1N36O

Structure of the thermus thermophilus 30s ribosomal subunit in the presence of crystallographically disordered codon and near-cognate transfer rna anticodon stem-loop mismatched at the second codon position
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
88
structure length
88
Chain Sequence
PITKEEKQKVIQEFARFPGDTGSTEVQVALLTLRINRLSEHLKVHKKDHHSHRGLLMMVGQRRRLLRYLQREDPERYRALIEKLGIRG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Selection of tRNA by the Ribosome Requires a Transition from an Open to a Closed Form
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 16S RIBOSOMAL RNA
total genus 29
structure length 88
sequence length 88
ec nomenclature
pdb deposition date 2002-10-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
O PF00312 Ribosomal_S15 Ribosomal protein S15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.10 Mainly Alpha Orthogonal Bundle Helix Hairpins S15/NS1, RNA-binding 1n36O00
4LF5O 4NXNO 4OX9O 2VQFO 2AGAA 5A2QN 5BXZA 5LMUO 3JAMN 4B3RO 4X64O 4JI2O 4X62O 1J5EO 5BY1A 3J80N 3R66A 3M8AA 1AILA 4DV7O 1XNRO 4JI0O 3F5TA 2F4VO 4DUZO 1IBMO 1IBKO 2JRIA 3T1YO 4DR5O 4JI3O 2UUCO 1HNWO 1FJGO 4LF9O 2VQEO 2UXBO 2FKXA 1X59A 4JYAO 1F7YA 1XEQA 3O65A 3RT3C 1HNXO 4A5UB 3OTOO 2DOSA 1XNQO 4LFBO 1IBLO 4LF8O 2UXDO 4LF7O 5IT9N 1A32A 4B3SO 1XMQO 3T1HO 4JI7O 4NXMO 4GKJO 2UUBO 4JI5O 1N33O 5FLXN 1DK1A 4LF4O 3J7AU 4DV4O 4LFAO 4JI4O 4JI6O 4DR3O 1D2DA 1KUQA 4OPHA 2UUAO 4DV5O 4B3TO 1HR0O 4YHHO 4DV3O 1AB3A 2Z0AA 4JI1O 1XMOO 5LMNO 4DR2O 5LL6Y 4OPAA 5H5NA 2ZM6O 4DV0O 2E5LO 1G1XB 4X65O 4LF6O 1HNZO 2UXCO 1YZBA 1R6TA 1I94O 4K0KO 4X66O 2HHHO 3J81N 2UU9O 4JV5O 1FKAO 4DV6O 4AQYO 4DR1O 4DUYO 4DR6O 4DR7O 1FYJA 4JI8O 4LFCO 2ZKOA 1NS1A 4DV1O 4DV2O 4DR4O 5IWAO 5BR8O 1N36O 1R1BA 4B3MO 4KHPO 2DJVA 1N34O 4GKKO 4YY3O 3SDLA 1N32O 2N74A 2LW7A
chains in the Genus database with same CATH superfamily
3ABKB 2Q7EA 1I0HA 1Q6UA 1H38A 4JI2B 5JCOC 1M4UA 4TUYA 1G8MA 4J9ZB 2Y4TA 1Y6XA 3UQ8A 3B8MA 1AILA 5L3GA 1HNZB 1NR1A 1TVKB 5KAFZ 1TA8A 2DE0X 2UXBO 3AG7A 3JSNA 3TK1A 1OZ0A 5GTHZ 3ZCCA 5LGUA 3U0ZA 3FX7A 4NXNB 4BIOA 1FFXA 3JALB 4CS2A 4UCOA 2L6LA 3WG7C 2PZSA 4JI1B 4DYLA 4JYYA 3K3WA 4FLUA 1GM9A 4X9QA 1R3LC 2ZINA 3N2KA 1AI6A 1WJZA 2Z0AA 5LHIA 1Y76B 3STZC 3FAVB 4N21A 4OPAA 1N36B 3G71V 1MZEA 2Y0PA 3OUSA 4JZ2A 2Q68A 2JGUA 4EKWA 3QO7A 4FVMA 1FFTB 3ZMZA 4F6EA 2Y4UA 3W7TA 3J81N 3ZRVA 4JZGA 1EN5A 4JV5O 3SPIA 4DV6O 1LNQA 3JARA 1IBLB 4DUYB 5CA1B 2A7WA 1SQGA 4KHPB 2W0FC 2VRZA 4EFEA 4DR1B 4QIWF 4DV3B 1X4TA 5FNVA 3WB0A 3E2EA 3ZMSA 2EJ7A 1PL4A 1VQ5V 4X62O 2PYLA 2WLJA 1KKCA 5BY1A 3RGBA 3R66A 3LSQA 4DV7O 4KXRA 3D3QA 3B77A 1IVSA 2V1DA 1EZJA 1K7DA 1VP7A 1VQMV 1B04A 1E1QG 2QKAA 1KU9A 4NTXA 3SPGA 2AZ0A 1JQ0A 1WPXA 1X59A 1F7YA 2R70A 2JGDA 3T4DA 3DTUB 1AJPA 4WFHA 3CJHB 3JASB 5LHHA 1A32A 2PUSA 4GKKB 3JARB 4UVBA 1VQPV 1DK1A 5J2TB 1QR9A 1NTMH 4PV1B 5EZYA 3CCRV 4LFAO 4P9OA 4X8AA 3ASOB 1GH6A 1EBOA 3DC5A 3HR0A 2Y69B 1VQ8V 4LF7B 1QNMA 2R9RB 1Y76A 3JD2A 4GT1A 2PI4A 2OWOA 2BTQB 1G1XB 4ZI7B 3Q4HA 4P2ZA 3CJHA 5FPOA 4Z2WA 3ZMTA 1DLBA 1NI8A 4QJFB 1JR9A 4K8XA 3F7YC 2ZDIC 1UFIA 3K0GA 3JSLA 1JJOA 1YF2A 1K3EA 4FFBA 1PP9H 4JI8O 2DQ0A 4G28B 1M57C 2HVJC 5LBQA 3SR2C 4E4EA 4UUJC 1N32B 3MD0A 2LFSA 3AG2C 3ASNB 3MDSA 4X1IA 1BGYH 4Z1MG 4JI2O 1Q43A 4X1KA 3JD3A 4LNUA 1XNRO 1S5LZ 2ZE5A 3AG4C 1AI7A 5EBLC 2QTSA 3T1YO 4CBCA 3G6EV 3G67A 2IJIA 3OE7G 3CS5A 5B3SC 4R6ZA 3CE2A 3O65A 3LDEA 4EEQA 3W7WA 3RYCB 5H2FZ 4MTGA 4QE9A 3U11A 3ZHQA 1XQ8A 4FMTA 1NH2B 1K4CC 1SQFA 4GLXA 1XNQO 2GDSA 3RW0A 1B3QA 4YJ3B 1M9NA 1GMGA 1TGOA 4B3SO 4MTXA 4OXSA 3SYCA 4GUNA 4JAUA 1TUBB 2HR3A 3HKCB 5J2UB 1P49A 3LUTB 1WPBA 1YIJV 3ZN0A 2UUCB 2QWRB 2DYSC 2CDYA 4WBNA 2FTKA 2LQTA 3JATA 1H2GA 3CMEV 3CHXA 5JJEB 5KHKA 1SZTA 1LUVA 1RPRA 3K5NA 3ABKC 4LWSB 1N33B 3HKDA 1S5HC 2IJHA 3K5LA 3BAAA 2P6JA 1R6TA 4U3JB 4IHJB 1KQSU 4YJ2A 2CH7A 4LWSA 1VQOV 3C3SA 3ETQA 2IU0A 1H2SB 2A0LA 2EZPA 3E22A 2Q8VA 1ZLZA 5B1OA 1TVKA 3OR6C 1NS1A 4PA7A 2DQ3A 5BR8O 1GKFA 3ZBHA 5EC1C 3SDLA 3X2QC 4Z1VA 1I5YA 1LR1A 2OTLV 3F5WC 4RUEA 2E75B 1VQKV 4NXNO 2GSMB 5B1AC 4QNHB 3E22B 4HNAA 2VWJA 3CD6V 2PF4E 2ZDIA 4FFKA 1V54B 1M5IA 3JAWA 4R8CA 2F4VO 5L3BA 3APOA 5IYCO 1XHZA 2UU9B 2YEVA 2ZIOA 3HKDB 5FPRA 1NQTA 2IJKA 3CRRA 4DK1A 4JI8B 1IXBA 1L8DA 3E83A 1XREA 1I94B 1VQ4V 1WA8B 1FJGB 1SQBH 2YIBD 3LSSA 2ODMA 2A06H 2ZM6B 2CTRA 3PN1A 4LF5B 1BL8A 4MVZA 4MT8A 5IT9N 1ZSPA 1RM1C 5JH7A 2UUBO 1QLEB 3FB8C 4UCRA 2PY5A 4RO2A 4PI2A 2EINB 4XDKA 1JX9A 3RYIA 4GZRB 3OM3B 2H3OA 1D2DA 4PA6A 2IU3A 4NVPA 2YXLA 5KUKA 1DF5A 4LP8A 4R7CA 5J2UA 3K03A 5BR8B 2LP7A 5EBWC 2Q9LA 2HJFC 3K9AA 1XOUA 4JAVA 4LNUB 4DV4B 1NH2D 2OIEA 4I50B 3RYCA 1R6KA 3H1KH 2ARHA 1Q82W 4X1KB 1RSOB 1NVPD 4G27B 4UB8Z 3FFQA 4IL6Z 5IYBO 4J42A 5FL7G 3OTFA 2Q7HA 1YCIA 4PD4F 4DV2O 4MW8A 2ZT9B 1W0KG 4I55B 1NU1H 4X1IB 2VQFO 2AZ2A 5BXZA 4OGQB 3HKBB 4GCZA 4I4TA 2ZQMA 2QM7A 5LGNA 4FLXA 1IBMB 1P7GA 4GX1A 4QGPA 1YDXA 2ZD9A 1HNWB 2QWPB 1QLNA 1AJNA 1YSCA 5K1XA 4LR3A 1NJIW 1QU7A 2QR4A 5D5PA 2BTQA 2Q4PA 1E79G 1ENVA 2ZE7A 3CC2V 2K9PA 2XUMA 4FIPC 4X20A 3BY6A 1PV0A 4D6TH 1KD1W 3OTOO 1R3JC 4IIJA 3ETDA 4WF9V 4JI7O 1M93A 3HKBA 2UUBB 5JCOA 2QM8A 1OCCB 2YC0A 1M57B 1KUQA 2BOCC 3QTCA 3A0RA 2LJ2A 2UUAO 3UKMA 3RVZA 1H2MA 5J2TA 4JI1O 3BABA 2D3OW 4X65B 1SQVH 5H5NA 3MAQA 5JQGA 4DRXA 3W7SA 4UCTA 1N0NA 4YIOA 2M7WA 1EN4A 4LF4B 5H6QA 2GHYA 1CP9A 1AJQA 2DWEC 4PDVA 4TV8A 4LF9B 5BZBA 3WG7B 1K5SA 2F23A 1Q90D 4IIJB 3OR7C 4NR1A 1FPOA 1VMGA 2IH3C 1OCCC 2EULA 1VQ7V 2XAGA 1Z5WA 2LW7A 1WB8A 2IJJA 3TXQA 3H01A 4TWKA 2CGOA 5LMUO 1GO3F 1K9MW 4EFBA 4NYKA 1EZVH 4UXNA 4QE7A 4J9YB 3RYFA 2E5LB 2W6JG 4J7JA 5KA6A 2KQXA 2A9HA 4FM0A 3DXRB 2ATKC 2WPDG 4JTDB 3ZRWA 3W7XA 2ZE8A 3OFNG 5ITZA 4CH5A 4K8ZA 4WFFA 5LGTA 5GW7A 1NT2B 2Z3YA 3D36C 3ABMB 5KX5B 3JAKA 2GV9A 1GN4A 2F93B 1IDSA 4TT3G 1SQPH 4DV4O 2RN9A 2Q69A 4WFEA 1P4RA 4BW5A 4DR3O 4MSWC 1O9HA 4I9WA 3RYIB 1SA0B 3U10A 2EILB 4UV9A 4AI8A 1XMOB 2Y0IA 4IYIA 2ADPA 3T1CA 3FB6C 4O4IA 2XAJA 4JYCA 3CRCA 2ZM6O 1K5QA 2CH7B 2PGGA 4X64B 2B1GA 4FJCC 1Q81W 1FFXB 3JALA 4BAYA 4JI4B 4JASA 4U3JA 5BMVB 4QPKA 2LO1A 2WLLB 2WSSG 2JIZG 2JJ1G 3K5OA 4O4JB 2UU9O 2AHZA 5JJJB 2BTOA 2LGQA 1PM9A 2QE7G 1SS3A 3OEEG 3E89A 4MVQA 3N27A 3ABUA 4XDJA 4UVCA 1GM7A 2BCCH 1S5JA 2HP8A 2DJVA 3GWKC 2CTWA 4ZOLB 1VF6A 2VQEB 4DV5B 3SJBC 1EN6A 4B3RO 3ZMUA 5CBGA 4WFGA 4D7TA 3LDCA 3CRAA 3F5TA 5CA0B 3CCUV 3VOUA 3RWRD 2IH1C 3SYQA 5EIBC 4GX0A 3TGUH 3D3IA 3K9SA 3C3TA 3AG3B 3IJ4A 2Q73A 2NLJC 1P84F 1AVMA 2UUAB 1IX9A 4O4JA 3CCVV 2OCCC 4RAIA 5KHGA 2R72A 1MSDA 4EB6A 5IY5C 3AK2A 4WCEV 3CCJV 3APQA 1KECA 1NZ6A 1XMQO 4X62B 2OTJV 4JI7B 1JFFA 1G6UA 4J7ZA 3SYPA 1PNLA 1TUEB 2JJ2G 3MHSC 3FYEB 4EB6B 3BVOA 2KB1A 2WA4A 3RFRA 2JDIG 3HPLC 4DK0A 4DXWA 1AB3A 3SPHA 2OIGA 2V4DA 2FL4A 4O2BB 1QQCA 5C8YA 1SA0A 1HWYA 4O2AB 3TCUA 4U7NA 2OCCB 2Q67A 3SJCC 3A0BZ 3BFRA 2A3QA 4DO2A 4DR6B 4LBEC 3ASOC 2JEUA 4JI3B 1YEWA 2QKSA 4BWAA 2PYJA 2EILC 2GUZA 3CRQA 1OHHG 4KHPO 1SC5B 4JI0B 1BT8A 4FK5C 2N74A 1JPXA 3FYIB 4P30A 5B66Z 1Z2GA 5GONB 1J5EO 2HLDG 3QO5A 4NTWA 4XDLA 2EIKC 4CS3A 3K04A 1NBMG 3CCLV 3LDDA 3ZHSA 5BMVA 3SPJA 1IBKO 1QVFU 5IWAB 2JRIA 3ZJZA 4DR5O 4LH7A 1EM1A 2RCVA 4FLVA 3FD9A 1XUQA 3VQXA 1ZTEA 4UCSA 4I0XA 1WNSA 2UXXA 4PI0A 4RWUA 3GVMA 4UCUA 2DOSA 4MVMA 2MK3A 3RBZA 3ASNC 4J41A 1K34A 1SERA 3G80A 1K73W 2YICA 3B4SA 1SZXA 3ZMVA 2DN9A 2ZR3A 2P4KA 4CS4A 1VF7A 5CA1A 4UFZA 5KUMA 1W2BU 5ITZB 5EZYB 4OX9B 4W4KA 2BSKB 1UPGA 3E8GA 4W4LA 5IYDO 2QWQB 1B06A 2GTSA 2YI8A 1HNZO 2UXCO 2RMKB 3ZRSA 1Q86W 3PJSK 4MVOA 4O4LA 2CE4A 3E35A 4WFBV 1GN6A 1H8HG 2E74B 3FAVA 2BSKA 2XAHA 4PJ0Z 3UCSC 3CX5F 3CSXA 5KA5A 4AQYO 4PELA 4HBNA 4DR6O 4B08A 3K06A 1NTZH 1IZ3A 3CCQV 5IWAO 1KP3A 1R1BA 3JD4A 1S3JA 2W6IG 1GK9A 2F66C 4GKKO 2EIJB 2N05A 4MVSA 3H1LH 5B1BC 2XHBA 3ABMC 2P06A 4X1YB 4YXWG 3I55V 1XDCA 1F4MA 1BQ0A 1IXMA 1URFA 3KCYA 3SGIA 1YTFD 4O4HA 3TETA 3AEIA 5L3DA 2QWOB 1AR4A 3QO8A 3HKEA 3SYOA 3BPZA 2X0LA 5JQGB 4JI3O 1HNWO 1JMKC 3ABLB 2H8PC 2IBZH 3RVYA 4GX5A 3CXCU 5B1NA 4I50A 2P22C 2JS5A 2N04A 1N8RW 5LMNB 4FZ1A 2LFRA 1E1RG 4X66B 1Q3EA 3WB2A 1IBLO 3ZHTA 3AG1B 3CP1A 1SETA 3BCCH 3K57A 4FLWA 2ZNJA 4J80A 2EIKB 3T4ZA 3ZX6A 4UB6Z 2CTQA 4PHZA 2UXCB 5E79Z 5JVDB 1YI2V 4IYHA 2P67A 3GWOA 1Q8IA 3IAYA 1AR1B 5H9CA 4YHHO 2RDCA 3JCZA 2CAZC 4JI5B 2MW2B 2E5LO 3L75H 4JGSA 1XMQB 1YZBA 2ZIMA 2RJZA 2UXBB 3D8CA 5DEDA 4B7KA 4DW1A 1YJWV 1YVWA 2GBOA 3CC7V 2FYUH 1K4DC 2QSAA 2YUAA 1PNMA 2HKOA 2ZKOA 1XL6A 1XBLA 1N34O 1ZL8A 4FPPA 4FLYA 1F23A 1K92A 4LF5O 3P30A 4TSFG 2E76B 3LSUA 1OCOB 3L72H 2XOKG 4P9PA 4HYOA 3DGEA 2ZXWC 1D5AA 3E8BA 1ZUQA 4Q20A 2IM9A 3L9DA 1O9GA 3CEIA 3HB3B 3FB7C 1JJ2U 2EJRA 3OMNB 4FM1A 2H94A 2JEXA 1SQQH 4TV9B 2UXDB 4DR7B 4X89A 2WLKA 4LFBO 4NB5A 3VQVA 2EZOA 2WAMA 3T1HO 1COWG 1Y66A 3UM7A 4JI5O 4FZ0A 5FLXN 4CC5A 1KBHA 4ZOLA 3J7AU 4MTFA 5L3FA 3ZS8C 1RPOA 2HEPA 1OV9A 1FXKA 3LNMB 1QVGU 1FD9A 3EFFK 2B1IA 4X88A 3EHBB 3ZHVA 5JJNB 1Y4MA 1XNQB 3HKCA 4HZ3A 4H37A 5EK0A 5LMNO 4DR2O 5LL6Y 1Z5VA 2ITDC 3C90A 5KHHA 2DYRC 1BE3H 3ICXA 1YTFB 2Q6AA 4X66O 4NTYA 5LP6B 4AILC 2HHHO 2KKWA 1VIBA 4I7ZB 5KMGB 1J95A 4O4IB 3LNNA 3QG5A 4I9QA 5IJ9A 3EVKA 3RYHA 4J7KA 4PA9A 1XI1A 4DV2B 1DF4A 4GYCB 2C2AA 2YIAA 5D5QA 1SKVA 4BR6A 3H9VA 3ZEDA 1BHAA 2AGAA 1FS0G 4Q6GA 5CBHA 3N2GA 2WLMA 5LMUB 2AHYA 1WP7A 3NR7A 4TQDA 2ADQB 4MW3A 1GM8A 3ZHUA 2LW1A 2QJ1A 3CMAV 1I5XA 1Y67A 4ICGA 3A2FA 4LF9O 1R73A 5EBMC 4CH4A 3HKEB 2DWDC 2R9AA 3CYOA 3AK1A 2YXYA 3JATB 3P3NA 3B09A 1DGSA 1K97A 4JAAA 4JF3A 3Q4HB 1N34B 1ZX3A 3M99B 1K8AW 2YSUB 4DR4B 3DSQA 2LGWA 1N0JA 1XL4A 4JI4O 3CPWU 1GN3A 5EIBD 2Q7GA 1AR5A 2PI5A 2XAQA 2AXTZ 1HR0O 4TV8B 2KSDA 3IC7A 1XMOO 4O4LB 3QF7A 3DC6A 5A9GA 4LF6O 4BIUA 4F4LA 3QVNA 1FXVA 4ZIBA 5EYPB 2ZR2A 4DR5B 2PTMA 1HW7A 2OT5A 3A8TA 4KL1A 3JD1A 5LYJB 3OT7A 2P4VA 2L35A 3NXSA 3VBBA 4U7OA 3ABLC 5J9PC 4LFCO 4MTOA 4I0XB 1S77D 2YS8A 1VQLV 3ZHRA 1MNGA 1K33A 4ZHQB 4CH6A 1MABG 2V7QG 4FFBB 1KKDA 1KYOF 4X1YA 1MG1A 3G6BA 4TOIA 5LYJA 1CXZB 1BCCH 4K35A 2QEXV 5B5EZ 3GB7C 2OYQA 2DW4A 4LH6A 3SJQC 1AI4A 3CRMA 1M56B 4B3SB 4LF8B 2HG5C 3AK3A 5FNVB 1W0JG 2FKXA 2HJDA 1XEQA 3RT3C 4UVAA 3B40A 1HNXO 4H44B 1V55B 4LF8O 2UXDO 1AI5A 1FXKC 3T1HB 1RSOA 4I55A 4LF4O 3OMIB 1PPJH 1YJ9V 2EIJC 4DV6B 1JCHA 2WA3A 3L73H 2YXHA 4BIZA 5IE9A 1V9PA 1Y74A 2JGDB 2YDEA 1MZFA 2Q5ZA 1WLEA 2QM4A 3OGIB 4JPRA 5C8YB 5KHJA 5TISZ 2JS3A 1KC8W 2CGNA 5HFLA 5IJ9B 4E2LA 3IC9A 3G4SV 3OMAB 4RUFA 5EC2C 3P32A 4DV0O 1S76D 1H2NA 4LC1A 4ZKIA 5IY5B 1RP3B 1I94O 4D7SA 3KCXA 2QTOA 1L1FA 4XBFA 4U3FH 4DV0B 1U96A 3CCSV 4DUZB 1FKAO 1YJNV 4TQFA 1SRYA 1D5NA 1CPYA 2QDOA 1QLEC 4DV1O 1WB7A 2G38A 3SYAA 4B3MO 2GUZB 3QNEA 3H1HH 4OX9O 1AP6A 2X7RB 3JAMN 1SESA 3CCEV 4YY3B 1Q7YW 5L3EA 1IBMO 3W7UA 4TUYB 2W0XA 1GRJA 5E1AC 2UUCO 1L0NH 1ORQC 3E86A 4FLTA 4MVRA 2BE3A 2X6AA 5LP6A 2DYRB 5LOVB 4ABMA 4O2AA 5CB4B 2NR5A 3SJAC 3T2MA 2RNBA 1RFYA 4GKJO 2F95B 3D36A 1F51A 1YHQV 3KZIZ 5B1BB 4AHCA 4DR3B 2XAFA 3ZN1A 4PDRA 1WAZA 4YJ2B 4YHHB 2QA4V 3FB5C 1S72V 4GKJB 3THOA 1HDJA 4B3TO 2Q0OC 2XTAA 1NTKH 2Q0AA 3OD4A 5KHIA 2WWWA 3K5MA 3UT5A 5IYZA 1V55C 4H13B 4K0KO 2JK5C 5LOVA 4B3TB 1RM1B 1YXBA 1VQNV 1QHTA 1XILA 3L71H 4HNAB 4R50A 3A0HZ 1KB9F 2YI9A 4DR1O 2NN4A 4DR7O 2ZCEA 1FYJA 1OJHA 1SQXH 4C7UA 1US6A 5CB4A 4WBNB 4FLZA 1I7FA 3P3PA 3OEHG 2EIMB 2A79B 2AW9A 1Q6HA 2ETNA 1BS3A 4JTAB 1N32O 5LXTB 5KAIZ 1TUBA 2BOBC 5CBFA 3BEHA 3I56V 3TXSA 1MA1A 3IGAC 3JAKB 4LF6B 2CUGA 3M7MX 2HVKC 3RYFB 4J11A 1MSWD 1GN2A 3M8AA 5KLVH 1BSMA 4DUZO 5CMUA 3ZRWB 4UCVA 5IDJA 4JTCB 1FJGO 3H1IH 2VQEO 3K79A 4LCUC 4JYAO 4B3RB 4A5UB 3B8NA 1GTOA 2WLLA 1THZA 4ZBMA 3MHHC 4LF7O 2E3CA 4KUMA 3ML0A 1PD3A 4IGGA 2EIMC 4CH3A 1VF6C 1ZWIC 1GAXA 5KX5A 2CTPA 4YJ3A 1I08A 1Y74B 4L8JA 4MS2A 5JVDA 3H1JH 4OPHA 2KG7A 3OAAG 2K1EA 2IW5A 4DW0A 4DV5O 3BA9A 4LFAB 1Q5OA 4GX2A 5LA6B 1VEWA 3JCUZ 1J5EB 1EFRG 5IJ0A 1TAEA 2VQFB 3AG4B 1BQZA 3AG1C 3WB1A 4O4HB 4KFMA 1SF9A 3AG3C 2P5OA 2VWKA 1OCZC 3DXRA 5B3SB 4ASUG 3CXHF 4DUYO 1T5EA 4NKGB 3JASA 5F2VO 4K3AA 1VARA 1JA8A 1VF5B 1QCEA 4F6RB 3SPCA 1FXHA 1VQ6V 4F6RA 4JI6B 4ZHQA 3J80N 3VQWA 1NVPB 3L70H 4JI0O 3O9OA 1OCRB 2WLIA 5C93A 4DRXB 1M90W 1B6QA 4ZI7A 1R6NA 3BRCA 5LP6C 4PA3A 3ETGA 1HP8A 1DTOA 3ETEA 3UO2A 5K1PA 1OCZB 4JV5B 3UO3A 1ZAUA 4PA4A 3WU2Z 1BMFG 1QR8A 1XNRB 1ROPA 4FM2A 4H33A 3OGCC 4B7EA 5IJ0B 2Y48A 1OCOC 4PDLA 1HR0B 2F1MA 1MMMA 2M6YA 4I4TB 4CC6A 3JD0A 1NKDA 2X6BA 1LUWA 1KMIZ 5DN6G 5LHGA 5EYPA 3KG2A 3X2QB 4B3MB 3E8FA 3S3XA 4I5SA 2WLHA 4DV1B 5B1AB 1XHXA 3K08A 3CWBH 4G2KA 1BZKA 1OCRC 4HAMA 4X20B 5LA6A 2EX3A 2XT9A 1V54C 3CB2A 3JYCA 3N2KB 4X65O 3L74H 2WLIB 4JYAB 2FB5A 2RQ6A 2DMXA 2VS0A 4AQYB 2D2CB 4WFAV 1H2LA 2R9IA 4IT5A 1L0LH 3R65A 1WP8A 4N23A 5GONA 5JWPA 1BHBA 2B9ZA 5DM6V 4RQFA 2CK3G 1KP2A 4JYBA 1NR7A 1M1KW 1PKXA 2WLNA 4DR4O 3EXAA 3S3WA 2FMLA 1FXKB 2Y69C 2F4VB 2JVDA 3KKYA 4H0LB 1VQ9V 2DYSB 3OUFA 3K59A 3OTOB 5A2QN 2EINC 1F4NA 2OCHA 4X64O 3RN4A 1IBKB 4J10A 4UV8A 4MVUA 4TV9A 2QWNB 4DV7B 3FKSG 1JOYA 3STLC 2XASA 1H2KA 3BHPA 4QPJA 3ABTA 1WA8A 1HNXB 3TJTA 1Q6IA 3N2GB 3RYHB 4O2BA 2ITCC 3E8HA 2YIBA 1R3KC 2QKCA 1U97A 5CA3A 5KMGA 2YEVB 5CN0A 1FAFA 1UJWB 5GTIZ 3K0DA 2KG7B 1G4YB 2ILMA 3B2EE 2Z5UA 1CEZA 3AG2B 1R3IC 1AROP 4NXMO 1N33O 4BW9A 1W59A 3ZIAG 1JVMA 4RQEA 3OW2U 1H8EG 2HHHB 1S0VA 5DECA 1ZL8B 3WFVA 4JI6O 4CZZA 3T1YB 3BA8A 5AG2A 2B5UA 3UT5B 5IYZB 4NXMB 4DV3O 2P7TC 2ZNIA 4K0KB 1JFFB 2O57A 1MOFA 2X6CA 1M56C 3IFXA 2EBOA 5JH7B 4DR2B 1PNKA 3CCMV 3ZRXA 2ZXWB 1N4CA 4IHJA 1AP5A 1P7BA 2UXNA 2HFEC 4PDMA 2GTAA 4KP4A 5L3CA 1PL0A 2QGNA 1YITV 4YIPA 2P90A 2YIDA 3CC4V 4L87A 5H6RA 1IURA 2ZE6A 3F7VC 2NNUA 5LXTA 3K58A 2F43G 1WN7A 2XNDG 5CA0A 1N36O 5HFMA 3I5DA 3JAWB 4LFCB 1QBZA 4YY3O 4LFBB 3VQYA
chains in the Genus database with same CATH topology
4LF5O 4NXNO 4OX9O 2VQFO 2AGAA 5A2QN 5BXZA 5LMUO 3JAMN 4B3RO 4X64O 4JI2O 4X62O 1J5EO 5BY1A 3J80N 3R66A 3M8AA 1AILA 4DV7O 1XNRO 4JI0O 3F5TA 2F4VO 4DUZO 1IBMO 1IBKO 2JRIA 3T1YO 4DR5O 4JI3O 2UUCO 1HNWO 1FJGO 4LF9O 2VQEO 2UXBO 2FKXA 1X59A 4JYAO 1F7YA 1XEQA 3O65A 3RT3C 1HNXO 4A5UB 3OTOO 2DOSA 1XNQO 4LFBO 1IBLO 4LF8O 2UXDO 4LF7O 5IT9N 1A32A 4B3SO 1XMQO 3T1HO 4JI7O 4NXMO 4GKJO 2UUBO 4JI5O 1N33O 5FLXN 1DK1A 4LF4O 3J7AU 4DV4O 4LFAO 4JI4O 4JI6O 4DR3O 1D2DA 1KUQA 4OPHA 2UUAO 4DV5O 4B3TO 1HR0O 4YHHO 4DV3O 1AB3A 2Z0AA 4JI1O 1XMOO 5LMNO 4DR2O 5LL6Y 4OPAA 5H5NA 2ZM6O 4DV0O 2E5LO 1G1XB 4X65O 4LF6O 1HNZO 2UXCO 1YZBA 1R6TA 1I94O 4K0KO 4X66O 2HHHO 3J81N 2UU9O 4JV5O 1FKAO 4DV6O 4AQYO 4DR1O 4DUYO 4DR6O 4DR7O 1FYJA 4JI8O 4LFCO 2ZKOA 1NS1A 4DV1O 4DV2O 4DR4O 5IWAO 5BR8O 1N36O 1R1BA 4B3MO 4KHPO 2DJVA 1N34O 4GKKO 4YY3O 3SDLA 1N32O 2N74A 2LW7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4LF5 O;  4NXN O;  4OX9 O;  2VQF O;  2AGA A;  5A2Q N;  5BXZ A;  5LMU O;  3JAM N;  4B3R O;  4X64 O;  4JI2 O;  4X62 O;  1J5E O;  5BY1 A;  3J80 N;  3R66 A;  3M8A A;  1AIL A;  4DV7 O;  1XNR O;  4JI0 O;  3F5T A;  2F4V O;  4DUZ O;  1IBM O;  1IBK O;  2JRI A;  3T1Y O;  4DR5 O;  4JI3 O;  2UUC O;  1HNW O;  1FJG O;  4LF9 O;  2VQE O;  2UXB O;  2FKX A;  1X59 A;  4JYA O;  1F7Y A;  1XEQ A;  3O65 A;  3RT3 C;  1HNX O;  4A5U B;  3OTO O;  2DOS A;  1XNQ O;  4LFB O;  1IBL O;  4LF8 O;  2UXD O;  4LF7 O;  5IT9 N;  1A32 A;  4B3S O;  1XMQ O;  3T1H O;  4JI7 O;  4NXM O;  4GKJ O;  2UUB O;  4JI5 O;  1N33 O;  5FLX N;  1DK1 A;  4LF4 O;  3J7A U;  4DV4 O;  4LFA O;  4JI4 O;  4JI6 O;  4DR3 O;  1D2D A;  1KUQ A;  4OPH A;  2UUA O;  4DV5 O;  4B3T O;  1HR0 O;  4YHH O;  4DV3 O;  1AB3 A;  2Z0A A;  4JI1 O;  1XMO O;  5LMN O;  4DR2 O;  5LL6 Y;  4OPA A;  5H5N A;  2ZM6 O;  4DV0 O;  2E5L O;  1G1X B;  4X65 O;  4LF6 O;  1HNZ O;  2UXC O;  1YZB A;  1R6T A;  1I94 O;  4K0K O;  4X66 O;  2HHH O;  3J81 N;  2UU9 O;  4JV5 O;  1FKA O;  4DV6 O;  4AQY O;  4DR1 O;  4DUY O;  4DR6 O;  4DR7 O;  1FYJ A;  4JI8 O;  4LFC O;  2ZKO A;  1NS1 A;  4DV1 O;  4DV2 O;  4DR4 O;  5IWA O;  5BR8 O;  1N36 O;  1R1B A;  4B3M O;  4KHP O;  2DJV A;  1N34 O;  4GKK O;  4YY3 O;  3SDL A;  1N32 O;  2N74 A;  2LW7 A; 
#chains in the Genus database with same CATH topology
 3ABK B;  2Q7E A;  1I0H A;  1Q6U A;  1H38 A;  4JI2 B;  5JCO C;  1M4U A;  4TUY A;  1G8M A;  4J9Z B;  2Y4T A;  1Y6X A;  3UQ8 A;  3B8M A;  1AIL A;  5L3G A;  1HNZ B;  1NR1 A;  1TVK B;  5KAF Z;  1TA8 A;  2DE0 X;  2UXB O;  3AG7 A;  3JSN A;  3TK1 A;  1OZ0 A;  5GTH Z;  3ZCC A;  5LGU A;  3U0Z A;  3FX7 A;  4NXN B;  4BIO A;  1FFX A;  3JAL B;  4CS2 A;  4UCO A;  2L6L A;  3WG7 C;  2PZS A;  4JI1 B;  4DYL A;  4JYY A;  3K3W A;  4FLU A;  1GM9 A;  4X9Q A;  1R3L C;  2ZIN A;  3N2K A;  1AI6 A;  1WJZ A;  2Z0A A;  5LHI A;  1Y76 B;  3STZ C;  3FAV B;  4N21 A;  4OPA A;  1N36 B;  3G71 V;  1MZE A;  2Y0P A;  3OUS A;  4JZ2 A;  2Q68 A;  2JGU A;  4EKW A;  3QO7 A;  4FVM A;  1FFT B;  3ZMZ A;  4F6E A;  2Y4U A;  3W7T A;  3J81 N;  3ZRV A;  4JZG A;  1EN5 A;  4JV5 O;  3SPI A;  4DV6 O;  1LNQ A;  3JAR A;  1IBL B;  4DUY B;  5CA1 B;  2A7W A;  1SQG A;  4KHP B;  2W0F C;  2VRZ A;  4EFE A;  4DR1 B;  4QIW F;  4DV3 B;  1X4T A;  5FNV A;  3WB0 A;  3E2E A;  3ZMS A;  2EJ7 A;  1PL4 A;  1VQ5 V;  4X62 O;  2PYL A;  2WLJ A;  1KKC A;  5BY1 A;  3RGB A;  3R66 A;  3LSQ A;  4DV7 O;  4KXR A;  3D3Q A;  3B77 A;  1IVS A;  2V1D A;  1EZJ A;  1K7D A;  1VP7 A;  1VQM V;  1B04 A;  1E1Q G;  2QKA A;  1KU9 A;  4NTX A;  3SPG A;  2AZ0 A;  1JQ0 A;  1WPX A;  1X59 A;  1F7Y A;  2R70 A;  2JGD A;  3T4D A;  3DTU B;  1AJP A;  4WFH A;  3CJH B;  3JAS B;  5LHH A;  1A32 A;  2PUS A;  4GKK B;  3JAR B;  4UVB A;  1VQP V;  1DK1 A;  5J2T B;  1QR9 A;  1NTM H;  4PV1 B;  5EZY A;  3CCR V;  4LFA O;  4P9O A;  4X8A A;  3ASO B;  1GH6 A;  1EBO A;  3DC5 A;  3HR0 A;  2Y69 B;  1VQ8 V;  4LF7 B;  1QNM A;  2R9R B;  1Y76 A;  3JD2 A;  4GT1 A;  2PI4 A;  2OWO A;  2BTQ B;  1G1X B;  4ZI7 B;  3Q4H A;  4P2Z A;  3CJH A;  5FPO A;  4Z2W A;  3ZMT A;  1DLB A;  1NI8 A;  4QJF B;  1JR9 A;  4K8X A;  3F7Y C;  2ZDI C;  1UFI A;  3K0G A;  3JSL A;  1JJO A;  1YF2 A;  1K3E A;  4FFB A;  1PP9 H;  4JI8 O;  2DQ0 A;  4G28 B;  1M57 C;  2HVJ C;  5LBQ A;  3SR2 C;  4E4E A;  4UUJ C;  1N32 B;  3MD0 A;  2LFS A;  3AG2 C;  3ASN B;  3MDS A;  4X1I A;  1BGY H;  4Z1M G;  4JI2 O;  1Q43 A;  4X1K A;  3JD3 A;  4LNU A;  1XNR O;  1S5L Z;  2ZE5 A;  3AG4 C;  1AI7 A;  5EBL C;  2QTS A;  3T1Y O;  4CBC A;  3G6E V;  3G67 A;  2IJI A;  3OE7 G;  3CS5 A;  5B3S C;  4R6Z A;  3CE2 A;  3O65 A;  3LDE A;  4EEQ A;  3W7W A;  3RYC B;  5H2F Z;  4MTG A;  4QE9 A;  3U11 A;  3ZHQ A;  1XQ8 A;  4FMT A;  1NH2 B;  1K4C C;  1SQF A;  4GLX A;  1XNQ O;  2GDS A;  3RW0 A;  1B3Q A;  4YJ3 B;  1M9N A;  1GMG A;  1TGO A;  4B3S O;  4MTX A;  4OXS A;  3SYC A;  4GUN A;  4JAU A;  1TUB B;  2HR3 A;  3HKC B;  5J2U B;  1P49 A;  3LUT B;  1WPB A;  1YIJ V;  3ZN0 A;  2UUC B;  2QWR B;  2DYS C;  2CDY A;  4WBN A;  2FTK A;  2LQT A;  3JAT A;  1H2G A;  3CME V;  3CHX A;  5JJE B;  5KHK A;  1SZT A;  1LUV A;  1RPR A;  3K5N A;  3ABK C;  4LWS B;  1N33 B;  3HKD A;  1S5H C;  2IJH A;  3K5L A;  3BAA A;  2P6J A;  1R6T A;  4U3J B;  4IHJ B;  1KQS U;  4YJ2 A;  2CH7 A;  4LWS A;  1VQO V;  3C3S A;  3ETQ A;  2IU0 A;  1H2S B;  2A0L A;  2EZP A;  3E22 A;  2Q8V A;  1ZLZ A;  5B1O A;  1TVK A;  3OR6 C;  1NS1 A;  4PA7 A;  2DQ3 A;  5BR8 O;  1GKF A;  3ZBH A;  5EC1 C;  3SDL A;  3X2Q C;  4Z1V A;  1I5Y A;  1LR1 A;  2OTL V;  3F5W C;  4RUE A;  2E75 B;  1VQK V;  4NXN O;  2GSM B;  5B1A C;  4QNH B;  3E22 B;  4HNA A;  2VWJ A;  3CD6 V;  2PF4 E;  2ZDI A;  4FFK A;  1V54 B;  1M5I A;  3JAW A;  4R8C A;  2F4V O;  5L3B A;  3APO A;  5IYC O;  1XHZ A;  2UU9 B;  2YEV A;  2ZIO A;  3HKD B;  5FPR A;  1NQT A;  2IJK A;  3CRR A;  4DK1 A;  4JI8 B;  1IXB A;  1L8D A;  3E83 A;  1XRE A;  1I94 B;  1VQ4 V;  1WA8 B;  1FJG B;  1SQB H;  2YIB D;  3LSS A;  2ODM A;  2A06 H;  2ZM6 B;  2CTR A;  3PN1 A;  4LF5 B;  1BL8 A;  4MVZ A;  4MT8 A;  5IT9 N;  1ZSP A;  1RM1 C;  5JH7 A;  2UUB O;  1QLE B;  3FB8 C;  4UCR A;  2PY5 A;  4RO2 A;  4PI2 A;  2EIN B;  4XDK A;  1JX9 A;  3RYI A;  4GZR B;  3OM3 B;  2H3O A;  1D2D A;  4PA6 A;  2IU3 A;  4NVP A;  2YXL A;  5KUK A;  1DF5 A;  4LP8 A;  4R7C A;  5J2U A;  3K03 A;  5BR8 B;  2LP7 A;  5EBW C;  2Q9L A;  2HJF C;  3K9A A;  1XOU A;  4JAV A;  4LNU B;  4DV4 B;  1NH2 D;  2OIE A;  4I50 B;  3RYC A;  1R6K A;  3H1K H;  2ARH A;  1Q82 W;  4X1K B;  1RSO B;  1NVP D;  4G27 B;  4UB8 Z;  3FFQ A;  4IL6 Z;  5IYB O;  4J42 A;  5FL7 G;  3OTF A;  2Q7H A;  1YCI A;  4PD4 F;  4DV2 O;  4MW8 A;  2ZT9 B;  1W0K G;  4I55 B;  1NU1 H;  4X1I B;  2VQF O;  2AZ2 A;  5BXZ A;  4OGQ B;  3HKB B;  4GCZ A;  4I4T A;  2ZQM A;  2QM7 A;  5LGN A;  4FLX A;  1IBM B;  1P7G A;  4GX1 A;  4QGP A;  1YDX A;  2ZD9 A;  1HNW B;  2QWP B;  1QLN A;  1AJN A;  1YSC A;  5K1X A;  4LR3 A;  1NJI W;  1QU7 A;  2QR4 A;  5D5P A;  2BTQ A;  2Q4P A;  1E79 G;  1ENV A;  2ZE7 A;  3CC2 V;  2K9P A;  2XUM A;  4FIP C;  4X20 A;  3BY6 A;  1PV0 A;  4D6T H;  1KD1 W;  3OTO O;  1R3J C;  4IIJ A;  3ETD A;  4WF9 V;  4JI7 O;  1M93 A;  3HKB A;  2UUB B;  5JCO A;  2QM8 A;  1OCC B;  2YC0 A;  1M57 B;  1KUQ A;  2BOC C;  3QTC A;  3A0R A;  2LJ2 A;  2UUA O;  3UKM A;  3RVZ A;  1H2M A;  5J2T A;  4JI1 O;  3BAB A;  2D3O W;  4X65 B;  1SQV H;  5H5N A;  3MAQ A;  5JQG A;  4DRX A;  3W7S A;  4UCT A;  1N0N A;  4YIO A;  2M7W A;  1EN4 A;  4LF4 B;  5H6Q A;  2GHY A;  1CP9 A;  1AJQ A;  2DWE C;  4PDV A;  4TV8 A;  4LF9 B;  5BZB A;  3WG7 B;  1K5S A;  2F23 A;  1Q90 D;  4IIJ B;  3OR7 C;  4NR1 A;  1FPO A;  1VMG A;  2IH3 C;  1OCC C;  2EUL A;  1VQ7 V;  2XAG A;  1Z5W A;  2LW7 A;  1WB8 A;  2IJJ A;  3TXQ A;  3H01 A;  4TWK A;  2CGO A;  5LMU O;  1GO3 F;  1K9M W;  4EFB A;  4NYK A;  1EZV H;  4UXN A;  4QE7 A;  4J9Y B;  3RYF A;  2E5L B;  2W6J G;  4J7J A;  5KA6 A;  2KQX A;  2A9H A;  4FM0 A;  3DXR B;  2ATK C;  2WPD G;  4JTD B;  3ZRW A;  3W7X A;  2ZE8 A;  3OFN G;  5ITZ A;  4CH5 A;  4K8Z A;  4WFF A;  5LGT A;  5GW7 A;  1NT2 B;  2Z3Y A;  3D36 C;  3ABM B;  5KX5 B;  3JAK A;  2GV9 A;  1GN4 A;  2F93 B;  1IDS A;  4TT3 G;  1SQP H;  4DV4 O;  2RN9 A;  2Q69 A;  4WFE A;  1P4R A;  4BW5 A;  4DR3 O;  4MSW C;  1O9H A;  4I9W A;  3RYI B;  1SA0 B;  3U10 A;  2EIL B;  4UV9 A;  4AI8 A;  1XMO B;  2Y0I A;  4IYI A;  2ADP A;  3T1C A;  3FB6 C;  4O4I A;  2XAJ A;  4JYC A;  3CRC A;  2ZM6 O;  1K5Q A;  2CH7 B;  2PGG A;  4X64 B;  2B1G A;  4FJC C;  1Q81 W;  1FFX B;  3JAL A;  4BAY A;  4JI4 B;  4JAS A;  4U3J A;  5BMV B;  4QPK A;  2LO1 A;  2WLL B;  2WSS G;  2JIZ G;  2JJ1 G;  3K5O A;  4O4J B;  2UU9 O;  2AHZ A;  5JJJ B;  2BTO A;  2LGQ A;  1PM9 A;  2QE7 G;  1SS3 A;  3OEE G;  3E89 A;  4MVQ A;  3N27 A;  3ABU A;  4XDJ A;  4UVC A;  1GM7 A;  2BCC H;  1S5J A;  2HP8 A;  2DJV A;  3GWK C;  2CTW A;  4ZOL B;  1VF6 A;  2VQE B;  4DV5 B;  3SJB C;  1EN6 A;  4B3R O;  3ZMU A;  5CBG A;  4WFG A;  4D7T A;  3LDC A;  3CRA A;  3F5T A;  5CA0 B;  3CCU V;  3VOU A;  3RWR D;  2IH1 C;  3SYQ A;  5EIB C;  4GX0 A;  3TGU H;  3D3I A;  3K9S A;  3C3T A;  3AG3 B;  3IJ4 A;  2Q73 A;  2NLJ C;  1P84 F;  1AVM A;  2UUA B;  1IX9 A;  4O4J A;  3CCV V;  2OCC C;  4RAI A;  5KHG A;  2R72 A;  1MSD A;  4EB6 A;  5IY5 C;  3AK2 A;  4WCE V;  3CCJ V;  3APQ A;  1KEC A;  1NZ6 A;  1XMQ O;  4X62 B;  2OTJ V;  4JI7 B;  1JFF A;  1G6U A;  4J7Z A;  3SYP A;  1PNL A;  1TUE B;  2JJ2 G;  3MHS C;  3FYE B;  4EB6 B;  3BVO A;  2KB1 A;  2WA4 A;  3RFR A;  2JDI G;  3HPL C;  4DK0 A;  4DXW A;  1AB3 A;  3SPH A;  2OIG A;  2V4D A;  2FL4 A;  4O2B B;  1QQC A;  5C8Y A;  1SA0 A;  1HWY A;  4O2A B;  3TCU A;  4U7N A;  2OCC B;  2Q67 A;  3SJC C;  3A0B Z;  3BFR A;  2A3Q A;  4DO2 A;  4DR6 B;  4LBE C;  3ASO C;  2JEU A;  4JI3 B;  1YEW A;  2QKS A;  4BWA A;  2PYJ A;  2EIL C;  2GUZ A;  3CRQ A;  1OHH G;  4KHP O;  1SC5 B;  4JI0 B;  1BT8 A;  4FK5 C;  2N74 A;  1JPX A;  3FYI B;  4P30 A;  5B66 Z;  1Z2G A;  5GON B;  1J5E O;  2HLD G;  3QO5 A;  4NTW A;  4XDL A;  2EIK C;  4CS3 A;  3K04 A;  1NBM G;  3CCL V;  3LDD A;  3ZHS A;  5BMV A;  3SPJ A;  1IBK O;  1QVF U;  5IWA B;  2JRI A;  3ZJZ A;  4DR5 O;  4LH7 A;  1EM1 A;  2RCV A;  4FLV A;  3FD9 A;  1XUQ A;  3VQX A;  1ZTE A;  4UCS A;  4I0X A;  1WNS A;  2UXX A;  4PI0 A;  4RWU A;  3GVM A;  4UCU A;  2DOS A;  4MVM A;  2MK3 A;  3RBZ A;  3ASN C;  4J41 A;  1K34 A;  1SER A;  3G80 A;  1K73 W;  2YIC A;  3B4S A;  1SZX A;  3ZMV A;  2DN9 A;  2ZR3 A;  2P4K A;  4CS4 A;  1VF7 A;  5CA1 A;  4UFZ A;  5KUM A;  1W2B U;  5ITZ B;  5EZY B;  4OX9 B;  4W4K A;  2BSK B;  1UPG A;  3E8G A;  4W4L A;  5IYD O;  2QWQ B;  1B06 A;  2GTS A;  2YI8 A;  1HNZ O;  2UXC O;  2RMK B;  3ZRS A;  1Q86 W;  3PJS K;  4MVO A;  4O4L A;  2CE4 A;  3E35 A;  4WFB V;  1GN6 A;  1H8H G;  2E74 B;  3FAV A;  2BSK A;  2XAH A;  4PJ0 Z;  3UCS C;  3CX5 F;  3CSX A;  5KA5 A;  4AQY O;  4PEL A;  4HBN A;  4DR6 O;  4B08 A;  3K06 A;  1NTZ H;  1IZ3 A;  3CCQ V;  5IWA O;  1KP3 A;  1R1B A;  3JD4 A;  1S3J A;  2W6I G;  1GK9 A;  2F66 C;  4GKK O;  2EIJ B;  2N05 A;  4MVS A;  3H1L H;  5B1B C;  2XHB A;  3ABM C;  2P06 A;  4X1Y B;  4YXW G;  3I55 V;  1XDC A;  1F4M A;  1BQ0 A;  1IXM A;  1URF A;  3KCY A;  3SGI A;  1YTF D;  4O4H A;  3TET A;  3AEI A;  5L3D A;  2QWO B;  1AR4 A;  3QO8 A;  3HKE A;  3SYO A;  3BPZ A;  2X0L A;  5JQG B;  4JI3 O;  1HNW O;  1JMK C;  3ABL B;  2H8P C;  2IBZ H;  3RVY A;  4GX5 A;  3CXC U;  5B1N A;  4I50 A;  2P22 C;  2JS5 A;  2N04 A;  1N8R W;  5LMN B;  4FZ1 A;  2LFR A;  1E1R G;  4X66 B;  1Q3E A;  3WB2 A;  1IBL O;  3ZHT A;  3AG1 B;  3CP1 A;  1SET A;  3BCC H;  3K57 A;  4FLW A;  2ZNJ A;  4J80 A;  2EIK B;  3T4Z A;  3ZX6 A;  4UB6 Z;  2CTQ A;  4PHZ A;  2UXC B;  5E79 Z;  5JVD B;  1YI2 V;  4IYH A;  2P67 A;  3GWO A;  1Q8I A;  3IAY A;  1AR1 B;  5H9C A;  4YHH O;  2RDC A;  3JCZ A;  2CAZ C;  4JI5 B;  2MW2 B;  2E5L O;  3L75 H;  4JGS A;  1XMQ B;  1YZB A;  2ZIM A;  2RJZ A;  2UXB B;  3D8C A;  5DED A;  4B7K A;  4DW1 A;  1YJW V;  1YVW A;  2GBO A;  3CC7 V;  2FYU H;  1K4D C;  2QSA A;  2YUA A;  1PNM A;  2HKO A;  2ZKO A;  1XL6 A;  1XBL A;  1N34 O;  1ZL8 A;  4FPP A;  4FLY A;  1F23 A;  1K92 A;  4LF5 O;  3P30 A;  4TSF G;  2E76 B;  3LSU A;  1OCO B;  3L72 H;  2XOK G;  4P9P A;  4HYO A;  3DGE A;  2ZXW C;  1D5A A;  3E8B A;  1ZUQ A;  4Q20 A;  2IM9 A;  3L9D A;  1O9G A;  3CEI A;  3HB3 B;  3FB7 C;  1JJ2 U;  2EJR A;  3OMN B;  4FM1 A;  2H94 A;  2JEX A;  1SQQ H;  4TV9 B;  2UXD B;  4DR7 B;  4X89 A;  2WLK A;  4LFB O;  4NB5 A;  3VQV A;  2EZO A;  2WAM A;  3T1H O;  1COW G;  1Y66 A;  3UM7 A;  4JI5 O;  4FZ0 A;  5FLX N;  4CC5 A;  1KBH A;  4ZOL A;  3J7A U;  4MTF A;  5L3F A;  3ZS8 C;  1RPO A;  2HEP A;  1OV9 A;  1FXK A;  3LNM B;  1QVG U;  1FD9 A;  3EFF K;  2B1I A;  4X88 A;  3EHB B;  3ZHV A;  5JJN B;  1Y4M A;  1XNQ B;  3HKC A;  4HZ3 A;  4H37 A;  5EK0 A;  5LMN O;  4DR2 O;  5LL6 Y;  1Z5V A;  2ITD C;  3C90 A;  5KHH A;  2DYR C;  1BE3 H;  3ICX A;  1YTF B;  2Q6A A;  4X66 O;  4NTY A;  5LP6 B;  4AIL C;  2HHH O;  2KKW A;  1VIB A;  4I7Z B;  5KMG B;  1J95 A;  4O4I B;  3LNN A;  3QG5 A;  4I9Q A;  5IJ9 A;  3EVK A;  3RYH A;  4J7K A;  4PA9 A;  1XI1 A;  4DV2 B;  1DF4 A;  4GYC B;  2C2A A;  2YIA A;  5D5Q A;  1SKV A;  4BR6 A;  3H9V A;  3ZED A;  1BHA A;  2AGA A;  1FS0 G;  4Q6G A;  5CBH A;  3N2G A;  2WLM A;  5LMU B;  2AHY A;  1WP7 A;  3NR7 A;  4TQD A;  2ADQ B;  4MW3 A;  1GM8 A;  3ZHU A;  2LW1 A;  2QJ1 A;  3CMA V;  1I5X A;  1Y67 A;  4ICG A;  3A2F A;  4LF9 O;  1R73 A;  5EBM C;  4CH4 A;  3HKE B;  2DWD C;  2R9A A;  3CYO A;  3AK1 A;  2YXY A;  3JAT B;  3P3N A;  3B09 A;  1DGS A;  1K97 A;  4JAA A;  4JF3 A;  3Q4H B;  1N34 B;  1ZX3 A;  3M99 B;  1K8A W;  2YSU B;  4DR4 B;  3DSQ A;  2LGW A;  1N0J A;  1XL4 A;  4JI4 O;  3CPW U;  1GN3 A;  5EIB D;  2Q7G A;  1AR5 A;  2PI5 A;  2XAQ A;  2AXT Z;  1HR0 O;  4TV8 B;  2KSD A;  3IC7 A;  1XMO O;  4O4L B;  3QF7 A;  3DC6 A;  5A9G A;  4LF6 O;  4BIU A;  4F4L A;  3QVN A;  1FXV A;  4ZIB A;  5EYP B;  2ZR2 A;  4DR5 B;  2PTM A;  1HW7 A;  2OT5 A;  3A8T A;  4KL1 A;  3JD1 A;  5LYJ B;  3OT7 A;  2P4V A;  2L35 A;  3NXS A;  3VBB A;  4U7O A;  3ABL C;  5J9P C;  4LFC O;  4MTO A;  4I0X B;  1S77 D;  2YS8 A;  1VQL V;  3ZHR A;  1MNG A;  1K33 A;  4ZHQ B;  4CH6 A;  1MAB G;  2V7Q G;  4FFB B;  1KKD A;  1KYO F;  4X1Y A;  1MG1 A;  3G6B A;  4TOI A;  5LYJ A;  1CXZ B;  1BCC H;  4K35 A;  2QEX V;  5B5E Z;  3GB7 C;  2OYQ A;  2DW4 A;  4LH6 A;  3SJQ C;  1AI4 A;  3CRM A;  1M56 B;  4B3S B;  4LF8 B;  2HG5 C;  3AK3 A;  5FNV B;  1W0J G;  2FKX A;  2HJD A;  1XEQ A;  3RT3 C;  4UVA A;  3B40 A;  1HNX O;  4H44 B;  1V55 B;  4LF8 O;  2UXD O;  1AI5 A;  1FXK C;  3T1H B;  1RSO A;  4I55 A;  4LF4 O;  3OMI B;  1PPJ H;  1YJ9 V;  2EIJ C;  4DV6 B;  1JCH A;  2WA3 A;  3L73 H;  2YXH A;  4BIZ A;  5IE9 A;  1V9P A;  1Y74 A;  2JGD B;  2YDE A;  1MZF A;  2Q5Z A;  1WLE A;  2QM4 A;  3OGI B;  4JPR A;  5C8Y B;  5KHJ A;  5TIS Z;  2JS3 A;  1KC8 W;  2CGN A;  5HFL A;  5IJ9 B;  4E2L A;  3IC9 A;  3G4S V;  3OMA B;  4RUF A;  5EC2 C;  3P32 A;  4DV0 O;  1S76 D;  1H2N A;  4LC1 A;  4ZKI A;  5IY5 B;  1RP3 B;  1I94 O;  4D7S A;  3KCX A;  2QTO A;  1L1F A;  4XBF A;  4U3F H;  4DV0 B;  1U96 A;  3CCS V;  4DUZ B;  1FKA O;  1YJN V;  4TQF A;  1SRY A;  1D5N A;  1CPY A;  2QDO A;  1QLE C;  4DV1 O;  1WB7 A;  2G38 A;  3SYA A;  4B3M O;  2GUZ B;  3QNE A;  3H1H H;  4OX9 O;  1AP6 A;  2X7R B;  3JAM N;  1SES A;  3CCE V;  4YY3 B;  1Q7Y W;  5L3E A;  1IBM O;  3W7U A;  4TUY B;  2W0X A;  1GRJ A;  5E1A C;  2UUC O;  1L0N H;  1ORQ C;  3E86 A;  4FLT A;  4MVR A;  2BE3 A;  2X6A A;  5LP6 A;  2DYR B;  5LOV B;  4ABM A;  4O2A A;  5CB4 B;  2NR5 A;  3SJA C;  3T2M A;  2RNB A;  1RFY A;  4GKJ O;  2F95 B;  3D36 A;  1F51 A;  1YHQ V;  3KZI Z;  5B1B B;  4AHC A;  4DR3 B;  2XAF A;  3ZN1 A;  4PDR A;  1WAZ A;  4YJ2 B;  4YHH B;  2QA4 V;  3FB5 C;  1S72 V;  4GKJ B;  3THO A;  1HDJ A;  4B3T O;  2Q0O C;  2XTA A;  1NTK H;  2Q0A A;  3OD4 A;  5KHI A;  2WWW A;  3K5M A;  3UT5 A;  5IYZ A;  1V55 C;  4H13 B;  4K0K O;  2JK5 C;  5LOV A;  4B3T B;  1RM1 B;  1YXB A;  1VQN V;  1QHT A;  1XIL A;  3L71 H;  4HNA B;  4R50 A;  3A0H Z;  1KB9 F;  2YI9 A;  4DR1 O;  2NN4 A;  4DR7 O;  2ZCE A;  1FYJ A;  1OJH A;  1SQX H;  4C7U A;  1US6 A;  5CB4 A;  4WBN B;  4FLZ A;  1I7F A;  3P3P A;  3OEH G;  2EIM B;  2A79 B;  2AW9 A;  1Q6H A;  2ETN A;  1BS3 A;  4JTA B;  1N32 O;  5LXT B;  5KAI Z;  1TUB A;  2BOB C;  5CBF A;  3BEH A;  3I56 V;  3TXS A;  1MA1 A;  3IGA C;  3JAK B;  4LF6 B;  2CUG A;  3M7M X;  2HVK C;  3RYF B;  4J11 A;  1MSW D;  1GN2 A;  3M8A A;  5KLV H;  1BSM A;  4DUZ O;  5CMU A;  3ZRW B;  4UCV A;  5IDJ A;  4JTC B;  1FJG O;  3H1I H;  2VQE O;  3K79 A;  4LCU C;  4JYA O;  4B3R B;  4A5U B;  3B8N A;  1GTO A;  2WLL A;  1THZ A;  4ZBM A;  3MHH C;  4LF7 O;  2E3C A;  4KUM A;  3ML0 A;  1PD3 A;  4IGG A;  2EIM C;  4CH3 A;  1VF6 C;  1ZWI C;  1GAX A;  5KX5 A;  2CTP A;  4YJ3 A;  1I08 A;  1Y74 B;  4L8J A;  4MS2 A;  5JVD A;  3H1J H;  4OPH A;  2KG7 A;  3OAA G;  2K1E A;  2IW5 A;  4DW0 A;  4DV5 O;  3BA9 A;  4LFA B;  1Q5O A;  4GX2 A;  5LA6 B;  1VEW A;  3JCU Z;  1J5E B;  1EFR G;  5IJ0 A;  1TAE A;  2VQF B;  3AG4 B;  1BQZ A;  3AG1 C;  3WB1 A;  4O4H B;  4KFM A;  1SF9 A;  3AG3 C;  2P5O A;  2VWK A;  1OCZ C;  3DXR A;  5B3S B;  4ASU G;  3CXH F;  4DUY O;  1T5E A;  4NKG B;  3JAS A;  5F2V O;  4K3A A;  1VAR A;  1JA8 A;  1VF5 B;  1QCE A;  4F6R B;  3SPC A;  1FXH A;  1VQ6 V;  4F6R A;  4JI6 B;  4ZHQ A;  3J80 N;  3VQW A;  1NVP B;  3L70 H;  4JI0 O;  3O9O A;  1OCR B;  2WLI A;  5C93 A;  4DRX B;  1M90 W;  1B6Q A;  4ZI7 A;  1R6N A;  3BRC A;  5LP6 C;  4PA3 A;  3ETG A;  1HP8 A;  1DTO A;  3ETE A;  3UO2 A;  5K1P A;  1OCZ B;  4JV5 B;  3UO3 A;  1ZAU A;  4PA4 A;  3WU2 Z;  1BMF G;  1QR8 A;  1XNR B;  1ROP A;  4FM2 A;  4H33 A;  3OGC C;  4B7E A;  5IJ0 B;  2Y48 A;  1OCO C;  4PDL A;  1HR0 B;  2F1M A;  1MMM A;  2M6Y A;  4I4T B;  4CC6 A;  3JD0 A;  1NKD A;  2X6B A;  1LUW A;  1KMI Z;  5DN6 G;  5LHG A;  5EYP A;  3KG2 A;  3X2Q B;  4B3M B;  3E8F A;  3S3X A;  4I5S A;  2WLH A;  4DV1 B;  5B1A B;  1XHX A;  3K08 A;  3CWB H;  4G2K A;  1BZK A;  1OCR C;  4HAM A;  4X20 B;  5LA6 A;  2EX3 A;  2XT9 A;  1V54 C;  3CB2 A;  3JYC A;  3N2K B;  4X65 O;  3L74 H;  2WLI B;  4JYA B;  2FB5 A;  2RQ6 A;  2DMX A;  2VS0 A;  4AQY B;  2D2C B;  4WFA V;  1H2L A;  2R9I A;  4IT5 A;  1L0L H;  3R65 A;  1WP8 A;  4N23 A;  5GON A;  5JWP A;  1BHB A;  2B9Z A;  5DM6 V;  4RQF A;  2CK3 G;  1KP2 A;  4JYB A;  1NR7 A;  1M1K W;  1PKX A;  2WLN A;  4DR4 O;  3EXA A;  3S3W A;  2FML A;  1FXK B;  2Y69 C;  2F4V B;  2JVD A;  3KKY A;  4H0L B;  1VQ9 V;  2DYS B;  3OUF A;  3K59 A;  3OTO B;  5A2Q N;  2EIN C;  1F4N A;  2OCH A;  4X64 O;  3RN4 A;  1IBK B;  4J10 A;  4UV8 A;  4MVU A;  4TV9 A;  2QWN B;  4DV7 B;  3FKS G;  1JOY A;  3STL C;  2XAS A;  1H2K A;  3BHP A;  4QPJ A;  3ABT A;  1WA8 A;  1HNX B;  3TJT A;  1Q6I A;  3N2G B;  3RYH B;  4O2B A;  2ITC C;  3E8H A;  2YIB A;  1R3K C;  2QKC A;  1U97 A;  5CA3 A;  5KMG A;  2YEV B;  5CN0 A;  1FAF A;  1UJW B;  5GTI Z;  3K0D A;  2KG7 B;  1G4Y B;  2ILM A;  3B2E E;  2Z5U A;  1CEZ A;  3AG2 B;  1R3I C;  1ARO P;  4NXM O;  1N33 O;  4BW9 A;  1W59 A;  3ZIA G;  1JVM A;  4RQE A;  3OW2 U;  1H8E G;  2HHH B;  1S0V A;  5DEC A;  1ZL8 B;  3WFV A;  4JI6 O;  4CZZ A;  3T1Y B;  3BA8 A;  5AG2 A;  2B5U A;  3UT5 B;  5IYZ B;  4NXM B;  4DV3 O;  2P7T C;  2ZNI A;  4K0K B;  1JFF B;  2O57 A;  1MOF A;  2X6C A;  1M56 C;  3IFX A;  2EBO A;  5JH7 B;  4DR2 B;  1PNK A;  3CCM V;  3ZRX A;  2ZXW B;  1N4C A;  4IHJ A;  1AP5 A;  1P7B A;  2UXN A;  2HFE C;  4PDM A;  2GTA A;  4KP4 A;  5L3C A;  1PL0 A;  2QGN A;  1YIT V;  4YIP A;  2P90 A;  2YID A;  3CC4 V;  4L87 A;  5H6R A;  1IUR A;  2ZE6 A;  3F7V C;  2NNU A;  5LXT A;  3K58 A;  2F43 G;  1WN7 A;  2XND G;  5CA0 A;  1N36 O;  5HFM A;  3I5D A;  3JAW B;  4LFC B;  1QBZ A;  4YY3 O;  4LFB B;  3VQY A; 
#chains in the Genus database with same CATH homology
 4LF5 O;  4NXN O;  4OX9 O;  2VQF O;  2AGA A;  5A2Q N;  5BXZ A;  5LMU O;  3JAM N;  4B3R O;  4X64 O;  4JI2 O;  4X62 O;  1J5E O;  5BY1 A;  3J80 N;  3R66 A;  3M8A A;  1AIL A;  4DV7 O;  1XNR O;  4JI0 O;  3F5T A;  2F4V O;  4DUZ O;  1IBM O;  1IBK O;  2JRI A;  3T1Y O;  4DR5 O;  4JI3 O;  2UUC O;  1HNW O;  1FJG O;  4LF9 O;  2VQE O;  2UXB O;  2FKX A;  1X59 A;  4JYA O;  1F7Y A;  1XEQ A;  3O65 A;  3RT3 C;  1HNX O;  4A5U B;  3OTO O;  2DOS A;  1XNQ O;  4LFB O;  1IBL O;  4LF8 O;  2UXD O;  4LF7 O;  5IT9 N;  1A32 A;  4B3S O;  1XMQ O;  3T1H O;  4JI7 O;  4NXM O;  4GKJ O;  2UUB O;  4JI5 O;  1N33 O;  5FLX N;  1DK1 A;  4LF4 O;  3J7A U;  4DV4 O;  4LFA O;  4JI4 O;  4JI6 O;  4DR3 O;  1D2D A;  1KUQ A;  4OPH A;  2UUA O;  4DV5 O;  4B3T O;  1HR0 O;  4YHH O;  4DV3 O;  1AB3 A;  2Z0A A;  4JI1 O;  1XMO O;  5LMN O;  4DR2 O;  5LL6 Y;  4OPA A;  5H5N A;  2ZM6 O;  4DV0 O;  2E5L O;  1G1X B;  4X65 O;  4LF6 O;  1HNZ O;  2UXC O;  1YZB A;  1R6T A;  1I94 O;  4K0K O;  4X66 O;  2HHH O;  3J81 N;  2UU9 O;  4JV5 O;  1FKA O;  4DV6 O;  4AQY O;  4DR1 O;  4DUY O;  4DR6 O;  4DR7 O;  1FYJ A;  4JI8 O;  4LFC O;  2ZKO A;  1NS1 A;  4DV1 O;  4DV2 O;  4DR4 O;  5IWA O;  5BR8 O;  1N36 O;  1R1B A;  4B3M O;  4KHP O;  2DJV A;  1N34 O;  4GKK O;  4YY3 O;  3SDL A;  1N32 O;  2N74 A;  2LW7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...