1N36O

Structure of the thermus thermophilus 30s ribosomal subunit in the presence of crystallographically disordered codon and near-cognate transfer rna anticodon stem-loop mismatched at the second codon position
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
88
structure length
88
Chain Sequence
PITKEEKQKVIQEFARFPGDTGSTEVQVALLTLRINRLSEHLKVHKKDHHSHRGLLMMVGQRRRLLRYLQREDPERYRALIEKLGIRG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S RIBOSOMAL RNA
publication title Selection of tRNA by the Ribosome Requires a Transition from an Open to a Closed Form
pubmed doi rcsb
molecule tags Ribosome
total genus 29
structure length 88
sequence length 88
ec nomenclature
pdb deposition date 2002-10-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
O PF00312 Ribosomal_S15 Ribosomal protein S15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.10 Mainly Alpha Orthogonal Bundle Helix Hairpins S15/NS1, RNA-binding 1n36O00
5LMUO 4LF6O 5H5NA 4KHPO 2VQFO 4LF7O 2HHHO 4DR7O 2LW7A 1DK1A 4LF8O 4DR5O 3F5TA 4DV4O 4AQYO 1XNRO 1G1XB 4JI1O 4NXMO 2Z0AA 4X62O 2ZKOA 4DV3O 2UXCO 2N74A 1AILA 4K0KO 4OPAA 4YY3O 4JI5O 3JAMN 4DV6O 4DV5O 4LFBO 5BY1A 5IT9N 1HR0O 1J5EO 2AGAA 4LFAO 1FYJA 3R66A 1X59A 5BXZA 4JI3O 5BR8O 1XEQA 4YHHO 4JI7O 4JI6O 5LL6Y 3T1HO 1N32O 4DR6O 4DUZO 2JRIA 4JI4O 1HNXO 1N34O 1I94O 1D2DA 4JI2O 3SDLA 2VQEO 4DV1O 3O65A 3T1YO 3J7AU 1NS1A 4JV5O 4GKJO 5LMNO 5IWAO 3OTOO 2FKXA 4JYAO 5FLXN 4B3TO 1F7YA 4NXNO 1XMQO 3J81N 1N33O 1XNQO 1N36O 4B3MO 4GKKO 4B3RO 2UUCO 4X66O 4DR1O 3M8AA 2UUAO 4DR2O 4JI0O 4OPHA 2UXDO 4LF4O 2UU9O 4DR3O 4OX9O 1IBMO 4A5UB 1IBKO 1KUQA 4X65O 5A2QN 4DV7O 4X64O 4DV2O 1R1BA 3J80N 4JI8O 4DR4O 1IBLO 4LF9O 1YZBA 1R6TA 4B3SO 4LFCO 4DUYO 1FKAO 1HNWO 1FJGO 4LF5O 2UXBO 2F4VO 2UUBO 2DJVA 1A32A 2E5LO 4DV0O 2DOSA 1HNZO 3RT3C 2ZM6O 1AB3A 1XMOO
chains in the Genus database with same CATH superfamily
2Q7EA 4KHPO 1LUWA 3U10A 5J2TB 3K03A 1Y67A 4DV4O 2BCCH 4NYKA 1F51A 4EFEA 3OE7G 4FVMA 5IDJA 4NKGB 2R9AA 3E2EA 4LFBO 2GTSA 3OMIB 1RFYA 1XQ8A 1LR1A 1TAEA 5F2VO 4P9OA 2Q0OC 1M90W 2YXHA 3OT7A 4X1YA 1QLNA 4XDLA 4AHCA 3AK3A 1OCZC 1N34O 4H37A 4KL1A 4J9YB 4JI2O 1SC5B 2YXLA 3RYHA 4PA3A 5IJ9B 4GKJO 1IZ3A 3E8FA 5LMNO 2EJRA 2BOBC 1B3QA 3MAQA 3JD2A 2JVDA 1BHAA 1YIJV 3EVKA 1M57B 1GMGA 2HEPA 4PELA 1XNQO 1GN2A 5CN0A 1G8MA 1MNGA 4B7EA 4RUEA 3BY6A 1RP3B 3FB7C 4PDLA 1IBKB 5GONB 1TUEB 1WNSA 1YEWA 2HLDG 1JOYA 2XOKG 4DV2B 3RYFA 1Z5WA 4EFBA 2XASA 1JA8A 2ODMA 4MVQA 4PA4A 2Y69B 4ZI7B 2ZINA 4DR4O 2DYRB 1L0LH 1IBLO 1R6TA 4O2AA 3T1CA 1JX9A 4JZGA 2KG7B 5EZYA 1J5EB 5H2FZ 4UCUA 1T5EA 1M56C 1XUQA 3LNNA 4EB6A 3A2FA 2XAHA 4I4TA 3FYEB 1U97A 3ZRXA 3CRMA 2P90A 1NH2B 4CC6A 2JGDA 4O4JA 3ZIAG 2IJJA 5H6QA 3WB2A 3ZHRA 2LW7A 3NXSA 4C7UA 2XUMA 1S77D 2D3OW 1I5YA 1UJWB 1I7FA 2QEXV 4I9WA 3K79A 1Y4MA 5LBQA 4LNUB 2ZKOA 3ZEDA 4U3JA 5EIBD 2H94A 1TVKA 1KQSU 2EIMB 1E1QG 2PTMA 5C8YB 4JI7B 1O9HA 5E79Z 3FD9A 2A9HA 2EJ7A 1N0JA 3K57A 1AP5A 4Q20A 3OGCC 3ZHTA 3UT5B 2GUZA 1IXBA 1PNLA 2OIEA 3GB7C 2P5OA 2HR3A 3QG5A 3CCQV 2F1MA 2VQEO 4X64B 3J7AU 2LP7A 4CH3A 4G27B 1G6UA 3K04A 2JJ1G 5KHHA 5EC1C 4F4LA 3JATA 5EBWC 3X2QB 2DQ0A 1M1KW 3SJCC 2KSDA 1BL8A 3ZMSA 1MZFA 1VF6A 4PDRA 2PF4E 1L8DA 2Y0IA 3OW2U 2UU9B 5CA3A 2LQTA 2GV9A 5L3FA 3OM3B 3N2KB 1GN6A 2DQ3A 4ZHQA 2WAMA 3EXAA 4LFCB 3JARA 4X1KA 3CXHF 1VQPV 4QGPA 4D6TH 2EINB 4JI8O 2N04A 2UXXA 1VQOV 1ZL8A 5BZBA 4LF5O 2W6IG 5FPRA 1TA8A 3T4DA 4KHPB 3AG2B 4I4TB 1Q6HA 3CC4V 4G2KA 1OZ0A 1V54B 1F4MA 1QU7A 2Y4UA 2GSMB 1I08A 2IW5A 4W4LA 1RSOA 1I94B 1HP8A 4WFHA 4DR7O 2RMKB 4DV1B 1MSDA 1WB8A 2WLNA 3C90A 4CH4A 3CX5F 4DW0A 3U11A 4J10A 4LFBB 1D5NA 2FTKA 3TCUA 4JI5O 4J42A 2ZIMA 1O9GA 1DGSA 4IT5A 1NJIW 2X6AA 1XL4A 1U96A 2F23A 3ZHQA 1N34B 4QE9A 1JFFB 4PA7A 1XHXA 3CMEV 1N32O 1H8HG 1N0NA 4DR6O 4GKJB 4JI4O 2W0FC 2A0LA 4FLUA 4RUFA 3O65A 3STZC 3FB8C 2ZNJA 2AZ2A 3WG7B 3CMAV 2RN9A 3VBBA 4JAAA 4RWUA 4TV8A 3M99B 4I7ZB 1N36O 1NVPD 2LJ2A 2EILB 2UUAO 3BAAA 1FXHA 4E4EA 3ZN0A 5FL7G 2YI8A 4ZOLB 5IYDO 1DTOA 4Z1VA 5L3EA 2CK3G 4DR4B 1IBLB 3HKEA 3T4ZA 5CB4A 3AG7A 3HPLC 3L75H 1NVPB 2P4KA 4LR3A 4X1KB 2OTJV 3B8NA 3ABKB 5DEDA 3CCEV 3MHHC 2N05A 4DXWA 2K9PA 1AI4A 4FM1A 2NN4A 3ASNC 2X7RB 3K08A 4DK0A 2ZM6O 1SERA 3SYPA 4RQEA 2B9ZA 1EN5A 1JVMA 4J7KA 3GWKC 3ASOC 2EIKB 1Q90D 1VEWA 2AZ0A 5IYBO 4G28B 1VQ8V 1SA0B 1TUBB 4U3FH 1YJNV 2WLLB 5IYCO 3P30A 2V4DA 3DXRB 2A06H 4JYAB 3E8GA 4UUJC 5FNVA 1AJPA 1Q3EA 1AR1B 1UFIA 3ZN1A 1OCCC 5KMGB 5KHKA 3JAWA 1HR0O 4CS3A 2ZDIA 4LFAO 2F43G 4DR1B 5LOVB 5EBLC 5DM6V 1Q7YW 4GYCB 2YIBA 4JI6O 4U7OA 1KD1W 5JQGA 5B3SC 1M4UA 2X0LA 2A79B 2BTQB 3E22B 5ITZA 2V1DA 4QPKA 1LNQA 4MVUA 5AG2A 1KKDA 2WLHA 1CXZB 2OCCB 1Y76A 2PY5A 2CTWA 1ZAUA 2FL4A 2JS5A 3QNEA 1KP3A 1S76D 3JD0A 1QQCA 4LF6B 3ABMB 2HKOA 5B1BC 4JI0O 2VQFB 1SQVH 2AHYA 4WBNB 2BOCC 4JI8B 3K9SA 4X20B 2GHYA 1NKDA 3JSNA 5J2UB 4QJFB 5DECA 2B1IA 3K06A 1B6QA 4B3SO 5CBFA 1OCRB 4U7NA 1WA8B 1DF5A 4BW9A 1Q86W 1J95A 1QHTA 2X6BA 3DTUB 1HW7A 1L1FA 3B8MA 3KCXA 5CBHA 2ILMA 1BSMA 3CE2A 4PDVA 1BMFG 4HBNA 4X1IA 4BIZA 4FLZA 4DR5O 2DWEC 3T1YB 3CD6V 3VQYA 4K8XA 4JI5B 1G1XB 1KKCA 5JJNB 1RM1B 1M93A 3AG1B 2N74A 4GUNA 3SR2C 4FMTA 4UCSA 1KYOF 2BSKB 4WF9V 1Q5OA 3W7XA 3MD0A 4B3MB 1J5EO 3OMNB 4GX1A 1N32B 1FYJA 4UFZA 4HNAB 4EEQA 4JI4B 4DR2B 5J2TA 3NR7A 4BWAA 4N21A 2EIJC 1AI6A 2WLMA 3SDLA 2WSSG 1OCOB 1QR8A 1YI2V 5CA0B 4TV9B 2JEXA 1COWG 5FLXN 1VF6C 1HNWB 2DYSB 1Q43A 5JVDB 4JTAB 3SJBC 2ZR3A 3SYCA 1KECA 2X6CA 4B3RO 2BTOA 4WFBV 3LSUA 4YJ3B 5LGTA 1FXVA 1SF9A 5IE9A 2QM7A 4LC1A 3GWOA 3U0ZA 3ZRSA 5IJ9A 2IM9A 3FAVB 5B1AB 1PL4A 4GX2A 4JASA 1IX9A 3R65A 5EBMC 4X64O 4ZKIA 3E8BA 4LBEC 1V55B 4N23A 2KQXA 1AI5A 4KP4A 4UCVA 2ZM6B 2LFSA 3JASB 3WB1A 1DF4A 3ICXA 5GONA 4MVSA 2Y0PA 1BQZA 1RPOA 4FLYA 1QLEC 4H13B 2DW4A 3VQVA 4ZI7A 3SYOA 1FXKC 4WFFA 4AI8A 3QVNA 4JV5B 3B77A 2EBOA 2KG7A 1SQFA 4D7SA 1MG1A 1Y6XA 2F66C 2IH1C 3AG4C 2WWWA 2LFRA 3AG3B 1WN7A 4JI6B 1HWYA 4MVMA 4GT1A 3R66A 4LCUC 2E3CA 1XBLA 5E1AC 2OWOA 1YJWV 4JAUA 1SQXH 2Z5UA 3ABTA 4DR3B 1I94O 4LNUA 1OJHA 1YTFB 4DV1O 3JD3A 4UCOA 4D7TA 1VF7A 2L6LA 4TT3G 2P06A 5C8YA 4JYBA 5IYZB 3PN1A 3OEEG 3CCLV 3HKBB 1AVMA 3OUFA 4JI0B 1QVGU 1AI7A 3THOA 2IJIA 3UT5A 1XMOB 4IHJA 4W4KA 3AK1A 2ITCC 1JQ0A 4LF4O 2Y48A 1KMIZ 2HJFC 1KU9A 3D3QA 4B3SB 4WFAV 3CS5A 4OXSA 3I56V 2MW2B 2XAGA 4X62B 4HYOA 2CTRA 3RWRD 3G6EV 5LXTB 5B5EZ 1EM1A 2VWKA 2KB1A 4P30A 1CP9A 3H1IH 1NTZH 1ZX3A 1GM8A 4I0XB 3N2KA 3SYAA 4DR5B 1AB3A 3E86A 2EULA 1NH2D 3SJQC 3BA9A 3RYIB 1MZEA 3HKDB 5KA6A 2NLJC 2Z0AA 3OFNG 2Q8VA 1SKVA 3KCYA 4R50A 3ZHUA 3G4SV 3JAMN 4IL6Z 4DRXB 3ZJZA 1N4CA 4R8CA 5IJ0B 4FLWA 2AGAA 3JD4A 1SQGA 3CPWU 1B06A 2R9RB 3UQ8A 1URFA 5KUKA 4YJ2B 5BR8O 1E1RG 1QR9A 3K59A 4K8ZA 3ABLC 1K4CC 1YF2A 4IYHA 1D2DA 3TK1A 4PHZA 4BR6A 1GN3A 4Z2WA 4B08A 1XOUA 2YEVB 3P3NA 1EN4A 3BABA 4JYAO 4B3RB 2A7WA 2NR5A 2XNDG 2YSUB 4JGSA 4JAVA 4NXNO 4TOIA 3UO3A 2UXBB 3SPHA 2P22C 1NTKH 1JFFA 3RVZA 1XDCA 2JIZG 2DN9A 4DR1O 4WFEA 3CJHB 2PI5A 5LHGA 4IHJB 3H1HH 2DE0X 3HR0A 1EZVH 4LF8B 5K1XA 1YDXA 1XNRB 1I5XA 3LNMB 1D5AA 3RVYA 4E2LA 1BS3A 3JD1A 3ZHVA 3E83A 2RNBA 1BCCH 4BAYA 4F6RB 1EFRG 1NQTA 4PDMA 3O9OA 3JCUZ 4J7ZA 4GZRB 4ZOLA 3JYCA 4K3AA 1SZTA 2F95B 1FD9A 2Q68A 3CRRA 2P7TC 4LF6O 4O4LB 2VQFO 5KHIA 1M9NA 1BT8A 4UB6Z 5L3DA 2WA4A 3D8CA 2XHBA 1N8RW 2W0XA 5KHJA 3DC6A 2C2AA 1YITV 5J9PC 5GTIZ 3A8TA 1QBZA 1VMGA 4UVCA 4UV9A 1BHBA 3L74H 2WA3A 4HZ3A 2XAFA 2MK3A 4X8AA 5IT9N 5B1BB 2B1GA 1Q6IA 1SZXA 3K5OA 4LH6A 5LP6C 5B1OA 1SA0A 1TUBA 4PA9A 3OMAB 4Z1MG 1LUVA 2WLLA 4TUYB 4TSFG 2H3OA 4LP8A 4J80A 3DXRA 3T1YO 1FS0G 5KMGA 2D2CB 1H2LA 5LOVA 4JYCA 4IGGA 2XAQA 1S3JA 2IJKA 4MTOA 5KA5A 4B3MO 4GKKO 1ORQC 4MT8A 4LF4B 3M8AA 5IY5B 2OIGA 4UVAA 4DR2O 2FB5A 1ZLZA 2BTQA 3E22A 2EZPA 1VQMV 4FLTA 1FAFA 2HHHB 1JCHA 1M57C 1JJ2U 3BCCH 5GTHZ 1THZA 4P9PA 3K0DA 4MVZA 4CC5A 3J80N 1YZBA 3C3TA 2YUAA 4DUYO 1BQ0A 1HNWO 1WPXA 4RO2A 2UUBO 3BEHA 3MHSC 4XDJA 1XREA 2P4VA 2Y69C 4Q6GA 5KAIZ 4WBNA 2E74B 1MSWD 2QTSA 2DYRC 4X20A 2QSAA 5J2UA 3ZBHA 4L87A 4DUZB 2H8PC 4NB5A 3SPJA 3ZHSA 3ETDA 1Y66A 1ENVA 4NVPA 1K33A 1PM9A 4J7JA 2ZXWB 1WA8A 4NXMO 4YIOA 3WU2Z 4ABMA 4GLXA 4MTFA 3CSXA 3BHPA 1K7DA 5BR8B 1W2BU 1W59A 2JJ2G 4O4IB 4LH7A 2F93B 1K97A 4K35A 3CHXA 1VQ6V 5EC2C 3UCSC 2EIMC 3APOA 3K0GA 4MW3A 5K1PA 2BSKA 2Q73A 3W7WA 4NXNB 1AR4A 4JV5O 3LDDA 2W6JG 2EZOA 2QKAA 4FPPA 2QR4A 4J11A 1PNKA 4O4HA 5EIBC 4HNAA 1PKXA 4IYIA 3CC7V 4JF3A 1IURA 3FYIB 3BRCA 4UB8Z 4I55B 4NR1A 5LMUB 2ZT9B 2WLIB 3K3WA 3Q4HB 3X2QC 4BIUA 2UXDO 4OPHA 5CA0A 4TV9A 4DR3O 4O2BB 1BGYH 3IFXA 5L3BA 5JVDA 3B40A 2L35A 4LF9O 4OGQB 3W7TA 3BPZA 4YJ3A 5KAFZ 3CRAA 2ZE6A 1SRYA 2G38A 2DJVA 3S3WA 2YICA 3AEIA 3FAVA 1XMOO 2ADQB 5H5NA 4JTCB 2IJHA 1YXBA 2IU3A 5LYJB 5JWPA 3AG2C 5EYPB 5IWAB 3ZRVA 1V54C 3JASA 4X62O 2YS8A 4CBCA 3QO8A 4YY3O 3CYOA 3OR7C 4RAIA 3BFRA 1OCZB 1R6NA 3AK2A 4UCTA 1W0JG 4FFKA 4X66B 3ZRWB 5KX5B 4YHHO 1UPGA 2E75B 2CGNA 3TXSA 4NTYA 2JRIA 4OX9B 2OCHA 3CP1A 1NT2B 3KG2A 4GKKB 2QJ1A 4QIWF 3BVOA 3IJ4A 4O4HB 2LGQA 3CWBH 3J81N 4ZIBA 1R6KA 1AP6A 1VQ4V 2LW1A 3W7UA 3WG7C 2CAZC 3ZX6A 3DGEA 3N27A 1GRJA 1NI8A 2R9IA 5KLVH 1RPRA 4A5UB 3JALB 2JGUA 1M56B 2HG5C 1NZ6A 4DUYB 2CGOA 5IYZA 2EILC 5LA6B 1PL0A 3HKBA 1P4RA 3UM7A 3IGAC 2UUBB 1MMMA 1K8AW 1VP7A 1FKAO 4IIJB 3IAYA 4I5SA 1L0NH 3OGIB 2UXBO 2XTAA 4X88A 1JPXA 2GDSA 5FPOA 3ABKC 3ABUA 3W7SA 2PYJA 1PD3A 4HAMA 3K5NA 2QWNB 1WP7A 5CA1B 4NXMB 3A0RA 4DYLA 3L70H 1DK1A 3K58A 4LF8O 1EBOA 4CH6A 2ETNA 1VQ5V 3E8HA 2JS3A 1XNRO 3SYQA 5LXTA 4KFMA 4PA6A 4DV3O 5BMVB 1IXMA 1OV9A 2EIKC 5EK0A 4MTGA 1H2MA 4I0XA 4FFBB 4MS2A 2ZQMA 4XBFA 3IC9A 3RYIA 5BXZA 5CMUA 2IU0A 3HKDA 3EHBB 2ZE7A 2RCVA 3QF7A 2ZCEA 3HKCB 1Q8IA 1JJOA 3IC7A 4LWSB 1S0VA 4DRXA 2Q5ZA 1YTFD 3OTOO 3SJAC 3UO2A 5IJ0A 2Q9LA 1FJGB 1F7YA 1IVSA 1VQLV 4YJ2A 4DO2A 2UXDB 1PPJH 4DV0B 2M6YA 3CRCA 2QA4V 2YI9A 4I9QA 2OCCC 3G71V 2GBOA 1VQKV 2YEVA 2JDIG 3CRQA 2Y4TA 4LF9B 2PI4A 3SPGA 4JI1B 1VQNV 4UVBA 5KUMA 1VQ7V 2UXCB 1QNMA 2ZNIA 3ABMC 2Q67A 3OUSA 3CCRV 4PV1B 3B09A 3JAKB 1F23A 3CJHA 5LP6B 5GW7A 1YJ9V 2YIAA 1I0HA 3STLC 2DOSA 2WPDG 1HNZO 4TQDA 5JH7B 1VF5B 1OCRC 2KKWA 3A0HZ 3E89A 2HHHO 4GX0A 1YHQV 3SGIA 3CC2V 3GVMA 1Y74B 2QWRB 4YY3B 4F6RA 1S5LZ 3P32A 4FIPC 4P2ZA 4JYYA 1VIBA 2YDEA 3ZMUA 1IDSA 2PGGA 3QTCA 2M7WA 3RFRA 3ML0A 4YHHB 3MDSA 4O4LA 1H38A 1RM1C 2RDCA 2PZSA 3AG1C 4JI3O 1XEQA 3OAAG 5LL6Y 4DUZO 3CEIA 2OTLV 1ZUQA 2DWDC 3DSQA 4X65B 5LHIA 2ZDIC 5L3GA 2ARHA 3CB2A 2AXTZ 3S3XA 4FZ1A 2FKXA 4I50A 3D36A 1K5QA 5TISZ 4B3TO 1K9MW 3JSLA 1K92A 1PP9H 3VOUA 3CCSV 5A9GA 1BZKA 3C3SA 1NTMH 1OCOC 4TUYA 1Q82W 3OR6C 3CCMV 4LF7B 3N2GA 2DYSC 2CH7B 4YIPA 3OTFA 3ASNB 1W0KG 3L71H 2B5UA 4EKWA 2Q6AA 2CUGA 1R3KC 5B1NA 3FB6C 5B1AC 3ASOB 4DV5B 3FFQA 3F7YC 4H33A 1V55C 2RJZA 5LMUO 3JCZA 3T1HB 1P7GA 2ZIOA 1R73A 2CDYA 4BIOA 3CCVV 1OCCB 1GM7A 4DV3B 3WFVA 2OT5A 4MTXA 4X1YB 1TGOA 4AQYO 2QWPB 3ZMVA 3RYHB 4K0KO 2QGNA 4JPRA 1XMQB 2HVKC 1N33B 2OYQA 3HB3B 5B3SB 3RBZA 1GKFA 5LHHA 1H2NA 1X4TA 2JK5C 2Q4PA 1H2KA 3H1JH 1WAZA 1HNXO 3OTOB 2JEUA 3AG3C 3BA8A 4QNHB 3LUTB 1AROP 4FM2A 5JCOA 2ZD9A 4J9ZB 3VQXA 1EZJA 2O57A 2WLKA 2BE3A 3RYFB 5IWAO 4I50B 4O4IA 1KP2A 2EX3A 4FJCC 4TQFA 1PV0A 2XAJA 2E5LB 1WB7A 2UUCO 4X66O 1HDJA 1WJZA 4O2AB 4QPJA 5EZYB 1BE3H 1SQPH 4UCRA 1Q81W 3RN4A 4UXNA 2QKSA 4PD4F 4EB6B 1WLEA 3N2GB 4RQFA 1SETA 3SPIA 1GO3F 1S72V 4OX9O 4DV4B 1IBMO 2JGDB 2IH3C 4O4JB 5A2QN 1F4NA 2HVJC 5DN6G 1MOFA 2FMLA 5H9CA 1Q6UA 4I55A 1HNZB 4UV8A 4DK1A 4FZ0A 2WLIA 3L72H 1CPYA 1FXKA 4U3JB 3Q4HA 4JZ2A 3K9AA 1MABG 1TVKB 3RT3C 1R3LC 4O2BA 2UXNA 4GX5A 1WP8A 1PNMA 2ADPA 1XILA 5D5QA 1US6A 3I55V 4JI2B 4R6ZA 3L73H 5LMNB 1SQBH 2GUZB 1GTOA 5JJEB 1K5SA 1P7BA 2PUSA 4NTXA 4YXWG 5D5PA 2EIJB 4DV6O 2QKCA 1XNQB 4MVOA 5BY1A 2QE7G 4JI3B 3JATB 1X59A 3B2EE 5LYJA 4FLVA 4JTDB 5EYPA 1E79G 3H01A 4KUMA 4PJ0Z 3B4SA 1V9PA 4KXRA 1JR9A 1NR7A 4B3TB 1GAXA 3K5LA 1R3IC 1S5HC 1K34A 4ZHQB 2K1EA 3JARB 4CZZA 3ZRWA 3F7VC 5KX5A 4X9QA 3ZS8C 3WB0A 1ZL8B 3FX7A 2Q7GA 4CS2A 3G6BA 3QO5A 1M5IA 3D3IA 5H6RA 1GK9A 1VARA 2Q0AA 1KUQA 4DV7O 2VWJA 1RSOB 3G67A 2Q7HA 2QDOA 2YC0A 1FFTB 2XT9A 2QWQB 3H1LH 1FFXA 1CEZA 1QLEB 2Z3YA 3LDCA 4MVRA 1FJGO 2E76B 3RYCA 3DC5A 2F4VO 3LDEA 4PI0A 1FXKB 3KKYA 1JMKC 4DV0O 4BW5A 1DLBA 1EN6A 2IBZH 3JALA 3G80A 4AQYB 3RW0A 2LGWA 3AG4B 3EFFK 3M7MX 1NU1H 5LA6A 3VQWA 1K73W 2VQEB 1WPBA 1AJNA 3F5TA 4K0KB 2QWOB 3FB5C 4IIJA 4MSWC 4JI1O 3TGUH 1K3EA 4R7CA 4CS4A 2UXCO 1AILA 2YXYA 1XL6A 1ROPA 1KBHA 2EINC 3CCUV 3F5WC 2ITDC 5LGUA 1GN4A 1ZTEA 5CA1A 4TV8B 1HNXB 1XHZA 1QVFU 1KB9F 2QM8A 1NBMG 3D36C 5BMVA 2ZE5A 2AHZA 1XI1A 1SESA 4GCZA 1P49A 4WFGA 4FFBA 1SQQH 3HKEB 5CB4B 1AR5A 2UUCB 2FYUH 4LF5B 1Z2GA 2R72A 3A0BZ 3RGBA 1K4DC 4B7KA 2ZE8A 4DW1A 2NNUA 3APQA 1IBMB 3HKCA 1YVWA 3OD4A 4LWSA 4DR7B 1QCEA 5HFLA 1IBKO 4X65O 1MA1A 3FKSG 2HJDA 4DV2O 5IY5C 5KHGA 1GM9A 4ASUG 1P84F 1FFXB 1NR1A 2YIBD 2PYLA 4AILC 5FNVB 3RYCB 2HFEC 1YCIA 4NTWA 5JJJB 1AJQA 2CE4A 2ZR2A 2RQ6A 4PI2A 3JAWB 2DMXA 1B04A 2P6JA 4DR6B 1VQ9V 4LF7O 3QO7A 3UKMA 2AW9A 3TJTA 2V7QG 4J41A 4X89A 4H0LB 3OEHG 4MW8A 3JAKA 5LP6A 4DV6B 5JQGB 2YIDA 2QTOA 5ITZB 4OPAA 3ETGA 2LO1A 1H8EG 3KZIZ 2R70A 2VS0A 3ABLB 3P3PA 1OHHG 4DV5O 5JH7A 1N36B 4H44B 1YSCA 2ZXWC 2WLJA 1Y76B 2UUAB 3ETQA 1ZSPA 1Y74A 5JCOC 4JI7O 3T1HO 2HP8A 1H2SB 3E35A 3K5MA 4XDKA 1NS1A 3CCJV 3LSSA 3T2MA 3SPCA 4QE7A 1S5JA 1R3JC 3ZCCA 4FM0A 3ZMTA 1XMQO 2CTPA 4CH5A 1N33O 4ZBMA 3LSQA 3H1KH 4ICGA 3H9VA 1Z5VA 1SS3A 3TXQA 3L9DA 3PJSK 3CXCU 5B66Z 1ZWIC 2QM4A 3ZMZA 4DV7B 5C93A 5L3CA 4FK5C 2UU9O 3ETEA 3I5DA 5CBGA 5LGNA 5HFMA 2VRZA 1R1BA 4X1IB 4F6EA 3TETA 4WCEV 4FLXA 2F4VB 1FPOA 1GH6A 4LFCO 2CTQA 4L8JA 1HR0B 2A3QA 2Q69A 1G4YB 1KC8W 4LFAB 2ATKC 1A32A 2E5LO 2CH7A 2GTAA 2P67A 1H2GA 4TWKA
chains in the Genus database with same CATH topology
5LMUO 4LF6O 5H5NA 4KHPO 2VQFO 4LF7O 2HHHO 4DR7O 2LW7A 1DK1A 4LF8O 4DR5O 3F5TA 4DV4O 4AQYO 1XNRO 1G1XB 4JI1O 4NXMO 2Z0AA 4X62O 2ZKOA 4DV3O 2UXCO 2N74A 1AILA 4K0KO 4OPAA 4YY3O 4JI5O 3JAMN 4DV6O 4DV5O 4LFBO 5BY1A 5IT9N 1HR0O 1J5EO 2AGAA 4LFAO 1FYJA 3R66A 1X59A 5BXZA 4JI3O 5BR8O 1XEQA 4YHHO 4JI7O 4JI6O 5LL6Y 3T1HO 1N32O 4DR6O 4DUZO 2JRIA 4JI4O 1HNXO 1N34O 1I94O 1D2DA 4JI2O 3SDLA 2VQEO 4DV1O 3O65A 3T1YO 3J7AU 1NS1A 4JV5O 4GKJO 5LMNO 5IWAO 3OTOO 2FKXA 4JYAO 5FLXN 4B3TO 1F7YA 4NXNO 1XMQO 3J81N 1N33O 1XNQO 1N36O 4B3MO 4GKKO 4B3RO 2UUCO 4X66O 4DR1O 3M8AA 2UUAO 4DR2O 4JI0O 4OPHA 2UXDO 4LF4O 2UU9O 4DR3O 4OX9O 1IBMO 4A5UB 1IBKO 1KUQA 4X65O 5A2QN 4DV7O 4X64O 4DV2O 1R1BA 3J80N 4JI8O 4DR4O 1IBLO 4LF9O 1YZBA 1R6TA 4B3SO 4LFCO 4DUYO 1FKAO 1HNWO 1FJGO 4LF5O 2UXBO 2F4VO 2UUBO 2DJVA 1A32A 2E5LO 4DV0O 2DOSA 1HNZO 3RT3C 2ZM6O 1AB3A 1XMOO
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5LMU O;  4LF6 O;  5H5N A;  4KHP O;  2VQF O;  4LF7 O;  2HHH O;  4DR7 O;  2LW7 A;  1DK1 A;  4LF8 O;  4DR5 O;  3F5T A;  4DV4 O;  4AQY O;  1XNR O;  1G1X B;  4JI1 O;  4NXM O;  2Z0A A;  4X62 O;  2ZKO A;  4DV3 O;  2UXC O;  2N74 A;  1AIL A;  4K0K O;  4OPA A;  4YY3 O;  4JI5 O;  3JAM N;  4DV6 O;  4DV5 O;  4LFB O;  5BY1 A;  5IT9 N;  1HR0 O;  1J5E O;  2AGA A;  4LFA O;  1FYJ A;  3R66 A;  1X59 A;  5BXZ A;  4JI3 O;  5BR8 O;  1XEQ A;  4YHH O;  4JI7 O;  4JI6 O;  5LL6 Y;  3T1H O;  1N32 O;  4DR6 O;  4DUZ O;  2JRI A;  4JI4 O;  1HNX O;  1N34 O;  1I94 O;  1D2D A;  4JI2 O;  3SDL A;  2VQE O;  4DV1 O;  3O65 A;  3T1Y O;  3J7A U;  1NS1 A;  4JV5 O;  4GKJ O;  5LMN O;  5IWA O;  3OTO O;  2FKX A;  4JYA O;  5FLX N;  4B3T O;  1F7Y A;  4NXN O;  1XMQ O;  3J81 N;  1N33 O;  1XNQ O;  1N36 O;  4B3M O;  4GKK O;  4B3R O;  2UUC O;  4X66 O;  4DR1 O;  3M8A A;  2UUA O;  4DR2 O;  4JI0 O;  4OPH A;  2UXD O;  4LF4 O;  2UU9 O;  4DR3 O;  4OX9 O;  1IBM O;  4A5U B;  1IBK O;  1KUQ A;  4X65 O;  5A2Q N;  4DV7 O;  4X64 O;  4DV2 O;  1R1B A;  3J80 N;  4JI8 O;  4DR4 O;  1IBL O;  4LF9 O;  1YZB A;  1R6T A;  4B3S O;  4LFC O;  4DUY O;  1FKA O;  1HNW O;  1FJG O;  4LF5 O;  2UXB O;  2F4V O;  2UUB O;  2DJV A;  1A32 A;  2E5L O;  4DV0 O;  2DOS A;  1HNZ O;  3RT3 C;  2ZM6 O;  1AB3 A;  1XMO O; 
#chains in the Genus database with same CATH topology
 2Q7E A;  4KHP O;  1LUW A;  3U10 A;  5J2T B;  3K03 A;  1Y67 A;  4DV4 O;  2BCC H;  4NYK A;  1F51 A;  4EFE A;  3OE7 G;  4FVM A;  5IDJ A;  4NKG B;  2R9A A;  3E2E A;  4LFB O;  2GTS A;  3OMI B;  1RFY A;  1XQ8 A;  1LR1 A;  1TAE A;  5F2V O;  4P9O A;  2Q0O C;  1M90 W;  2YXH A;  3OT7 A;  4X1Y A;  1QLN A;  4XDL A;  4AHC A;  3AK3 A;  1OCZ C;  1N34 O;  4H37 A;  4KL1 A;  4J9Y B;  4JI2 O;  1SC5 B;  2YXL A;  3RYH A;  4PA3 A;  5IJ9 B;  4GKJ O;  1IZ3 A;  3E8F A;  5LMN O;  2EJR A;  2BOB C;  1B3Q A;  3MAQ A;  3JD2 A;  2JVD A;  1BHA A;  1YIJ V;  3EVK A;  1M57 B;  1GMG A;  2HEP A;  4PEL A;  1XNQ O;  1GN2 A;  5CN0 A;  1G8M A;  1MNG A;  4B7E A;  4RUE A;  3BY6 A;  1RP3 B;  3FB7 C;  4PDL A;  1IBK B;  5GON B;  1TUE B;  1WNS A;  1YEW A;  2HLD G;  1JOY A;  2XOK G;  4DV2 B;  3RYF A;  1Z5W A;  4EFB A;  2XAS A;  1JA8 A;  2ODM A;  4MVQ A;  4PA4 A;  2Y69 B;  4ZI7 B;  2ZIN A;  4DR4 O;  2DYR B;  1L0L H;  1IBL O;  1R6T A;  4O2A A;  3T1C A;  1JX9 A;  4JZG A;  2KG7 B;  5EZY A;  1J5E B;  5H2F Z;  4UCU A;  1T5E A;  1M56 C;  1XUQ A;  3LNN A;  4EB6 A;  3A2F A;  2XAH A;  4I4T A;  3FYE B;  1U97 A;  3ZRX A;  3CRM A;  2P90 A;  1NH2 B;  4CC6 A;  2JGD A;  4O4J A;  3ZIA G;  2IJJ A;  5H6Q A;  3WB2 A;  3ZHR A;  2LW7 A;  3NXS A;  4C7U A;  2XUM A;  1S77 D;  2D3O W;  1I5Y A;  1UJW B;  1I7F A;  2QEX V;  4I9W A;  3K79 A;  1Y4M A;  5LBQ A;  4LNU B;  2ZKO A;  3ZED A;  4U3J A;  5EIB D;  2H94 A;  1TVK A;  1KQS U;  2EIM B;  1E1Q G;  2PTM A;  5C8Y B;  4JI7 B;  1O9H A;  5E79 Z;  3FD9 A;  2A9H A;  2EJ7 A;  1N0J A;  3K57 A;  1AP5 A;  4Q20 A;  3OGC C;  3ZHT A;  3UT5 B;  2GUZ A;  1IXB A;  1PNL A;  2OIE A;  3GB7 C;  2P5O A;  2HR3 A;  3QG5 A;  3CCQ V;  2F1M A;  2VQE O;  4X64 B;  3J7A U;  2LP7 A;  4CH3 A;  4G27 B;  1G6U A;  3K04 A;  2JJ1 G;  5KHH A;  5EC1 C;  4F4L A;  3JAT A;  5EBW C;  3X2Q B;  2DQ0 A;  1M1K W;  3SJC C;  2KSD A;  1BL8 A;  3ZMS A;  1MZF A;  1VF6 A;  4PDR A;  2PF4 E;  1L8D A;  2Y0I A;  3OW2 U;  2UU9 B;  5CA3 A;  2LQT A;  2GV9 A;  5L3F A;  3OM3 B;  3N2K B;  1GN6 A;  2DQ3 A;  4ZHQ A;  2WAM A;  3EXA A;  4LFC B;  3JAR A;  4X1K A;  3CXH F;  1VQP V;  4QGP A;  4D6T H;  2EIN B;  4JI8 O;  2N04 A;  2UXX A;  1VQO V;  1ZL8 A;  5BZB A;  4LF5 O;  2W6I G;  5FPR A;  1TA8 A;  3T4D A;  4KHP B;  3AG2 B;  4I4T B;  1Q6H A;  3CC4 V;  4G2K A;  1OZ0 A;  1V54 B;  1F4M A;  1QU7 A;  2Y4U A;  2GSM B;  1I08 A;  2IW5 A;  4W4L A;  1RSO A;  1I94 B;  1HP8 A;  4WFH A;  4DR7 O;  2RMK B;  4DV1 B;  1MSD A;  1WB8 A;  2WLN A;  3C90 A;  4CH4 A;  3CX5 F;  4DW0 A;  3U11 A;  4J10 A;  4LFB B;  1D5N A;  2FTK A;  3TCU A;  4JI5 O;  4J42 A;  2ZIM A;  1O9G A;  1DGS A;  4IT5 A;  1NJI W;  2X6A A;  1XL4 A;  1U96 A;  2F23 A;  3ZHQ A;  1N34 B;  4QE9 A;  1JFF B;  4PA7 A;  1XHX A;  3CME V;  1N32 O;  1H8H G;  1N0N A;  4DR6 O;  4GKJ B;  4JI4 O;  2W0F C;  2A0L A;  4FLU A;  4RUF A;  3O65 A;  3STZ C;  3FB8 C;  2ZNJ A;  2AZ2 A;  3WG7 B;  3CMA V;  2RN9 A;  3VBB A;  4JAA A;  4RWU A;  4TV8 A;  3M99 B;  4I7Z B;  1N36 O;  1NVP D;  2LJ2 A;  2EIL B;  2UUA O;  3BAA A;  1FXH A;  4E4E A;  3ZN0 A;  5FL7 G;  2YI8 A;  4ZOL B;  5IYD O;  1DTO A;  4Z1V A;  5L3E A;  2CK3 G;  4DR4 B;  1IBL B;  3HKE A;  3T4Z A;  5CB4 A;  3AG7 A;  3HPL C;  3L75 H;  1NVP B;  2P4K A;  4LR3 A;  4X1K B;  2OTJ V;  3B8N A;  3ABK B;  5DED A;  3CCE V;  3MHH C;  2N05 A;  4DXW A;  2K9P A;  1AI4 A;  4FM1 A;  2NN4 A;  3ASN C;  2X7R B;  3K08 A;  4DK0 A;  2ZM6 O;  1SER A;  3SYP A;  4RQE A;  2B9Z A;  1EN5 A;  1JVM A;  4J7K A;  3GWK C;  3ASO C;  2EIK B;  1Q90 D;  1VEW A;  2AZ0 A;  5IYB O;  4G28 B;  1VQ8 V;  1SA0 B;  1TUB B;  4U3F H;  1YJN V;  2WLL B;  5IYC O;  3P30 A;  2V4D A;  3DXR B;  2A06 H;  4JYA B;  3E8G A;  4UUJ C;  5FNV A;  1AJP A;  1Q3E A;  1AR1 B;  1UFI A;  3ZN1 A;  1OCC C;  5KMG B;  5KHK A;  3JAW A;  1HR0 O;  4CS3 A;  2ZDI A;  4LFA O;  2F43 G;  4DR1 B;  5LOV B;  5EBL C;  5DM6 V;  1Q7Y W;  4GYC B;  2YIB A;  4JI6 O;  4U7O A;  1KD1 W;  5JQG A;  5B3S C;  1M4U A;  2X0L A;  2A79 B;  2BTQ B;  3E22 B;  5ITZ A;  2V1D A;  4QPK A;  1LNQ A;  4MVU A;  5AG2 A;  1KKD A;  2WLH A;  1CXZ B;  2OCC B;  1Y76 A;  2PY5 A;  2CTW A;  1ZAU A;  2FL4 A;  2JS5 A;  3QNE A;  1KP3 A;  1S76 D;  3JD0 A;  1QQC A;  4LF6 B;  3ABM B;  2HKO A;  5B1B C;  4JI0 O;  2VQF B;  1SQV H;  2AHY A;  4WBN B;  2BOC C;  4JI8 B;  3K9S A;  4X20 B;  2GHY A;  1NKD A;  3JSN A;  5J2U B;  4QJF B;  5DEC A;  2B1I A;  3K06 A;  1B6Q A;  4B3S O;  5CBF A;  1OCR B;  4U7N A;  1WA8 B;  1DF5 A;  4BW9 A;  1Q86 W;  1J95 A;  1QHT A;  2X6B A;  3DTU B;  1HW7 A;  1L1F A;  3B8M A;  3KCX A;  5CBH A;  2ILM A;  1BSM A;  3CE2 A;  4PDV A;  1BMF G;  4HBN A;  4X1I A;  4BIZ A;  4FLZ A;  4DR5 O;  2DWE C;  3T1Y B;  3CD6 V;  3VQY A;  4K8X A;  4JI5 B;  1G1X B;  1KKC A;  5JJN B;  1RM1 B;  1M93 A;  3AG1 B;  2N74 A;  4GUN A;  3SR2 C;  4FMT A;  4UCS A;  1KYO F;  2BSK B;  4WF9 V;  1Q5O A;  3W7X A;  3MD0 A;  4B3M B;  1J5E O;  3OMN B;  4GX1 A;  1N32 B;  1FYJ A;  4UFZ A;  4HNA B;  4EEQ A;  4JI4 B;  4DR2 B;  5J2T A;  3NR7 A;  4BWA A;  4N21 A;  2EIJ C;  1AI6 A;  2WLM A;  3SDL A;  2WSS G;  1OCO B;  1QR8 A;  1YI2 V;  5CA0 B;  4TV9 B;  2JEX A;  1COW G;  5FLX N;  1VF6 C;  1HNW B;  2DYS B;  1Q43 A;  5JVD B;  4JTA B;  3SJB C;  2ZR3 A;  3SYC A;  1KEC A;  2X6C A;  4B3R O;  2BTO A;  4WFB V;  3LSU A;  4YJ3 B;  5LGT A;  1FXV A;  1SF9 A;  5IE9 A;  2QM7 A;  4LC1 A;  3GWO A;  3U0Z A;  3ZRS A;  5IJ9 A;  2IM9 A;  3FAV B;  5B1A B;  1PL4 A;  4GX2 A;  4JAS A;  1IX9 A;  3R65 A;  5EBM C;  4X64 O;  4ZKI A;  3E8B A;  4LBE C;  1V55 B;  4N23 A;  2KQX A;  1AI5 A;  4KP4 A;  4UCV A;  2ZM6 B;  2LFS A;  3JAS B;  3WB1 A;  1DF4 A;  3ICX A;  5GON A;  4MVS A;  2Y0P A;  1BQZ A;  1RPO A;  4FLY A;  1QLE C;  4H13 B;  2DW4 A;  3VQV A;  4ZI7 A;  3SYO A;  1FXK C;  4WFF A;  4AI8 A;  3QVN A;  4JV5 B;  3B77 A;  2EBO A;  2KG7 A;  1SQF A;  4D7S A;  1MG1 A;  1Y6X A;  2F66 C;  2IH1 C;  3AG4 C;  2WWW A;  2LFR A;  3AG3 B;  1WN7 A;  4JI6 B;  1HWY A;  4MVM A;  4GT1 A;  3R66 A;  4LCU C;  2E3C A;  1XBL A;  5E1A C;  2OWO A;  1YJW V;  4JAU A;  1SQX H;  2Z5U A;  3ABT A;  4DR3 B;  1I94 O;  4LNU A;  1OJH A;  1YTF B;  4DV1 O;  3JD3 A;  4UCO A;  4D7T A;  1VF7 A;  2L6L A;  4TT3 G;  2P06 A;  5C8Y A;  4JYB A;  5IYZ B;  3PN1 A;  3OEE G;  3CCL V;  3HKB B;  1AVM A;  3OUF A;  4JI0 B;  1QVG U;  1AI7 A;  3THO A;  2IJI A;  3UT5 A;  1XMO B;  4IHJ A;  4W4K A;  3AK1 A;  2ITC C;  1JQ0 A;  4LF4 O;  2Y48 A;  1KMI Z;  2HJF C;  1KU9 A;  3D3Q A;  4B3S B;  4WFA V;  3CS5 A;  4OXS A;  3I56 V;  2MW2 B;  2XAG A;  4X62 B;  4HYO A;  2CTR A;  3RWR D;  3G6E V;  5LXT B;  5B5E Z;  1EM1 A;  2VWK A;  2KB1 A;  4P30 A;  1CP9 A;  3H1I H;  1NTZ H;  1ZX3 A;  1GM8 A;  4I0X B;  3N2K A;  3SYA A;  4DR5 B;  1AB3 A;  3E86 A;  2EUL A;  1NH2 D;  3SJQ C;  3BA9 A;  3RYI B;  1MZE A;  3HKD B;  5KA6 A;  2NLJ C;  2Z0A A;  3OFN G;  2Q8V A;  1SKV A;  3KCY A;  4R50 A;  3ZHU A;  3G4S V;  3JAM N;  4IL6 Z;  4DRX B;  3ZJZ A;  1N4C A;  4R8C A;  5IJ0 B;  4FLW A;  2AGA A;  3JD4 A;  1SQG A;  3CPW U;  1B06 A;  2R9R B;  3UQ8 A;  1URF A;  5KUK A;  4YJ2 B;  5BR8 O;  1E1R G;  1QR9 A;  3K59 A;  4K8Z A;  3ABL C;  1K4C C;  1YF2 A;  4IYH A;  1D2D A;  3TK1 A;  4PHZ A;  4BR6 A;  1GN3 A;  4Z2W A;  4B08 A;  1XOU A;  2YEV B;  3P3N A;  1EN4 A;  3BAB A;  4JYA O;  4B3R B;  2A7W A;  2NR5 A;  2XND G;  2YSU B;  4JGS A;  4JAV A;  4NXN O;  4TOI A;  3UO3 A;  2UXB B;  3SPH A;  2P22 C;  1NTK H;  1JFF A;  3RVZ A;  1XDC A;  2JIZ G;  2DN9 A;  4DR1 O;  4WFE A;  3CJH B;  2PI5 A;  5LHG A;  4IHJ B;  3H1H H;  2DE0 X;  3HR0 A;  1EZV H;  4LF8 B;  5K1X A;  1YDX A;  1XNR B;  1I5X A;  3LNM B;  1D5A A;  3RVY A;  4E2L A;  1BS3 A;  3JD1 A;  3ZHV A;  3E83 A;  2RNB A;  1BCC H;  4BAY A;  4F6R B;  1EFR G;  1NQT A;  4PDM A;  3O9O A;  3JCU Z;  4J7Z A;  4GZR B;  4ZOL A;  3JYC A;  4K3A A;  1SZT A;  2F95 B;  1FD9 A;  2Q68 A;  3CRR A;  2P7T C;  4LF6 O;  4O4L B;  2VQF O;  5KHI A;  1M9N A;  1BT8 A;  4UB6 Z;  5L3D A;  2WA4 A;  3D8C A;  2XHB A;  1N8R W;  2W0X A;  5KHJ A;  3DC6 A;  2C2A A;  1YIT V;  5J9P C;  5GTI Z;  3A8T A;  1QBZ A;  1VMG A;  4UVC A;  4UV9 A;  1BHB A;  3L74 H;  2WA3 A;  4HZ3 A;  2XAF A;  2MK3 A;  4X8A A;  5IT9 N;  5B1B B;  2B1G A;  1Q6I A;  1SZX A;  3K5O A;  4LH6 A;  5LP6 C;  5B1O A;  1SA0 A;  1TUB A;  4PA9 A;  3OMA B;  4Z1M G;  1LUV A;  2WLL A;  4TUY B;  4TSF G;  2H3O A;  4LP8 A;  4J80 A;  3DXR A;  3T1Y O;  1FS0 G;  5KMG A;  2D2C B;  1H2L A;  5LOV A;  4JYC A;  4IGG A;  2XAQ A;  1S3J A;  2IJK A;  4MTO A;  5KA5 A;  4B3M O;  4GKK O;  1ORQ C;  4MT8 A;  4LF4 B;  3M8A A;  5IY5 B;  2OIG A;  4UVA A;  4DR2 O;  2FB5 A;  1ZLZ A;  2BTQ A;  3E22 A;  2EZP A;  1VQM V;  4FLT A;  1FAF A;  2HHH B;  1JCH A;  1M57 C;  1JJ2 U;  3BCC H;  5GTH Z;  1THZ A;  4P9P A;  3K0D A;  4MVZ A;  4CC5 A;  3J80 N;  1YZB A;  3C3T A;  2YUA A;  4DUY O;  1BQ0 A;  1HNW O;  1WPX A;  4RO2 A;  2UUB O;  3BEH A;  3MHS C;  4XDJ A;  1XRE A;  2P4V A;  2Y69 C;  4Q6G A;  5KAI Z;  4WBN A;  2E74 B;  1MSW D;  2QTS A;  2DYR C;  4X20 A;  2QSA A;  5J2U A;  3ZBH A;  4L87 A;  4DUZ B;  2H8P C;  4NB5 A;  3SPJ A;  3ZHS A;  3ETD A;  1Y66 A;  1ENV A;  4NVP A;  1K33 A;  1PM9 A;  4J7J A;  2ZXW B;  1WA8 A;  4NXM O;  4YIO A;  3WU2 Z;  4ABM A;  4GLX A;  4MTF A;  3CSX A;  3BHP A;  1K7D A;  5BR8 B;  1W2B U;  1W59 A;  2JJ2 G;  4O4I B;  4LH7 A;  2F93 B;  1K97 A;  4K35 A;  3CHX A;  1VQ6 V;  5EC2 C;  3UCS C;  2EIM C;  3APO A;  3K0G A;  4MW3 A;  5K1P A;  2BSK A;  2Q73 A;  3W7W A;  4NXN B;  1AR4 A;  4JV5 O;  3LDD A;  2W6J G;  2EZO A;  2QKA A;  4FPP A;  2QR4 A;  4J11 A;  1PNK A;  4O4H A;  5EIB C;  4HNA A;  1PKX A;  4IYI A;  3CC7 V;  4JF3 A;  1IUR A;  3FYI B;  3BRC A;  4UB8 Z;  4I55 B;  4NR1 A;  5LMU B;  2ZT9 B;  2WLI B;  3K3W A;  3Q4H B;  3X2Q C;  4BIU A;  2UXD O;  4OPH A;  5CA0 A;  4TV9 A;  4DR3 O;  4O2B B;  1BGY H;  3IFX A;  5L3B A;  5JVD A;  3B40 A;  2L35 A;  4LF9 O;  4OGQ B;  3W7T A;  3BPZ A;  4YJ3 A;  5KAF Z;  3CRA A;  2ZE6 A;  1SRY A;  2G38 A;  2DJV A;  3S3W A;  2YIC A;  3AEI A;  3FAV A;  1XMO O;  2ADQ B;  5H5N A;  4JTC B;  2IJH A;  1YXB A;  2IU3 A;  5LYJ B;  5JWP A;  3AG2 C;  5EYP B;  5IWA B;  3ZRV A;  1V54 C;  3JAS A;  4X62 O;  2YS8 A;  4CBC A;  3QO8 A;  4YY3 O;  3CYO A;  3OR7 C;  4RAI A;  3BFR A;  1OCZ B;  1R6N A;  3AK2 A;  4UCT A;  1W0J G;  4FFK A;  4X66 B;  3ZRW B;  5KX5 B;  4YHH O;  1UPG A;  2E75 B;  2CGN A;  3TXS A;  4NTY A;  2JRI A;  4OX9 B;  2OCH A;  3CP1 A;  1NT2 B;  3KG2 A;  4GKK B;  2QJ1 A;  4QIW F;  3BVO A;  3IJ4 A;  4O4H B;  2LGQ A;  3CWB H;  3J81 N;  4ZIB A;  1R6K A;  1AP6 A;  1VQ4 V;  2LW1 A;  3W7U A;  3WG7 C;  2CAZ C;  3ZX6 A;  3DGE A;  3N27 A;  1GRJ A;  1NI8 A;  2R9I A;  5KLV H;  1RPR A;  4A5U B;  3JAL B;  2JGU A;  1M56 B;  2HG5 C;  1NZ6 A;  4DUY B;  2CGO A;  5IYZ A;  2EIL C;  5LA6 B;  1PL0 A;  3HKB A;  1P4R A;  3UM7 A;  3IGA C;  2UUB B;  1MMM A;  1K8A W;  1VP7 A;  1FKA O;  4IIJ B;  3IAY A;  4I5S A;  1L0N H;  3OGI B;  2UXB O;  2XTA A;  4X88 A;  1JPX A;  2GDS A;  5FPO A;  3ABK C;  3ABU A;  3W7S A;  2PYJ A;  1PD3 A;  4HAM A;  3K5N A;  2QWN B;  1WP7 A;  5CA1 B;  4NXM B;  3A0R A;  4DYL A;  3L70 H;  1DK1 A;  3K58 A;  4LF8 O;  1EBO A;  4CH6 A;  2ETN A;  1VQ5 V;  3E8H A;  2JS3 A;  1XNR O;  3SYQ A;  5LXT A;  4KFM A;  4PA6 A;  4DV3 O;  5BMV B;  1IXM A;  1OV9 A;  2EIK C;  5EK0 A;  4MTG A;  1H2M A;  4I0X A;  4FFB B;  4MS2 A;  2ZQM A;  4XBF A;  3IC9 A;  3RYI A;  5BXZ A;  5CMU A;  2IU0 A;  3HKD A;  3EHB B;  2ZE7 A;  2RCV A;  3QF7 A;  2ZCE A;  3HKC B;  1Q8I A;  1JJO A;  3IC7 A;  4LWS B;  1S0V A;  4DRX A;  2Q5Z A;  1YTF D;  3OTO O;  3SJA C;  3UO2 A;  5IJ0 A;  2Q9L A;  1FJG B;  1F7Y A;  1IVS A;  1VQL V;  4YJ2 A;  4DO2 A;  2UXD B;  1PPJ H;  4DV0 B;  2M6Y A;  3CRC A;  2QA4 V;  2YI9 A;  4I9Q A;  2OCC C;  3G71 V;  2GBO A;  1VQK V;  2YEV A;  2JDI G;  3CRQ A;  2Y4T A;  4LF9 B;  2PI4 A;  3SPG A;  4JI1 B;  1VQN V;  4UVB A;  5KUM A;  1VQ7 V;  2UXC B;  1QNM A;  2ZNI A;  3ABM C;  2Q67 A;  3OUS A;  3CCR V;  4PV1 B;  3B09 A;  3JAK B;  1F23 A;  3CJH A;  5LP6 B;  5GW7 A;  1YJ9 V;  2YIA A;  1I0H A;  3STL C;  2DOS A;  2WPD G;  1HNZ O;  4TQD A;  5JH7 B;  1VF5 B;  1OCR C;  2KKW A;  3A0H Z;  3E89 A;  2HHH O;  4GX0 A;  1YHQ V;  3SGI A;  3CC2 V;  3GVM A;  1Y74 B;  2QWR B;  4YY3 B;  4F6R A;  1S5L Z;  3P32 A;  4FIP C;  4P2Z A;  4JYY A;  1VIB A;  2YDE A;  3ZMU A;  1IDS A;  2PGG A;  3QTC A;  2M7W A;  3RFR A;  3ML0 A;  4YHH B;  3MDS A;  4O4L A;  1H38 A;  1RM1 C;  2RDC A;  2PZS A;  3AG1 C;  4JI3 O;  1XEQ A;  3OAA G;  5LL6 Y;  4DUZ O;  3CEI A;  2OTL V;  1ZUQ A;  2DWD C;  3DSQ A;  4X65 B;  5LHI A;  2ZDI C;  5L3G A;  2ARH A;  3CB2 A;  2AXT Z;  3S3X A;  4FZ1 A;  2FKX A;  4I50 A;  3D36 A;  1K5Q A;  5TIS Z;  4B3T O;  1K9M W;  3JSL A;  1K92 A;  1PP9 H;  3VOU A;  3CCS V;  5A9G A;  1BZK A;  3C3S A;  1NTM H;  1OCO C;  4TUY A;  1Q82 W;  3OR6 C;  3CCM V;  4LF7 B;  3N2G A;  2DYS C;  2CH7 B;  4YIP A;  3OTF A;  3ASN B;  1W0K G;  3L71 H;  2B5U A;  4EKW A;  2Q6A A;  2CUG A;  1R3K C;  5B1N A;  3FB6 C;  5B1A C;  3ASO B;  4DV5 B;  3FFQ A;  3F7Y C;  4H33 A;  1V55 C;  2RJZ A;  5LMU O;  3JCZ A;  3T1H B;  1P7G A;  2ZIO A;  1R73 A;  2CDY A;  4BIO A;  3CCV V;  1OCC B;  1GM7 A;  4DV3 B;  3WFV A;  2OT5 A;  4MTX A;  4X1Y B;  1TGO A;  4AQY O;  2QWP B;  3ZMV A;  3RYH B;  4K0K O;  2QGN A;  4JPR A;  1XMQ B;  2HVK C;  1N33 B;  2OYQ A;  3HB3 B;  5B3S B;  3RBZ A;  1GKF A;  5LHH A;  1H2N A;  1X4T A;  2JK5 C;  2Q4P A;  1H2K A;  3H1J H;  1WAZ A;  1HNX O;  3OTO B;  2JEU A;  3AG3 C;  3BA8 A;  4QNH B;  3LUT B;  1ARO P;  4FM2 A;  5JCO A;  2ZD9 A;  4J9Z B;  3VQX A;  1EZJ A;  2O57 A;  2WLK A;  2BE3 A;  3RYF B;  5IWA O;  4I50 B;  4O4I A;  1KP2 A;  2EX3 A;  4FJC C;  4TQF A;  1PV0 A;  2XAJ A;  2E5L B;  1WB7 A;  2UUC O;  4X66 O;  1HDJ A;  1WJZ A;  4O2A B;  4QPJ A;  5EZY B;  1BE3 H;  1SQP H;  4UCR A;  1Q81 W;  3RN4 A;  4UXN A;  2QKS A;  4PD4 F;  4EB6 B;  1WLE A;  3N2G B;  4RQF A;  1SET A;  3SPI A;  1GO3 F;  1S72 V;  4OX9 O;  4DV4 B;  1IBM O;  2JGD B;  2IH3 C;  4O4J B;  5A2Q N;  1F4N A;  2HVJ C;  5DN6 G;  1MOF A;  2FML A;  5H9C A;  1Q6U A;  4I55 A;  1HNZ B;  4UV8 A;  4DK1 A;  4FZ0 A;  2WLI A;  3L72 H;  1CPY A;  1FXK A;  4U3J B;  3Q4H A;  4JZ2 A;  3K9A A;  1MAB G;  1TVK B;  3RT3 C;  1R3L C;  4O2B A;  2UXN A;  4GX5 A;  1WP8 A;  1PNM A;  2ADP A;  1XIL A;  5D5Q A;  1US6 A;  3I55 V;  4JI2 B;  4R6Z A;  3L73 H;  5LMN B;  1SQB H;  2GUZ B;  1GTO A;  5JJE B;  1K5S A;  1P7B A;  2PUS A;  4NTX A;  4YXW G;  5D5P A;  2EIJ B;  4DV6 O;  2QKC A;  1XNQ B;  4MVO A;  5BY1 A;  2QE7 G;  4JI3 B;  3JAT B;  1X59 A;  3B2E E;  5LYJ A;  4FLV A;  4JTD B;  5EYP A;  1E79 G;  3H01 A;  4KUM A;  4PJ0 Z;  3B4S A;  1V9P A;  4KXR A;  1JR9 A;  1NR7 A;  4B3T B;  1GAX A;  3K5L A;  1R3I C;  1S5H C;  1K34 A;  4ZHQ B;  2K1E A;  3JAR B;  4CZZ A;  3ZRW A;  3F7V C;  5KX5 A;  4X9Q A;  3ZS8 C;  3WB0 A;  1ZL8 B;  3FX7 A;  2Q7G A;  4CS2 A;  3G6B A;  3QO5 A;  1M5I A;  3D3I A;  5H6R A;  1GK9 A;  1VAR A;  2Q0A A;  1KUQ A;  4DV7 O;  2VWJ A;  1RSO B;  3G67 A;  2Q7H A;  2QDO A;  2YC0 A;  1FFT B;  2XT9 A;  2QWQ B;  3H1L H;  1FFX A;  1CEZ A;  1QLE B;  2Z3Y A;  3LDC A;  4MVR A;  1FJG O;  2E76 B;  3RYC A;  3DC5 A;  2F4V O;  3LDE A;  4PI0 A;  1FXK B;  3KKY A;  1JMK C;  4DV0 O;  4BW5 A;  1DLB A;  1EN6 A;  2IBZ H;  3JAL A;  3G80 A;  4AQY B;  3RW0 A;  2LGW A;  3AG4 B;  3EFF K;  3M7M X;  1NU1 H;  5LA6 A;  3VQW A;  1K73 W;  2VQE B;  1WPB A;  1AJN A;  3F5T A;  4K0K B;  2QWO B;  3FB5 C;  4IIJ A;  4MSW C;  4JI1 O;  3TGU H;  1K3E A;  4R7C A;  4CS4 A;  2UXC O;  1AIL A;  2YXY A;  1XL6 A;  1ROP A;  1KBH A;  2EIN C;  3CCU V;  3F5W C;  2ITD C;  5LGU A;  1GN4 A;  1ZTE A;  5CA1 A;  4TV8 B;  1HNX B;  1XHZ A;  1QVF U;  1KB9 F;  2QM8 A;  1NBM G;  3D36 C;  5BMV A;  2ZE5 A;  2AHZ A;  1XI1 A;  1SES A;  4GCZ A;  1P49 A;  4WFG A;  4FFB A;  1SQQ H;  3HKE B;  5CB4 B;  1AR5 A;  2UUC B;  2FYU H;  4LF5 B;  1Z2G A;  2R72 A;  3A0B Z;  3RGB A;  1K4D C;  4B7K A;  2ZE8 A;  4DW1 A;  2NNU A;  3APQ A;  1IBM B;  3HKC A;  1YVW A;  3OD4 A;  4LWS A;  4DR7 B;  1QCE A;  5HFL A;  1IBK O;  4X65 O;  1MA1 A;  3FKS G;  2HJD A;  4DV2 O;  5IY5 C;  5KHG A;  1GM9 A;  4ASU G;  1P84 F;  1FFX B;  1NR1 A;  2YIB D;  2PYL A;  4AIL C;  5FNV B;  3RYC B;  2HFE C;  1YCI A;  4NTW A;  5JJJ B;  1AJQ A;  2CE4 A;  2ZR2 A;  2RQ6 A;  4PI2 A;  3JAW B;  2DMX A;  1B04 A;  2P6J A;  4DR6 B;  1VQ9 V;  4LF7 O;  3QO7 A;  3UKM A;  2AW9 A;  3TJT A;  2V7Q G;  4J41 A;  4X89 A;  4H0L B;  3OEH G;  4MW8 A;  3JAK A;  5LP6 A;  4DV6 B;  5JQG B;  2YID A;  2QTO A;  5ITZ B;  4OPA A;  3ETG A;  2LO1 A;  1H8E G;  3KZI Z;  2R70 A;  2VS0 A;  3ABL B;  3P3P A;  1OHH G;  4DV5 O;  5JH7 A;  1N36 B;  4H44 B;  1YSC A;  2ZXW C;  2WLJ A;  1Y76 B;  2UUA B;  3ETQ A;  1ZSP A;  1Y74 A;  5JCO C;  4JI7 O;  3T1H O;  2HP8 A;  1H2S B;  3E35 A;  3K5M A;  4XDK A;  1NS1 A;  3CCJ V;  3LSS A;  3T2M A;  3SPC A;  4QE7 A;  1S5J A;  1R3J C;  3ZCC A;  4FM0 A;  3ZMT A;  1XMQ O;  2CTP A;  4CH5 A;  1N33 O;  4ZBM A;  3LSQ A;  3H1K H;  4ICG A;  3H9V A;  1Z5V A;  1SS3 A;  3TXQ A;  3L9D A;  3PJS K;  3CXC U;  5B66 Z;  1ZWI C;  2QM4 A;  3ZMZ A;  4DV7 B;  5C93 A;  5L3C A;  4FK5 C;  2UU9 O;  3ETE A;  3I5D A;  5CBG A;  5LGN A;  5HFM A;  2VRZ A;  1R1B A;  4X1I B;  4F6E A;  3TET A;  4WCE V;  4FLX A;  2F4V B;  1FPO A;  1GH6 A;  4LFC O;  2CTQ A;  4L8J A;  1HR0 B;  2A3Q A;  2Q69 A;  1G4Y B;  1KC8 W;  4LFA B;  2ATK C;  1A32 A;  2E5L O;  2CH7 A;  2GTA A;  2P67 A;  1H2G A;  4TWK A; 
#chains in the Genus database with same CATH homology
 5LMU O;  4LF6 O;  5H5N A;  4KHP O;  2VQF O;  4LF7 O;  2HHH O;  4DR7 O;  2LW7 A;  1DK1 A;  4LF8 O;  4DR5 O;  3F5T A;  4DV4 O;  4AQY O;  1XNR O;  1G1X B;  4JI1 O;  4NXM O;  2Z0A A;  4X62 O;  2ZKO A;  4DV3 O;  2UXC O;  2N74 A;  1AIL A;  4K0K O;  4OPA A;  4YY3 O;  4JI5 O;  3JAM N;  4DV6 O;  4DV5 O;  4LFB O;  5BY1 A;  5IT9 N;  1HR0 O;  1J5E O;  2AGA A;  4LFA O;  1FYJ A;  3R66 A;  1X59 A;  5BXZ A;  4JI3 O;  5BR8 O;  1XEQ A;  4YHH O;  4JI7 O;  4JI6 O;  5LL6 Y;  3T1H O;  1N32 O;  4DR6 O;  4DUZ O;  2JRI A;  4JI4 O;  1HNX O;  1N34 O;  1I94 O;  1D2D A;  4JI2 O;  3SDL A;  2VQE O;  4DV1 O;  3O65 A;  3T1Y O;  3J7A U;  1NS1 A;  4JV5 O;  4GKJ O;  5LMN O;  5IWA O;  3OTO O;  2FKX A;  4JYA O;  5FLX N;  4B3T O;  1F7Y A;  4NXN O;  1XMQ O;  3J81 N;  1N33 O;  1XNQ O;  1N36 O;  4B3M O;  4GKK O;  4B3R O;  2UUC O;  4X66 O;  4DR1 O;  3M8A A;  2UUA O;  4DR2 O;  4JI0 O;  4OPH A;  2UXD O;  4LF4 O;  2UU9 O;  4DR3 O;  4OX9 O;  1IBM O;  4A5U B;  1IBK O;  1KUQ A;  4X65 O;  5A2Q N;  4DV7 O;  4X64 O;  4DV2 O;  1R1B A;  3J80 N;  4JI8 O;  4DR4 O;  1IBL O;  4LF9 O;  1YZB A;  1R6T A;  4B3S O;  4LFC O;  4DUY O;  1FKA O;  1HNW O;  1FJG O;  4LF5 O;  2UXB O;  2F4V O;  2UUB O;  2DJV A;  1A32 A;  2E5L O;  4DV0 O;  2DOS A;  1HNZ O;  3RT3 C;  2ZM6 O;  1AB3 A;  1XMO O; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...