1N36O

Structure of the thermus thermophilus 30s ribosomal subunit in the presence of crystallographically disordered codon and near-cognate transfer rna anticodon stem-loop mismatched at the second codon position
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
88
structure length
88
Chain Sequence
PITKEEKQKVIQEFARFPGDTGSTEVQVALLTLRINRLSEHLKVHKKDHHSHRGLLMMVGQRRRLLRYLQREDPERYRALIEKLGIRG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S RIBOSOMAL RNA
publication title Selection of tRNA by the Ribosome Requires a Transition from an Open to a Closed Form
pubmed doi rcsb
molecule tags Ribosome
total genus 29
structure length 88
sequence length 88
ec nomenclature
pdb deposition date 2002-10-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
O PF00312 Ribosomal_S15 Ribosomal protein S15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.10 Mainly Alpha Orthogonal Bundle Helix Hairpins S15/NS1, RNA-binding 1n36O00
1FJGO 1A32A 1XNRO 3RT3C 3J7AU 5BXZA 1AILA 3SDLA 4LFBO 4JI4O 4DR5O 1IBKO 4DV7O 4NXMO 2N74A 5LL6Y 4NXNO 4JI7O 4DR6O 2UXBO 1FYJA 1IBMO 2VQEO 1G1XB 1XEQA 4K0KO 5LMNO 5IT9N 5IWAO 2AGAA 4DV6O 2UXDO 1DK1A 4JI2O 3T1HO 2UU9O 4GKKO 4JI8O 4JYAO 1D2DA 4DV0O 2DJVA 4DV4O 2UUBO 1R1BA 4X66O 2UUCO 4B3MO 4DR2O 4LF7O 4A5UB 4B3TO 5H5NA 1F7YA 3J80N 4JI6O 3O65A 4YHHO 5BR8O 4DUZO 2E5LO 1AB3A 4LF8O 4YY3O 1FKAO 4DR7O 4LF6O 2LW7A 4JI1O 4AQYO 3J81N 4LF4O 4DR4O 4JI3O 5A2QN 4B3SO 1HNWO 4X65O 4DV5O 4DV3O 2ZM6O 1KUQA 1N33O 4LFAO 3JAMN 4GKJO 1IBLO 2F4VO 4B3RO 3T1YO 2DOSA 4DUYO 4DV1O 1X59A 1YZBA 4DR3O 2UXCO 1R6TA 3F5TA 1J5EO 2HHHO 5BY1A 4LF5O 1HNZO 1HR0O 2FKXA 2VQFO 4OX9O 4OPAA 4OPHA 5FLXN 4DV2O 1NS1A 1XMOO 2JRIA 3R66A 4X64O 5LMUO 2ZKOA 3M8AA 1N36O 1N32O 4LF9O 1I94O 4DR1O 4JI5O 1XNQO 4KHPO 4JV5O 4LFCO 1N34O 1HNXO 1XMQO 2Z0AA 4JI0O 4X62O 2UUAO 3OTOO
chains in the Genus database with same CATH superfamily
1A32A 4K8XA 3D8CA 3ZEDA 4DW1A 3I5DA 3CCEV 4FIPC 1DF4A 2GHYA 3JD3A 3ML0A 3E83A 1H8EG 3JSLA 4O2BB 2Q6AA 4DV7O 4NXMO 3QF7A 1SA0B 2WPDG 3BRCA 2E3CA 4LCUC 1G6UA 3ZHTA 1Z5WA 2AXTZ 4UCSA 2EJ7A 2IJHA 2JK5C 5CA0A 2EIJC 5IT9N 5B1BC 1I5YA 4TOIA 3T1HO 3JARB 2XNDG 1JMKC 2QKCA 4UVBA 1NU1H 1BCCH 2WA3A 3JAWA 4B7KA 4DR1B 2X0LA 4LF7O 2ZDIA 4MVRA 1YI2V 4PELA 4Q6GA 5H5NA 4QPKA 2PF4E 2RCVA 5DN6G 2Y69C 2PTMA 4UVCA 3OE7G 2WLIA 3OEHG 4OXSA 2PZSA 1CXZB 3OR6C 4NXMB 3JCUZ 4LFAO 3DTUB 3H1LH 4B08A 3RYHA 1IBLO 3T1YO 3T1HB 2QM4A 3T4DA 1SRYA 4FPPA 2QWOB 2WWWA 1BE3H 3CCJV 4UUJC 3UQ8A 3ZHQA 2K1EA 3SYOA 4LNUB 4LF7B 3M7MX 2XUMA 4GYCB 4X64O 2IM9A 3ZN1A 5CBFA 1BS3A 1KD1W 1YEWA 1COWG 2ZE7A 1XBLA 5DM6V 1N0NA 1Q6HA 1XOUA 4O2AB 1N0JA 4LFAB 3UT5B 2DYRB 4MVQA 1IBLB 1Y66A 4RWUA 3G4SV 3O9OA 4MVMA 3T1YB 3CX5F 4WFFA 4BW9A 3AG3C 4LWSA 2N74A 1KQSU 1VF6C 1XILA 2JS3A 2IU0A 3W7SA 2OCCC 1FFXA 2XTAA 4XBFA 2Q7GA 1I08A 2UXDO 4FLYA 3WG7C 5IJ0A 4CH5A 3JD1A 4X64B 3CS5A 4I55A 2YICA 3ZMSA 2BSKA 1FS0G 1M90W 4GX2A 3ZX6A 3VQYA 2CUGA 2GDSA 4G27B 2IJKA 1AROP 4ZI7A 4CH4A 4AQYO 4U3JB 4JI3O 4WFHA 3RYFA 3TGUH 1XREA 1OV9A 4TSFG 1FFTB 1TUBA 3N2KB 4H37A 3P32A 2UXDB 3H1HH 1O9GA 3KKYA 1YZBA 1VQMV 2UXCO 3ZS8C 2X6BA 1WPXA 2PI5A 3K9SA 2NLJC 2QDOA 4OPHA 2QKAA 2IBZH 1ZSPA 3R66A 5D5QA 5E1AC 1N32O 4F6RA 3E35A 5LGUA 4RUFA 2DWDC 4AQYB 4JTCB 1XNQO 4KFMA 3ZRXA 3L9DA 5ITZA 1L1FA 4Q20A 4JI3B 5LYJA 3QTCA 2XAQA 1MABG 2GBOA 1JA8A 1HDJA 1AILA 3K59A 1XI1A 5FL7G 2QWQB 5C8YA 2RMKB 2Q67A 4H0LB 1H2NA 4DR6O 2UXCB 1M93A 3L73H 2EZPA 3FB5C 3VQXA 2EIKC 3K5NA 3TJTA 4PA6A 3H9VA 4JGSA 4FM2A 4WBNA 2LO1A 3IAYA 1N32B 2BE3A 4MTXA 5B3SC 2FMLA 2XAFA 4YIPA 3AK1A 1XNQB 5GTIZ 2WLHA 5IE9A 5IWAB 4DV6B 2ZD9A 2ITDC 3C3SA 1TAEA 1H8HG 1ZX3A 2OWOA 4MTFA 1FD9A 4LF8O 5L3EA 2ITCC 1K97A 3NXSA 2LW7A 3IJ4A 4GX1A 4LF4O 1QNMA 4GUNA 3SYCA 3SPJA 4DR6B 3JAMN 1S3JA 1QLEB 5EYPB 4LH6A 4FVMA 1NBMG 1VF6A 3JD2A 1YVWA 4WFBV 1RFYA 4DRXA 3ZBHA 2BTQA 2DMXA 4D6TH 5CBHA 2ZNIA 2ODMA 3RYIB 3HR0A 1OCCB 1IXMA 1FXHA 4FLZA 2YDEA 4ZOLA 2OTJV 2GUZB 3OMAB 1AI7A 4JAUA 1H2GA 1YDXA 4JAVA 4O4IB 2YIBD 3ETDA 2EJRA 3CRQA 1S0VA 4YJ2B 5IJ9B 1V55C 4QNHB 5L3DA 3LDDA 4LF8B 2PI4A 2BOBC 1GH6A 2ADQB 3UCSC 4LF4B 2HVJC 4PI0A 2GTSA 3ZMTA 3LUTB 4O4HA 2FTKA 1PNMA 4MVZA 2EBOA 3BA9A 3DXRB 4LFBO 4LBEC 2IH3C 4I0XA 4PA7A 5JQGB 1QR9A 1Q7YW 4NB5A 2UUAB 1IBMO 1NQTA 5KX5B 4UCRA 4JI2O 1Y74A 4N21A 5EC2C 3OEEG 4K3AA 5DEDA 4RQFA 4HYOA 2X6AA 3KZIZ 2YEVA 4FZ1A 1V54C 3X2QB 4BAYA 2R9AA 1VARA 1OCOB 1ZL8B 3E2EA 4EEQA 1E79G 1ZAUA 2HJFC 4GX0A 2F93B 4JI6O 4DXWA 5KA5A 1AB3A 1KMIZ 1LUWA 2EIMC 1F51A 2Y48A 3B2EE 2R70A 3LDCA 5LGTA 3HKCB 2PYLA 1DLBA 2WLLB 2DYSC 1KUQA 3HKDA 4DV3O 1QHTA 3PN1A 4GKJO 4KXRA 1IBMB 3JALB 3QO7A 3BABA 3GWOA 1RPRA 2NNUA 2RQ6A 4B3RO 4JI2B 2DN9A 1KKCA 4MS2A 5IY5C 3CCRV 1VQ8V 5CN0A 3JASA 4MTGA 3FB6C 3F5TA 1S77D 4Z1VA 3CCQV 5L3CA 3CWBH 3RYCB 4LC1A 1HR0O 2KQXA 4HNAB 3OGIB 4FLTA 1Q90D 5FLXN 5KA6A 5JVDB 1XHXA 2CE4A 3SPIA 5IYZA 4U7OA 4JI6B 4J41A 5FNVB 2XOKG 1SQPH 2WLJA 4CS3A 4IYIA 1XDCA 2KKWA 1XMQO 3JAKA 4DV3B 1S5LZ 4JF3A 1YF2A 3ZCCA 1XNRO 1ORQC 4GKJB 4X1KA 4NTXA 5EIBD 1B04A 1XHZA 1MG1A 4JYYA 5LHGA 1S5JA 3H1IH 1TVKB 3IC9A 5C93A 2AZ0A 2ZR3A 5E79Z 4PDVA 4JAAA 5JH7A 1HR0B 2NR5A 3JATB 2P7TC 4PA9A 4X88A 4NYKA 3KG2A 3GB7C 4GCZA 1YITV 4O4JA 1R3JC 3CMAV 1DF5A 1R1BA 2ADPA 5CA3A 3KCYA 5LXTA 5EIBC 2A0LA 2LJ2A 4JYCA 3K04A 4YJ3B 3L70H 2EULA 2E5LO 3FAVA 1XNRB 1GN3A 3CC2V 4ZIBA 4DR7O 3KCXA 1J95A 1YXBA 2IW5A 2OIEA 1WA8B 4X65O 5LP6B 3SPHA 3Q4HB 1F4MA 1OCOC 1VQ6V 4I5SA 2JJ1G 4YIOA 5B1AB 3R65A 3E22B 5BMVA 3CRAA 1OCZB 3MHHC 1KP2A 2WLKA 4OX9O 2D2CB 4TUYB 2E75B 1NS1A 2E5LB 4PD4F 1EM1A 4F4LA 1VP7A 2OCHA 5F2VO 4DR7B 1I94O 3ETQA 3VBBA 2HEPA 1PD3A 1EZJA 5LOVB 3K9AA 1IX9A 1N34O 1MMMA 5KHJA 4X65B 4JI0O 2F23A 5EZYA 2ZQMA 5KHHA 2DWEC 4DR5O 1QVGU 4X1IA 1GRJA 2XAJA 3TETA 3FD9A 2JGDA 2B9ZA 4BWAA 5IYCO 3ABMC 4WF9V 3CP1A 1M56B 2CTRA 1MSDA 2UXXA 1XUQA 5LMNO 3A0HZ 4Z2WA 4OX9B 4R50A 1WN7A 1AI5A 2CH7B 2M6YA 4R7CA 2UU9O 1NTZH 4J42A 2KG7B 2V1DA 3G80A 4LR3A 5IYDO 5H6RA 3UO3A 1I94B 1Q82W 5CBGA 4ZHQA 1WP7A 4FK5C 5JJNB 1N34B 4GT1A 4JI0B 2L6LA 1K5QA 4MVSA 5BR8O 4DUZO 2ZXWB 2HKOA 1L0LH 2CTPA 4DR5B 2YXHA 2ZE8A 1K73W 1DGSA 3CE2A 3CJHA 4TV9B 1Y6XA 2H8PC 3ABLB 1HP8A 5LMNB 3G6BA 1KECA 3WFVA 3AG1B 1JCHA 1VMGA 4DUYO 2UU9B 5LHIA 4DR3O 3VOUA 3F5WC 5B1NA 5BY1A 1R6NA 3ASNB 2VQFO 3LDEA 3D3IA 4DUZB 5BR8B 2ILMA 4I50A 1H2MA 4JYBA 4FLUA 2ARHA 3G6EV 3OR7C 2EX3A 3ZHRA 1OHHG 2HP8A 3CCUV 1HNXO 1AR4A 2YXYA 2X6CA 3EFFK 1Q6IA 3CRCA 5JCOC 1VQ4V 5GONB 2O57A 4R8CA 3IGAC 1NJIW 1I5XA 1IBKO 4PDMA 4FFBA 4DUYB 1N8RW 1K3EA 4DR3B 1BHAA 2UXBO 1P49A 3SYAA 5KUKA 5J2TB 3CMEV 2VQFB 3B09A 1DK1A 4X1YB 2HLDG 4IIJA 1M5IA 4JZ2A 5KMGA 3NR7A 1KBHA 2DW4A 3RGBA 3K57A 2QWRB 3CCVV 4B7EA 1K34A 2OYQA 1WLEA 4B3TO 3HB3B 1HNXB 1P84F 5FPRA 3U10A 1RM1B 3CC4V 4TV8B 1NR7A 1NVPB 2YXLA 1NTKH 1X4TA 5LA6B 1Z5VA 3PJSK 2L35A 2LFRA 4NR1A 1V9PA 3ZRWB 1IBKB 5B5EZ 1JQ0A 2ZM6O 1AJPA 2UXBB 3CYOA 5H2FZ 3I56V 1PKXA 3VQVA 3IC7A 2Q9LA 1BL8A 2Q0OC 4XDJA 2V4DA 3HKBA 2EINB 2LW1A 3BFRA 2PY5A 2VS0A 2R72A 3I55V 3K5MA 4B3TB 1PPJH 4I4TA 4O4LB 1SQQH 2KSDA 5LMUO 5CB4A 3K5LA 1MSWD 1N36O 4LF9O 1R3LC 3JD0A 4W4LA 3ABKB 4GZRB 4J9ZB 4X20B 1VQPV 4KHPO 1Y67A 1WP8A 1CP9A 3G71V 1VEWA 2Y4UA 3D3QA 3HKEB 2YSUB 5EK0A 4EB6A 3K5OA 2ZM6B 2OT5A 5J2UA 5BXZA 2EZOA 3ABTA 1JFFA 3VQWA 1SESA 4JV5B 1PV0A 4FM0A 5EBMC 2X7RB 2CTQA 5KLVH 5L3BA 2AHYA 2JVDA 5TISZ 3OD4A 4L8JA 1RSOA 4IHJB 1TUEB 4ASUG 4PHZA 2KB1A 5IWAO 3SGIA 4DV6O 1NT2B 2Q7HA 1THZA 3ZHSA 3MHSC 5LMUB 5EBWC 1EN4A 1N36B 4NXNB 4LF9B 4JASA 3CCMV 2OTLV 2UUCO 2W0XA 1QLNA 1YSCA 4B3MO 3SPCA 4KHPB 1BSMA 2YIDA 4A5UB 3N2GA 3ZHUA 2HJDA 3STZC 3SYQA 5H6QA 2P67A 4NVPA 1AR1B 2P4KA 1U97A 2HG5C 3G67A 1PNLA 4JI1O 1BZKA 5K1PA 5B1OA 3EHBB 5JCOA 4DR4O 1Y76A 2A79B 3MAQA 1N4CA 2DYRC 4FJCC 2RN9A 5EBLC 4J11A 2Q5ZA 3OGCC 3DGEA 3ETGA 1Q81W 2JEUA 1MOFA 4DV1O 1GTOA 4PA3A 4MVUA 3OUFA 1SF9A 4TWKA 3FB7C 1QR8A 2P22C 4AILC 1J5EO 4JPRA 2UUCB 1FXKB 1AP5A 1HNZO 4B3MB 3CRRA 5CA1A 4BIUA 2FKXA 1EN6A 1W2BU 1DTOA 1VQKV 4DV2O 3A0BZ 4OGQB 4FMTA 2ZKOA 4H33A 1AJQA 1EBOA 3D36C 1IDSA 2MW2B 4JI1B 1HWYA 4FLVA 3A0RA 3SJAC 2EILB 2MK3A 4DR4B 2Z0AA 4BW5A 4RQEA 3APQA 2UUAO 1S72V 3E8FA 1GM8A 3AEIA 3SDLA 1UFIA 5IYBO 2A7WA 2CK3G 4O2BA 1TGOA 4DV1B 2HR3A 1SA0A 3E8GA 2FL4A 2CAZC 2RNBA 3K0DA 3ABKC 2VWKA 1J5EB 4UFZA 4EFEA 4PA4A 4BIZA 1B6QA 1US6A 3ZHVA 1HNZB 3C3TA 2QWPB 1EN5A 5CA0B 2YS8A 4KUMA 1I0HA 1SERA 4DV2B 3AG4B 3ASOB 1W0KG 4RO2A 4EFBA 1L8DA 4X8AA 1BGYH 1U96A 1SKVA 2C2AA 4J9YB 3JAWB 1BQZA 2E76B 1K5SA 2QA4V 4QE9A 1P7BA 4ZBMA 4IT5A 4PJ0Z 3K08A 2WLIB 1Q6UA 2ZIOA 3DSQA 4B3SO 1HNWO 1M57B 2B5UA 2DQ0A 2WAMA 3E8BA 3RWRD 3FB8C 1ZLZA 3RYHB 1O9HA 1XQ8A 5JJJB 5K1XA 1AI4A 2P5OA 4BIOA 2Y0IA 1Q8IA 5LGNA 4I9QA 5KHIA 1ZUQA 3ZN0A 4LNUA 4PDLA 1JJ2U 4CZZA 2Q4PA 4H13B 2BTOA 1JX9A 3M8AA 1MA1A 4EKWA 1MZFA 3CPWU 4F6EA 4B3SB 1HNWB 4O2AA 4MT8A 1FXKC 1K7DA 3BY6A 3UT5A 1JJOA 1Q5OA 2LP7A 1W59A 2ZNJA 2K9PA 4JI4O 3SJCC 2F43G 4KP4A 3L74H 4FLWA 4LWSB 1QLEC 5EC1C 2HFEC 1GAXA 1NKDA 3P3PA 3UKMA 2VQEO 4NTWA 4CH3A 2Q69A 1FFXB 1Q43A 4L87A 4TQDA 1OCCC 3B8MA 2WLNA 3MD0A 5IJ0B 1SQVH 4JYAO 4I55B 3ZIAG 3WB0A 2BSKB 4UCUA 3QVNA 3D36A 3FX7A 3JSNA 1MZEA 3APOA 1F7YA 1YHQV 4P9PA 2BCCH 1VF5B 3O65A 4UVAA 1KKDA 3EXAA 2Y4TA 2YC0A 4ZI7B 4MW3A 2P06A 5B66Z 1VQOV 4QGPA 1UPGA 4JI4B 4U3JA 3S3XA 3RYFB 3ZMUA 2W0FC 3U11A 2VQEB 1BHBA 5CB4B 2ZR2A 1TUBB 2ZCEA 3N2KA 4I9WA 3T2MA 3OAAG 2RDCA 5B1BB 4JYAB 1GM7A 3THOA 1SZTA 2P6JA 3LSUA 1F4NA 2P4VA 1JFFB 3X2QC 1M57C 3P3NA 5D5PA 2QTSA 2YIBA 4C7UA 3L75H 4H44B 4WFEA 1FPOA 4K35A 4F6RB 4WFAV 4MW8A 3AK2A 1BQ0A 1XL4A 3BA8A 3OUSA 1AI6A 2Y69B 5IDJA 2Q8VA 1YCIA 5ITZB 5LYJB 1UJWB 1XMOB 2UUBO 1VF7A 1LUVA 4XDLA 2BOCC 3RBZA 2WLMA 2LFSA 3E8HA 5C8YB 1SQFA 1EZVH 4DK1A 1KB9F 2AGAA 3RW0A 3CXCU 4D7TA 3B77A 4WBNB 4CBCA 1SQBH 2VRZA 1P7GA 2H3OA 2WSSG 3QO5A 2QR4A 2UUBB 1IURA 2Y0PA 2Q68A 1NI8A 2GSMB 2QEXV 2WA4A 2QWNB 2JEXA 2IJIA 4PV1B 3BPZA 2JIZG 3AG3B 1K4DC 4HBNA 5EYPA 4UCTA 1SZXA 1VQ5V 2ATKC 4DRXB 1Z2GA 4JZGA 2OCCB 2BTQB 3TXSA 3RYIA 1OJHA 1YIJV 1K9MW 3WG7B 4ZOLB 1IXBA 3W7WA 1B3QA 2GUZA 1JOYA 4OPAA 4O4IA 2ZINA 1ROPA 4YJ2A 5IJ9A 3A2FA 2B1GA 2LGWA 1URFA 2ZE6A 2HHHB 1AVMA 4LFCO 2QKSA 4O4HB 3A8TA 4X62O 4CH6A 4UCOA 2F66C 3RT3C 1LNQA 3B40A 3CHXA 4AHCA 3TK1A 3HPLC 3DXRA 3OT7A 1VQ9V 5LP6C 2FB5A 3LNNA 4I0XB 1MNGA 5JQGA 4JI7O 5B1AC 2YUAA 2JDIG 5KX5A 2XAHA 1E1RG 1HW7A 1Y74B 2YEVB 5GW7A 2ETNA 1OCZC 4DV7B 3FYEB 1OCRB 4JI8O 1K4CC 2Q73A 5A9GA 4X9QA 4X66O 1ZL8A 2IU3A 4JTDB 2DQ3A 4MSWC 4LFCB 1CPYA 4X62B 1M1KW 4CS2A 5GTHZ 4FFKA 1H2KA 3FYIB 3J81N 5JJEB 3HKCA 2WLLA 4IGGA 2YI8A 3K79A 3HKDB 4JI7B 1G4YB 3JALA 4WCEV 3ZRSA 3T1CA 1YJ9V 3JCZA 2EIKB 4CC6A 1E1QG 1M56C 3JASB 4HZ3A 4JI8B 4UB6Z 1ZTEA 4X66B 4LF5O 3RYCA 2D3OW 4HNAA 5B3SB 3MDSA 2LQTA 5JWPA 5JVDA 5IYZB 4X89A 1WB8A 2FYUH 3P30A 5FNVA 4K8ZA 2Q0AA 4JV5O 4MTOA 3CB2A 2A06H 3JAKB 3ZMVA 2ZXWC 1FAFA 2CTWA 3OTOO 2XT9A 3AG2B 4X1KB 5L3GA 1SQGA 3LSQA 1SC5B 4G28B 1RP3B 1H2SB 3BHPA 4CS4A 1NZ6A 2QM7A 5LL6Y 3IFXA 1K8AW 4NXNO 3ABLC 4AI8A 1H2LA 1TVKA 3AG1C 3L72H 4LF5B 1F23A 1XEQA 3DC5A 5JH7B 1VIBA 3JATA 2QTOA 5LBQA 4GX5A 4DV0O 1D5NA 4O4JB 3SJBC 1QBZA 3ASNC 5KAIZ 4FM1A 1GK9A 1V55B 4DK0A 4GLXA 5LXTB 1NR1A 4FLXA 4YJ3A 1YTFB 1QU7A 4ABMA 4ICGA 3OTOB 3FAVB 2PGGA 3ABUA 4QIWF 3CCLV 5KUMA 1R3KC 3L71H 2QGNA 2Q7EA 1WA8A 1OCRC 4IYHA 4DV5O 5LP6A 2A9HA 2F95B 3Q4HA 4WFGA 1VQNV 2ZE5A 1AR5A 3E22A 4KL1A 2DOSA 3WB1A 5BMVB 1B06A 4DV0B 3SR2C 1NVPD 3DC6A 1V54B 3E89A 1S76D 3OTFA 4J10A 4J7ZA 3S3WA 4TUYA 3UO2A 1SETA 4UCVA 3GVMA 4E2LA 5KAFZ 1GO3F 4JI5O 3U0ZA 1G8MA 4UB8Z 1KC8W 5LOVA 2EIMB 1VQLV 1RM1C 3BEHA 4DV5B 4U7NA 1CEZA 4P2ZA 2DYSB 2R9IA 3ZRVA 4TT3G 4J80A 5EZYB 3UM7A 2R9RB 1JVMA 2HVKC 1WAZA 2IH1C 2JS5A 4X1IB 4G2KA 3W7XA 3E86A 1AP6A 2JGDB 5IY5B 3OFNG 1W0JG 2ZIMA 3JYCA 3OMNB 1JR9A 3K0GA 2N04A 3EVKA 2CH7A 2EINC 3AG2C 2KG7A 3RVYA 2P90A 3LNMB 5HFMA 1D5AA 3H01A 2AHZA 5LHHA 4JI5B 4W4KA 4U3FH 2W6IG 4ZHQB 2Z3YA 1YTFD 4YHHO 3F7YC 2CDYA 1SQXH 2QM8A 4P30A 2A3QA 1GMGA 3JARA 2M7WA 1PP9H 1WPBA 1QCEA 1ZWIC 3CJHB 4TV9A 3CCSV 4D7SA 1GKFA 2F4VO 2XAGA 2QSAA 5KHGA 3RVZA 2UXNA 3SJQC 3BVOA 5KHKA 3CD6V 1X59A 1PL4A 4P9OA 3SYPA 4DYLA 1LR1A 1IVSA 3K06A 3FKSG 3CSXA 5BZBA 1K92A 4YHHB 2JRIA 4I50B 2AZ2A 3AK3A 4I7ZB 1GN6A 2QJ1A 2PYJA 1PNKA 4UXNA 4UV9A 1FJGO 1IZ3A 4J7KA 3K58A 2F4VB 1PM9A 1R3IC 3ETEA 1R6KA 5GONA 1WB7A 1XL6A 2Z5UA 3T4ZA 4YXWG 3K3WA 4FFBB 2E74B 3M99B 1FYJA 4FZ0A 1G1XB 4N23A 4QPJA 1GN4A 1BMFG 5J2TA 4K0KO 2LGQA 2YIAA 2AW9A 3OW2U 4HAMA 4LFBB 5DECA 4X1YA 1K33A 4IIJB 2H94A 3LSSA 5KMGB 1Y4MA 2DJVA 4LH7A 5FPOA 3JD4A 1R73A 4RUEA 5AG2A 1KYOF 5L3FA 2JGUA 3ICXA 4TQFA 1NH2B 3J80N 1BT8A 2JJ2G 1FJGB 4TV8A 4DW0A 4NKGB 4YY3O 1KU9A 5LA6A 3QO8A 4LF6O 2XASA 2EILC 1FXVA 2B1IA 3RFRA 3ZRWA 4LP8A 5A2QN 4PI2A 1M9NA 2G38A 1Q3EA 1TA8A 1KP3A 3ABMB 3WB2A 4K0KB 5CMUA 1WJZA 2W6JG 3CXHF 3BCCH 3HKBB 4Z1MG 3B4SA 1P4RA 3TCUA 3AG4C 3B8NA 3ASOC 1I7FA 4B3RB 4I4TB 1QVFU 4O4LA 3STLC 1XMOO 1EFRG 1VQ7V 4CC5A 3GWKC 4NTYA 4ZKIA 4YY3B 2ZDIC 4X20A 4LF6B 3BAAA 1NTMH 1M4UA 1WNSA 3FFQA 1YJNV 2EIJB 2N05A 3HKEA 4EB6B 3AG7A 5J2UB 4JTAB 3J7AU 3OMIB 3CEIA 2RJZA 3F7VC 3W7UA 3K03A 4QE7A 1XMQB 3H1KH 3QNEA 1T5EA 1RSOB 3OM3B 4IHJA 4DO2A 2CGNA 1ENVA 2QE7G 3TXQA 2PUSA 4XDKA 3QG5A 4GKKO 1D2DA 4PDRA 4DV4O 1JPXA 2F1MA 2NN4A 2CGOA 2ZT9B 5H9CA 1H38A 4QJFB 3N27A 2GV9A 4DR2O 3N2GB 1NH2D 1S5HC 3CC7V 1PL0A 1YJWV 1GM9A 1AJNA 1FKAO 3W7TA 4UV8A 4J7JA 1Y76B 1N33O 1L0NH 1OZ0A 3RN4A 3ZMZA 5HFLA 2YI9A 1RPOA 2DE0X 2XHBA 4IL6Z 3ZJZA 5J9PC 3SPGA 4RAIA 4GKKB 4E4EA 3CRMA 4DV4B 1R6TA 3WU2Z 1FXKA 2HHHO 5CA1B 4DR2B 1SS3A 4BR6A 1Q86W 2V7QG 2IJJA 3H1JH 1GN2A 3C90A 2GTAA 4R6ZA 4DR1O 4MVOA 2VWJA 1QQCA 2OIGA 1N33B
chains in the Genus database with same CATH topology
1FJGO 1A32A 1XNRO 3RT3C 3J7AU 5BXZA 1AILA 3SDLA 4LFBO 4JI4O 4DR5O 1IBKO 4DV7O 4NXMO 2N74A 5LL6Y 4NXNO 4JI7O 4DR6O 2UXBO 1FYJA 1IBMO 2VQEO 1G1XB 1XEQA 4K0KO 5LMNO 5IT9N 5IWAO 2AGAA 4DV6O 2UXDO 1DK1A 4JI2O 3T1HO 2UU9O 4GKKO 4JI8O 4JYAO 1D2DA 4DV0O 2DJVA 4DV4O 2UUBO 1R1BA 4X66O 2UUCO 4B3MO 4DR2O 4LF7O 4A5UB 4B3TO 5H5NA 1F7YA 3J80N 4JI6O 3O65A 4YHHO 5BR8O 4DUZO 2E5LO 1AB3A 4LF8O 4YY3O 1FKAO 4DR7O 4LF6O 2LW7A 4JI1O 4AQYO 3J81N 4LF4O 4DR4O 4JI3O 5A2QN 4B3SO 1HNWO 4X65O 4DV5O 4DV3O 2ZM6O 1KUQA 1N33O 4LFAO 3JAMN 4GKJO 1IBLO 2F4VO 4B3RO 3T1YO 2DOSA 4DUYO 4DV1O 1X59A 1YZBA 4DR3O 2UXCO 1R6TA 3F5TA 1J5EO 2HHHO 5BY1A 4LF5O 1HNZO 1HR0O 2FKXA 2VQFO 4OX9O 4OPAA 4OPHA 5FLXN 4DV2O 1NS1A 1XMOO 2JRIA 3R66A 4X64O 5LMUO 2ZKOA 3M8AA 1N36O 1N32O 4LF9O 1I94O 4DR1O 4JI5O 1XNQO 4KHPO 4JV5O 4LFCO 1N34O 1HNXO 1XMQO 2Z0AA 4JI0O 4X62O 2UUAO 3OTOO
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1FJG O;  1A32 A;  1XNR O;  3RT3 C;  3J7A U;  5BXZ A;  1AIL A;  3SDL A;  4LFB O;  4JI4 O;  4DR5 O;  1IBK O;  4DV7 O;  4NXM O;  2N74 A;  5LL6 Y;  4NXN O;  4JI7 O;  4DR6 O;  2UXB O;  1FYJ A;  1IBM O;  2VQE O;  1G1X B;  1XEQ A;  4K0K O;  5LMN O;  5IT9 N;  5IWA O;  2AGA A;  4DV6 O;  2UXD O;  1DK1 A;  4JI2 O;  3T1H O;  2UU9 O;  4GKK O;  4JI8 O;  4JYA O;  1D2D A;  4DV0 O;  2DJV A;  4DV4 O;  2UUB O;  1R1B A;  4X66 O;  2UUC O;  4B3M O;  4DR2 O;  4LF7 O;  4A5U B;  4B3T O;  5H5N A;  1F7Y A;  3J80 N;  4JI6 O;  3O65 A;  4YHH O;  5BR8 O;  4DUZ O;  2E5L O;  1AB3 A;  4LF8 O;  4YY3 O;  1FKA O;  4DR7 O;  4LF6 O;  2LW7 A;  4JI1 O;  4AQY O;  3J81 N;  4LF4 O;  4DR4 O;  4JI3 O;  5A2Q N;  4B3S O;  1HNW O;  4X65 O;  4DV5 O;  4DV3 O;  2ZM6 O;  1KUQ A;  1N33 O;  4LFA O;  3JAM N;  4GKJ O;  1IBL O;  2F4V O;  4B3R O;  3T1Y O;  2DOS A;  4DUY O;  4DV1 O;  1X59 A;  1YZB A;  4DR3 O;  2UXC O;  1R6T A;  3F5T A;  1J5E O;  2HHH O;  5BY1 A;  4LF5 O;  1HNZ O;  1HR0 O;  2FKX A;  2VQF O;  4OX9 O;  4OPA A;  4OPH A;  5FLX N;  4DV2 O;  1NS1 A;  1XMO O;  2JRI A;  3R66 A;  4X64 O;  5LMU O;  2ZKO A;  3M8A A;  1N36 O;  1N32 O;  4LF9 O;  1I94 O;  4DR1 O;  4JI5 O;  1XNQ O;  4KHP O;  4JV5 O;  4LFC O;  1N34 O;  1HNX O;  1XMQ O;  2Z0A A;  4JI0 O;  4X62 O;  2UUA O;  3OTO O; 
#chains in the Genus database with same CATH topology
 1A32 A;  4K8X A;  3D8C A;  3ZED A;  4DW1 A;  3I5D A;  3CCE V;  4FIP C;  1DF4 A;  2GHY A;  3JD3 A;  3ML0 A;  3E83 A;  1H8E G;  3JSL A;  4O2B B;  2Q6A A;  4DV7 O;  4NXM O;  3QF7 A;  1SA0 B;  2WPD G;  3BRC A;  2E3C A;  4LCU C;  1G6U A;  3ZHT A;  1Z5W A;  2AXT Z;  4UCS A;  2EJ7 A;  2IJH A;  2JK5 C;  5CA0 A;  2EIJ C;  5IT9 N;  5B1B C;  1I5Y A;  4TOI A;  3T1H O;  3JAR B;  2XND G;  1JMK C;  2QKC A;  4UVB A;  1NU1 H;  1BCC H;  2WA3 A;  3JAW A;  4B7K A;  4DR1 B;  2X0L A;  4LF7 O;  2ZDI A;  4MVR A;  1YI2 V;  4PEL A;  4Q6G A;  5H5N A;  4QPK A;  2PF4 E;  2RCV A;  5DN6 G;  2Y69 C;  2PTM A;  4UVC A;  3OE7 G;  2WLI A;  3OEH G;  4OXS A;  2PZS A;  1CXZ B;  3OR6 C;  4NXM B;  3JCU Z;  4LFA O;  3DTU B;  3H1L H;  4B08 A;  3RYH A;  1IBL O;  3T1Y O;  3T1H B;  2QM4 A;  3T4D A;  1SRY A;  4FPP A;  2QWO B;  2WWW A;  1BE3 H;  3CCJ V;  4UUJ C;  3UQ8 A;  3ZHQ A;  2K1E A;  3SYO A;  4LNU B;  4LF7 B;  3M7M X;  2XUM A;  4GYC B;  4X64 O;  2IM9 A;  3ZN1 A;  5CBF A;  1BS3 A;  1KD1 W;  1YEW A;  1COW G;  2ZE7 A;  1XBL A;  5DM6 V;  1N0N A;  1Q6H A;  1XOU A;  4O2A B;  1N0J A;  4LFA B;  3UT5 B;  2DYR B;  4MVQ A;  1IBL B;  1Y66 A;  4RWU A;  3G4S V;  3O9O A;  4MVM A;  3T1Y B;  3CX5 F;  4WFF A;  4BW9 A;  3AG3 C;  4LWS A;  2N74 A;  1KQS U;  1VF6 C;  1XIL A;  2JS3 A;  2IU0 A;  3W7S A;  2OCC C;  1FFX A;  2XTA A;  4XBF A;  2Q7G A;  1I08 A;  2UXD O;  4FLY A;  3WG7 C;  5IJ0 A;  4CH5 A;  3JD1 A;  4X64 B;  3CS5 A;  4I55 A;  2YIC A;  3ZMS A;  2BSK A;  1FS0 G;  1M90 W;  4GX2 A;  3ZX6 A;  3VQY A;  2CUG A;  2GDS A;  4G27 B;  2IJK A;  1ARO P;  4ZI7 A;  4CH4 A;  4AQY O;  4U3J B;  4JI3 O;  4WFH A;  3RYF A;  3TGU H;  1XRE A;  1OV9 A;  4TSF G;  1FFT B;  1TUB A;  3N2K B;  4H37 A;  3P32 A;  2UXD B;  3H1H H;  1O9G A;  3KKY A;  1YZB A;  1VQM V;  2UXC O;  3ZS8 C;  2X6B A;  1WPX A;  2PI5 A;  3K9S A;  2NLJ C;  2QDO A;  4OPH A;  2QKA A;  2IBZ H;  1ZSP A;  3R66 A;  5D5Q A;  5E1A C;  1N32 O;  4F6R A;  3E35 A;  5LGU A;  4RUF A;  2DWD C;  4AQY B;  4JTC B;  1XNQ O;  4KFM A;  3ZRX A;  3L9D A;  5ITZ A;  1L1F A;  4Q20 A;  4JI3 B;  5LYJ A;  3QTC A;  2XAQ A;  1MAB G;  2GBO A;  1JA8 A;  1HDJ A;  1AIL A;  3K59 A;  1XI1 A;  5FL7 G;  2QWQ B;  5C8Y A;  2RMK B;  2Q67 A;  4H0L B;  1H2N A;  4DR6 O;  2UXC B;  1M93 A;  3L73 H;  2EZP A;  3FB5 C;  3VQX A;  2EIK C;  3K5N A;  3TJT A;  4PA6 A;  3H9V A;  4JGS A;  4FM2 A;  4WBN A;  2LO1 A;  3IAY A;  1N32 B;  2BE3 A;  4MTX A;  5B3S C;  2FML A;  2XAF A;  4YIP A;  3AK1 A;  1XNQ B;  5GTI Z;  2WLH A;  5IE9 A;  5IWA B;  4DV6 B;  2ZD9 A;  2ITD C;  3C3S A;  1TAE A;  1H8H G;  1ZX3 A;  2OWO A;  4MTF A;  1FD9 A;  4LF8 O;  5L3E A;  2ITC C;  1K97 A;  3NXS A;  2LW7 A;  3IJ4 A;  4GX1 A;  4LF4 O;  1QNM A;  4GUN A;  3SYC A;  3SPJ A;  4DR6 B;  3JAM N;  1S3J A;  1QLE B;  5EYP B;  4LH6 A;  4FVM A;  1NBM G;  1VF6 A;  3JD2 A;  1YVW A;  4WFB V;  1RFY A;  4DRX A;  3ZBH A;  2BTQ A;  2DMX A;  4D6T H;  5CBH A;  2ZNI A;  2ODM A;  3RYI B;  3HR0 A;  1OCC B;  1IXM A;  1FXH A;  4FLZ A;  2YDE A;  4ZOL A;  2OTJ V;  2GUZ B;  3OMA B;  1AI7 A;  4JAU A;  1H2G A;  1YDX A;  4JAV A;  4O4I B;  2YIB D;  3ETD A;  2EJR A;  3CRQ A;  1S0V A;  4YJ2 B;  5IJ9 B;  1V55 C;  4QNH B;  5L3D A;  3LDD A;  4LF8 B;  2PI4 A;  2BOB C;  1GH6 A;  2ADQ B;  3UCS C;  4LF4 B;  2HVJ C;  4PI0 A;  2GTS A;  3ZMT A;  3LUT B;  4O4H A;  2FTK A;  1PNM A;  4MVZ A;  2EBO A;  3BA9 A;  3DXR B;  4LFB O;  4LBE C;  2IH3 C;  4I0X A;  4PA7 A;  5JQG B;  1QR9 A;  1Q7Y W;  4NB5 A;  2UUA B;  1IBM O;  1NQT A;  5KX5 B;  4UCR A;  4JI2 O;  1Y74 A;  4N21 A;  5EC2 C;  3OEE G;  4K3A A;  5DED A;  4RQF A;  4HYO A;  2X6A A;  3KZI Z;  2YEV A;  4FZ1 A;  1V54 C;  3X2Q B;  4BAY A;  2R9A A;  1VAR A;  1OCO B;  1ZL8 B;  3E2E A;  4EEQ A;  1E79 G;  1ZAU A;  2HJF C;  4GX0 A;  2F93 B;  4JI6 O;  4DXW A;  5KA5 A;  1AB3 A;  1KMI Z;  1LUW A;  2EIM C;  1F51 A;  2Y48 A;  3B2E E;  2R70 A;  3LDC A;  5LGT A;  3HKC B;  2PYL A;  1DLB A;  2WLL B;  2DYS C;  1KUQ A;  3HKD A;  4DV3 O;  1QHT A;  3PN1 A;  4GKJ O;  4KXR A;  1IBM B;  3JAL B;  3QO7 A;  3BAB A;  3GWO A;  1RPR A;  2NNU A;  2RQ6 A;  4B3R O;  4JI2 B;  2DN9 A;  1KKC A;  4MS2 A;  5IY5 C;  3CCR V;  1VQ8 V;  5CN0 A;  3JAS A;  4MTG A;  3FB6 C;  3F5T A;  1S77 D;  4Z1V A;  3CCQ V;  5L3C A;  3CWB H;  3RYC B;  4LC1 A;  1HR0 O;  2KQX A;  4HNA B;  3OGI B;  4FLT A;  1Q90 D;  5FLX N;  5KA6 A;  5JVD B;  1XHX A;  2CE4 A;  3SPI A;  5IYZ A;  4U7O A;  4JI6 B;  4J41 A;  5FNV B;  2XOK G;  1SQP H;  2WLJ A;  4CS3 A;  4IYI A;  1XDC A;  2KKW A;  1XMQ O;  3JAK A;  4DV3 B;  1S5L Z;  4JF3 A;  1YF2 A;  3ZCC A;  1XNR O;  1ORQ C;  4GKJ B;  4X1K A;  4NTX A;  5EIB D;  1B04 A;  1XHZ A;  1MG1 A;  4JYY A;  5LHG A;  1S5J A;  3H1I H;  1TVK B;  3IC9 A;  5C93 A;  2AZ0 A;  2ZR3 A;  5E79 Z;  4PDV A;  4JAA A;  5JH7 A;  1HR0 B;  2NR5 A;  3JAT B;  2P7T C;  4PA9 A;  4X88 A;  4NYK A;  3KG2 A;  3GB7 C;  4GCZ A;  1YIT V;  4O4J A;  1R3J C;  3CMA V;  1DF5 A;  1R1B A;  2ADP A;  5CA3 A;  3KCY A;  5LXT A;  5EIB C;  2A0L A;  2LJ2 A;  4JYC A;  3K04 A;  4YJ3 B;  3L70 H;  2EUL A;  2E5L O;  3FAV A;  1XNR B;  1GN3 A;  3CC2 V;  4ZIB A;  4DR7 O;  3KCX A;  1J95 A;  1YXB A;  2IW5 A;  2OIE A;  1WA8 B;  4X65 O;  5LP6 B;  3SPH A;  3Q4H B;  1F4M A;  1OCO C;  1VQ6 V;  4I5S A;  2JJ1 G;  4YIO A;  5B1A B;  3R65 A;  3E22 B;  5BMV A;  3CRA A;  1OCZ B;  3MHH C;  1KP2 A;  2WLK A;  4OX9 O;  2D2C B;  4TUY B;  2E75 B;  1NS1 A;  2E5L B;  4PD4 F;  1EM1 A;  4F4L A;  1VP7 A;  2OCH A;  5F2V O;  4DR7 B;  1I94 O;  3ETQ A;  3VBB A;  2HEP A;  1PD3 A;  1EZJ A;  5LOV B;  3K9A A;  1IX9 A;  1N34 O;  1MMM A;  5KHJ A;  4X65 B;  4JI0 O;  2F23 A;  5EZY A;  2ZQM A;  5KHH A;  2DWE C;  4DR5 O;  1QVG U;  4X1I A;  1GRJ A;  2XAJ A;  3TET A;  3FD9 A;  2JGD A;  2B9Z A;  4BWA A;  5IYC O;  3ABM C;  4WF9 V;  3CP1 A;  1M56 B;  2CTR A;  1MSD A;  2UXX A;  1XUQ A;  5LMN O;  3A0H Z;  4Z2W A;  4OX9 B;  4R50 A;  1WN7 A;  1AI5 A;  2CH7 B;  2M6Y A;  4R7C A;  2UU9 O;  1NTZ H;  4J42 A;  2KG7 B;  2V1D A;  3G80 A;  4LR3 A;  5IYD O;  5H6R A;  3UO3 A;  1I94 B;  1Q82 W;  5CBG A;  4ZHQ A;  1WP7 A;  4FK5 C;  5JJN B;  1N34 B;  4GT1 A;  4JI0 B;  2L6L A;  1K5Q A;  4MVS A;  5BR8 O;  4DUZ O;  2ZXW B;  2HKO A;  1L0L H;  2CTP A;  4DR5 B;  2YXH A;  2ZE8 A;  1K73 W;  1DGS A;  3CE2 A;  3CJH A;  4TV9 B;  1Y6X A;  2H8P C;  3ABL B;  1HP8 A;  5LMN B;  3G6B A;  1KEC A;  3WFV A;  3AG1 B;  1JCH A;  1VMG A;  4DUY O;  2UU9 B;  5LHI A;  4DR3 O;  3VOU A;  3F5W C;  5B1N A;  5BY1 A;  1R6N A;  3ASN B;  2VQF O;  3LDE A;  3D3I A;  4DUZ B;  5BR8 B;  2ILM A;  4I50 A;  1H2M A;  4JYB A;  4FLU A;  2ARH A;  3G6E V;  3OR7 C;  2EX3 A;  3ZHR A;  1OHH G;  2HP8 A;  3CCU V;  1HNX O;  1AR4 A;  2YXY A;  2X6C A;  3EFF K;  1Q6I A;  3CRC A;  5JCO C;  1VQ4 V;  5GON B;  2O57 A;  4R8C A;  3IGA C;  1NJI W;  1I5X A;  1IBK O;  4PDM A;  4FFB A;  4DUY B;  1N8R W;  1K3E A;  4DR3 B;  1BHA A;  2UXB O;  1P49 A;  3SYA A;  5KUK A;  5J2T B;  3CME V;  2VQF B;  3B09 A;  1DK1 A;  4X1Y B;  2HLD G;  4IIJ A;  1M5I A;  4JZ2 A;  5KMG A;  3NR7 A;  1KBH A;  2DW4 A;  3RGB A;  3K57 A;  2QWR B;  3CCV V;  4B7E A;  1K34 A;  2OYQ A;  1WLE A;  4B3T O;  3HB3 B;  1HNX B;  1P84 F;  5FPR A;  3U10 A;  1RM1 B;  3CC4 V;  4TV8 B;  1NR7 A;  1NVP B;  2YXL A;  1NTK H;  1X4T A;  5LA6 B;  1Z5V A;  3PJS K;  2L35 A;  2LFR A;  4NR1 A;  1V9P A;  3ZRW B;  1IBK B;  5B5E Z;  1JQ0 A;  2ZM6 O;  1AJP A;  2UXB B;  3CYO A;  5H2F Z;  3I56 V;  1PKX A;  3VQV A;  3IC7 A;  2Q9L A;  1BL8 A;  2Q0O C;  4XDJ A;  2V4D A;  3HKB A;  2EIN B;  2LW1 A;  3BFR A;  2PY5 A;  2VS0 A;  2R72 A;  3I55 V;  3K5M A;  4B3T B;  1PPJ H;  4I4T A;  4O4L B;  1SQQ H;  2KSD A;  5LMU O;  5CB4 A;  3K5L A;  1MSW D;  1N36 O;  4LF9 O;  1R3L C;  3JD0 A;  4W4L A;  3ABK B;  4GZR B;  4J9Z B;  4X20 B;  1VQP V;  4KHP O;  1Y67 A;  1WP8 A;  1CP9 A;  3G71 V;  1VEW A;  2Y4U A;  3D3Q A;  3HKE B;  2YSU B;  5EK0 A;  4EB6 A;  3K5O A;  2ZM6 B;  2OT5 A;  5J2U A;  5BXZ A;  2EZO A;  3ABT A;  1JFF A;  3VQW A;  1SES A;  4JV5 B;  1PV0 A;  4FM0 A;  5EBM C;  2X7R B;  2CTQ A;  5KLV H;  5L3B A;  2AHY A;  2JVD A;  5TIS Z;  3OD4 A;  4L8J A;  1RSO A;  4IHJ B;  1TUE B;  4ASU G;  4PHZ A;  2KB1 A;  5IWA O;  3SGI A;  4DV6 O;  1NT2 B;  2Q7H A;  1THZ A;  3ZHS A;  3MHS C;  5LMU B;  5EBW C;  1EN4 A;  1N36 B;  4NXN B;  4LF9 B;  4JAS A;  3CCM V;  2OTL V;  2UUC O;  2W0X A;  1QLN A;  1YSC A;  4B3M O;  3SPC A;  4KHP B;  1BSM A;  2YID A;  4A5U B;  3N2G A;  3ZHU A;  2HJD A;  3STZ C;  3SYQ A;  5H6Q A;  2P67 A;  4NVP A;  1AR1 B;  2P4K A;  1U97 A;  2HG5 C;  3G67 A;  1PNL A;  4JI1 O;  1BZK A;  5K1P A;  5B1O A;  3EHB B;  5JCO A;  4DR4 O;  1Y76 A;  2A79 B;  3MAQ A;  1N4C A;  2DYR C;  4FJC C;  2RN9 A;  5EBL C;  4J11 A;  2Q5Z A;  3OGC C;  3DGE A;  3ETG A;  1Q81 W;  2JEU A;  1MOF A;  4DV1 O;  1GTO A;  4PA3 A;  4MVU A;  3OUF A;  1SF9 A;  4TWK A;  3FB7 C;  1QR8 A;  2P22 C;  4AIL C;  1J5E O;  4JPR A;  2UUC B;  1FXK B;  1AP5 A;  1HNZ O;  4B3M B;  3CRR A;  5CA1 A;  4BIU A;  2FKX A;  1EN6 A;  1W2B U;  1DTO A;  1VQK V;  4DV2 O;  3A0B Z;  4OGQ B;  4FMT A;  2ZKO A;  4H33 A;  1AJQ A;  1EBO A;  3D36 C;  1IDS A;  2MW2 B;  4JI1 B;  1HWY A;  4FLV A;  3A0R A;  3SJA C;  2EIL B;  2MK3 A;  4DR4 B;  2Z0A A;  4BW5 A;  4RQE A;  3APQ A;  2UUA O;  1S72 V;  3E8F A;  1GM8 A;  3AEI A;  3SDL A;  1UFI A;  5IYB O;  2A7W A;  2CK3 G;  4O2B A;  1TGO A;  4DV1 B;  2HR3 A;  1SA0 A;  3E8G A;  2FL4 A;  2CAZ C;  2RNB A;  3K0D A;  3ABK C;  2VWK A;  1J5E B;  4UFZ A;  4EFE A;  4PA4 A;  4BIZ A;  1B6Q A;  1US6 A;  3ZHV A;  1HNZ B;  3C3T A;  2QWP B;  1EN5 A;  5CA0 B;  2YS8 A;  4KUM A;  1I0H A;  1SER A;  4DV2 B;  3AG4 B;  3ASO B;  1W0K G;  4RO2 A;  4EFB A;  1L8D A;  4X8A A;  1BGY H;  1U96 A;  1SKV A;  2C2A A;  4J9Y B;  3JAW B;  1BQZ A;  2E76 B;  1K5S A;  2QA4 V;  4QE9 A;  1P7B A;  4ZBM A;  4IT5 A;  4PJ0 Z;  3K08 A;  2WLI B;  1Q6U A;  2ZIO A;  3DSQ A;  4B3S O;  1HNW O;  1M57 B;  2B5U A;  2DQ0 A;  2WAM A;  3E8B A;  3RWR D;  3FB8 C;  1ZLZ A;  3RYH B;  1O9H A;  1XQ8 A;  5JJJ B;  5K1X A;  1AI4 A;  2P5O A;  4BIO A;  2Y0I A;  1Q8I A;  5LGN A;  4I9Q A;  5KHI A;  1ZUQ A;  3ZN0 A;  4LNU A;  4PDL A;  1JJ2 U;  4CZZ A;  2Q4P A;  4H13 B;  2BTO A;  1JX9 A;  3M8A A;  1MA1 A;  4EKW A;  1MZF A;  3CPW U;  4F6E A;  4B3S B;  1HNW B;  4O2A A;  4MT8 A;  1FXK C;  1K7D A;  3BY6 A;  3UT5 A;  1JJO A;  1Q5O A;  2LP7 A;  1W59 A;  2ZNJ A;  2K9P A;  4JI4 O;  3SJC C;  2F43 G;  4KP4 A;  3L74 H;  4FLW A;  4LWS B;  1QLE C;  5EC1 C;  2HFE C;  1GAX A;  1NKD A;  3P3P A;  3UKM A;  2VQE O;  4NTW A;  4CH3 A;  2Q69 A;  1FFX B;  1Q43 A;  4L87 A;  4TQD A;  1OCC C;  3B8M A;  2WLN A;  3MD0 A;  5IJ0 B;  1SQV H;  4JYA O;  4I55 B;  3ZIA G;  3WB0 A;  2BSK B;  4UCU A;  3QVN A;  3D36 A;  3FX7 A;  3JSN A;  1MZE A;  3APO A;  1F7Y A;  1YHQ V;  4P9P A;  2BCC H;  1VF5 B;  3O65 A;  4UVA A;  1KKD A;  3EXA A;  2Y4T A;  2YC0 A;  4ZI7 B;  4MW3 A;  2P06 A;  5B66 Z;  1VQO V;  4QGP A;  1UPG A;  4JI4 B;  4U3J A;  3S3X A;  3RYF B;  3ZMU A;  2W0F C;  3U11 A;  2VQE B;  1BHB A;  5CB4 B;  2ZR2 A;  1TUB B;  2ZCE A;  3N2K A;  4I9W A;  3T2M A;  3OAA G;  2RDC A;  5B1B B;  4JYA B;  1GM7 A;  3THO A;  1SZT A;  2P6J A;  3LSU A;  1F4N A;  2P4V A;  1JFF B;  3X2Q C;  1M57 C;  3P3N A;  5D5P A;  2QTS A;  2YIB A;  4C7U A;  3L75 H;  4H44 B;  4WFE A;  1FPO A;  4K35 A;  4F6R B;  4WFA V;  4MW8 A;  3AK2 A;  1BQ0 A;  1XL4 A;  3BA8 A;  3OUS A;  1AI6 A;  2Y69 B;  5IDJ A;  2Q8V A;  1YCI A;  5ITZ B;  5LYJ B;  1UJW B;  1XMO B;  2UUB O;  1VF7 A;  1LUV A;  4XDL A;  2BOC C;  3RBZ A;  2WLM A;  2LFS A;  3E8H A;  5C8Y B;  1SQF A;  1EZV H;  4DK1 A;  1KB9 F;  2AGA A;  3RW0 A;  3CXC U;  4D7T A;  3B77 A;  4WBN B;  4CBC A;  1SQB H;  2VRZ A;  1P7G A;  2H3O A;  2WSS G;  3QO5 A;  2QR4 A;  2UUB B;  1IUR A;  2Y0P A;  2Q68 A;  1NI8 A;  2GSM B;  2QEX V;  2WA4 A;  2QWN B;  2JEX A;  2IJI A;  4PV1 B;  3BPZ A;  2JIZ G;  3AG3 B;  1K4D C;  4HBN A;  5EYP A;  4UCT A;  1SZX A;  1VQ5 V;  2ATK C;  4DRX B;  1Z2G A;  4JZG A;  2OCC B;  2BTQ B;  3TXS A;  3RYI A;  1OJH A;  1YIJ V;  1K9M W;  3WG7 B;  4ZOL B;  1IXB A;  3W7W A;  1B3Q A;  2GUZ A;  1JOY A;  4OPA A;  4O4I A;  2ZIN A;  1ROP A;  4YJ2 A;  5IJ9 A;  3A2F A;  2B1G A;  2LGW A;  1URF A;  2ZE6 A;  2HHH B;  1AVM A;  4LFC O;  2QKS A;  4O4H B;  3A8T A;  4X62 O;  4CH6 A;  4UCO A;  2F66 C;  3RT3 C;  1LNQ A;  3B40 A;  3CHX A;  4AHC A;  3TK1 A;  3HPL C;  3DXR A;  3OT7 A;  1VQ9 V;  5LP6 C;  2FB5 A;  3LNN A;  4I0X B;  1MNG A;  5JQG A;  4JI7 O;  5B1A C;  2YUA A;  2JDI G;  5KX5 A;  2XAH A;  1E1R G;  1HW7 A;  1Y74 B;  2YEV B;  5GW7 A;  2ETN A;  1OCZ C;  4DV7 B;  3FYE B;  1OCR B;  4JI8 O;  1K4C C;  2Q73 A;  5A9G A;  4X9Q A;  4X66 O;  1ZL8 A;  2IU3 A;  4JTD B;  2DQ3 A;  4MSW C;  4LFC B;  1CPY A;  4X62 B;  1M1K W;  4CS2 A;  5GTH Z;  4FFK A;  1H2K A;  3FYI B;  3J81 N;  5JJE B;  3HKC A;  2WLL A;  4IGG A;  2YI8 A;  3K79 A;  3HKD B;  4JI7 B;  1G4Y B;  3JAL A;  4WCE V;  3ZRS A;  3T1C A;  1YJ9 V;  3JCZ A;  2EIK B;  4CC6 A;  1E1Q G;  1M56 C;  3JAS B;  4HZ3 A;  4JI8 B;  4UB6 Z;  1ZTE A;  4X66 B;  4LF5 O;  3RYC A;  2D3O W;  4HNA A;  5B3S B;  3MDS A;  2LQT A;  5JWP A;  5JVD A;  5IYZ B;  4X89 A;  1WB8 A;  2FYU H;  3P30 A;  5FNV A;  4K8Z A;  2Q0A A;  4JV5 O;  4MTO A;  3CB2 A;  2A06 H;  3JAK B;  3ZMV A;  2ZXW C;  1FAF A;  2CTW A;  3OTO O;  2XT9 A;  3AG2 B;  4X1K B;  5L3G A;  1SQG A;  3LSQ A;  1SC5 B;  4G28 B;  1RP3 B;  1H2S B;  3BHP A;  4CS4 A;  1NZ6 A;  2QM7 A;  5LL6 Y;  3IFX A;  1K8A W;  4NXN O;  3ABL C;  4AI8 A;  1H2L A;  1TVK A;  3AG1 C;  3L72 H;  4LF5 B;  1F23 A;  1XEQ A;  3DC5 A;  5JH7 B;  1VIB A;  3JAT A;  2QTO A;  5LBQ A;  4GX5 A;  4DV0 O;  1D5N A;  4O4J B;  3SJB C;  1QBZ A;  3ASN C;  5KAI Z;  4FM1 A;  1GK9 A;  1V55 B;  4DK0 A;  4GLX A;  5LXT B;  1NR1 A;  4FLX A;  4YJ3 A;  1YTF B;  1QU7 A;  4ABM A;  4ICG A;  3OTO B;  3FAV B;  2PGG A;  3ABU A;  4QIW F;  3CCL V;  5KUM A;  1R3K C;  3L71 H;  2QGN A;  2Q7E A;  1WA8 A;  1OCR C;  4IYH A;  4DV5 O;  5LP6 A;  2A9H A;  2F95 B;  3Q4H A;  4WFG A;  1VQN V;  2ZE5 A;  1AR5 A;  3E22 A;  4KL1 A;  2DOS A;  3WB1 A;  5BMV B;  1B06 A;  4DV0 B;  3SR2 C;  1NVP D;  3DC6 A;  1V54 B;  3E89 A;  1S76 D;  3OTF A;  4J10 A;  4J7Z A;  3S3W A;  4TUY A;  3UO2 A;  1SET A;  4UCV A;  3GVM A;  4E2L A;  5KAF Z;  1GO3 F;  4JI5 O;  3U0Z A;  1G8M A;  4UB8 Z;  1KC8 W;  5LOV A;  2EIM B;  1VQL V;  1RM1 C;  3BEH A;  4DV5 B;  4U7N A;  1CEZ A;  4P2Z A;  2DYS B;  2R9I A;  3ZRV A;  4TT3 G;  4J80 A;  5EZY B;  3UM7 A;  2R9R B;  1JVM A;  2HVK C;  1WAZ A;  2IH1 C;  2JS5 A;  4X1I B;  4G2K A;  3W7X A;  3E86 A;  1AP6 A;  2JGD B;  5IY5 B;  3OFN G;  1W0J G;  2ZIM A;  3JYC A;  3OMN B;  1JR9 A;  3K0G A;  2N04 A;  3EVK A;  2CH7 A;  2EIN C;  3AG2 C;  2KG7 A;  3RVY A;  2P90 A;  3LNM B;  5HFM A;  1D5A A;  3H01 A;  2AHZ A;  5LHH A;  4JI5 B;  4W4K A;  4U3F H;  2W6I G;  4ZHQ B;  2Z3Y A;  1YTF D;  4YHH O;  3F7Y C;  2CDY A;  1SQX H;  2QM8 A;  4P30 A;  2A3Q A;  1GMG A;  3JAR A;  2M7W A;  1PP9 H;  1WPB A;  1QCE A;  1ZWI C;  3CJH B;  4TV9 A;  3CCS V;  4D7S A;  1GKF A;  2F4V O;  2XAG A;  2QSA A;  5KHG A;  3RVZ A;  2UXN A;  3SJQ C;  3BVO A;  5KHK A;  3CD6 V;  1X59 A;  1PL4 A;  4P9O A;  3SYP A;  4DYL A;  1LR1 A;  1IVS A;  3K06 A;  3FKS G;  3CSX A;  5BZB A;  1K92 A;  4YHH B;  2JRI A;  4I50 B;  2AZ2 A;  3AK3 A;  4I7Z B;  1GN6 A;  2QJ1 A;  2PYJ A;  1PNK A;  4UXN A;  4UV9 A;  1FJG O;  1IZ3 A;  4J7K A;  3K58 A;  2F4V B;  1PM9 A;  1R3I C;  3ETE A;  1R6K A;  5GON A;  1WB7 A;  1XL6 A;  2Z5U A;  3T4Z A;  4YXW G;  3K3W A;  4FFB B;  2E74 B;  3M99 B;  1FYJ A;  4FZ0 A;  1G1X B;  4N23 A;  4QPJ A;  1GN4 A;  1BMF G;  5J2T A;  4K0K O;  2LGQ A;  2YIA A;  2AW9 A;  3OW2 U;  4HAM A;  4LFB B;  5DEC A;  4X1Y A;  1K33 A;  4IIJ B;  2H94 A;  3LSS A;  5KMG B;  1Y4M A;  2DJV A;  4LH7 A;  5FPO A;  3JD4 A;  1R73 A;  4RUE A;  5AG2 A;  1KYO F;  5L3F A;  2JGU A;  3ICX A;  4TQF A;  1NH2 B;  3J80 N;  1BT8 A;  2JJ2 G;  1FJG B;  4TV8 A;  4DW0 A;  4NKG B;  4YY3 O;  1KU9 A;  5LA6 A;  3QO8 A;  4LF6 O;  2XAS A;  2EIL C;  1FXV A;  2B1I A;  3RFR A;  3ZRW A;  4LP8 A;  5A2Q N;  4PI2 A;  1M9N A;  2G38 A;  1Q3E A;  1TA8 A;  1KP3 A;  3ABM B;  3WB2 A;  4K0K B;  5CMU A;  1WJZ A;  2W6J G;  3CXH F;  3BCC H;  3HKB B;  4Z1M G;  3B4S A;  1P4R A;  3TCU A;  3AG4 C;  3B8N A;  3ASO C;  1I7F A;  4B3R B;  4I4T B;  1QVF U;  4O4L A;  3STL C;  1XMO O;  1EFR G;  1VQ7 V;  4CC5 A;  3GWK C;  4NTY A;  4ZKI A;  4YY3 B;  2ZDI C;  4X20 A;  4LF6 B;  3BAA A;  1NTM H;  1M4U A;  1WNS A;  3FFQ A;  1YJN V;  2EIJ B;  2N05 A;  3HKE A;  4EB6 B;  3AG7 A;  5J2U B;  4JTA B;  3J7A U;  3OMI B;  3CEI A;  2RJZ A;  3F7V C;  3W7U A;  3K03 A;  4QE7 A;  1XMQ B;  3H1K H;  3QNE A;  1T5E A;  1RSO B;  3OM3 B;  4IHJ A;  4DO2 A;  2CGN A;  1ENV A;  2QE7 G;  3TXQ A;  2PUS A;  4XDK A;  3QG5 A;  4GKK O;  1D2D A;  4PDR A;  4DV4 O;  1JPX A;  2F1M A;  2NN4 A;  2CGO A;  2ZT9 B;  5H9C A;  1H38 A;  4QJF B;  3N27 A;  2GV9 A;  4DR2 O;  3N2G B;  1NH2 D;  1S5H C;  3CC7 V;  1PL0 A;  1YJW V;  1GM9 A;  1AJN A;  1FKA O;  3W7T A;  4UV8 A;  4J7J A;  1Y76 B;  1N33 O;  1L0N H;  1OZ0 A;  3RN4 A;  3ZMZ A;  5HFL A;  2YI9 A;  1RPO A;  2DE0 X;  2XHB A;  4IL6 Z;  3ZJZ A;  5J9P C;  3SPG A;  4RAI A;  4GKK B;  4E4E A;  3CRM A;  4DV4 B;  1R6T A;  3WU2 Z;  1FXK A;  2HHH O;  5CA1 B;  4DR2 B;  1SS3 A;  4BR6 A;  1Q86 W;  2V7Q G;  2IJJ A;  3H1J H;  1GN2 A;  3C90 A;  2GTA A;  4R6Z A;  4DR1 O;  4MVO A;  2VWJ A;  1QQC A;  2OIG A;  1N33 B; 
#chains in the Genus database with same CATH homology
 1FJG O;  1A32 A;  1XNR O;  3RT3 C;  3J7A U;  5BXZ A;  1AIL A;  3SDL A;  4LFB O;  4JI4 O;  4DR5 O;  1IBK O;  4DV7 O;  4NXM O;  2N74 A;  5LL6 Y;  4NXN O;  4JI7 O;  4DR6 O;  2UXB O;  1FYJ A;  1IBM O;  2VQE O;  1G1X B;  1XEQ A;  4K0K O;  5LMN O;  5IT9 N;  5IWA O;  2AGA A;  4DV6 O;  2UXD O;  1DK1 A;  4JI2 O;  3T1H O;  2UU9 O;  4GKK O;  4JI8 O;  4JYA O;  1D2D A;  4DV0 O;  2DJV A;  4DV4 O;  2UUB O;  1R1B A;  4X66 O;  2UUC O;  4B3M O;  4DR2 O;  4LF7 O;  4A5U B;  4B3T O;  5H5N A;  1F7Y A;  3J80 N;  4JI6 O;  3O65 A;  4YHH O;  5BR8 O;  4DUZ O;  2E5L O;  1AB3 A;  4LF8 O;  4YY3 O;  1FKA O;  4DR7 O;  4LF6 O;  2LW7 A;  4JI1 O;  4AQY O;  3J81 N;  4LF4 O;  4DR4 O;  4JI3 O;  5A2Q N;  4B3S O;  1HNW O;  4X65 O;  4DV5 O;  4DV3 O;  2ZM6 O;  1KUQ A;  1N33 O;  4LFA O;  3JAM N;  4GKJ O;  1IBL O;  2F4V O;  4B3R O;  3T1Y O;  2DOS A;  4DUY O;  4DV1 O;  1X59 A;  1YZB A;  4DR3 O;  2UXC O;  1R6T A;  3F5T A;  1J5E O;  2HHH O;  5BY1 A;  4LF5 O;  1HNZ O;  1HR0 O;  2FKX A;  2VQF O;  4OX9 O;  4OPA A;  4OPH A;  5FLX N;  4DV2 O;  1NS1 A;  1XMO O;  2JRI A;  3R66 A;  4X64 O;  5LMU O;  2ZKO A;  3M8A A;  1N36 O;  1N32 O;  4LF9 O;  1I94 O;  4DR1 O;  4JI5 O;  1XNQ O;  4KHP O;  4JV5 O;  4LFC O;  1N34 O;  1HNX O;  1XMQ O;  2Z0A A;  4JI0 O;  4X62 O;  2UUA O;  3OTO O; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...