA 1X6FA 4ZYDA 4USMA 4ZYGA 1I94E 1OYPA 2DMYA 2JEBB 2LUQA 4DUZI 2HJJA 2EL5A 2ENAA 3J80C 2V8PA 4DV7E 1IQSA 3MSWA 2YT4A 2F4VE 4IZKB 1EH6A 2VE7C 4LU9A 4Z7CA 3M85G 5KL4A 1VI7A 4R2SA 5K36B 4DR2E 2UXDI 4F6MA 1XMQI 4LF9I 4RPFA 3IWDA 2VRDA 4LTYA 1R6MA 1O0WA 1S4EA 5A6AA 4OO1F 4MU4A 4R03A 4WUCA 3VYXA 5AE3A 2I13A 1Y4SA 4BA1B 2UUAI 2EMIA 2V8QB 1ELOA 4DU7A 2JYAA 3H09A 4JV5E 1PJSA 1U2RA 4DV4I 2JY9A 2CSHA 3EPLA 2M9AA 2C38A 2HFSA 3IWBA 3KRNA 4OOGC 4GKJI 4JI4E 1WRJA 1JK1A 2BBGA 3FIGA 1TF6A 3B8HA 4JI4I 4B3MI 3J7Yp 1N33I 4WSPA 3CWVA 2YU5A 4IFDE 2JXPA 2C37B 1Z0CA 2YTDA 2WP8B 3J81C 1ZR9A 5A6BA 1ZAAC 2J7JA 2EM5A 1RR9A 2EM4A 2CG9A 1HNWI 2L92A 3WU5A 2WZOA 1DQ3A 4MLQA 2EPPA 4P7DA 1B69A 2E5LI 1ZBQA 5JEAA 2EOZA 2EFGA 3ZZUA 1NHJA 1ZXNA 3BIDA 1HR0E 4FWHA 2CGEA 5AC4A 2EOMA 5KL7A 4F6NA 4BC9A 5EL9A 4DV7I 2GQ0A 2F4VI 5IT9C 4OO1B 1AH5A 4DV5I 2YZTA 4B3TE 1Z0EA 3CDIA 4LF7I 2M1SA 4DV5E 4LOMA 2CTDA 2UXBI 4BCAA 2HC5A 1UEKA 4QNJA 4DUYI 4GKJE 2EOSA 1N0UA 2PO1B 5A6KA 5A2QC 4DUYE 3C4TA 5A2QQ 3OTOI 2ELZA 2ELYA 2NN6C 4MDTA 4ISAA 4BA2B 2EN7A 2DMIA 4WSGA 4WXCA 2EQ3A 4TUGA 3T1YE 2VF3A 3PYFA 4M30A 4DV3E 5KL2A 2NUGA 1YPNA 3PYDA 1RC7A 2EPZA 3EPKA 4I3HA 2V89A 4PRXA 2O1WA 2YTOA 4R2PA 5DRPA 5L3JA 4F2JC 2UU9I 1UDQA 2WP8A 4DR5I 2L6MA 1OYRA 2YRHA 2UU9E 3JU0A 2E72A 3LTOA 2PNZB 2YTIA 4X9JA 1FJGI 2EOOA 2BR2A 4DXLA 2L3CA 1FNMA 2NN6F 5DNYA 5LMUI 4JI3E 2BM1A 4OKGA 3OMLA 1H74A 4HY1A 5LMNI 2YWQA 3DJWA 2JVAA 4LF5E 2EN3A 4DR6E 3L7ZB 4JI3I 4FN5A 2EOEA 5JEAB 1Z5CA 2DEJA 1WHQA 2NN6B 1FWKA 4R8OA 4JV5I 1J5EI 4O24A 1GZ6A 4ZYHA 4GZNC 1Z0BA 3VK6A 3F6HA 4FK5C 4TUIA 1PDAA 2RS7A 4F54A 2GO3A 2Z5CB 4LF9E 2LT7A 2PO2B 1ZM2A 4BA1A 1IBLI 1X3CA 1Y60A 4MU0A 3EQ1A 1YUJA 1DARA 1KVKA 3QT7A 5C0XC 5K36D 2YTPA 1NCSA 2N3GA 4R2RA 2EE8A 1J26A 3T1YI 4MU1A 4NXNI 2EMAA 4P52A 4NXME 4NXNE 2EM3A 3HJCA 4R1FA 4O4KA 1RREA 3PYEA 4NBQA 5JEAF 2UXCI 2IHR1 4JI0E 2UXBE 3B78A 2EMCA 2UXCE 2AE8A 1R6LA 1EKZA 2K7IA 2YSPA 1TN9A 1T4NA 3JTZA 1X49A 1HNWE 4LF8E 1X47A 1ZM9A 4JG4A 1YH8A 4DR2I 1T38A 1WHNA 4GKKE 5A6JA 4X65E 3WU4A 2JT2A 1XMOE 2BA0D 3ZM7A 4B3SE 3NZKA 4X65I 4WUBA 3HXLA 4FW4A 2MC5A 4NHRA 1YYOA 1HR0I 4B3SI 1Y5YA 3GLLA 3ECRA 3LLHA 3C6MA 2V2VA 2RSIA 3QT5A 5TSEA 2EORA 2J65A 1NHHA 5BR8I 2DSYA 2MDGA 1HNZE 2M4IA 2L2NA 2L33A 2EJ4A 5BR8E 1ZM3A 2IOPA 2EOFA 3H4LA 4BBYA 4HEIA 3P1XA 1D6TA 2YRMA 4YHHI 3OTOE 3HKMA 2DIXA 2HGHA 5LMNE 4JYAE 5FWKA 1GTKA 4B3RE 4DV0I 4HXZA 3EPHA 5ELWA 2R76A 2UUAE 5A6BD 2JEBA 2CT1A 1X6EA 1XXEA 2RSMA 4O5GA 4LPFA 2G7HA 1JK2A 2EOYA 2F8BA 2Z5BB 3PS1A 3ADJA 4IZJA 4MQYA 4NXMI 4LF8I 2NABA 4LFCI 1A6FA 4GKKI 3ZKBA 3HPZA 2N3HA 1IQOA 2LRSA 2V83A 3AV0A 2HKJA 1WUUA 2X36A 1ZU1A 2EOHA 2EMKA 2O1UA 4X64I 2ZITA 2EMXA 2X7IA 2EM9A 4JI1I 2EPRA 4BC7A 5K36E 2EN6A 2JWOA 4JI1E 2CZ9A 1K47A 2EM8A 2JOXA 2JPAA 3ADIA 1IMUA 1HNZI 2V88A 3THNA 2KHXA 4KZSA 2EQ0A 4DR4E 2DLKA 5ADZA 1STUA 2NN6E 3L7ZA 4K0KE 2EN4A 2BA1G 4R2AA 1ZXMA 5LMUE 1X6HA 2MC6A 1H7SA 1KKHA 1NEIA 4X66E 1FKAE 3T1HI 3HPSA 2EL6A 4IJDA 4F9CB 4LF6I 1EH7A 4GEQB 4YHHE 4ZVIA 4L8NA 1ZBTA 4DR3I 4OX9E 1L4SA 2K4VA 3ADGA 4JI6I 4P7AA 4AIMA 3M99B 1J5EE 1NZ0A 1N34I 5IT9Q 2N8XA 4LF7E 4GQUA 4FW7A 1Y6ZA 2LVHA 2R1FA 3KZYA 3AUZA 4M2ZA 1RHYA 5AASA 3UK3C 2EMHA 2LJHA 4PU9A 4IFDB 2VQFI 4LFCE 3LNUA 4M1KA 1X48A 1SFEA 3MHSC 1WXRA 1A1FA 1IBME 4XTJA 4DV6E 2DRPA 1B62A 4UTGA 5IV8B 1UN6B 4KHPE 2EPUA 4F9BB 4WYQB 4DPWA 4Q35B 3C4BA 4WUDA 2V2QA 1GQEA 2HK2A 3PYGA 2LO3A 2PRTA 2EMWA 2ZM6E 4DKKA 4F9AB 4HYMA 2ODRD 2ZM6I 2ENCA 4DMIA 2UUBI 5C0XB 2EL4A 5AC5A 1H73A 4DR4I 1FJGE 3KZZA 3BF2A 3TQMA 2EN2A 4X62E 4KQVA 4ED4A 2EMYA 2YTEA 1UDSA 2NN6A 4BS9A 1MGTA 4DR7E 1EH8A 3JAMQ 3UHMA 2WNRA 1SR9A 3ZZ0A 4DV2E 2B3TB 2JOBA 4BHCA 5T6JA 4JI6E 2HK3A 4FWDA 1E3PA 1TF3A 5JEAC 4KWYA 3L00A 2PNMA 4B3TI 4R2QA 5KL6A 2AJ4A 3IWCA 3C6KA 4RHBB 2EM6A 4IZKA 3KWRA 2YRKA 2WBTA 4R2CA 2CPNA 1EA6A 2VESA 3VYYA 1IBLE 3M7ND 4LF6E 2F1DA 2EMZA 4MYUA 1OJ4A 2MDRA 4IZJD 4DR3E 2GLIA 3B82A 2VQFE 4LCFA 1KJKA 3PRYA 1UILA 1N34E 1XHKA 4J3DA 4AIDA 4DV3I 1RMDA 1FWLA 2L2MA 1S16A 1Z59A 2EPKX 4I8OA 2CVEA 2NPFA 4OO1A 4URLA 3M85D 2UUBE 2BR2B 2EP3A 3K6QA 2LJPA 5DNLA 4K0KI 4X62I 1UDOA 2V87A 1N32E 2UXDE 2EM2A 4X64E 1A1GA 4LFAE 4RH8A 2EPNA 2C38B 4MYTA 2GPIA 5GMDA 4OO1E 2PO0A 5CFFE 4USKA 4DV2I 3U1KA 4DPTA 1KTVA 2VF1A 4R2EA 2MKDA 2LCEA 4LF5I 4DR7I 5DNXA 4OO1C 2NN6D 4BHBA 2VQEI 1USVA 2V2ZA 4DPUA 1YSAC 1YYWA 2VQEE 2FGGA 2A2CA 1B63A 1PKPA 1A1HA 2EPOA 1N3GA 2O1VA 3WU3A 2O1TA 2ADRA 1BBOA 3CDJA 1Y4UA 2L8TA 3U1YA 2EPAA 5AE2A 2BM0A 2EPMX 2MKNA 2B7TA 5LLQA 1QNTA 5DRQA 3F6GA 1Z0TA 1IBMI 4DV0E 2Z5BA 4IZJB 4OX9I 2PO0B 2J7KA 2PNLA 4B3RI 5A69A 4KHPI 2EMGA 1E3HA 2V85A 2IESA 5C0XF 5LL6R 3K17A 1QZRA 4O43A 1IBKE 2EOXA 1MX0A 3GONA 2R3VA 2EPLX 5EKWA 1IBKI 1KIJA 4DUZE 4NZVA 2B9DA 1H7UA 1Z1BA 5FLXC 2GS8A 4M0VA 2C39B 4R2DA 3H1CA 4MU3A 3J80Q 4LF4I 2M7QA 2FV4B 1G2FC 4MLVA
chains in the Genus database with same CATH topology
4LF4E 1Z5BA 3V2UC 4EMDA 1Z0VA 2A2DA 1XNQI 4YY3I 2UUCE 1FI4A 4LFBI 2E1RA 2B7VA 1HK7A 2EZ6A 4HACA 4JI8E 2RTXA 1HNXI 2EWLA 1ZM4A 4DR1I 2LMZA 3ADLA 3QT8A 4N3OA 5IWAE 4LFAI 4BMJA 1PIEA 1XNRI 4WFTA 1N36I 4X66I 3LPSA 5AE1A 1T4OA 1EI1A 2BV3A 4WPYA 2HKEA 2LBSB 3F0NA 4X8WA 3HQ1A 3J7AG 1N33E 4UT4A 4AQYE 3K1JA 1MG7A 1I94I 5FLXQ 1NHIA 2H36X 4DR5E 2NUFA 2OI2A 1Z0WA 1PVGA 3D4JA 4DPYA 4DV6I 2HFUA 4YY3E 4JI5E 2DB2A 1T4LB 4LFBE 4PRVA 2L2KB 1HNXE 3HTXA 2V34A 1Z0GA 3P06A 2L3JA 4Q28A 4JI7I 1MU5A 3V5RA 3ZZTA 4JI7E 1H72C 1YYKA 2Q2EB 2RS6A 3M6AA 3Q1QA 1XMQE 1USUA 3Q6NA 3LMLA 3T1HE 2R42A 5F3WA 3QT6A 2JR1A 5IWAI 3J81Q 2ZBKB 1XNRE 2KONA 2WW4A 2V86A 2NA2A 1QU6A 4DV4E 1N0VC 2Z5CA 3WU6A 4J8ZA 4DV1E 2HHHE 2UUCI 4P78A 1YZ9A 2KOUA 2LUPB 1DI2A 4JI8I 2XEXA 3JAMC 2LTRA 4DR6I 4DR1E 2LTSA 3RMPA 4FW9A 1N32I 3K85A 4HACB 3DF6A 1N36E 2Z5EA 1Z5AA 1XNQE 2NUEA 3ZKDA 2FTXB 4JYAI 4JI2I 4FWGA 5GMEA 2DEIA 1BKNA 4JI2E 2E1MA 2LE2A 4AQYI 4B3ME 4DU8A 3HULA 2IOQA 4DPXA 4JI0I 3J7AM 4L5NC 4Z7YA 1VISA 2ODRC 4JI5I 3ZOQB 2HHHI 3Q6MA 1UHZA 1XMOI 1RQ0A 2E5LE 4DV1I 4USMA 1I94E 2DMYA 2LUQA 4DUZI 3J80C 2V8PA 4DV7E 3MSWA 2YT4A 2F4VE 4IZKB 2VE7C 4LU9A 4Z7CA 4DR2E 2UXDI 1XMQI 4LF9I 4RPFA 3IWDA 4LTYA 1S4EA 1O0WA 4R03A 4WUCA 3VYXA 5AE3A 1Y4SA 2UUAI 2V8QB 1ELOA 4DU7A 3H09A 4JV5E 1U2RA 4DV4I 2JY9A 2HFSA 3IWBA 4OOGC 4GKJI 4JI4E 3FIGA 3B8HA 4JI4I 4B3MI 3J7Yp 1N33I 4WSPA 3CWVA 1Z0CA 3J81C 1RR9A 2CG9A 1HNWI 2L92A 3WU5A 2WZOA 1DQ3A 4P7DA 2E5LI 1ZBQA 2EFGA 3ZZUA 1NHJA 1ZXNA 1HR0E 4FWHA 2CGEA 4DV7I 4BC9A 2GQ0A 2F4VI 5IT9C 4DV5I 2YZTA 4B3TE 1Z0EA 4LF7I 2M1SA 4DV5E 2UXBI 4BCAA 1UEKA 4DUYI 4GKJE 1N0UA 5A2QC 4DUYE 5A2QQ 3C4TA 3OTOI 4TUGA 3PYFA 3T1YE 2VF3A 4M30A 4DV3E 2NUGA 3PYDA 1RC7A 4I3HA 2V89A 4PRXA 2O1WA 5L3JA 2UU9I 4DR5I 2L6MA 2UU9E 3JU0A 3LTOA 1FJGI 4DXLA 2L3CA 1FNMA 5DNYA 5LMUI 4JI3E 2BM1A 3OMLA 1H74A 4HY1A 5LMNI 3DJWA 2JVAA 4LF5E 4DR6E 4JI3I 4FN5A 1Z5CA 2DEJA 1WHQA 1FWKA 4R8OA 4JV5I 1J5EI 1GZ6A 1Z0BA 3VK6A 3F6HA 4TUIA 2Z5CB 2RS7A 4F54A 4LF9E 1ZM2A 1IBLI 1DARA 1KVKA 3QT7A 2N3GA 1J26A 3T1YI 4NXNI 4P52A 4NXME 4NXNE 3HJCA 4R1FA 2UXCI 1RREA 3PYEA 2IHR1 4JI0E 2UXBE 3B78A 2UXCE 1EKZA 1T4NA 3JTZA 1X49A 1HNWE 4LF8E 1X47A 1ZM9A 4JG4A 1WHNA 4GKKE 4X65E 3WU4A 3ZM7A 1XMOE 4B3SE 4X65I 4WUBA 3HXLA 2MC5A 1YYOA 1HR0I 4B3SI 3LLHA 2V2VA 3QT5A 5BR8I 1NHHA 2DSYA 1HNZE 2M4IA 2L2NA 2L33A 5BR8E 1ZM3A 2IOPA 3H4LA 4BBYA 3P1XA 1D6TA 4YHHI 3OTOE 2DIXA 5LMNE 4JYAE 5FWKA 4B3RE 4DV0I 4HXZA 2UUAE 2RSMA 2G7HA 2F8BA 2Z5BB 4IZJA 3ADJA 4NXMI 4LF8I 4LFCI 1A6FA 4GKKI 3ZKBA 3HPZA 2N3HA 2HKJA 2LRSA 2V83A 3AV0A 1WUUA 2X36A 2O1UA 4X64I 2ZITA 2X7IA 4JI1I 4BC7A 2JWOA 4JI1E 2CZ9A 1K47A 2JOXA 3ADIA 1HNZI 2V88A 2KHXA 4KZSA 4DR4E 5ADZA 1STUA 4K0KE 1ZXMA 5LMUE 2MC6A 1KKHA 1H7SA 4X66E 1FKAE 3T1HI 3HPSA 4F9CB 4LF6I 4GEQB 4YHHE 4ZVIA 4L8NA 1ZBTA 4DR3I 4OX9E 2K4VA 3ADGA 4JI6I 4P7AA 1J5EE 1N34I 1NZ0A 5IT9Q 4LF7E 1Y6ZA 3AUZA 4M2ZA 5AASA 2LJHA 4PU9A 2VQFI 4LFCE 3LNUA 4M1KA 1X48A 1WXRA 1IBME 4XTJA 4DV6E 1B62A 4UTGA 4KHPE 4F9BB 4WYQB 4DPWA 3C4BA 4WUDA 2V2QA 1GQEA 2HK2A 3PYGA 2ZM6E 4DKKA 4F9AB 4HYMA 2ODRD 2ZM6I 4DMIA 2UUBI 1H73A 4DR4I 1FJGE 4X62E 4KQVA 4ED4A 4BS9A 4DR7E 3JAMQ 3ZZ0A 1SR9A 4DV2E 2B3TB 2JOBA 4JI6E 5T6JA 2HK3A 4FWDA 2PNMA 4B3TI 2AJ4A 3IWCA 4IZKA 3KWRA 1EA6A 2CPNA 3VYYA 1IBLE 4LF6E 4MYUA 1OJ4A 2MDRA 4IZJD 4DR3E 3B82A 2VQFE 3PRYA 1UILA 1N34E 1XHKA 4DV3I 1FWLA 2L2MA 1S16A 1Z59A 4I8OA 2NPFA 4URLA 2UUBE 3K6QA 2LJPA 4K0KI 4X62I 2V87A 1N32E 2UXDE 4DR2I 4X64E 4LFAE 4MYTA 5GMDA 5CFFE 4USKA 4DV2I 4DPTA 1KTVA 2VF1A 4LF5I 4DR7I 2VQEI 1USVA 2V2ZA 4DPUA 1YYWA 2VQEE 2FGGA 2A2CA 1B63A 1PKPA 2O1VA 3WU3A 2O1TA 1Y4UA 2L8TA 5AE2A 2BM0A 2B7TA 3F6GA 1Z0TA 1IBMI 4DV0E 2Z5BA 4IZJB 4OX9I 4B3RI 2J7KA 2PNLA 4KHPI 2V85A 5LL6R 3K17A 1QZRA 1IBKE 1MX0A 3GONA 2R3VA 1IBKI 1KIJA 4DUZE 2B9DA 1H7UA 5FLXC 2GS8A 4M0VA 3J80Q 4LF4I 2M7QA 2FV4B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4LF4 E;  1Z5B A;  3V2U C;  4EMD A;  1Z0V A;  2A2D A;  1XNQ I;  4YY3 I;  2UUC E;  1FI4 A;  4LFB I;  2E1R A;  2B7V A;  4HAC A;  2EZ6 A;  1HNX I;  4JI8 E;  2RTX A;  1ZM4 A;  4DR1 I;  3ADL A;  3QT8 A;  5IWA E;  4LFA I;  1PIE A;  1XNR I;  4WFT A;  1N36 I;  4X66 I;  3LPS A;  1T4O A;  1EI1 A;  2BV3 A;  2HKE A;  2LBS B;  3F0N A;  4X8W A;  1N33 E;  4UT4 A;  3J7A G;  4AQY E;  3K1J A;  1MG7 A;  1I94 I;  5FLX Q;  1NHI A;  4DR5 E;  2NUF A;  2OI2 A;  1Z0W A;  1PVG A;  3D4J A;  4DPY A;  4DV6 I;  2HFU A;  4YY3 E;  4JI5 E;  2DB2 A;  1T4L B;  4LFB E;  4PRV A;  2L2K B;  1HNX E;  3HTX A;  2V34 A;  1Z0G A;  2L3J A;  4JI7 I;  1MU5 A;  3V5R A;  3ZZT A;  4JI7 E;  1H72 C;  1YYK A;  2Q2E B;  2RS6 A;  3M6A A;  3Q1Q A;  1XMQ E;  3T1H E;  2R42 A;  3QT6 A;  5IWA I;  3J81 Q;  2ZBK B;  1XNR E;  2WW4 A;  2NA2 A;  1QU6 A;  4DV4 E;  1N0V C;  3WU6 A;  4DV1 E;  2HHH E;  2UUC I;  1YZ9 A;  2LUP B;  1DI2 A;  4JI8 I;  2XEX A;  3JAM C;  2LTR A;  4DR6 I;  4DR1 E;  2LTS A;  4FW9 A;  1N32 I;  4HAC B;  1N36 E;  1Z5A A;  1XNQ E;  2NUE A;  3ZKD A;  4JYA I;  4JI2 I;  4FWG A;  5GME A;  2DEI A;  1BKN A;  4JI2 E;  4AQY I;  4B3M E;  4DU8 A;  3HUL A;  4DPX A;  4JI0 I;  3J7A M;  4Z7Y A;  1VIS A;  4JI5 I;  2HHH I;  1UHZ A;  1XMO I;  1RQ0 A;  2E5L E;  4DV1 I;  4USM A;  1I94 E;  2DMY A;  2LUQ A;  4DUZ I;  3J80 C;  2V8P A;  4DV7 E;  2YT4 A;  2F4V E;  4Z7C A;  4DR2 E;  2UXD I;  1XMQ I;  4LF9 I;  4RPF A;  1S4E A;  1O0W A;  4WUC A;  3VYX A;  2UUA I;  1ELO A;  4DU7 A;  4JV5 E;  1U2R A;  4DV4 I;  2JY9 A;  2HFS A;  4OOG C;  4GKJ I;  4JI4 E;  3B8H A;  4JI4 I;  4B3M I;  3J7Y p;  1N33 I;  3CWV A;  1Z0C A;  3J81 C;  1RR9 A;  1HNW I;  3WU5 A;  2E5L I;  2EFG A;  3ZZU A;  1NHJ A;  1ZXN A;  1HR0 E;  4FWH A;  4DV7 I;  2F4V I;  5IT9 C;  4DV5 I;  4B3T E;  1Z0E A;  4LF7 I;  4DV5 E;  2UXB I;  1UEK A;  4DUY I;  4GKJ E;  1N0U A;  5A2Q C;  4DUY E;  5A2Q Q;  3C4T A;  3OTO I;  3PYF A;  3T1Y E;  2VF3 A;  4M30 A;  4DV3 E;  2NUG A;  3PYD A;  1RC7 A;  4I3H A;  4PRX A;  5L3J A;  2UU9 I;  4DR5 I;  2UU9 E;  3LTO A;  1FJG I;  4DXL A;  2L3C A;  1FNM A;  5LMU I;  4JI3 E;  2BM1 A;  1H74 A;  4HY1 A;  5LMN I;  2JVA A;  4LF5 E;  4DR6 E;  4JI3 I;  4FN5 A;  1Z5C A;  2DEJ A;  1WHQ A;  1FWK A;  4JV5 I;  1J5E I;  1Z0B A;  2RS7 A;  4LF9 E;  1ZM2 A;  1IBL I;  1DAR A;  1KVK A;  3QT7 A;  2N3G A;  1J26 A;  3T1Y I;  4NXN I;  4P52 A;  4NXM E;  4NXN E;  4R1F A;  2UXC I;  1RRE A;  3PYE A;  2IHR 1;  4JI0 E;  2UXB E;  3B78 A;  2UXC E;  1EKZ A;  1T4N A;  1ZM9 A;  1X49 A;  1HNW E;  4LF8 E;  1X47 A;  4JG4 A;  1WHN A;  4GKK E;  4X65 E;  3WU4 A;  3ZM7 A;  1XMO E;  4B3S E;  4X65 I;  4WUB A;  1YYO A;  1HR0 I;  4B3S I;  3LLH A;  2V2V A;  3QT5 A;  5BR8 I;  1NHH A;  1HNZ E;  5BR8 E;  2L2N A;  2L33 A;  1ZM3 A;  3H4L A;  3P1X A;  1D6T A;  4YHH I;  3OTO E;  2DIX A;  5LMN E;  4JYA E;  4B3R E;  4DV0 I;  4HXZ A;  2UUA E;  2RSM A;  3ADJ A;  4NXM I;  4LF8 I;  4LFC I;  1A6F A;  4GKK I;  3ZKB A;  2HKJ A;  2N3H A;  2LRS A;  1WUU A;  2X36 A;  4X64 I;  2ZIT A;  2X7I A;  4JI1 I;  4JI1 E;  2CZ9 A;  1K47 A;  3ADI A;  1HNZ I;  2KHX A;  4DR4 E;  1STU A;  4K0K E;  1ZXM A;  5LMU E;  1H7S A;  1KKH A;  4X66 E;  1FKA E;  3T1H I;  4LF6 I;  4YHH E;  4ZVI A;  1ZBT A;  4DR3 I;  4OX9 E;  4JI6 I;  3ADG A;  4P7A A;  1J5E E;  1N34 I;  1NZ0 A;  5IT9 Q;  4LF7 E;  4M2Z A;  2LJH A;  4PU9 A;  2VQF I;  4LFC E;  3LNU A;  4M1K A;  1X48 A;  1IBM E;  4XTJ A;  4DV6 E;  1B62 A;  4UTG A;  4KHP E;  4WYQ B;  4DPW A;  3C4B A;  4WUD A;  2V2Q A;  1GQE A;  2HK2 A;  3PYG A;  2ZM6 E;  4DKK A;  4HYM A;  2ZM6 I;  2UUB I;  1H73 A;  4DR4 I;  1FJG E;  4X62 E;  4KQV A;  4ED4 A;  4DR7 E;  3JAM Q;  3ZZ0 A;  4DV2 E;  2B3T B;  4JI6 E;  2HK3 A;  4FWD A;  4B3T I;  2AJ4 A;  1EA6 A;  2CPN A;  3VYY A;  1IBL E;  4LF6 E;  4MYU A;  1OJ4 A;  2MDR A;  4DR3 E;  3B82 A;  2VQF E;  1UIL A;  1N34 E;  1XHK A;  4DV3 I;  1FWL A;  2L2M A;  1S16 A;  1Z59 A;  2NPF A;  4URL A;  2UUB E;  2LJP A;  4K0K I;  4X62 I;  1N32 E;  2UXD E;  4DR2 I;  4X64 E;  4LFA E;  4MYT A;  5GMD A;  5CFF E;  4USK A;  4DV2 I;  4DPT A;  1KTV A;  4LF5 I;  4DR7 I;  2VQE I;  2V2Z A;  4DPU A;  1YYW A;  2VQE E;  2A2C A;  1B63 A;  1PKP A;  3WU3 A;  2BM0 A;  2B7T A;  1Z0T A;  1IBM I;  4DV0 E;  4B3R I;  4OX9 I;  2J7K A;  4KHP I;  3K17 A;  5LL6 R;  1QZR A;  1IBK E;  1MX0 A;  3GON A;  2R3V A;  1IBK I;  1KIJ A;  4DUZ E;  1H7U A;  5FLX C;  2GS8 A;  3J80 Q;  4LF4 I; 
#chains in the Genus database with same CATH topology
 4LF4 E;  1Z5B A;  3V2U C;  5JEA E;  4EMD A;  3QG5 C;  1Z0V A;  2A2D A;  1XNQ I;  4YY3 I;  2UUC E;  1FI4 A;  4LFB I;  2E1R A;  4OZE A;  2DLQ A;  2B7V A;  1HK7 A;  2EZ6 A;  4HAC A;  4JI8 E;  2RTX A;  1HNX I;  2EWL A;  1ZM4 A;  4DR1 I;  2LV2 A;  1A1L A;  2LMZ A;  5K36 F;  2RQL A;  3ADL A;  3QT8 A;  4N3O A;  4OO1 D;  3GME A;  5IWA E;  4LFA I;  4BMJ A;  2WNR B;  2A25 A;  2C39 A;  1PIE A;  2EPX A;  1AAY A;  1XNR I;  4WFT A;  1N36 I;  3THO B;  4X66 I;  3LPS A;  5AE1 A;  2JE6 A;  3P3G A;  1T4O A;  1EI1 A;  2EN8 A;  2BV3 A;  5K36 C;  4WPY A;  2HKE A;  1OYS A;  2LBS B;  1P47 A;  3F0N A;  4X8W A;  3HQ1 A;  3J7A G;  1N33 E;  4UT4 A;  1PJQ A;  5KL3 A;  4AQY E;  3K1J A;  2JEA B;  1MG7 A;  1I94 I;  3PS3 A;  5DRO A;  1F2I G;  5IXM B;  1MEY C;  1T39 A;  1NHI A;  2H36 X;  5FLX Q;  4HTG A;  4WX9 A;  4WXD A;  4DR5 E;  2EML A;  2NUF A;  2OI2 A;  2YTF A;  3P76 A;  2EMF A;  1BB8 A;  5KL5 A;  1PVG A;  1Z0W A;  3D4J A;  3P3C A;  4DPY A;  2HFU A;  4DV6 I;  4YY3 E;  4JI5 E;  2DB2 A;  1T4L B;  4M9V C;  4LFB E;  5C0X E;  2EN1 A;  4PRV A;  2EQ1 A;  2BA0 G;  5K36 A;  2L2K B;  1HNX E;  4BA2 A;  3HTX A;  2V34 A;  1Z0G A;  3P06 A;  2BB8 A;  2L3J A;  2RPC A;  5DRR A;  4Q28 A;  4JI7 I;  5JEA D;  1MU5 A;  3MHH C;  1P42 A;  2EMB A;  3GCM A;  3V5R A;  3ZZT A;  2WCC 3;  4JI7 E;  1YUI A;  1H72 C;  1YYK A;  2Q2E B;  3P3E A;  2RS6 A;  1DGC A;  3M6A A;  2YSO A;  1X5W A;  4LCG A;  4AM3 A;  3Q1Q A;  2LJU A;  1BBG A;  1XMQ E;  1USU A;  3Q6N A;  4FW5 A;  2GHF A;  3LML A;  3T1H E;  1LLM C;  2R42 A;  5F3W A;  3QT6 A;  2JR1 A;  2I9I A;  2PO2 A;  2D9H A;  5IWA I;  2PO1 A;  2YPN A;  3J81 Q;  4IFD A;  2ZBK B;  1XNR E;  4LCH A;  2KON A;  2JP9 A;  3VHT B;  2WW4 A;  2V86 A;  2NA2 A;  4IFD D;  1QU6 A;  4DV4 E;  1N0V C;  2EM0 A;  2C37 A;  3B4T A;  2Z5C A;  3WU6 A;  2EOJ A;  4J8Z A;  4DV1 E;  1YFH A;  2JE6 B;  2HHH E;  2UUC I;  4P78 A;  1YZ9 A;  2KOU A;  2LUP B;  4FW6 A;  1DI2 A;  1G2D C;  4JI8 I;  2XEX A;  3JAM C;  2LTR A;  5C0X A;  4DR6 I;  2PNZ A;  2ENH A;  4DR1 E;  2LTS A;  5C0X D;  3RMP A;  2YTG A;  4IFD C;  4FW9 A;  1N32 I;  3K85 A;  4HAC B;  3DF6 A;  1N36 E;  2Z5E A;  1Z5A A;  2YTJ A;  1XNQ E;  2NUE A;  2WBU A;  3ZKD A;  1WJP A;  2FTX B;  2Q8U A;  4JYA I;  1PJT A;  2BA1 D;  3DD6 A;  3PS2 A;  2EOQ A;  4JI2 I;  4FWG A;  5GME A;  4IFD F;  2DEI A;  2O3Z A;  1BKN A;  2YTQ A;  2IER A;  4JI2 E;  1KYQ A;  1UBD C;  2LE2 A;  2E1M A;  4AQY I;  4B3M E;  4DU8 A;  3HUL A;  2IOQ A;  4DPX A;  2EOI A;  4IS1 C;  3BGH A;  4JI0 I;  2YU8 A;  3J7A M;  4U3D A;  2EM7 A;  1UDN A;  4L5N C;  4N4R B;  1A1K A;  4Z7Y A;  4ZYE A;  4QNK A;  2YTN A;  2WBS A;  1A1J A;  3EPJ A;  1VIS A;  2JEA A;  3M7N G;  2ODR C;  2EPC A;  4IS9 A;  3ZOQ B;  4U3B A;  3Q6M A;  1UHZ A;  2HHH I;  1XMO I;  1RQ0 A;  1YHC A;  4JI5 I;  2E5L E;  4DV1 I;  3BBG A;  1A1I A;  2GO4 A;  4FW3 A;  2DGC A;  1X6F A;  4ZYD A;  4USM A;  4ZYG A;  1I94 E;  1OYP A;  2DMY A;  2JEB B;  2LUQ A;  4DUZ I;  2HJJ A;  2EL5 A;  2ENA A;  3J80 C;  2V8P A;  4DV7 E;  1IQS A;  3MSW A;  2YT4 A;  2F4V E;  4IZK B;  1EH6 A;  2VE7 C;  4LU9 A;  4Z7C A;  3M85 G;  5KL4 A;  1VI7 A;  4R2S A;  5K36 B;  4DR2 E;  2UXD I;  4F6M A;  1XMQ I;  4LF9 I;  4RPF A;  3IWD A;  2VRD A;  4LTY A;  1R6M A;  1O0W A;  1S4E A;  5A6A A;  4OO1 F;  4MU4 A;  4R03 A;  4WUC A;  3VYX A;  5AE3 A;  2I13 A;  1Y4S A;  4BA1 B;  2UUA I;  2EMI A;  2V8Q B;  1ELO A;  4DU7 A;  2JYA A;  3H09 A;  4JV5 E;  1PJS A;  1U2R A;  4DV4 I;  2JY9 A;  2CSH A;  3EPL A;  2M9A A;  2C38 A;  2HFS A;  3IWB A;  3KRN A;  4OOG C;  4GKJ I;  4JI4 E;  1WRJ A;  1JK1 A;  2BBG A;  3FIG A;  1TF6 A;  3B8H A;  4JI4 I;  4B3M I;  3J7Y p;  1N33 I;  4WSP A;  3CWV A;  2YU5 A;  4IFD E;  2JXP A;  2C37 B;  1Z0C A;  2YTD A;  2WP8 B;  3J81 C;  1ZR9 A;  5A6B A;  1ZAA C;  2J7J A;  2EM5 A;  1RR9 A;  2EM4 A;  2CG9 A;  1HNW I;  2L92 A;  3WU5 A;  2WZO A;  1DQ3 A;  4MLQ A;  2EPP A;  4P7D A;  1B69 A;  2E5L I;  1ZBQ A;  5JEA A;  2EOZ A;  2EFG A;  3ZZU A;  1NHJ A;  1ZXN A;  3BID A;  1HR0 E;  4FWH A;  2CGE A;  5AC4 A;  2EOM A;  5KL7 A;  4F6N A;  4BC9 A;  5EL9 A;  4DV7 I;  2GQ0 A;  2F4V I;  5IT9 C;  4OO1 B;  1AH5 A;  4DV5 I;  2YZT A;  4B3T E;  1Z0E A;  3CDI A;  4LF7 I;  2M1S A;  4DV5 E;  4LOM A;  2CTD A;  2UXB I;  4BCA A;  2HC5 A;  1UEK A;  4QNJ A;  4DUY I;  4GKJ E;  2EOS A;  1N0U A;  2PO1 B;  5A6K A;  5A2Q C;  4DUY E;  3C4T A;  5A2Q Q;  3OTO I;  2ELZ A;  2ELY A;  2NN6 C;  4MDT A;  4ISA A;  4BA2 B;  2EN7 A;  2DMI A;  4WSG A;  4WXC A;  2EQ3 A;  4TUG A;  3T1Y E;  2VF3 A;  3PYF A;  4M30 A;  4DV3 E;  5KL2 A;  2NUG A;  1YPN A;  3PYD A;  1RC7 A;  2EPZ A;  3EPK A;  4I3H A;  2V89 A;  4PRX A;  2O1W A;  2YTO A;  4R2P A;  5DRP A;  5L3J A;  4F2J C;  2UU9 I;  1UDQ A;  2WP8 A;  4DR5 I;  2L6M A;  1OYR A;  2YRH A;  2UU9 E;  3JU0 A;  2E72 A;  3LTO A;  2PNZ B;  2YTI A;  4X9J A;  1FJG I;  2EOO A;  2BR2 A;  4DXL A;  2L3C A;  1FNM A;  2NN6 F;  5DNY A;  5LMU I;  4JI3 E;  2BM1 A;  4OKG A;  3OML A;  1H74 A;  4HY1 A;  5LMN I;  2YWQ A;  3DJW A;  2JVA A;  4LF5 E;  2EN3 A;  4DR6 E;  3L7Z B;  4JI3 I;  4FN5 A;  2EOE A;  5JEA B;  1Z5C A;  2DEJ A;  1WHQ A;  2NN6 B;  1FWK A;  4R8O A;  4JV5 I;  1J5E I;  4O24 A;  1GZ6 A;  4ZYH A;  4GZN C;  1Z0B A;  3VK6 A;  3F6H A;  4FK5 C;  4TUI A;  1PDA A;  2RS7 A;  4F54 A;  2GO3 A;  2Z5C B;  4LF9 E;  2LT7 A;  2PO2 B;  1ZM2 A;  4BA1 A;  1IBL I;  1X3C A;  1Y60 A;  4MU0 A;  3EQ1 A;  1YUJ A;  1DAR A;  1KVK A;  3QT7 A;  5C0X C;  5K36 D;  2YTP A;  1NCS A;  2N3G A;  4R2R A;  2EE8 A;  1J26 A;  3T1Y I;  4MU1 A;  4NXN I;  2EMA A;  4P52 A;  4NXM E;  4NXN E;  2EM3 A;  3HJC A;  4R1F A;  4O4K A;  1RRE A;  3PYE A;  4NBQ A;  5JEA F;  2UXC I;  2IHR 1;  4JI0 E;  2UXB E;  3B78 A;  2EMC A;  2UXC E;  2AE8 A;  1R6L A;  1EKZ A;  2K7I A;  2YSP A;  1TN9 A;  1T4N A;  3JTZ A;  1X49 A;  1HNW E;  4LF8 E;  1X47 A;  1ZM9 A;  4JG4 A;  1YH8 A;  4DR2 I;  1T38 A;  1WHN A;  4GKK E;  5A6J A;  4X65 E;  3WU4 A;  2JT2 A;  1XMO E;  2BA0 D;  3ZM7 A;  4B3S E;  3NZK A;  4X65 I;  4WUB A;  3HXL A;  4FW4 A;  2MC5 A;  4NHR A;  1YYO A;  1HR0 I;  4B3S I;  1Y5Y A;  3GLL A;  3ECR A;  3LLH A;  3C6M A;  2V2V A;  2RSI A;  3QT5 A;  5TSE A;  2EOR A;  2J65 A;  1NHH A;  5BR8 I;  2DSY A;  2MDG A;  1HNZ E;  2M4I A;  2L2N A;  2L33 A;  2EJ4 A;  5BR8 E;  1ZM3 A;  2IOP A;  2EOF A;  3H4L A;  4BBY A;  4HEI A;  3P1X A;  1D6T A;  2YRM A;  4YHH I;  3OTO E;  3HKM A;  2DIX A;  2HGH A;  5LMN E;  4JYA E;  5FWK A;  1GTK A;  4B3R E;  4DV0 I;  4HXZ A;  3EPH A;  5ELW A;  2R76 A;  2UUA E;  5A6B D;  2JEB A;  2CT1 A;  1X6E A;  1XXE A;  2RSM A;  4O5G A;  4LPF A;  2G7H A;  1JK2 A;  2EOY A;  2F8B A;  2Z5B B;  3PS1 A;  3ADJ A;  4IZJ A;  4MQY A;  4NXM I;  4LF8 I;  2NAB A;  4LFC I;  1A6F A;  4GKK I;  3ZKB A;  3HPZ A;  2N3H A;  1IQO A;  2LRS A;  2V83 A;  3AV0 A;  2HKJ A;  1WUU A;  2X36 A;  1ZU1 A;  2EOH A;  2EMK A;  2O1U A;  4X64 I;  2ZIT A;  2EMX A;  2X7I A;  2EM9 A;  4JI1 I;  2EPR A;  4BC7 A;  5K36 E;  2EN6 A;  2JWO A;  4JI1 E;  2CZ9 A;  1K47 A;  2EM8 A;  2JOX A;  2JPA A;  3ADI A;  1IMU A;  1HNZ I;  2V88 A;  3THN A;  2KHX A;  4KZS A;  2EQ0 A;  4DR4 E;  2DLK A;  5ADZ A;  1STU A;  2NN6 E;  3L7Z A;  4K0K E;  2EN4 A;  2BA1 G;  4R2A A;  1ZXM A;  5LMU E;  1X6H A;  2MC6 A;  1H7S A;  1KKH A;  1NEI A;  4X66 E;  1FKA E;  3T1H I;  3HPS A;  2EL6 A;  4IJD A;  4F9C B;  4LF6 I;  1EH7 A;  4GEQ B;  4YHH E;  4ZVI A;  4L8N A;  1ZBT A;  4DR3 I;  4OX9 E;  1L4S A;  2K4V A;  3ADG A;  4JI6 I;  4P7A A;  4AIM A;  3M99 B;  1J5E E;  1NZ0 A;  1N34 I;  5IT9 Q;  2N8X A;  4LF7 E;  4GQU A;  4FW7 A;  1Y6Z A;  2LVH A;  2R1F A;  3KZY A;  3AUZ A;  4M2Z A;  1RHY A;  5AAS A;  3UK3 C;  2EMH A;  2LJH A;  4PU9 A;  4IFD B;  2VQF I;  4LFC E;  3LNU A;  4M1K A;  1X48 A;  1SFE A;  3MHS C;  1WXR A;  1A1F A;  1IBM E;  4XTJ A;  4DV6 E;  2DRP A;  1B62 A;  4UTG A;  5IV8 B;  1UN6 B;  4KHP E;  2EPU A;  4F9B B;  4WYQ B;  4DPW A;  4Q35 B;  3C4B A;  4WUD A;  2V2Q A;  1GQE A;  2HK2 A;  3PYG A;  2LO3 A;  2PRT A;  2EMW A;  2ZM6 E;  4DKK A;  4F9A B;  4HYM A;  2ODR D;  2ZM6 I;  2ENC A;  4DMI A;  2UUB I;  5C0X B;  2EL4 A;  5AC5 A;  1H73 A;  4DR4 I;  1FJG E;  3KZZ A;  3BF2 A;  3TQM A;  2EN2 A;  4X62 E;  4KQV A;  4ED4 A;  2EMY A;  2YTE A;  1UDS A;  2NN6 A;  4BS9 A;  1MGT A;  4DR7 E;  1EH8 A;  3JAM Q;  3UHM A;  2WNR A;  1SR9 A;  3ZZ0 A;  4DV2 E;  2B3T B;  2JOB A;  4BHC A;  5T6J A;  4JI6 E;  2HK3 A;  4FWD A;  1E3P A;  1TF3 A;  5JEA C;  4KWY A;  3L00 A;  2PNM A;  4B3T I;  4R2Q A;  5KL6 A;  2AJ4 A;  3IWC A;  3C6K A;  4RHB B;  2EM6 A;  4IZK A;  3KWR A;  2YRK A;  2WBT A;  4R2C A;  2CPN A;  1EA6 A;  2VES A;  3VYY A;  1IBL E;  3M7N D;  4LF6 E;  2F1D A;  2EMZ A;  4MYU A;  1OJ4 A;  2MDR A;  4IZJ D;  4DR3 E;  2GLI A;  3B82 A;  2VQF E;  4LCF A;  1KJK A;  3PRY A;  1UIL A;  1N34 E;  1XHK A;  4J3D A;  4AID A;  4DV3 I;  1RMD A;  1FWL A;  2L2M A;  1S16 A;  1Z59 A;  2EPK X;  4I8O A;  2CVE A;  2NPF A;  4OO1 A;  4URL A;  3M85 D;  2UUB E;  2BR2 B;  2EP3 A;  3K6Q A;  2LJP A;  5DNL A;  4K0K I;  4X62 I;  1UDO A;  2V87 A;  1N32 E;  2UXD E;  2EM2 A;  4X64 E;  1A1G A;  4LFA E;  4RH8 A;  2EPN A;  2C38 B;  4MYT A;  2GPI A;  5GMD A;  4OO1 E;  2PO0 A;  5CFF E;  4USK A;  4DV2 I;  3U1K A;  4DPT A;  1KTV A;  2VF1 A;  4R2E A;  2MKD A;  2LCE A;  4LF5 I;  4DR7 I;  5DNX A;  4OO1 C;  2NN6 D;  4BHB A;  2VQE I;  1USV A;  2V2Z A;  4DPU A;  1YSA C;  1YYW A;  2VQE E;  2FGG A;  2A2C A;  1B63 A;  1PKP A;  1A1H A;  2EPO A;  1N3G A;  2O1V A;  3WU3 A;  2O1T A;  2ADR A;  1BBO A;  3CDJ A;  1Y4U A;  2L8T A;  3U1Y A;  2EPA A;  5AE2 A;  2BM0 A;  2EPM X;  2MKN A;  2B7T A;  5LLQ A;  1QNT A;  5DRQ A;  3F6G A;  1Z0T A;  1IBM I;  4DV0 E;  2Z5B A;  4IZJ B;  4OX9 I;  2PO0 B;  2J7K A;  2PNL A;  4B3R I;  5A69 A;  4KHP I;  2EMG A;  1E3H A;  2V85 A;  2IES A;  5C0X F;  5LL6 R;  3K17 A;  1QZR A;  4O43 A;  1IBK E;  2EOX A;  1MX0 A;  3GON A;  2R3V A;  2EPL X;  5EKW A;  1IBK I;  1KIJ A;  4DUZ E;  4NZV A;  2B9D A;  1H7U A;  1Z1B A;  5FLX C;  2GS8 A;  4M0V A;  2C39 B;  4R2D A;  3H1C A;  4MU3 A;  3J80 Q;  4LF4 I;  2M7Q A;  2FV4 B;  1G2F C;  4MLV A; 
#chains in the Genus database with same CATH homology
 4LF4 E;  1Z5B A;  3V2U C;  4EMD A;  1Z0V A;  2A2D A;  1XNQ I;  4YY3 I;  2UUC E;  1FI4 A;  4LFB I;  2E1R A;  2B7V A;  1HK7 A;  2EZ6 A;  4HAC A;  4JI8 E;  2RTX A;  1HNX I;  2EWL A;  1ZM4 A;  4DR1 I;  2LMZ A;  3ADL A;  3QT8 A;  4N3O A;  5IWA E;  4LFA I;  4BMJ A;  1PIE A;  1XNR I;  4WFT A;  1N36 I;  4X66 I;  3LPS A;  5AE1 A;  1T4O A;  1EI1 A;  2BV3 A;  4WPY A;  2HKE A;  2LBS B;  3F0N A;  4X8W A;  3HQ1 A;  3J7A G;  1N33 E;  4UT4 A;  4AQY E;  3K1J A;  1MG7 A;  1I94 I;  5FLX Q;  1NHI A;  2H36 X;  4DR5 E;  2NUF A;  2OI2 A;  1Z0W A;  1PVG A;  3D4J A;  4DPY A;  4DV6 I;  2HFU A;  4YY3 E;  4JI5 E;  2DB2 A;  1T4L B;  4LFB E;  4PRV A;  2L2K B;  1HNX E;  3HTX A;  2V34 A;  1Z0G A;  3P06 A;  2L3J A;  4Q28 A;  4JI7 I;  1MU5 A;  3V5R A;  3ZZT A;  4JI7 E;  1H72 C;  1YYK A;  2Q2E B;  2RS6 A;  3M6A A;  3Q1Q A;  1XMQ E;  1USU A;  3Q6N A;  3LML A;  3T1H E;  2R42 A;  5F3W A;  3QT6 A;  2JR1 A;  5IWA I;  3J81 Q;  2ZBK B;  1XNR E;  2KON A;  2WW4 A;  2V86 A;  2NA2 A;  1QU6 A;  4DV4 E;  1N0V C;  2Z5C A;  3WU6 A;  4J8Z A;  4DV1 E;  2HHH E;  2UUC I;  4P78 A;  1YZ9 A;  2KOU A;  2LUP B;  1DI2 A;  4JI8 I;  2XEX A;  3JAM C;  2LTR A;  4DR6 I;  4DR1 E;  2LTS A;  3RMP A;  4FW9 A;  1N32 I;  3K85 A;  4HAC B;  3DF6 A;  1N36 E;  2Z5E A;  1Z5A A;  1XNQ E;  2NUE A;  3ZKD A;  2FTX B;  4JYA I;  4JI2 I;  4FWG A;  5GME A;  2DEI A;  1BKN A;  4JI2 E;  2E1M A;  2LE2 A;  4AQY I;  4B3M E;  4DU8 A;  3HUL A;  2IOQ A;  4DPX A;  4JI0 I;  3J7A M;  4L5N C;  4Z7Y A;  1VIS A;  2ODR C;  4JI5 I;  3ZOQ B;  2HHH I;  3Q6M A;  1UHZ A;  1XMO I;  1RQ0 A;  2E5L E;  4DV1 I;  4USM A;  1I94 E;  2DMY A;  2LUQ A;  4DUZ I;  3J80 C;  2V8P A;  4DV7 E;  3MSW A;  2YT4 A;  2F4V E;  4IZK B;  2VE7 C;  4LU9 A;  4Z7C A;  4DR2 E;  2UXD I;  1XMQ I;  4LF9 I;  4RPF A;  3IWD A;  4LTY A;  1S4E A;  1O0W A;  4R03 A;  4WUC A;  3VYX A;  5AE3 A;  1Y4S A;  2UUA I;  2V8Q B;  1ELO A;  4DU7 A;  3H09 A;  4JV5 E;  1U2R A;  4DV4 I;  2JY9 A;  2HFS A;  3IWB A;  4OOG C;  4GKJ I;  4JI4 E;  3FIG A;  3B8H A;  4JI4 I;  4B3M I;  3J7Y p;  1N33 I;  4WSP A;  3CWV A;  1Z0C A;  3J81 C;  1RR9 A;  2CG9 A;  1HNW I;  2L92 A;  3WU5 A;  2WZO A;  1DQ3 A;  4P7D A;  2E5L I;  1ZBQ A;  2EFG A;  3ZZU A;  1NHJ A;  1ZXN A;  1HR0 E;  4FWH A;  2CGE A;  4DV7 I;  4BC9 A;  2GQ0 A;  2F4V I;  5IT9 C;  4DV5 I;  2YZT A;  4B3T E;  1Z0E A;  4LF7 I;  2M1S A;  4DV5 E;  2UXB I;  4BCA A;  1UEK A;  4DUY I;  4GKJ E;  1N0U A;  5A2Q C;  4DUY E;  5A2Q Q;  3C4T A;  3OTO I;  4TUG A;  3PYF A;  3T1Y E;  2VF3 A;  4M30 A;  4DV3 E;  2NUG A;  3PYD A;  1RC7 A;  4I3H A;  2V89 A;  4PRX A;  2O1W A;  5L3J A;  2UU9 I;  4DR5 I;  2L6M A;  2UU9 E;  3JU0 A;  3LTO A;  1FJG I;  4DXL A;  2L3C A;  1FNM A;  5DNY A;  5LMU I;  4JI3 E;  2BM1 A;  3OML A;  1H74 A;  4HY1 A;  5LMN I;  3DJW A;  2JVA A;  4LF5 E;  4DR6 E;  4JI3 I;  4FN5 A;  1Z5C A;  2DEJ A;  1WHQ A;  1FWK A;  4R8O A;  4JV5 I;  1J5E I;  1GZ6 A;  1Z0B A;  3VK6 A;  3F6H A;  4TUI A;  2Z5C B;  2RS7 A;  4F54 A;  4LF9 E;  1ZM2 A;  1IBL I;  1DAR A;  1KVK A;  3QT7 A;  2N3G A;  1J26 A;  3T1Y I;  4NXN I;  4P52 A;  4NXM E;  4NXN E;  3HJC A;  4R1F A;  2UXC I;  1RRE A;  3PYE A;  2IHR 1;  4JI0 E;  2UXB E;  3B78 A;  2UXC E;  1EKZ A;  1T4N A;  3JTZ A;  1X49 A;  1HNW E;  4LF8 E;  1X47 A;  1ZM9 A;  4JG4 A;  1WHN A;  4GKK E;  4X65 E;  3WU4 A;  3ZM7 A;  1XMO E;  4B3S E;  4X65 I;  4WUB A;  3HXL A;  2MC5 A;  1YYO A;  1HR0 I;  4B3S I;  3LLH A;  2V2V A;  3QT5 A;  5BR8 I;  1NHH A;  2DSY A;  1HNZ E;  2M4I A;  2L2N A;  2L33 A;  5BR8 E;  1ZM3 A;  2IOP A;  3H4L A;  4BBY A;  3P1X A;  1D6T A;  4YHH I;  3OTO E;  2DIX A;  5LMN E;  4JYA E;  5FWK A;  4B3R E;  4DV0 I;  4HXZ A;  2UUA E;  2RSM A;  2G7H A;  2F8B A;  2Z5B B;  4IZJ A;  3ADJ A;  4NXM I;  4LF8 I;  4LFC I;  1A6F A;  4GKK I;  3ZKB A;  3HPZ A;  2N3H A;  2HKJ A;  2LRS A;  2V83 A;  3AV0 A;  1WUU A;  2X36 A;  2O1U A;  4X64 I;  2ZIT A;  2X7I A;  4JI1 I;  4BC7 A;  2JWO A;  4JI1 E;  2CZ9 A;  1K47 A;  2JOX A;  3ADI A;  1HNZ I;  2V88 A;  2KHX A;  4KZS A;  4DR4 E;  5ADZ A;  1STU A;  4K0K E;  1ZXM A;  5LMU E;  2MC6 A;  1KKH A;  1H7S A;  4X66 E;  1FKA E;  3T1H I;  3HPS A;  4F9C B;  4LF6 I;  4GEQ B;  4YHH E;  4ZVI A;  4L8N A;  1ZBT A;  4DR3 I;  4OX9 E;  2K4V A;  3ADG A;  4JI6 I;  4P7A A;  1J5E E;  1N34 I;  1NZ0 A;  5IT9 Q;  4LF7 E;  1Y6Z A;  3AUZ A;  4M2Z A;  5AAS A;  2LJH A;  4PU9 A;  2VQF I;  4LFC E;  3LNU A;  4M1K A;  1X48 A;  1WXR A;  1IBM E;  4XTJ A;  4DV6 E;  1B62 A;  4UTG A;  4KHP E;  4F9B B;  4WYQ B;  4DPW A;  3C4B A;  4WUD A;  2V2Q A;  1GQE A;  2HK2 A;  3PYG A;  2ZM6 E;  4DKK A;  4F9A B;  4HYM A;  2ODR D;  2ZM6 I;  4DMI A;  2UUB I;  1H73 A;  4DR4 I;  1FJG E;  4X62 E;  4KQV A;  4ED4 A;  4BS9 A;  4DR7 E;  3JAM Q;  3ZZ0 A;  1SR9 A;  4DV2 E;  2B3T B;  2JOB A;  4JI6 E;  5T6J A;  2HK3 A;  4FWD A;  2PNM A;  4B3T I;  2AJ4 A;  3IWC A;  4IZK A;  3KWR A;  1EA6 A;  2CPN A;  3VYY A;  1IBL E;  4LF6 E;  4MYU A;  1OJ4 A;  2MDR A;  4IZJ D;  4DR3 E;  3B82 A;  2VQF E;  3PRY A;  1UIL A;  1N34 E;  1XHK A;  4DV3 I;  1FWL A;  2L2M A;  1S16 A;  1Z59 A;  4I8O A;  2NPF A;  4URL A;  2UUB E;  3K6Q A;  2LJP A;  4K0K I;  4X62 I;  2V87 A;  1N32 E;  2UXD E;  4DR2 I;  4X64 E;  4LFA E;  4MYT A;  5GMD A;  5CFF E;  4USK A;  4DV2 I;  4DPT A;  1KTV A;  2VF1 A;  4LF5 I;  4DR7 I;  2VQE I;  1USV A;  2V2Z A;  4DPU A;  1YYW A;  2VQE E;  2FGG A;  2A2C A;  1B63 A;  1PKP A;  2O1V A;  3WU3 A;  2O1T A;  1Y4U A;  2L8T A;  5AE2 A;  2BM0 A;  2B7T A;  3F6G A;  1Z0T A;  1IBM I;  4DV0 E;  2Z5B A;  4IZJ B;  4OX9 I;  4B3R I;  2J7K A;  2PNL A;  4KHP I;  2V85 A;  5LL6 R;  3K17 A;  1QZR A;  1IBK E;  1MX0 A;  3GON A;  2R3V A;  1IBK I;  1KIJ A;  4DUZ E;  2B9D A;  1H7U A;  5FLX C;  2GS8 A;  4M0V A;  3J80 Q;  4LF4 I;  2M7Q A;  2FV4 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...