1N36O

Structure of the thermus thermophilus 30s ribosomal subunit in the presence of crystallographically disordered codon and near-cognate transfer rna anticodon stem-loop mismatched at the second codon position
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
88
structure length
88
Chain Sequence
PITKEEKQKVIQEFARFPGDTGSTEVQVALLTLRINRLSEHLKVHKKDHHSHRGLLMMVGQRRRLLRYLQREDPERYRALIEKLGIRG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Selection of tRNA by the Ribosome Requires a Transition from an Open to a Closed Form
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 16S RIBOSOMAL RNA
total genus 29
structure length 88
sequence length 88
ec nomenclature
pdb deposition date 2002-10-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
O PF00312 Ribosomal_S15 Ribosomal protein S15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.10 Mainly Alpha Orthogonal Bundle Helix Hairpins S15/NS1, RNA-binding 1n36O00
1N36O 4DV4O 1IBLO 4NXMO 1R1BA 4LF8O 4X66O 4DR3O 4DR5O 4JI0O 3OTOO 4DV0O 2HHHO 2UUAO 4DR6O 1XEQA 1G1XB 2UXCO 1XMQO 4GKKO 4X64O 4DV7O 1I94O 4LF5O 1XMOO 4B3SO 4B3RO 5H5NA 1X59A 1HR0O 4DV1O 4OX9O 4DR4O 5IWAO 2AGAA 1F7YA 3J80N 1HNWO 4OPHA 1J5EO 2VQEO 5LMUO 3T1HO 5BR8O 4JI2O 4GKJO 4LF9O 2VQFO 4OPAA 4JI8O 1HNZO 4JI6O 3R66A 3O65A 4NXNO 1XNQO 2LW7A 2DJVA 4DUZO 3F5TA 1N32O 1A32A 4DV6O 1XNRO 5A2QN 4JI7O 2DOSA 4DV3O 1HNXO 4DV5O 4DV2O 3M8AA 4JI3O 4DR1O 1AB3A 2N74A 2ZKOA 2F4VO 4A5UB 1FKAO 1IBKO 2UUBO 1NS1A 4AQYO 3SDLA 3J81N 4LFAO 4LF7O 2Z0AA 2ZM6O 4DUYO 1N34O 4JI4O 4DR7O 1FYJA 1D2DA 2UXDO 2E5LO 1YZBA 4B3TO 4X62O 1IBMO 4YHHO 2UUCO 5FLXN 4JV5O 5LL6Y 5IT9N 3J7AU 2JRIA 1R6TA 3T1YO 5BXZA 4JYAO 4K0KO 4YY3O 1KUQA 4LFBO 3RT3C 4LF6O 4JI5O 5BY1A 4DR2O 1FJGO 1DK1A 2UU9O 1AILA 4X65O 2UXBO 4B3MO 5LMNO 3JAMN 4KHPO 4LFCO 2FKXA 1N33O 4JI1O 4LF4O
chains in the Genus database with same CATH superfamily
2IW5A 5EBWC 1HP8A 4QJFB 1CEZA 1G8MA 4AHCA 4H44B 2ZD9A 4UUJC 3W7WA 3CB2A 1Q6UA 2IM9A 4B3SO 4YIPA 5H5NA 2PY5A 4DR4O 1SA0A 3OAAG 1BE3H 4LCUC 2D2CB 4OPAA 5IYBO 1WP7A 2RJZA 5FL7G 1IBLB 2L6LA 4DXWA 1B06A 4X89A 2R9AA 3I55V 2LW1A 5EIBC 4DV6O 4JI7O 3SJCC 4DV3O 5LXTB 4WCEV 2BSKB 4JI3O 3C3SA 3QO5A 4DR1O 2N74A 3HR0A 3D36C 1JA8A 1PNLA 3LDDA 2ZE6A 3RWRD 3FX7A 2XHBA 4JI2B 2GV9A 4NTXA 4KHPB 4ABMA 1Y67A 1N33B 4EFBA 3TK1A 1H2KA 4DR7O 3BA9A 2JGUA 1SQBH 1AP6A 4GUNA 1YZBA 2XAJA 4LF8B 1R3IC 2EJ7A 5FLXN 2UUAB 4I55B 3L73H 2QWPB 5L3GA 1K4DC 4X64B 3K79A 1DK1A 5IE9A 4X65O 2Q0OC 4RUFA 5BMVA 1XREA 1G6UA 3SJQC 1S77D 4I5SA 1T5EA 4Z1VA 1KU9A 4LF9B 2LFRA 1VP7A 3APOA 2M6YA 3HKCA 1IBLO 5F2VO 3RVZA 4X20A 2QGNA 1WJZA 1SQPH 1XOUA 4TQDA 5LGUA 4JYAB 1XBLA 4I9WA 1NBMG 3N2GB 1XMQO 2JDIG 1YTFD 2Q0AA 3ZMTA 3JAKA 2RCVA 3BY6A 2QKCA 2ZXWC 1AROP 4IT5A 2MW2B 4JYBA 2WA3A 2BOCC 2WWWA 4QE7A 3K08A 4JYYA 4JASA 3G71V 2KKWA 4NXNO 3KZIZ 1J95A 2GTSA 4WF9V 5IYZA 5JWPA 3SYPA 1W59A 2ITDC 5CB4B 4K0KB 1JQ0A 4CBCA 4FIPC 1RPRA 4G27B 2IH1C 4I9QA 3OEEG 4A5UB 2X6CA 2DYSC 1TA8A 5BR8B 5KMGB 2ZDIA 4LF7O 3EVKA 4X20B 2H8PC 1RFYA 5H2FZ 3ZCCA 5B1OA 3RVYA 1S76D 3K9AA 4DV4B 5IY5B 1NQTA 2GUZB 3JAKB 1ZTEA 1SF9A 1BQ0A 2OT5A 2R9IA 4O4HA 1M56B 1V55B 3K59A 3B09A 3RFRA 3QF7A 1NH2D 3WFVA 1PNKA 1R6KA 2V1DA 4DK0A 3ZHUA 3U0ZA 2WLLB 2YXYA 3VQWA 5DM6V 1RPOA 3SGIA 3EFFK 1YF2A 3JARA 2F66C 3DC5A 4B3TB 2CE4A 2O57A 4J7JA 4UCOA 5GW7A 1M57B 1M4UA 3E8BA 3K5NA 4FLUA 1MABG 4L8JA 1UPGA 4OXSA 2ZNIA 4AILC 4DV5B 2PZSA 3HKDB 2EILC 1H8HG 3CMAV 1EZJA 1S72V 2DYRB 3OUFA 3SJAC 1Y74A 2ZXWB 1E79G 1WNSA 4GX5A 4DUYB 2HJFC 4JI6O 5IYDO 2JIZG 2LW7A 4O4HB 2QSAA 3HKEA 5B66Z 1IX9A 3ZMUA 1QLEB 3ZHQA 3CCLV 2DOSA 3PN1A 5LHIA 4B3SB 3ZN0A 4FZ0A 1K3EA 3G6BA 2DYRC 1K9MW 3ABKC 1YJWV 4WBNB 3CE2A 5EBLC 1KP3A 4UCUA 1VQ9V 1D5NA 1GM9A 1K4CC 4MTOA 4B7EA 4PA6A 4WFFA 2ZINA 3RYFB 2E5LO 1Y76B 2BTQA 1BT8A 3GWKC 1N8RW 3UT5B 1Q3EA 4YHHO 2E74B 3I56V 1Q8IA 1E1RG 5LL6Y 4UVAA 4DV3B 1QR8A 2OIEA 3RT3C 4F6RA 4DR1B 2Q6AA 3ZRVA 4FM0A 1YJ9V 4GX1A 3PJSK 1GRJA 5JVDA 4JAAA 5EC1C 5KHHA 2AXTZ 2M7WA 4X88A 4B08A 1O9GA 2EIJB 1OV9A 4JI1O 3FKSG 1WA8A 4LNUB 4Z2WA 1ZSPA 1XL4A 3ASOC 5LA6A 3CRMA 3AG1C 1RSOB 4DYLA 4Q20A 1K97A 3TGUH 2CTRA 4LFBB 4X64O 5JCOA 5L3BA 3FYEB 5KHKA 4B7KA 1AP5A 2AGAA 2UUBB 2FMLA 3LSSA 4TWKA 1NVPD 2P7TC 2EINC 3ZHVA 1QQCA 4PDMA 5CN0A 1NVPB 5K1PA 3ASNB 4JZ2A 2WPDG 4DV0B 1H8EG 5EYPA 5L3FA 2GSMB 4ASUG 4U7OA 1VQ4V 5A2QN 3ZX6A 3ZRWB 1VQNV 2ZDIC 4AI8A 2QJ1A 3UKMA 4BW9A 4KFMA 4PJ0Z 3QVNA 4HAMA 1KKDA 4W4LA 4TUYA 3F7YC 1MG1A 1WP8A 1OJHA 4MVZA 4JI6B 5B5EZ 4DUYO 2QM4A 4MTXA 1N36B 3CCSV 1NJIW 5KX5A 1H2LA 1P7GA 4FZ1A 4CC6A 2H3OA 1XNRB 3BEHA 4FFBB 3OTOB 2OIGA 3FB5C 4DR6B 1R6TA 2QM8A 1NR1A 1VF7A 4I4TA 4MVUA 1NU1H 5EIBD 4JI5O 4QNHB 1OCRC 2QR4A 5CA0B 1QR9A 5FPOA 5LHGA 2JJ1G 4R7CA 1AI7A 1BS3A 2CTWA 2BOBC 2HR3A 2P90A 3UCSC 3X2QC 2A3QA 4LF4O 2YI9A 2NR5A 2YEVA 4I50A 5H9CA 2JEUA 3ZRWA 1NKDA 2E75B 3L70H 3LSUA 3K9SA 1SC5B 3AG7A 1WLEA 3CP1A 2JK5C 3CS5A 2QWQB 3TETA 3M7MX 4HZ3A 4DV7O 1RM1B 4B3RO 4JI3B 3SJBC 5J2UB 3FB7C 3LNNA 3N2KA 1FXKC 2IJJA 1BHAA 4X9QA 2ZIOA 2IJIA 1IXBA 4JI2O 5L3CA 3B40A 2C2AA 4DR7B 4JTAB 4DO2A 1ZUQA 4C7UA 2DWDC 4IHJA 3IGAC 3JD1A 3T4DA 1K5SA 3JD2A 5CA0A 4X62B 3T4ZA 4XDJA 4ZOLB 2A7WA 4HNAB 5KHIA 2E76B 2Q9LA 4J9YB 1KBHA 2ARHA 4PA4A 3FFQA 2PI4A 1HNWB 2YXLA 3T1HB 1V55C 5IJ0A 4U3FH 2ZE7A 3G80A 3TCUA 2Y4TA 4LC1A 2ZM6O 5LXTA 2ODMA 1HNZB 1H2NA 5C8YA 2ITCC 3D3IA 4HYOA 1YVWA 3JD3A 4J9ZB 4P9PA 1AJNA 2XTAA 1OCCC 2GHYA 4DW1A 4UCVA 3ZRSA 4NR1A 1HR0B 2VRZA 3QG5A 3WB2A 4KHPO 3IC9A 1TUBA 4U3JA 3CRQA 5GTIZ 2YIBD 3JAWB 5EBMC 4O2BB 2YUAA 4WFHA 4KUMA 5JQGA 4TOIA 3OGIB 4RQEA 1N4CA 2UUAO 1F23A 1Z5VA 3WB0A 4EEQA 1P7BA 3H1JH 4UB6Z 2CUGA 1H2MA 1VQPV 3KG2A 1U96A 1K92A 3HKCB 3CD6V 4H13B 2EJRA 3ABLB 1S5LZ 1COWG 1QU7A 4MVOA 4LBEC 5EZYB 3T1HO 5B1AC 1H38A 2Q68A 3ZHTA 4LH7A 2VWJA 4LF9O 1SERA 5L3DA 4PA7A 3OR7C 1NTMH 1FFXA 4O2AB 3TXQA 1AI4A 1XL6A 2DJVA 5LYJB 1A32A 2K1EA 1JMKC 2HKOA 3A0RA 4CS2A 2YSUB 3ZIAG 3E8FA 3ABMB 2AHZA 1EN5A 5DECA 2B9ZA 3OUSA 4NTWA 4H0LB 4U7NA 3SPJA 3BPZA 4F4LA 3CCRV 3JD4A 4QE9A 5IYZB 2GDSA 5LMNB 1YDXA 1VQ6V 5LP6A 1N0JA 4WFBV 5KLVH 1VQOV 2FTKA 1H2GA 4X62O 1XQ8A 2YICA 2HHHB 3OTFA 1HNXB 5BXZA 3ABTA 3RGBA 4UCTA 3ABUA 5LOVB 1VARA 3RYCA 1AI5A 3SYQA 1WB8A 3H1HH 4FVMA 2ZIMA 3S3XA 5D5PA 5LGNA 2PI5A 4LP8A 3E22B 2FKXA 2KB1A 4I7ZB 1MMMA 4E4EA 2NLJC 4DV4O 2W0XA 1D5AA 5KUMA 2YIDA 3CYOA 3H1KH 3KCYA 4P2ZA 4X66O 4DRXB 4DR6O 2H94A 2IJHA 1KKCA 4JF3A 4G28B 2A9HA 2WLLA 4O4JB 2XAQA 5KMGA 4DR2B 1XMOO 4UCSA 3OW2U 2V4DA 1XILA 1LUWA 2ZT9B 3BRCA 4QGPA 2R72A 2YDEA 4K8XA 4LWSB 1Z5WA 5CA3A 2EX3A 4QPKA 1FXHA 3MHHC 3RYCB 2UXDB 3JASB 1N32O 4CH4A 3CC7V 2DQ3A 4OGQB 2D3OW 4R6ZA 3K04A 3R65A 2ZKOA 2EBOA 1FKAO 1SZTA 2P06A 3JARB 2Z3YA 1PM9A 3IFXA 2N04A 3D36A 3A2FA 4GT1A 3L9DA 4LFCB 1JFFB 4JTDB 3ZMSA 2Q73A 4JI4O 3Q4HA 4ZKIA 1QCEA 1M1KW 5J2TB 4N23A 1RP3B 1IBMO 4DR3B 4JI0B 1K7DA 3O9OA 3OD4A 4N21A 4NKGB 4FFKA 3TJTA 1YI2V 1TVKA 1PP9H 1EN6A 2DWEC 4KL1A 4IYIA 1Y74B 2RDCA 4YXWG 5D5QA 4DR4B 2QKAA 4O4IB 2HVJC 3FYIB 4ZHQB 4PI2A 2Y4UA 4F6EA 1F51A 3TXSA 3ICXA 3THOA 1W2BU 2EINB 4RUEA 1JX9A 5EK0A 1V54C 1W0KG 1F4NA 2ZR3A 3ETDA 3JALB 3P30A 4DV0O 3B77A 3CJHA 1O9HA 2Y48A 4CH5A 4LF5O 4BIOA 2Q4PA 4ZI7B 3L74H 1YCIA 4IIJA 2X0LA 5CBHA 2EIMB 2P67A 3CPWU 5DEDA 4EB6A 2BTQB 3QTCA 4CC5A 4UV9A 4X1IA 4MTGA 1GH6A 3O65A 2OTLV 1TVKB 1Q5OA 4DUZO 3OFNG 3G67A 2PTMA 3BCCH 3SYOA 1KB9F 2CGNA 3CC2V 3ZHRA 2ATKC 3GVMA 1WN7A 3K5OA 2OTJV 2CTQA 3JCZA 4ZHQA 1QBZA 4E2LA 5EYPB 4DW0A 1NTKH 4GKJB 3FB8C 2CK3G 1N34O 1XUQA 4LF4B 3DXRA 3X2QB 3B8NA 4EKWA 1OCZB 5C93A 3JATB 5JCOC 4Z1MG 3APQA 2AW9A 3E89A 4TUYB 1OCOC 1NT2B 3H9VA 4YY3O 3IC7A 4YJ2B 4EB6B 2DYSB 4AQYB 1M56C 1PV0A 4BWAA 2Y0IA 1Q7YW 2F93B 5B1BB 4JYCA 5TISZ 1NR7A 1SKVA 1PL0A 2W6JG 1R1BA 3L71H 2ILMA 4LF8O 3E8GA 4TV9B 4X1KA 3AK1A 2HJDA 2W6IG 3A0HZ 3E2EA 1X59A 3JD0A 2UXBB 1VQ7V 5AG2A 3CCUV 3J80N 4OPHA 2A79B 5KX5B 1KD1W 4JI8O 3HKBB 5LGTA 2EIJC 3H1IH 4YJ2A 1Y66A 2JGDB 3F5TA 1GAXA 1S3JA 2NN4A 3VQYA 1YIJV 3RYIA 3T1YB 1AR4A 1M93A 1LUVA 1QLNA 2OYQA 1L8DA 4PV1B 5A9GA 4IHJB 1V54B 2ZE5A 3MD0A 1K8AW 1QLEC 2JS3A 1YITV 5IJ9A 1OHHG 2LJ2A 1SETA 1IVSA 2UXDO 2WA4A 4TSFG 5IYCO 3ZN1A 3OMIB 4J41A 2JRIA 2EZPA 5IJ0B 4FM2A 1YEWA 5KAFZ 3K58A 1MZEA 3LDEA 2F4VB 1FS0G 1IBKB 4MTFA 3ABMC 2Q7GA 3HKBA 5E1AC 1XHZA 1AR1B 1XDCA 2HFEC 3RYHA 2UXNA 4B3MO 5FNVB 2JGDA 4I55A 2QE7G 5L3EA 2ZE8A 4ZOLA 3MHSC 2X6AA 4WFAV 4DR3O 3ABKB 5BMVB 1Q6HA 5GTHZ 1AJPA 4BAYA 4P9OA 1CXZB 3E8HA 1URFA 1I94O 4O2BA 3AK3A 5IJ9B 2QWNB 4FK5C 1F4MA 3I5DA 3CCMV 1I0HA 3BABA 1K73W 1FXVA 2P4VA 4LH6A 2X6BA 3N2GA 4BIUA 1IZ3A 2IBZH 1XNQO 4J7KA 3OMAB 1K5QA 4J42A 4BIZA 1ZL8B 1ROPA 4U3JB 2Y0PA 3JAWA 4EFEA 2JEXA 2QWOB 1IBKO 2UU9B 1FXKB 3FAVA 1DTOA 1BHBA 5LHHA 1WB7A 2L35A 1GKFA 3FD9A 4MVQA 1R3LC 5CB4A 3VQXA 3L75H 4G2KA 4MVSA 5JJEB 4BR6A 1CPYA 2FL4A 4FLTA 1JPXA 4J10A 1VF6C 1YHQV 4MS2A 4X66B 3UM7A 2CAZC 3AG4C 2YI8A 3AG4B 1YTFB 4JYAO 5B3SB 1H2SB 5KA6A 4KP4A 4DV2B 4LFBO 2X7RB 5EZYA 3KCXA 4B3RB 1HW7A 3UQ8A 3LSQA 3DTUB 3F5WC 2EZOA 4O2AA 1MNGA 3MDSA 2GUZA 5LYJA 2XASA 1ORQC 4FJCC 1SQGA 1KC8W 2QKSA 3S3WA 1LR1A 1OCOB 2E3CA 3CCVV 3AG2C 3CXHF 3CXCU 1I5YA 1KQSU 1JVMA 3E22A 2OCHA 2F1MA 2EULA 2IU3A 2WAMA 2YIBA 1PNMA 2P6JA 5H6RA 1VQLV 5LP6B 3E35A 3MAQA 4X1YA 4ZBMA 5IWAO 1F7YA 2LQTA 4DRXA 2VQEO 3K06A 3HB3B 2N05A 2KG7B 2QTOA 1PKXA 1NI8A 1VF5B 4PA3A 2HEPA 3G6EV 3ZEDA 3CX5F 4HBNA 4NXMB 2QTSA 2XOKG 5DN6G 2QEXV 1Q90D 1UFIA 1VEWA 3H01A 1R3JC 2DMXA 1XMOB 4NVPA 1OCRB 3VOUA 3GWOA 1S5JA 4DV2O 2CH7A 2JJ2G 2ZCEA 3UO2A 1G4YB 4LF6B 3JSLA 1AB3A 1Y76A 3D8CA 2UUBO 1THZA 4R8CA 3JASA 2ADPA 1W0JG 1I5XA 1SQXH 3K57A 5CA1A 4J80A 1I08A 5IDJA 4XDLA 1FYJA 2P5OA 1Q43A 3C3TA 4B3TO 4GX0A 4JI7B 3T2MA 5IT9N 4DR5B 3H1LH 2YXHA 1RM1C 4K0KO 1X4TA 1ZAUA 2HP8A 3BAAA 1JFFA 3L72H 1EM1A 3F7VC 5BY1A 3JYCA 2KG7A 1L1FA 2UU9O 1AILA 4CH6A 4ZIBA 3RYFA 4OX9B 2WLKA 3UT5A 1E1QG 3AEIA 3W7SA 5KA5A 2JS5A 4TQFA 3ASOB 5KUKA 3VBBA 4FLWA 1PL4A 4UVCA 1PD3A 4NXMO 3WB1A 2WSSG 2ADQB 4TV8A 4PDRA 4JI0O 1MA1A 2ZQMA 2UXXA 1CP9A 4O4IA 1QNMA 2DW4A 4K35A 2YC0A 5JJJB 2DQ0A 4GKKO 2B1GA 4NTYA 1WA8B 1BL8A 4LNUA 1VQ5V 3BA8A 3ETEA 1I7FA 4DV1O 1QVFU 4Q6GA 2VWKA 2WLHA 3CJHB 2OWOA 3SYAA 1M9NA 2QA4V 4ZI7A 1Q86W 2E5LB 3ETGA 1GN4A 3DSQA 4IL6Z 3JCUZ 4JV5B 3U10A 4CZZA 4H37A 1U97A 3ZMVA 4DV5O 3ML0A 1TGOA 3K5LA 3M8AA 1SZXA 2KSDA 1DF4A 1EN4A 2XNDG 3ZBHA 1GN2A 3ASNC 2VQEB 2LFSA 1WPBA 4I4TB 1GK9A 1VF6A 4FLZA 4R50A 2CTPA 2Z0AA 2GTAA 1WPXA 1KP2A 1D2DA 1B04A 3AK2A 4NXNB 1WAZA 4PD4F 2LGWA 3CCJV 4D7TA 4H33A 2PUSA 3BHPA 2G38A 1KUQA 4J7ZA 4FPPA 4CH3A 2ZR2A 1VQ8V 3P3PA 2OCCB 2UXBO 1BSMA 3AG1B 4LFAB 2BSKA 3SYCA 2WLNA 4FFBA 2ZM6B 1TUEB 1ZLZA 1VQMV 2BTOA 1R6NA 1BMFG 3IJ4A 5J2UA 2AZ0A 1N0NA 3N2KB 3HPLC 1AR5A 1SA0B 3RW0A 5CMUA 3WU2Z 2KQXA 4JAUA 1DGSA 2HLDG 3K0GA 2UXCO 4UCRA 3OM3B 2IU0A 1S0VA 1ZWIC 1FJGB 1BQZA 1AJQA 1GM8A 4OX9O 1MZFA 2DE0X 3K0DA 4RAIA 3JATA 2MK3A 1QHTA 2WLIA 1OZ0A 4FLVA 3CSXA 3LNMB 1Q82W 3KKYA 4D7SA 1XNRO 2ZNJA 2V7QG 4RWUA 3CRRA 1HNXO 1AVMA 2A0LA 1VMGA 1SQQH 4UB8Z 4JI5B 2F4VO 5B1AB 4MVMA 3ZRXA 1R73A 3GB7C 5H6QA 1GN6A 3ETQA 3J81N 3ZHSA 3AG3B 3K5MA 1JR9A 4JI8B 4TV9A 1M90W 4O4LB 3RYIB 4X1KB 1L0LH 3WG7B 4HNAA 2R9RB 1EBOA 3ZMZA 4W4KA 4FM1A 5FPRA 3SPHA 1MSDA 1R3KC 2UUCO 1TUBB 2YS8A 5JJNB 3T1YO 2GBOA 3P32A 1XMQB 1YJNV 1OCZC 1US6A 1HWYA 3A8TA 4LF5B 2WLIB 4ICGA 1BZKA 2LGQA 2W0FC 5C8YB 1GMGA 4WFEA 2PYLA 3AG2B 5JH7A 1QVGU 1GO3F 2NNUA 2RNBA 1OCCB 1N36O 2R70A 2B5UA 5B1NA 3K3WA 4MVRA 4YIOA 2QWRB 3T1CA 4YHHB 3SPGA 4GLXA 1Y6XA 4DR5O 2HHHO 2CGOA 1XEQA 4MW3A 4UV8A 5FNVA 4RO2A 1YSCA 4NB5A 2QDOA 1EFRG 1FFXB 1KYOF 3M99B 4X8AA 5BZBA 4P30A 3QNEA 4O4LA 1Z2GA 3K03A 5JQGB 1L0NH 4B3MB 1VQKV 1HNWO 4XBFA 5LMUO 4JI1B 4GKJO 5K1XA 2EIMC 2HVKC 4K8ZA 1S5HC 5LBQA 1HNZO 3STZC 4JI4B 5KHGA 2B1IA 3R66A 4CS4A 2UUCB 2UXCB 4NYKA 4PI0A 3RYHB 3CCEV 1IXMA 2XAGA 4FLYA 2ETNA 1FPOA 2RMKB 5B3SC 2EIKC 5JH7B 3VQVA 4RQFA 1NS1A 1DLBA 4PDVA 4YJ3A 4GCZA 1V9PA 2HG5C 3CWBH 5LOVA 3UO3A 4FMTA 5EC2C 3N27A 3ABLC 1JJ2U 2RN9A 1XHXA 2Q8VA 3JSNA 5B1BC 1P84F 2QM7A 3CMEV 3SPIA 3B8MA 3DC6A 4CS3A 2OCCC 3B4SA 2DN9A 3QO7A 1M57C 1XI1A 1IURA 5IWAB 5IY5C 3OT7A 3OE7G 1MSWD 1VIBA 1Q81W 5HFLA 4PHZA 3BVOA 1AI6A 1HDJA 1K34A 3HKDA 1Y4MA 3FB6C 1ZL8A 2JVDA 5HFMA 3OTOO 2XUMA 4DUZB 2PYJA 2F95B 1G1XB 3OEHG 1FXKA 2WLMA 3FAVB 4LWSA 4YJ3B 3STLC 3OMNB 4FLXA 1HR0O 4JGSA 1SESA 3HKEB 3OGCC 5ITZB 4TT3G 3E83A 1J5EO 2K9PA 3G4SV 3RBZA 5JVDB 1TAEA 2Q67A 1N34B 4O4JA 5KHJA 3WG7C 1M5IA 5CBGA 3NR7A 1BGYH 4WBNA 2EIKB 4KXRA 2Q5ZA 3AG3C 2WLJA 4I0XA 3ZS8C 2BE3A 2FB5A 4UVBA 2AZ2A 1IDSA 4YY3B 1RSOA 4J11A 4GZRB 1PPJH 1MOFA 4WFGA 4JZGA 2YIAA 4QPJA 4MSWC 4AQYO 1NTZH 5LMUB 3SDLA 2EILB 1B6QA 4F6RB 2VQFB 4BW5A 3E86A 2FYUH 4MW8A 1ZX3A 4JTCB 4K3AA 1LNQA 1EZVH 2P22C 2Q7HA 1KECA 4GX2A 2Q69A 4IYHA 4X1YB 1K33A 3J7AU 2CDYA 5ITZA 3U11A 2IJKA 3P3NA 4LF6O 5LA6B 1I94B 3W7TA 3Q4HB 4DR2O 2RQ6A 2F23A 5J2TA 4DV1B 2Y69B 2Y69C 1FAFA 3ZJZA 3JAMN 3CEIA 1SS3A 3A0BZ 3CHXA 3W7UA 4PA9A 4I0XB 3CCQV 1NZ6A 4JPRA 4UXNA 3NXSA 2CH7B 1XNQB 3LDCA 5GONA 2XT9A 1FD9A 1N32B 2Q7EA 4JAVA 4MT8A 2Z5UA 3EHBB 1FFTB 4X1IB 4PDLA 3RN4A 5CA1B 5J9PC 2LO1A 1Q6IA 2A06H 1ENVA 4TV8B 3JALA 3CRAA 1KMIZ 3CRCA 5BR8O 2BCCH 3LUTB 4LF7B 1SQVH 2VQFO 1P4RA 2PF4E 1P49A 1GTOA 4XDKA 1NH2B 3SR2C 4IIJB 3CC4V 1JJOA 4DK1A 1IBMB 4GYCB 4PELA 4GKKB 1UJWB 2PGGA 3SPCA 3DXRB 1YXBA 5LP6C 2XAFA 4IGGA 3IAYA 2F43G 3QO8A 5CBFA 4X65B 1DF5A 1J5EB 1BCCH 3C90A 4LFAO 2AHYA 2LP7A 5GONB 3W7XA 4QIWF 5E79Z 2P4KA 3EXAA 3BFRA 1JOYA 1GM7A 4DV6B 2IH3C 4JV5O 4L87A 5KAIZ 1SQFA 2YEVB 4I50B 2XAHA 4DV7B 4LR3A 1JCHA 1FJGO 3D3QA 2VS0A 3OR6C 3B2EE 5LMNO 3DGEA 4LFCO 1N33O 1B3QA 4UFZA 1SRYA 4D6TH 1GN3A
chains in the Genus database with same CATH topology
1N36O 4DV4O 1IBLO 4NXMO 1R1BA 4LF8O 4X66O 4DR3O 4DR5O 4JI0O 3OTOO 4DV0O 2HHHO 2UUAO 4DR6O 1XEQA 1G1XB 2UXCO 1XMQO 4GKKO 4X64O 4DV7O 1I94O 4LF5O 1XMOO 4B3SO 4B3RO 5H5NA 1X59A 1HR0O 4DV1O 4OX9O 4DR4O 5IWAO 2AGAA 1F7YA 3J80N 1HNWO 4OPHA 1J5EO 2VQEO 5LMUO 3T1HO 5BR8O 4JI2O 4GKJO 4LF9O 2VQFO 4OPAA 4JI8O 1HNZO 4JI6O 3R66A 3O65A 4NXNO 1XNQO 2LW7A 2DJVA 4DUZO 3F5TA 1N32O 1A32A 4DV6O 1XNRO 5A2QN 4JI7O 2DOSA 4DV3O 1HNXO 4DV5O 4DV2O 3M8AA 4JI3O 4DR1O 1AB3A 2N74A 2ZKOA 2F4VO 4A5UB 1FKAO 1IBKO 2UUBO 1NS1A 4AQYO 3SDLA 3J81N 4LFAO 4LF7O 2Z0AA 2ZM6O 4DUYO 1N34O 4JI4O 4DR7O 1FYJA 1D2DA 2UXDO 2E5LO 1YZBA 4B3TO 4X62O 1IBMO 4YHHO 2UUCO 5FLXN 4JV5O 5LL6Y 5IT9N 3J7AU 2JRIA 1R6TA 3T1YO 5BXZA 4JYAO 4K0KO 4YY3O 1KUQA 4LFBO 3RT3C 4LF6O 4JI5O 5BY1A 4DR2O 1FJGO 1DK1A 2UU9O 1AILA 4X65O 2UXBO 4B3MO 5LMNO 3JAMN 4KHPO 4LFCO 2FKXA 1N33O 4JI1O 4LF4O
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1N36 O;  4DV4 O;  1IBL O;  4NXM O;  1R1B A;  4LF8 O;  4X66 O;  4DR3 O;  4DR5 O;  4JI0 O;  3OTO O;  4DV0 O;  2HHH O;  2UUA O;  4DR6 O;  1XEQ A;  1G1X B;  2UXC O;  1XMQ O;  4GKK O;  4X64 O;  4DV7 O;  1I94 O;  4LF5 O;  1XMO O;  4B3S O;  4B3R O;  5H5N A;  1X59 A;  1HR0 O;  4DV1 O;  4OX9 O;  4DR4 O;  5IWA O;  2AGA A;  1F7Y A;  3J80 N;  1HNW O;  4OPH A;  1J5E O;  2VQE O;  5LMU O;  3T1H O;  5BR8 O;  4JI2 O;  4GKJ O;  4LF9 O;  2VQF O;  4OPA A;  4JI8 O;  1HNZ O;  4JI6 O;  3R66 A;  3O65 A;  4NXN O;  1XNQ O;  2LW7 A;  2DJV A;  4DUZ O;  3F5T A;  1N32 O;  1A32 A;  4DV6 O;  1XNR O;  5A2Q N;  4JI7 O;  2DOS A;  4DV3 O;  1HNX O;  4DV5 O;  4DV2 O;  3M8A A;  4JI3 O;  4DR1 O;  1AB3 A;  2N74 A;  2ZKO A;  2F4V O;  4A5U B;  1FKA O;  1IBK O;  2UUB O;  1NS1 A;  4AQY O;  3SDL A;  3J81 N;  4LFA O;  4LF7 O;  2Z0A A;  2ZM6 O;  4DUY O;  1N34 O;  4JI4 O;  4DR7 O;  1FYJ A;  1D2D A;  2UXD O;  2E5L O;  1YZB A;  4B3T O;  4X62 O;  1IBM O;  4YHH O;  2UUC O;  5FLX N;  4JV5 O;  5LL6 Y;  5IT9 N;  3J7A U;  2JRI A;  1R6T A;  3T1Y O;  5BXZ A;  4JYA O;  4K0K O;  4YY3 O;  1KUQ A;  4LFB O;  3RT3 C;  4LF6 O;  4JI5 O;  5BY1 A;  4DR2 O;  1FJG O;  1DK1 A;  2UU9 O;  1AIL A;  4X65 O;  2UXB O;  4B3M O;  5LMN O;  3JAM N;  4KHP O;  4LFC O;  2FKX A;  1N33 O;  4JI1 O;  4LF4 O; 
#chains in the Genus database with same CATH topology
 2IW5 A;  5EBW C;  1HP8 A;  4QJF B;  1CEZ A;  1G8M A;  4AHC A;  4H44 B;  2ZD9 A;  4UUJ C;  3W7W A;  3CB2 A;  1Q6U A;  2IM9 A;  4B3S O;  4YIP A;  5H5N A;  2PY5 A;  4DR4 O;  1SA0 A;  3OAA G;  1BE3 H;  4LCU C;  2D2C B;  4OPA A;  5IYB O;  1WP7 A;  2RJZ A;  5FL7 G;  1IBL B;  2L6L A;  4DXW A;  1B06 A;  4X89 A;  2R9A A;  3I55 V;  2LW1 A;  5EIB C;  4DV6 O;  4JI7 O;  3SJC C;  4DV3 O;  5LXT B;  4WCE V;  2BSK B;  4JI3 O;  3C3S A;  3QO5 A;  4DR1 O;  2N74 A;  3HR0 A;  3D36 C;  1JA8 A;  1PNL A;  3LDD A;  2ZE6 A;  3RWR D;  3FX7 A;  2XHB A;  4JI2 B;  2GV9 A;  4NTX A;  4KHP B;  4ABM A;  1Y67 A;  1N33 B;  4EFB A;  3TK1 A;  1H2K A;  4DR7 O;  3BA9 A;  2JGU A;  1SQB H;  1AP6 A;  4GUN A;  1YZB A;  2XAJ A;  4LF8 B;  1R3I C;  2EJ7 A;  5FLX N;  2UUA B;  4I55 B;  3L73 H;  2QWP B;  5L3G A;  1K4D C;  4X64 B;  3K79 A;  1DK1 A;  5IE9 A;  4X65 O;  2Q0O C;  4RUF A;  5BMV A;  1XRE A;  1G6U A;  3SJQ C;  1S77 D;  4I5S A;  1T5E A;  4Z1V A;  1KU9 A;  4LF9 B;  2LFR A;  1VP7 A;  3APO A;  2M6Y A;  3HKC A;  1IBL O;  5F2V O;  3RVZ A;  4X20 A;  2QGN A;  1WJZ A;  1SQP H;  1XOU A;  4TQD A;  5LGU A;  4JYA B;  1XBL A;  4I9W A;  1NBM G;  3N2G B;  1XMQ O;  2JDI G;  1YTF D;  2Q0A A;  3ZMT A;  3JAK A;  2RCV A;  3BY6 A;  2QKC A;  2ZXW C;  1ARO P;  4IT5 A;  2MW2 B;  4JYB A;  2WA3 A;  2BOC C;  2WWW A;  4QE7 A;  3K08 A;  4JYY A;  4JAS A;  3G71 V;  2KKW A;  4NXN O;  3KZI Z;  1J95 A;  2GTS A;  4WF9 V;  5IYZ A;  5JWP A;  3SYP A;  1W59 A;  2ITD C;  5CB4 B;  4K0K B;  1JQ0 A;  4CBC A;  4FIP C;  1RPR A;  4G27 B;  2IH1 C;  4I9Q A;  3OEE G;  4A5U B;  2X6C A;  2DYS C;  1TA8 A;  5BR8 B;  5KMG B;  2ZDI A;  4LF7 O;  3EVK A;  4X20 B;  2H8P C;  1RFY A;  5H2F Z;  3ZCC A;  5B1O A;  3RVY A;  1S76 D;  3K9A A;  4DV4 B;  5IY5 B;  1NQT A;  2GUZ B;  3JAK B;  1ZTE A;  1SF9 A;  1BQ0 A;  2OT5 A;  2R9I A;  4O4H A;  1M56 B;  1V55 B;  3K59 A;  3B09 A;  3RFR A;  3QF7 A;  1NH2 D;  3WFV A;  1PNK A;  1R6K A;  2V1D A;  4DK0 A;  3ZHU A;  3U0Z A;  2WLL B;  2YXY A;  3VQW A;  5DM6 V;  1RPO A;  3SGI A;  3EFF K;  1YF2 A;  3JAR A;  2F66 C;  3DC5 A;  4B3T B;  2CE4 A;  2O57 A;  4J7J A;  4UCO A;  5GW7 A;  1M57 B;  1M4U A;  3E8B A;  3K5N A;  4FLU A;  1MAB G;  4L8J A;  1UPG A;  4OXS A;  2ZNI A;  4AIL C;  4DV5 B;  2PZS A;  3HKD B;  2EIL C;  1H8H G;  3CMA V;  1EZJ A;  1S72 V;  2DYR B;  3OUF A;  3SJA C;  1Y74 A;  2ZXW B;  1E79 G;  1WNS A;  4GX5 A;  4DUY B;  2HJF C;  4JI6 O;  5IYD O;  2JIZ G;  2LW7 A;  4O4H B;  2QSA A;  3HKE A;  5B66 Z;  1IX9 A;  3ZMU A;  1QLE B;  3ZHQ A;  3CCL V;  2DOS A;  3PN1 A;  5LHI A;  4B3S B;  3ZN0 A;  4FZ0 A;  1K3E A;  3G6B A;  2DYR C;  1K9M W;  3ABK C;  1YJW V;  4WBN B;  3CE2 A;  5EBL C;  1KP3 A;  4UCU A;  1VQ9 V;  1D5N A;  1GM9 A;  1K4C C;  4MTO A;  4B7E A;  4PA6 A;  4WFF A;  2ZIN A;  3RYF B;  2E5L O;  1Y76 B;  2BTQ A;  1BT8 A;  3GWK C;  1N8R W;  3UT5 B;  1Q3E A;  4YHH O;  2E74 B;  3I56 V;  1Q8I A;  1E1R G;  5LL6 Y;  4UVA A;  4DV3 B;  1QR8 A;  2OIE A;  3RT3 C;  4F6R A;  4DR1 B;  2Q6A A;  3ZRV A;  4FM0 A;  1YJ9 V;  4GX1 A;  3PJS K;  1GRJ A;  5JVD A;  4JAA A;  5EC1 C;  5KHH A;  2AXT Z;  2M7W A;  4X88 A;  4B08 A;  1O9G A;  2EIJ B;  1OV9 A;  4JI1 O;  3FKS G;  1WA8 A;  4LNU B;  4Z2W A;  1ZSP A;  1XL4 A;  3ASO C;  5LA6 A;  3CRM A;  3AG1 C;  1RSO B;  4DYL A;  4Q20 A;  1K97 A;  3TGU H;  2CTR A;  4LFB B;  4X64 O;  5JCO A;  5L3B A;  3FYE B;  5KHK A;  4B7K A;  1AP5 A;  2AGA A;  2UUB B;  2FML A;  3LSS A;  4TWK A;  1NVP D;  2P7T C;  2EIN C;  3ZHV A;  1QQC A;  4PDM A;  5CN0 A;  1NVP B;  5K1P A;  3ASN B;  4JZ2 A;  2WPD G;  4DV0 B;  1H8E G;  5EYP A;  5L3F A;  2GSM B;  4ASU G;  4U7O A;  1VQ4 V;  5A2Q N;  3ZX6 A;  3ZRW B;  1VQN V;  2ZDI C;  4AI8 A;  2QJ1 A;  3UKM A;  4BW9 A;  4KFM A;  4PJ0 Z;  3QVN A;  4HAM A;  1KKD A;  4W4L A;  4TUY A;  3F7Y C;  1MG1 A;  1WP8 A;  1OJH A;  4MVZ A;  4JI6 B;  5B5E Z;  4DUY O;  2QM4 A;  4MTX A;  1N36 B;  3CCS V;  1NJI W;  5KX5 A;  1H2L A;  1P7G A;  4FZ1 A;  4CC6 A;  2H3O A;  1XNR B;  3BEH A;  4FFB B;  3OTO B;  2OIG A;  3FB5 C;  4DR6 B;  1R6T A;  2QM8 A;  1NR1 A;  1VF7 A;  4I4T A;  4MVU A;  1NU1 H;  5EIB D;  4JI5 O;  4QNH B;  1OCR C;  2QR4 A;  5CA0 B;  1QR9 A;  5FPO A;  5LHG A;  2JJ1 G;  4R7C A;  1AI7 A;  1BS3 A;  2CTW A;  2BOB C;  2HR3 A;  2P90 A;  3UCS C;  3X2Q C;  2A3Q A;  4LF4 O;  2YI9 A;  2NR5 A;  2YEV A;  4I50 A;  5H9C A;  2JEU A;  3ZRW A;  1NKD A;  2E75 B;  3L70 H;  3LSU A;  3K9S A;  1SC5 B;  3AG7 A;  1WLE A;  3CP1 A;  2JK5 C;  3CS5 A;  2QWQ B;  3TET A;  3M7M X;  4HZ3 A;  4DV7 O;  1RM1 B;  4B3R O;  4JI3 B;  3SJB C;  5J2U B;  3FB7 C;  3LNN A;  3N2K A;  1FXK C;  2IJJ A;  1BHA A;  4X9Q A;  2ZIO A;  2IJI A;  1IXB A;  4JI2 O;  5L3C A;  3B40 A;  2C2A A;  4DR7 B;  4JTA B;  4DO2 A;  1ZUQ A;  4C7U A;  2DWD C;  4IHJ A;  3IGA C;  3JD1 A;  3T4D A;  1K5S A;  3JD2 A;  5CA0 A;  4X62 B;  3T4Z A;  4XDJ A;  4ZOL B;  2A7W A;  4HNA B;  5KHI A;  2E76 B;  2Q9L A;  4J9Y B;  1KBH A;  2ARH A;  4PA4 A;  3FFQ A;  2PI4 A;  1HNW B;  2YXL A;  3T1H B;  1V55 C;  5IJ0 A;  4U3F H;  2ZE7 A;  3G80 A;  3TCU A;  2Y4T A;  4LC1 A;  2ZM6 O;  5LXT A;  2ODM A;  1HNZ B;  1H2N A;  5C8Y A;  2ITC C;  3D3I A;  4HYO A;  1YVW A;  3JD3 A;  4J9Z B;  4P9P A;  1AJN A;  2XTA A;  1OCC C;  2GHY A;  4DW1 A;  4UCV A;  3ZRS A;  4NR1 A;  1HR0 B;  2VRZ A;  3QG5 A;  3WB2 A;  4KHP O;  3IC9 A;  1TUB A;  4U3J A;  3CRQ A;  5GTI Z;  2YIB D;  3JAW B;  5EBM C;  4O2B B;  2YUA A;  4WFH A;  4KUM A;  5JQG A;  4TOI A;  3OGI B;  4RQE A;  1N4C A;  2UUA O;  1F23 A;  1Z5V A;  3WB0 A;  4EEQ A;  1P7B A;  3H1J H;  4UB6 Z;  2CUG A;  1H2M A;  1VQP V;  3KG2 A;  1U96 A;  1K92 A;  3HKC B;  3CD6 V;  4H13 B;  2EJR A;  3ABL B;  1S5L Z;  1COW G;  1QU7 A;  4MVO A;  4LBE C;  5EZY B;  3T1H O;  5B1A C;  1H38 A;  2Q68 A;  3ZHT A;  4LH7 A;  2VWJ A;  4LF9 O;  1SER A;  5L3D A;  4PA7 A;  3OR7 C;  1NTM H;  1FFX A;  4O2A B;  3TXQ A;  1AI4 A;  1XL6 A;  2DJV A;  5LYJ B;  1A32 A;  2K1E A;  1JMK C;  2HKO A;  3A0R A;  4CS2 A;  2YSU B;  3ZIA G;  3E8F A;  3ABM B;  2AHZ A;  1EN5 A;  5DEC A;  2B9Z A;  3OUS A;  4NTW A;  4H0L B;  4U7N A;  3SPJ A;  3BPZ A;  4F4L A;  3CCR V;  3JD4 A;  4QE9 A;  5IYZ B;  2GDS A;  5LMN B;  1YDX A;  1VQ6 V;  5LP6 A;  1N0J A;  4WFB V;  5KLV H;  1VQO V;  2FTK A;  1H2G A;  4X62 O;  1XQ8 A;  2YIC A;  2HHH B;  3OTF A;  1HNX B;  5BXZ A;  3ABT A;  3RGB A;  4UCT A;  3ABU A;  5LOV B;  1VAR A;  3RYC A;  1AI5 A;  3SYQ A;  1WB8 A;  3H1H H;  4FVM A;  2ZIM A;  3S3X A;  5D5P A;  5LGN A;  2PI5 A;  4LP8 A;  3E22 B;  2FKX A;  2KB1 A;  4I7Z B;  1MMM A;  4E4E A;  2NLJ C;  4DV4 O;  2W0X A;  1D5A A;  5KUM A;  2YID A;  3CYO A;  3H1K H;  3KCY A;  4P2Z A;  4X66 O;  4DRX B;  4DR6 O;  2H94 A;  2IJH A;  1KKC A;  4JF3 A;  4G28 B;  2A9H A;  2WLL A;  4O4J B;  2XAQ A;  5KMG A;  4DR2 B;  1XMO O;  4UCS A;  3OW2 U;  2V4D A;  1XIL A;  1LUW A;  2ZT9 B;  3BRC A;  4QGP A;  2R72 A;  2YDE A;  4K8X A;  4LWS B;  1Z5W A;  5CA3 A;  2EX3 A;  4QPK A;  1FXH A;  3MHH C;  3RYC B;  2UXD B;  3JAS B;  1N32 O;  4CH4 A;  3CC7 V;  2DQ3 A;  4OGQ B;  2D3O W;  4R6Z A;  3K04 A;  3R65 A;  2ZKO A;  2EBO A;  1FKA O;  1SZT A;  2P06 A;  3JAR B;  2Z3Y A;  1PM9 A;  3IFX A;  2N04 A;  3D36 A;  3A2F A;  4GT1 A;  3L9D A;  4LFC B;  1JFF B;  4JTD B;  3ZMS A;  2Q73 A;  4JI4 O;  3Q4H A;  4ZKI A;  1QCE A;  1M1K W;  5J2T B;  4N23 A;  1RP3 B;  1IBM O;  4DR3 B;  4JI0 B;  1K7D A;  3O9O A;  3OD4 A;  4N21 A;  4NKG B;  4FFK A;  3TJT A;  1YI2 V;  1TVK A;  1PP9 H;  1EN6 A;  2DWE C;  4KL1 A;  4IYI A;  1Y74 B;  2RDC A;  4YXW G;  5D5Q A;  4DR4 B;  2QKA A;  4O4I B;  2HVJ C;  3FYI B;  4ZHQ B;  4PI2 A;  2Y4U A;  4F6E A;  1F51 A;  3TXS A;  3ICX A;  3THO A;  1W2B U;  2EIN B;  4RUE A;  1JX9 A;  5EK0 A;  1V54 C;  1W0K G;  1F4N A;  2ZR3 A;  3ETD A;  3JAL B;  3P30 A;  4DV0 O;  3B77 A;  3CJH A;  1O9H A;  2Y48 A;  4CH5 A;  4LF5 O;  4BIO A;  2Q4P A;  4ZI7 B;  3L74 H;  1YCI A;  4IIJ A;  2X0L A;  5CBH A;  2EIM B;  2P67 A;  3CPW U;  5DED A;  4EB6 A;  2BTQ B;  3QTC A;  4CC5 A;  4UV9 A;  4X1I A;  4MTG A;  1GH6 A;  3O65 A;  2OTL V;  1TVK B;  1Q5O A;  4DUZ O;  3OFN G;  3G67 A;  2PTM A;  3BCC H;  3SYO A;  1KB9 F;  2CGN A;  3CC2 V;  3ZHR A;  2ATK C;  3GVM A;  1WN7 A;  3K5O A;  2OTJ V;  2CTQ A;  3JCZ A;  4ZHQ A;  1QBZ A;  4E2L A;  5EYP B;  4DW0 A;  1NTK H;  4GKJ B;  3FB8 C;  2CK3 G;  1N34 O;  1XUQ A;  4LF4 B;  3DXR A;  3X2Q B;  3B8N A;  4EKW A;  1OCZ B;  5C93 A;  3JAT B;  5JCO C;  4Z1M G;  3APQ A;  2AW9 A;  3E89 A;  4TUY B;  1OCO C;  1NT2 B;  3H9V A;  4YY3 O;  3IC7 A;  4YJ2 B;  4EB6 B;  2DYS B;  4AQY B;  1M56 C;  1PV0 A;  4BWA A;  2Y0I A;  1Q7Y W;  2F93 B;  5B1B B;  4JYC A;  5TIS Z;  1NR7 A;  1SKV A;  1PL0 A;  2W6J G;  1R1B A;  3L71 H;  2ILM A;  4LF8 O;  3E8G A;  4TV9 B;  4X1K A;  3AK1 A;  2HJD A;  2W6I G;  3A0H Z;  3E2E A;  1X59 A;  3JD0 A;  2UXB B;  1VQ7 V;  5AG2 A;  3CCU V;  3J80 N;  4OPH A;  2A79 B;  5KX5 B;  1KD1 W;  4JI8 O;  3HKB B;  5LGT A;  2EIJ C;  3H1I H;  4YJ2 A;  1Y66 A;  2JGD B;  3F5T A;  1GAX A;  1S3J A;  2NN4 A;  3VQY A;  1YIJ V;  3RYI A;  3T1Y B;  1AR4 A;  1M93 A;  1LUV A;  1QLN A;  2OYQ A;  1L8D A;  4PV1 B;  5A9G A;  4IHJ B;  1V54 B;  2ZE5 A;  3MD0 A;  1K8A W;  1QLE C;  2JS3 A;  1YIT V;  5IJ9 A;  1OHH G;  2LJ2 A;  1SET A;  1IVS A;  2UXD O;  2WA4 A;  4TSF G;  5IYC O;  3ZN1 A;  3OMI B;  4J41 A;  2JRI A;  2EZP A;  5IJ0 B;  4FM2 A;  1YEW A;  5KAF Z;  3K58 A;  1MZE A;  3LDE A;  2F4V B;  1FS0 G;  1IBK B;  4MTF A;  3ABM C;  2Q7G A;  3HKB A;  5E1A C;  1XHZ A;  1AR1 B;  1XDC A;  2HFE C;  3RYH A;  2UXN A;  4B3M O;  5FNV B;  2JGD A;  4I55 A;  2QE7 G;  5L3E A;  2ZE8 A;  4ZOL A;  3MHS C;  2X6A A;  4WFA V;  4DR3 O;  3ABK B;  5BMV B;  1Q6H A;  5GTH Z;  1AJP A;  4BAY A;  4P9O A;  1CXZ B;  3E8H A;  1URF A;  1I94 O;  4O2B A;  3AK3 A;  5IJ9 B;  2QWN B;  4FK5 C;  1F4M A;  3I5D A;  3CCM V;  1I0H A;  3BAB A;  1K73 W;  1FXV A;  2P4V A;  4LH6 A;  2X6B A;  3N2G A;  4BIU A;  1IZ3 A;  2IBZ H;  1XNQ O;  4J7K A;  3OMA B;  1K5Q A;  4J42 A;  4BIZ A;  1ZL8 B;  1ROP A;  4U3J B;  2Y0P A;  3JAW A;  4EFE A;  2JEX A;  2QWO B;  1IBK O;  2UU9 B;  1FXK B;  3FAV A;  1DTO A;  1BHB A;  5LHH A;  1WB7 A;  2L35 A;  1GKF A;  3FD9 A;  4MVQ A;  1R3L C;  5CB4 A;  3VQX A;  3L75 H;  4G2K A;  4MVS A;  5JJE B;  4BR6 A;  1CPY A;  2FL4 A;  4FLT A;  1JPX A;  4J10 A;  1VF6 C;  1YHQ V;  4MS2 A;  4X66 B;  3UM7 A;  2CAZ C;  3AG4 C;  2YI8 A;  3AG4 B;  1YTF B;  4JYA O;  5B3S B;  1H2S B;  5KA6 A;  4KP4 A;  4DV2 B;  4LFB O;  2X7R B;  5EZY A;  3KCX A;  4B3R B;  1HW7 A;  3UQ8 A;  3LSQ A;  3DTU B;  3F5W C;  2EZO A;  4O2A A;  1MNG A;  3MDS A;  2GUZ A;  5LYJ A;  2XAS A;  1ORQ C;  4FJC C;  1SQG A;  1KC8 W;  2QKS A;  3S3W A;  1LR1 A;  1OCO B;  2E3C A;  3CCV V;  3AG2 C;  3CXH F;  3CXC U;  1I5Y A;  1KQS U;  1JVM A;  3E22 A;  2OCH A;  2F1M A;  2EUL A;  2IU3 A;  2WAM A;  2YIB A;  1PNM A;  2P6J A;  5H6R A;  1VQL V;  5LP6 B;  3E35 A;  3MAQ A;  4X1Y A;  4ZBM A;  5IWA O;  1F7Y A;  2LQT A;  4DRX A;  2VQE O;  3K06 A;  3HB3 B;  2N05 A;  2KG7 B;  2QTO A;  1PKX A;  1NI8 A;  1VF5 B;  4PA3 A;  2HEP A;  3G6E V;  3ZED A;  3CX5 F;  4HBN A;  4NXM B;  2QTS A;  2XOK G;  5DN6 G;  2QEX V;  1Q90 D;  1UFI A;  1VEW A;  3H01 A;  1R3J C;  2DMX A;  1XMO B;  4NVP A;  1OCR B;  3VOU A;  3GWO A;  1S5J A;  4DV2 O;  2CH7 A;  2JJ2 G;  2ZCE A;  3UO2 A;  1G4Y B;  4LF6 B;  3JSL A;  1AB3 A;  1Y76 A;  3D8C A;  2UUB O;  1THZ A;  4R8C A;  3JAS A;  2ADP A;  1W0J G;  1I5X A;  1SQX H;  3K57 A;  5CA1 A;  4J80 A;  1I08 A;  5IDJ A;  4XDL A;  1FYJ A;  2P5O A;  1Q43 A;  3C3T A;  4B3T O;  4GX0 A;  4JI7 B;  3T2M A;  5IT9 N;  4DR5 B;  3H1L H;  2YXH A;  1RM1 C;  4K0K O;  1X4T A;  1ZAU A;  2HP8 A;  3BAA A;  1JFF A;  3L72 H;  1EM1 A;  3F7V C;  5BY1 A;  3JYC A;  2KG7 A;  1L1F A;  2UU9 O;  1AIL A;  4CH6 A;  4ZIB A;  3RYF A;  4OX9 B;  2WLK A;  3UT5 A;  1E1Q G;  3AEI A;  3W7S A;  5KA5 A;  2JS5 A;  4TQF A;  3ASO B;  5KUK A;  3VBB A;  4FLW A;  1PL4 A;  4UVC A;  1PD3 A;  4NXM O;  3WB1 A;  2WSS G;  2ADQ B;  4TV8 A;  4PDR A;  4JI0 O;  1MA1 A;  2ZQM A;  2UXX A;  1CP9 A;  4O4I A;  1QNM A;  2DW4 A;  4K35 A;  2YC0 A;  5JJJ B;  2DQ0 A;  4GKK O;  2B1G A;  4NTY A;  1WA8 B;  1BL8 A;  4LNU A;  1VQ5 V;  3BA8 A;  3ETE A;  1I7F A;  4DV1 O;  1QVF U;  4Q6G A;  2VWK A;  2WLH A;  3CJH B;  2OWO A;  3SYA A;  1M9N A;  2QA4 V;  4ZI7 A;  1Q86 W;  2E5L B;  3ETG A;  1GN4 A;  3DSQ A;  4IL6 Z;  3JCU Z;  4JV5 B;  3U10 A;  4CZZ A;  4H37 A;  1U97 A;  3ZMV A;  4DV5 O;  3ML0 A;  1TGO A;  3K5L A;  3M8A A;  1SZX A;  2KSD A;  1DF4 A;  1EN4 A;  2XND G;  3ZBH A;  1GN2 A;  3ASN C;  2VQE B;  2LFS A;  1WPB A;  4I4T B;  1GK9 A;  1VF6 A;  4FLZ A;  4R50 A;  2CTP A;  2Z0A A;  2GTA A;  1WPX A;  1KP2 A;  1D2D A;  1B04 A;  3AK2 A;  4NXN B;  1WAZ A;  4PD4 F;  2LGW A;  3CCJ V;  4D7T A;  4H33 A;  2PUS A;  3BHP A;  2G38 A;  1KUQ A;  4J7Z A;  4FPP A;  4CH3 A;  2ZR2 A;  1VQ8 V;  3P3P A;  2OCC B;  2UXB O;  1BSM A;  3AG1 B;  4LFA B;  2BSK A;  3SYC A;  2WLN A;  4FFB A;  2ZM6 B;  1TUE B;  1ZLZ A;  1VQM V;  2BTO A;  1R6N A;  1BMF G;  3IJ4 A;  5J2U A;  2AZ0 A;  1N0N A;  3N2K B;  3HPL C;  1AR5 A;  1SA0 B;  3RW0 A;  5CMU A;  3WU2 Z;  2KQX A;  4JAU A;  1DGS A;  2HLD G;  3K0G A;  2UXC O;  4UCR A;  3OM3 B;  2IU0 A;  1S0V A;  1ZWI C;  1FJG B;  1BQZ A;  1AJQ A;  1GM8 A;  4OX9 O;  1MZF A;  2DE0 X;  3K0D A;  4RAI A;  3JAT A;  2MK3 A;  1QHT A;  2WLI A;  1OZ0 A;  4FLV A;  3CSX A;  3LNM B;  1Q82 W;  3KKY A;  4D7S A;  1XNR O;  2ZNJ A;  2V7Q G;  4RWU A;  3CRR A;  1HNX O;  1AVM A;  2A0L A;  1VMG A;  1SQQ H;  4UB8 Z;  4JI5 B;  2F4V O;  5B1A B;  4MVM A;  3ZRX A;  1R73 A;  3GB7 C;  5H6Q A;  1GN6 A;  3ETQ A;  3J81 N;  3ZHS A;  3AG3 B;  3K5M A;  1JR9 A;  4JI8 B;  4TV9 A;  1M90 W;  4O4L B;  3RYI B;  4X1K B;  1L0L H;  3WG7 B;  4HNA A;  2R9R B;  1EBO A;  3ZMZ A;  4W4K A;  4FM1 A;  5FPR A;  3SPH A;  1MSD A;  1R3K C;  2UUC O;  1TUB B;  2YS8 A;  5JJN B;  3T1Y O;  2GBO A;  3P32 A;  1XMQ B;  1YJN V;  1OCZ C;  1US6 A;  1HWY A;  3A8T A;  4LF5 B;  2WLI B;  4ICG A;  1BZK A;  2LGQ A;  2W0F C;  5C8Y B;  1GMG A;  4WFE A;  2PYL A;  3AG2 B;  5JH7 A;  1QVG U;  1GO3 F;  2NNU A;  2RNB A;  1OCC B;  1N36 O;  2R70 A;  2B5U A;  5B1N A;  3K3W A;  4MVR A;  4YIO A;  2QWR B;  3T1C A;  4YHH B;  3SPG A;  4GLX A;  1Y6X A;  4DR5 O;  2HHH O;  2CGO A;  1XEQ A;  4MW3 A;  4UV8 A;  5FNV A;  4RO2 A;  1YSC A;  4NB5 A;  2QDO A;  1EFR G;  1FFX B;  1KYO F;  3M99 B;  4X8A A;  5BZB A;  4P30 A;  3QNE A;  4O4L A;  1Z2G A;  3K03 A;  5JQG B;  1L0N H;  4B3M B;  1VQK V;  1HNW O;  4XBF A;  5LMU O;  4JI1 B;  4GKJ O;  5K1X A;  2EIM C;  2HVK C;  4K8Z A;  1S5H C;  5LBQ A;  1HNZ O;  3STZ C;  4JI4 B;  5KHG A;  2B1I A;  3R66 A;  4CS4 A;  2UUC B;  2UXC B;  4NYK A;  4PI0 A;  3RYH B;  3CCE V;  1IXM A;  2XAG A;  4FLY A;  2ETN A;  1FPO A;  2RMK B;  5B3S C;  2EIK C;  5JH7 B;  3VQV A;  4RQF A;  1NS1 A;  1DLB A;  4PDV A;  4YJ3 A;  4GCZ A;  1V9P A;  2HG5 C;  3CWB H;  5LOV A;  3UO3 A;  4FMT A;  5EC2 C;  3N27 A;  3ABL C;  1JJ2 U;  2RN9 A;  1XHX A;  2Q8V A;  3JSN A;  5B1B C;  1P84 F;  2QM7 A;  3CME V;  3SPI A;  3B8M A;  3DC6 A;  4CS3 A;  2OCC C;  3B4S A;  2DN9 A;  3QO7 A;  1M57 C;  1XI1 A;  1IUR A;  5IWA B;  5IY5 C;  3OT7 A;  3OE7 G;  1MSW D;  1VIB A;  1Q81 W;  5HFL A;  4PHZ A;  3BVO A;  1AI6 A;  1HDJ A;  1K34 A;  3HKD A;  1Y4M A;  3FB6 C;  1ZL8 A;  2JVD A;  5HFM A;  3OTO O;  2XUM A;  4DUZ B;  2PYJ A;  2F95 B;  1G1X B;  3OEH G;  1FXK A;  2WLM A;  3FAV B;  4LWS A;  4YJ3 B;  3STL C;  3OMN B;  4FLX A;  1HR0 O;  4JGS A;  1SES A;  3HKE B;  3OGC C;  5ITZ B;  4TT3 G;  3E83 A;  1J5E O;  2K9P A;  3G4S V;  3RBZ A;  5JVD B;  1TAE A;  2Q67 A;  1N34 B;  4O4J A;  5KHJ A;  3WG7 C;  1M5I A;  5CBG A;  3NR7 A;  1BGY H;  4WBN A;  2EIK B;  4KXR A;  2Q5Z A;  3AG3 C;  2WLJ A;  4I0X A;  3ZS8 C;  2BE3 A;  2FB5 A;  4UVB A;  2AZ2 A;  1IDS A;  4YY3 B;  1RSO A;  4J11 A;  4GZR B;  1PPJ H;  1MOF A;  4WFG A;  4JZG A;  2YIA A;  4QPJ A;  4MSW C;  4AQY O;  1NTZ H;  5LMU B;  3SDL A;  2EIL B;  1B6Q A;  4F6R B;  2VQF B;  4BW5 A;  3E86 A;  2FYU H;  4MW8 A;  1ZX3 A;  4JTC B;  4K3A A;  1LNQ A;  1EZV H;  2P22 C;  2Q7H A;  1KEC A;  4GX2 A;  2Q69 A;  4IYH A;  4X1Y B;  1K33 A;  3J7A U;  2CDY A;  5ITZ A;  3U11 A;  2IJK A;  3P3N A;  4LF6 O;  5LA6 B;  1I94 B;  3W7T A;  3Q4H B;  4DR2 O;  2RQ6 A;  2F23 A;  5J2T A;  4DV1 B;  2Y69 B;  2Y69 C;  1FAF A;  3ZJZ A;  3JAM N;  3CEI A;  1SS3 A;  3A0B Z;  3CHX A;  3W7U A;  4PA9 A;  4I0X B;  3CCQ V;  1NZ6 A;  4JPR A;  4UXN A;  3NXS A;  2CH7 B;  1XNQ B;  3LDC A;  5GON A;  2XT9 A;  1FD9 A;  1N32 B;  2Q7E A;  4JAV A;  4MT8 A;  2Z5U A;  3EHB B;  1FFT B;  4X1I B;  4PDL A;  3RN4 A;  5CA1 B;  5J9P C;  2LO1 A;  1Q6I A;  2A06 H;  1ENV A;  4TV8 B;  3JAL A;  3CRA A;  1KMI Z;  3CRC A;  5BR8 O;  2BCC H;  3LUT B;  4LF7 B;  1SQV H;  2VQF O;  1P4R A;  2PF4 E;  1P49 A;  1GTO A;  4XDK A;  1NH2 B;  3SR2 C;  4IIJ B;  3CC4 V;  1JJO A;  4DK1 A;  1IBM B;  4GYC B;  4PEL A;  4GKK B;  1UJW B;  2PGG A;  3SPC A;  3DXR B;  1YXB A;  5LP6 C;  2XAF A;  4IGG A;  3IAY A;  2F43 G;  3QO8 A;  5CBF A;  4X65 B;  1DF5 A;  1J5E B;  1BCC H;  3C90 A;  4LFA O;  2AHY A;  2LP7 A;  5GON B;  3W7X A;  4QIW F;  5E79 Z;  2P4K A;  3EXA A;  3BFR A;  1JOY A;  1GM7 A;  4DV6 B;  2IH3 C;  4JV5 O;  4L87 A;  5KAI Z;  1SQF A;  2YEV B;  4I50 B;  2XAH A;  4DV7 B;  4LR3 A;  1JCH A;  1FJG O;  3D3Q A;  2VS0 A;  3OR6 C;  3B2E E;  5LMN O;  3DGE A;  4LFC O;  1N33 O;  1B3Q A;  4UFZ A;  1SRY A;  4D6T H;  1GN3 A; 
#chains in the Genus database with same CATH homology
 1N36 O;  4DV4 O;  1IBL O;  4NXM O;  1R1B A;  4LF8 O;  4X66 O;  4DR3 O;  4DR5 O;  4JI0 O;  3OTO O;  4DV0 O;  2HHH O;  2UUA O;  4DR6 O;  1XEQ A;  1G1X B;  2UXC O;  1XMQ O;  4GKK O;  4X64 O;  4DV7 O;  1I94 O;  4LF5 O;  1XMO O;  4B3S O;  4B3R O;  5H5N A;  1X59 A;  1HR0 O;  4DV1 O;  4OX9 O;  4DR4 O;  5IWA O;  2AGA A;  1F7Y A;  3J80 N;  1HNW O;  4OPH A;  1J5E O;  2VQE O;  5LMU O;  3T1H O;  5BR8 O;  4JI2 O;  4GKJ O;  4LF9 O;  2VQF O;  4OPA A;  4JI8 O;  1HNZ O;  4JI6 O;  3R66 A;  3O65 A;  4NXN O;  1XNQ O;  2LW7 A;  2DJV A;  4DUZ O;  3F5T A;  1N32 O;  1A32 A;  4DV6 O;  1XNR O;  5A2Q N;  4JI7 O;  2DOS A;  4DV3 O;  1HNX O;  4DV5 O;  4DV2 O;  3M8A A;  4JI3 O;  4DR1 O;  1AB3 A;  2N74 A;  2ZKO A;  2F4V O;  4A5U B;  1FKA O;  1IBK O;  2UUB O;  1NS1 A;  4AQY O;  3SDL A;  3J81 N;  4LFA O;  4LF7 O;  2Z0A A;  2ZM6 O;  4DUY O;  1N34 O;  4JI4 O;  4DR7 O;  1FYJ A;  1D2D A;  2UXD O;  2E5L O;  1YZB A;  4B3T O;  4X62 O;  1IBM O;  4YHH O;  2UUC O;  5FLX N;  4JV5 O;  5LL6 Y;  5IT9 N;  3J7A U;  2JRI A;  1R6T A;  3T1Y O;  5BXZ A;  4JYA O;  4K0K O;  4YY3 O;  1KUQ A;  4LFB O;  3RT3 C;  4LF6 O;  4JI5 O;  5BY1 A;  4DR2 O;  1FJG O;  1DK1 A;  2UU9 O;  1AIL A;  4X65 O;  2UXB O;  4B3M O;  5LMN O;  3JAM N;  4KHP O;  4LFC O;  2FKX A;  1N33 O;  4JI1 O;  4LF4 O; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...