1N36O

Structure of the thermus thermophilus 30s ribosomal subunit in the presence of crystallographically disordered codon and near-cognate transfer rna anticodon stem-loop mismatched at the second codon position
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
88
structure length
88
Chain Sequence
b'PITKEEKQKVIQEFARFPGDTGSTEVQVALLTLRINRLSEHLKVHKKDHHSHRGLLMMVGQRRRLLRYLQREDPERYRALIEKLGIRG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S RIBOSOMAL RNA
publication title Selection of tRNA by the Ribosome Requires a Transition from an Open to a Closed Form
pubmed doi rcsb
molecule tags Ribosome
total genus 29
structure length 88
sequence length 88
ec nomenclature
pdb deposition date 2002-10-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
O PF00312 Ribosomal_S15 Ribosomal protein S15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.10 Mainly Alpha Orthogonal Bundle Helix Hairpins S15/NS1, RNA-binding 1n36O00
1IBMO 4JI5O 4LF6O 5LMNO 5IWAO 1FYJA 5H5NA 2E5LO 4LFBO 4K0KO 4DR5O 4B3TO 2UXCO 4DR3O 4YHHO 4OPAA 1N34O 1FKAO 1D2DA 2ZM6O 4DV0O 3M8AA 1HR0O 1XNQO 4JI7O 5BXZA 5IT9N 4LF5O 1XMOO 4JYAO 4DV4O 4AQYO 3J80N 4DV5O 4X66O 4LFAO 1HNZO 3OTOO 2UUCO 4DV2O 4YY3O 4JI0O 1YZBA 5BY1A 4JI3O 4B3MO 4LF4O 4JI8O 4GKKO 2UUAO 4NXNO 2DJVA 5A2QN 4DR7O 2UXBO 2VQEO 1F7YA 1NS1A 5FLXN 4LF7O 1FJGO 1IBKO 4NXMO 1I94O 4LF8O 1N36O 4JV5O 4DV1O 1AB3A 3T1HO 3J7AU 4DR4O 2HHHO 1XEQA 2FKXA 4DR2O 4DV6O 4X65O 2VQFO 5LMUO 4DV3O 1R1BA 4LFCO 4DUYO 3JAMN 4X64O 1J5EO 4A5UB 1HNXO 4DR6O 4DUZO 4DR1O 2ZKOA 2DOSA 2JRIA 2UXDO 2Z0AA 2UUBO 4JI1O 4OPHA 4JI6O 3F5TA 4DV7O 1N32O 3T1YO 2AGAA 2LW7A 4OX9O 1X59A 1N33O 3RT3C 1R6TA 3J81N 5LL6Y 4JI4O 1KUQA 3SDLA 1IBLO 2F4VO 1AILA 2N74A 2UU9O 4GKJO 1DK1A 1XNRO 4B3RO 1XMQO 3R66A 1G1XB 4X62O 4B3SO 3O65A 4JI2O 4LF9O 1HNWO 1A32A 4KHPO 5BR8O
chains in the Genus database with same CATH superfamily
2A06H 4FLWA 2CDYA 3K0DA 1OCZB 2WA4A 3W7SA 2UUCB 5C93A 3MD0A 3K5NA 2AW9A 4BIUA 3ZRWB 1YJ9V 4ASUG 1Z2GA 4U7NA 3CCEV 1YTFD 4AQYO 3AG4C 3BA8A 1I08A 3MHHC 3ZN0A 3WB2A 5DECA 3SJCC 4L87A 1LR1A 1WPBA 3T1YB 4JI3O 2QKCA 1BHAA 1YEWA 4G2KA 2E74B 2AHYA 4DV6B 5CN0A 2KQXA 2UXBO 4UCTA 4J7KA 2XAJA 1M9NA 4IHJA 3OE7G 2R9IA 1SF9A 5BMVA 1BQ0A 2GDSA 2ZE6A 3J7AU 3T2MA 4OXSA 2Y4TA 2PI4A 1WP7A 4DR2O 4JI2B 4O4JB 3OW2U 4DV3O 4K3AA 4LFCO 2G38A 2P7TC 1XI1A 2WLKA 3QO8A 1Q6HA 4DR3B 4ZBMA 3VQWA 1KB9F 1QVFU 2P6JA 3K5LA 3UO2A 5IY5C 2ZIOA 2VWJA 2GTSA 3MHSC 4B3RB 5EZYA 1GN6A 3MDSA 2EIKC 3ZRVA 2PYLA 1U97A 1EM1A 2LQTA 3U10A 2HKOA 5HFMA 1DGSA 3AG2B 4JI4O 3IFXA 4TQFA 4Z1MG 4R6ZA 1I5XA 4I4TB 1VF6C 3BVOA 4UV9A 4NR1A 4GT1A 1N34B 1VQ8V 4B7EA 4DV0B 1Y74A 1S76D 1NR1A 4NB5A 4UCUA 1YI2V 1GM8A 1HNWO 3HKDA 1GM9A 1BE3H 3K5OA 1Y76B 4LCUC 4LF6O 4FPPA 3JYCA 3CCJV 3EVKA 1VQKV 4YHHO 5CA1B 2ZDIA 1HDJA 4G27B 5B1BB 2ZINA 4DR7B 4AI8A 4JTCB 1M5IA 4JTAB 2YDEA 3CX5F 3HKCA 4MTFA 4X1KA 5CB4B 1YITV 3OEEG 1N32B 4JI0O 1NI8A 3KCXA 4GX1A 4R50A 4OX9B 4JI8O 3L74H 4UUJC 1FXHA 4RUFA 1UJWB 2IJKA 4I55A 5BZBA 1QLEB 2XASA 1M56C 4LP8A 2QA4V 1FJGO 2F43G 2GV9A 2Y0PA 2Y0IA 2YUAA 1VF5B 2XAGA 1AB3A 1VIBA 5H6RA 4DV1O 3A0HZ 2ZIMA 1JFFA 2W6IG 1XQ8A 5LP6A 2HHHO 2JS5A 2KB1A 3OUSA 4X62B 4RWUA 5LMUO 1YCIA 2M7WA 1XHXA 2DWDC 3OGIB 2YXYA 1H2GA 1JA8A 3L9DA 5GW7A 4WFEA 4ZI7B 2WSSG 3FB8C 5FPRA 2RDCA 3T4DA 3JD2A 2L6LA 3JAKB 1ORQC 2Q4PA 2P06A 4CS4A 3APOA 3RT3C 3HB3B 2RJZA 2CTPA 4GCZA 3HKEA 4J7ZA 3ZMVA 1FS0G 4PI0A 3CD6V 1M4UA 1WPXA 2UXCB 5GTIZ 1AILA 3CMEV 5L3FA 1KP2A 3DGEA 1XNRO 1XNQB 1AJNA 2OCCB 3Q4HA 3R66A 2X7RB 2M6YA 1ENVA 4PA9A 4KHPO 3JCZA 3BAAA 4QGPA 2QWOB 2Q0AA 3OMNB 4DR4B 3ZCCA 5IWAO 5KX5A 4FFKA 3ZJZA 5B1OA 1OCOC 1MZFA 3WG7C 1GTOA 1HP8A 2IH1C 3K59A 1NTMH 3DSQA 5EZYB 4LF5O 2P22C 3JASA 1Q3EA 4Q20A 2RCVA 3DC5A 1BCCH 1W2BU 1KC8W 3F7YC 2JGDA 3ABKC 5BY1A 4UV8A 5IE9A 4YIPA 2LP7A 5IJ0B 2VQEO 3QVNA 1NS1A 2ATKC 5FLXN 3FAVA 3HKDB 4DR6B 1GKFA 4YJ3A 3UT5A 3RYCA 1S72V 5EBWC 1OCRB 3ABMC 2W0FC 4X1IA 2YICA 3ZHUA 4LR3A 1M57B 2V1DA 4GLXA 3LDCA 4DUYO 5TISZ 3JAMN 3K03A 1PL4A 1JJ2U 4W4LA 3ASNC 3KZIZ 2QM7A 3HKCB 4MVUA 2Q7EA 4KUMA 2XAHA 3BA9A 3D36A 4NTWA 4IYIA 2WLMA 4JI1O 3DXRA 1S3JA 1XOUA 1H2LA 3CMAV 5AG2A 1X59A 2OIGA 3VQYA 2ARHA 1SQXH 3CS5A 1JMKC 4N23A 3H9VA 4PHZA 4PDMA 4WFGA 4BW9A 1IBMB 3A8TA 4J10A 3JAWB 3GWKC 2IBZH 1JFFB 4LWSB 2VRZA 5LOVB 1W0JG 2UU9O 4O2AA 4BIZA 2Q68A 4TUYA 3D8CA 3B8MA 5LGTA 5B5EZ 4DR2B 5JH7A 2E75B 1QBZA 4DV3B 1H2MA 1U96A 4GKKB 3L73H 4JI7O 1P4RA 2ADQB 5CA0A 4LNUA 1XREA 3PJSK 5EC1C 1DF5A 1DLBA 1NKDA 2BTQB 1RP3B 4U7OA 1RSOA 3HKEB 3K57A 4JTDB 4BIOA 3OFNG 3JARA 4E2LA 1X4TA 1MZEA 1RPRA 5DEDA 2X6AA 2DJVA 4R7CA 1AI4A 3ZX6A 1H2SB 2WLIB 1B3QA 4JI4B 3Q4HB 2FYUH 2PI5A 4UCVA 2A79B 4C7UA 2CTWA 3JALA 3IC7A 3T1HO 4I50A 3HKBA 1GMGA 4FMTA 4UVCA 2EX3A 2F95B 4GX2A 3STLC 4TWKA 1R1BA 3JASB 1V55B 2X6BA 4LF6B 1FFXA 3LNMB 2JEUA 2R70A 4YHHB 1MSWD 3RVYA 2EIJC 3EHBB 3AK2A 4LBEC 5B3SC 3RYFA 4FM2A 1VP7A 2EIMC 3CRCA 4X8AA 4X20B 1N33O 3FAVB 1BGYH 1R6TA 1Q43A 2EILB 2NN4A 3UT5B 4FM1A 4JI8B 4F6RA 1S0VA 1YIJV 1THZA 1B06A 1TVKB 3SJQC 4X1IB 1TUBA 2MW2B 4I7ZB 3E83A 3BCCH 3G71V 3CC7V 4B3SO 1DTOA 4JYBA 1L0NH 3GB7C 3OR6C 1HNZB 1R6NA 2IJJA 1JX9A 3LDDA 4ICGA 2EZOA 2WLNA 3ZMTA 5LMUB 3N2KB 5KLVH 4O2BB 5KMGB 1K7DA 4LH6A 2JJ1G 3AG3C 2QKAA 4KFMA 4FZ0A 3TXSA 2W0XA 5EK0A 3BPZA 2UXNA 1NZ6A 2WAMA 4LC1A 2V4DA 1BZKA 5IYZA 3ZHVA 5B66Z 4EB6A 3VBBA 4O2AB 1SERA 1BT8A 3JATB 2QTSA 3JCUZ 4LF7O 4IIJA 1KYOF 1J5EB 3NXSA 4XDJA 5JH7B 1XNRB 1IX9A 4XBFA 2DN9A 2K1EA 2YIAA 1SA0B 4LNUB 2N04A 4X64O 2H3OA 1F4MA 2UXDO 2KG7A 2ITDC 1TGOA 4FLVA 4LF5B 1VQLV 1NR7A 4I9WA 1NH2B 2JDIG 2JIZG 4EEQA 2HJFC 5CBFA 1TUEB 1FAFA 4JI5B 1KUQA 2D2CB 3A0RA 1IBLO 4EFBA 1YJWV 3FX7A 1HWYA 1W59A 4KXRA 2ADPA 2ZD9A 4AHCA 1GN4A 3N2GB 4G28B 3ZMZA 1IURA 3RGBA 2X6CA 5KHHA 1FFXB 5KAFZ 4O4LA 5B1NA 4DV5B 4P30A 4LFAB 3B4SA 3FYEB 3CJHA 2ETNA 4LFBO 4J80A 3LNNA 2PTMA 2QKSA 2OTJV 3UKMA 4EFEA 4WCEV 1IXBA 3CCRV 1O9HA 2CTRA 3IGAC 2ZXWC 3G67A 3W7TA 2HJDA 3CRRA 3X2QB 5JVDA 3J80N 4JI1B 1S77D 3RW0A 4F6RB 4TV9A 3BFRA 3SPGA 4LF4O 1PM9A 1NTZH 1SS3A 4JAUA 4WBNA 3CCSV 1QHTA 5B1AC 1Q7YW 4YIOA 1N4CA 2QTOA 1E1RG 1IBKO 3ZRSA 1BHBA 2Y48A 1LUWA 1O9GA 2CUGA 4F6EA 1EZVH 2VS0A 4DK0A 1AR5A 2WLHA 1Y67A 1G4YB 2FKXA 5IYBO 2GUZB 1R3JC 3E89A 4KP4A 1COWG 2FMLA 4J7JA 4DUZO 4X1YA 1ROPA 3QO7A 4I9QA 1K5SA 2YEVA 1P84F 5LYJA 3TGUH 1GO3F 2AZ2A 4UCRA 2PUSA 2DYSC 2XNDG 2Q67A 1PL0A 5CA3A 1S5JA 1M57C 2LW7A 4CBCA 1YXBA 4IIJB 1NTKH 3CP1A 2WLJA 3OT7A 4JYYA 2E3CA 3LSSA 2PZSA 4FJCC 2WPDG 2YS8A 1FXKB 2ZE7A 3AEIA 2BSKA 2D3OW 1Z5WA 2XTAA 4H33A 3C3SA 2P4KA 4PA7A 4LF9O 1A32A 1F23A 5JCOC 2HR3A 2KG7B 2E5LO 4DR5O 4B3TO 4AILC 1FKAO 2Q73A 5C8YB 1OCCC 4P2ZA 4CS3A 4NXMB 4HNAB 3CEIA 3OTOO 1G6UA 1US6A 4FLXA 3IJ4A 4E4EA 2E76B 3I5DA 3M99B 4I0XA 2HVKC 3OTFA 4O4LB 4LF8O 3CCUV 2QM4A 3K58A 4DV7B 3JD0A 2B1IA 3K04A 1MOFA 2P4VA 4JGSA 2EULA 1EBOA 3P30A 3OGCC 4B7KA 4PDLA 4PJ0Z 1S5HC 1ZL8A 1YHQV 4JYCA 2QWQB 1K8AW 2QSAA 4FLUA 1PKXA 2NNUA 1XILA 4NKGB 2YC0A 2Z3YA 4TV8A 4MTGA 4WBNB 4PA4A 4GKJB 3OR7C 1QQCA 5JWPA 3W7UA 5J2TA 1P7GA 3FYIB 3ABLC 2CTQA 3T1CA 3J81N 2CGNA 4BAYA 4IL6Z 1XBLA 3CCVV 2CK3G 3HPLC 1YTFB 2F4VO 3C3TA 1SC5B 2ZM6B 1K5QA 1KP3A 1F4NA 3VQVA 4ZHQA 5JCOA 3OD4A 1D5AA 4DRXA 3ML0A 4X1YB 1K3EA 2YEVB 4X66B 5LYJB 4IHJB 1SZTA 1VF6A 4MVSA 4RO2A 5LMNO 4PA3A 2DYRC 4IGGA 4NYKA 4B3MB 1VMGA 5BMVB 4OPAA 3O9OA 2A7WA 2UUAB 4NXNB 2GBOA 1OJHA 1HR0O 4X64B 2OTLV 4NTXA 2P90A 2RN9A 2UXDB 5KA6A 2ODMA 1N36B 3B40A 2DW4A 4GX5A 4JV5B 4DV2O 1D5NA 1YZBA 3OUFA 3PN1A 4TOIA 3THOA 5A2QN 3ZRXA 4PELA 5J2UA 3ZMSA 2VQFB 1AP6A 2KSDA 2CGOA 3ZHTA 4JASA 5CBHA 3B77A 2WWWA 1NJIW 3WFVA 3CXHF 5FNVA 1QR9A 2YIBD 3FD9A 4X65O 3SJBC 1Z5VA 1JQ0A 2Q8VA 5KUKA 3OM3B 1Y74B 5KUMA 3F7VC 4LFBB 5LXTA 1B6QA 1QVGU 3ZEDA 4MVZA 4H44B 1R3KC 5L3BA 1M1KW 1R6KA 3CC2V 3AG4B 2Y69C 1KKCA 1KU9A 4F4LA 5BR8B 1FFTB 4TT3G 1NQTA 1AI7A 2CE4A 4X1KB 3M7MX 2OT5A 1Q86W 2OCHA 1IBKB 1XMQO 2QM8A 2EINC 1EN5A 3E86A 4I55B 4AQYB 1E79G 1PPJH 5F2VO 3EFFK 1SZXA 2HLDG 4GZRB 3ASOB 4JI3B 4TV8B 1EN4A 3CCQV 5IYDO 2GSMB 5LP6B 2UXBB 4JYAO 4DXWA 5JQGA 1PP9H 2UUCO 1Y6XA 2QE7G 3ZIAG 5IY5B 2JGUA 5EYPA 4WFBV 1NT2B 2ZNIA 2IW5A 5JJJB 1CXZB 2EIKB 4L8JA 3JD3A 3X2QC 4LFCB 5LGUA 4DRXB 3UO3A 1AVMA 2K9PA 1AJPA 3QG5A 3W7WA 5KHJA 4O4HA 1OCZC 1NU1H 3TETA 1JVMA 2ILMA 4DV6O 4LF9B 4O4IA 1WLEA 4PA6A 4CZZA 2P67A 4JPRA 1EZJA 4BWAA 1QU7A 1VQPV 1RPOA 1YDXA 1GAXA 2JRIA 1P7BA 4DW1A 1CP9A 3F5TA 3SPJA 3AG1B 5KX5B 2QWNB 1QR8A 4W4KA 5JJNB 1L1FA 2GTAA 4DK1A 3WB0A 3ZHQA 4JF3A 3UQ8A 1BS3A 1HNWB 3RWRD 3IC9A 4FIPC 3LSQA 5FNVB 4D7SA 1OZ0A 1R73A 5LGNA 2JGDB 1VQNV 4B3RO 1VEWA 1M56B 3G4SV 3ETQA 4WFFA 1Q5OA 1GK9A 3E8HA 2WLLA 5D5QA 5H2FZ 3RYHA 1FXKC 1Y4MA 4J41A 2LGWA 5EBMC 3JSLA 1T5EA 4QNHB 4JI0B 4NTYA 4YJ3B 4QJFB 1NVPB 1N34O 3RYCB 4DV0O 4KL1A 3E22A 4NVPA 2ZR2A 4FM0A 3H1LH 5LHIA 2BTOA 1XMOO 1FJGB 2QDOA 1K97A 4CS2A 3CCLV 3ETGA 4DV1B 3AG2C 4YY3O 3E2EA 4QE7A 2N05A 3GWOA 2FL4A 2HHHB 4B08A 3DXRB 4DR7O 1ZLZA 3E8BA 1IVSA 1SQPH 3C90A 4ZKIA 2DQ3A 3APQA 2F4VB 4FVMA 3T4ZA 1N8RW 3JD4A 1XEQA 2DMXA 2LFSA 3OAAG 1V54B 5B1BC 5J9PC 3CHXA 3ZHRA 4BR6A 4DR1O 2YI8A 1OCOB 4TUYB 3BABA 4CH4A 1EN6A 1HR0B 1UPGA 3ZHSA 3SPCA 2IU3A 3QO5A 2A9HA 1YSCA 4MTXA 1M90W 1OHHG 4DV2B 1QLEC 5CA0B 2JVDA 4KHPB 3A2FA 2F1MA 1NBMG 1IXMA 3VQXA 5IWAB 2BOCC 3L75H 4UB8Z 3ZBHA 2FB5A 1RSOB 1GRJA 2Q69A 4O4JA 1JCHA 1MA1A 3JARB 4WF9V 1DK1A 1Q90D 1WA8A 3F5WC 1L8DA 3OEHG 3ABMB 2UXCO 3JALB 3H1KH 4I50B 3HKBB 4QPKA 1MNGA 1EFRG 1XNQO 1I7FA 4H13B 2VQEB 4N21A 1M93A 3ASNB 3K5MA 1Y66A 3FB5C 2JK5C 5CBGA 3CE2A 4CH3A 5L3EA 4R8CA 1GN3A 5D5PA 2F23A 1H2KA 5EIBC 2HVJC 1FXVA 3LDEA 4HZ3A 1XDCA 1BL8A 1HW7A 1XL6A 4LH7A 3RYFB 1VQOV 4BW5A 3SJAC 1QNMA 4IT5A 4DUYB 1L0LH 4UVAA 2WLLB 2XAFA 2OCCC 5GTHZ 2NLJC 2YI9A 3RYHB 1PD3A 3ZMUA 1ZUQA 5LA6A 3AK3A 2BOBC 3EXAA 2Q7GA 4PV1B 3IAYA 4UFZA 2F66C 1KKDA 1JOYA 1TUBB 4DR6O 2AZ0A 2LW1A 1J95A 1VQ4V 4GX0A 4JZGA 1N0NA 1F51A 1WP8A 4UVBA 4HBNA 2L35A 5KHKA 1ZWIC 3WB1A 4JYAB 1GH6A 5FL7G 2UU9B 1LUVA 1ZTEA 4QIWF 4PDVA 3SYPA 5K1XA 2DWEC 1UFIA 1RM1B 1R3LC 3G80A 3AG7A 1E1QG 3OMIB 1W0KG 2YXHA 1PNLA 4RUEA 5LBQA 4MVRA 1MMMA 4D6TH 1VQ6V 5KHIA 1OCRC 5E1AC 4RAIA 4HYOA 2ZDIC 4JI7B 5IYZB 3A0BZ 1G1XB 4EB6B 2B1GA 1SQQH 3KKYA 4ZI7A 2QJ1A 3R65A 1IBMO 2R9AA 2YSUB 3K08A 3JAKA 4CC6A 4GUNA 4PI2A 2H8PC 4J9ZB 3MAQA 1XHZA 3B2EE 1VQ9V 1Q6UA 2PGGA 3M8AA 2XAQA 3H1JH 2PY5A 4X88A 1H8EG 5EIBD 1Q8IA 4DV4O 1JJOA 4CH5A 3ASOC 2EIJB 2P5OA 5B3SB 3T1HB 1MSDA 2EIMB 1K33A 4GKKO 3RN4A 5LP6C 1R3IC 1GN2A 2QR4A 3TCUA 2VWKA 3FB6C 3U11A 1WA8B 3FB7C 4I5SA 3H1IH 1SQFA 3LSUA 3BRCA 3TJTA 4UCSA 2RMKB 2R72A 2UXXA 2QEXV 1YF2A 1N33B 3RVZA 4MSWC 1KBHA 2ZCEA 1IDSA 2DOSA 2JEXA 2Q9LA 2Z0AA 5IJ0A 4OGQB 1K73W 4JI6O 4YJ2A 4YXWG 2JJ2G 1XMOB 3CJHB 3AK1A 3FFQA 3CC4V 2EJ7A 3AG3B 4MS2A 1AP5A 4TQDA 4TSFG 1SQVH 4MT8A 3CSXA 5JJEB 4B3SB 2IH3C 4YY3B 3P3PA 5LL6Y 1KQSU 5LA6B 5JVDB 2V7QG 3AG1C 4TV9B 4DYLA 4U3FH 2WA3A 1AROP 1AI5A 1DF4A 1V55C 1H38A 1OV9A 2CAZC 1AR4A 1SQBH 2QWRB 2X0LA 4Z2WA 1D2DA 3ZN1A 5IT9N 4DR1B 2HEPA 2Q0OC 4LF7B 3JAWA 2DQ0A 2EILC 1HNZO 4LWSA 2R9RB 5LOVA 1WN7A 3STZC 2RQ6A 3CRQA 2GHYA 3UCSC 3SYAA 1P49A 5A9GA 2NR5A 2ITCC 3B09A 3RYIA 3D36C 5HFLA 1MG1A 3ICXA 1FD9A 1QCEA 3L71H 4GYCB 2BSKB 2BTQA 2B9ZA 3K9SA 3BY6A 1J5EO 1YJNV 1HNXO 2Q6AA 4K8XA 1JPXA 4H0LB 5DN6G 4U3JA 2UUBO 1IBLB 3K0GA 4OPHA 2WLIA 4FK5C 4PD4F 2HP8A 3FKSG 1V54C 1H8HG 3BEHA 1SKVA 2ZXWB 3LUTB 2OIEA 3JSNA 2O57A 3E8GA 1K9MW 2YIBA 3CWBH 3SPIA 2A0LA 4EKWA 5CMUA 5H9CA 1WB8A 2N74A 5B1AB 2AHZA 1GM7A 1G8MA 4MVMA 1K92A 3B8NA 1BQZA 2FTKA 3CCMV 4I0XB 4JI5O 4JZ2A 4J42A 2DE0X 4QE9A 1Q82W 2LFRA 4K0KO 4LF4B 4X20A 4HAMA 5L3DA 4YJ2B 3G6EV 5BXZA 1NVPD 3CRAA 4CC5A 5K1PA 4DV5O 4LFAO 2DYSB 1JR9A 1TVKA 5IJ9A 1S5LZ 1PNMA 2OYQA 1ZL8B 1VQ7V 3K79A 2BE3A 3W7XA 2IM9A 4MVQA 1F7YA 5KAIZ 1RFYA 4XDKA 5EC2C 1I94O 4WFHA 4DUZB 3D3IA 5J2TB 2QGNA 5KHGA 3N2KA 3SGIA 4O2BA 5KMGA 2LGQA 2MK3A 1IZ3A 5LHHA 4RQFA 3CPWU 4QPJA 1VQMV 4A5UB 2ZKOA 4ZHQB 2ZE5A 3I55V 2YIDA 1ZAUA 2C2AA 3HR0A 2HFEC 3ABTA 3D3QA 3E35A 3JATA 3T1YO 1OCCB 4DV4B 1KD1W 2CH7A 4UB6Z 3S3XA 1N0JA 5KA5A 1YVWA 2PYJA 2B5UA 1SESA 3RYIB 5L3GA 1WB7A 3SDLA 2E5LB 4DR5B 4B3TB 4P9OA 1CPYA 1SA0A 3L72H 3SYQA 3CB2A 4DO2A 1SRYA 1RM1C 1Q6IA 1KMIZ 4FLZA 2EBOA 2Q7HA 3BHPA 5BR8O 4JI2O 1MABG 3K9AA 5J2UB 3U0ZA 4ZOLA 2Y4UA 2IU0A 3OTOB 1URFA 3ETDA 1FYJA 3H1HH 4U3JB 5H5NA 5IYCO 1NH2D 5GONA 4P9PA 4DR3O 1BSMA 2ZR3A 1Q81W 2Q5ZA 4MW8A 1VF7A 5H6QA 3G6BA 4J11A 3ZS8C 4LF8B 4JI6B 3N2GA 3WU2Z 2EJRA 4FFBA 3RFRA 5LXTB 1K34A 5EBLC 2PF4E 4D7TA 3ABLB 2LO1A 3CRMA 2Z5UA 4NXMO 4JAAA 4DW0A 4X9QA 1ZSPA 3VOUA 1AJQA 1FPOA 2ZQMA 2RNBA 3OMAB 3I56V 5ITZA 3SPHA 4CH6A 3DTUB 1SQGA 1QLNA 2DYRB 1WJZA 5IJ9B 2LJ2A 3DC6A 5L3CA 4MTOA 3L70H 4DV7O 1N32O 4FLYA 2AGAA 1TAEA 4OX9O 3ZRWA 1K4CC 4Z1VA 1BMFG 3CYOA 4X89A 5LMNB 2GUZA 1AI6A 5JQGB 4K8ZA 4MVOA 3WG7B 3QTCA 2XHBA 3H01A 4WFAV 2ZT9B 4GKJO 5EYPB 3TXQA 3TK1A 3SR2C 2HG5C 2XOKG 4X62O 3O65A 1WNSA 2KKWA 2ZNJA 1TA8A 4H37A 1LNQA 3RBZA 5IDJA 3ABKB 1AR1B 1VARA 3SYCA 2ZM6O 4RQEA 4O4HB 1HNXB 2CH7B 3ETEA 3SYOA 1FXKA 2BCCH 3S3WA 4O4IB 2UUBB 4X66O 3JD1A 2XT9A 4B3MO 2JS3A 2UUAO 4NXNO 4FLTA 1XUQA 3KCYA 2QWPB 4Q6GA 4UXNA 2ZE8A 4X65B 2Y69B 1XL4A 5DM6V 1N36O 3UM7A 2W6JG 4ZOLB 2YXLA 4JV5O 4I4TA 5GONB 5C8YA 4UCOA 4DR4O 1B04A 2EZPA 2EINB 4HNAA 2VQFO 2IJIA 4FZ1A 2H94A 5FPOA 1V9PA 2A3QA 4K0KB 2IJHA 3N27A 1WAZA 1Y76A 3K06A 2OWOA 4JAVA 4PDRA 3E8FA 4IYHA 4FFBB 1VQ5V 5E79Z 5CA1A 3QNEA 2F93B 1XMQB 4ZIBA 3ABUA 1I0HA 3E22B 3QF7A 1SETA 2AXTZ 3GVMA 1K4DC 2XUMA 3P32A 1CEZA 5CB4A 1H2NA 1KECA 1PV0A 1PNKA 3CXCU 3NR7A 4J9YB 5LHGA 3P3NA 1ZX3A 1I5YA 1I94B 5ITZB 3K3WA 4MW3A 4ABMA 4XDLA 3KG2A 4K35A
chains in the Genus database with same CATH topology
1IBMO 4JI5O 4LF6O 5LMNO 5IWAO 1FYJA 5H5NA 2E5LO 4LFBO 4K0KO 4DR5O 4B3TO 2UXCO 4DR3O 4YHHO 4OPAA 1N34O 1FKAO 1D2DA 2ZM6O 4DV0O 3M8AA 1HR0O 1XNQO 4JI7O 5BXZA 5IT9N 4LF5O 1XMOO 4JYAO 4DV4O 4AQYO 3J80N 4DV5O 4X66O 4LFAO 1HNZO 3OTOO 2UUCO 4DV2O 4YY3O 4JI0O 1YZBA 5BY1A 4JI3O 4B3MO 4LF4O 4JI8O 4GKKO 2UUAO 4NXNO 2DJVA 5A2QN 4DR7O 2UXBO 2VQEO 1F7YA 1NS1A 5FLXN 4LF7O 1FJGO 1IBKO 4NXMO 1I94O 4LF8O 1N36O 4JV5O 4DV1O 1AB3A 3T1HO 3J7AU 4DR4O 2HHHO 1XEQA 2FKXA 4DR2O 4DV6O 4X65O 2VQFO 5LMUO 4DV3O 1R1BA 4LFCO 4DUYO 3JAMN 4X64O 1J5EO 4A5UB 1HNXO 4DR6O 4DUZO 4DR1O 2ZKOA 2DOSA 2JRIA 2UXDO 2Z0AA 2UUBO 4JI1O 4OPHA 4JI6O 3F5TA 4DV7O 1N32O 3T1YO 2AGAA 2LW7A 4OX9O 1X59A 1N33O 3RT3C 1R6TA 3J81N 5LL6Y 4JI4O 1KUQA 3SDLA 1IBLO 2F4VO 1AILA 2N74A 2UU9O 4GKJO 1DK1A 1XNRO 4B3RO 1XMQO 3R66A 1G1XB 4X62O 4B3SO 3O65A 4JI2O 4LF9O 1HNWO 1A32A 4KHPO 5BR8O
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1IBM O;  4JI5 O;  4LF6 O;  5LMN O;  5IWA O;  1FYJ A;  5H5N A;  2E5L O;  4LFB O;  4K0K O;  4DR5 O;  4B3T O;  2UXC O;  4DR3 O;  4YHH O;  4OPA A;  1N34 O;  1FKA O;  1D2D A;  2ZM6 O;  4DV0 O;  3M8A A;  1HR0 O;  1XNQ O;  4JI7 O;  5BXZ A;  5IT9 N;  4LF5 O;  1XMO O;  4JYA O;  4DV4 O;  4AQY O;  3J80 N;  4DV5 O;  4X66 O;  4LFA O;  1HNZ O;  3OTO O;  2UUC O;  4DV2 O;  4YY3 O;  4JI0 O;  1YZB A;  5BY1 A;  4JI3 O;  4B3M O;  4LF4 O;  4JI8 O;  4GKK O;  2UUA O;  4NXN O;  2DJV A;  5A2Q N;  4DR7 O;  2UXB O;  2VQE O;  1F7Y A;  1NS1 A;  5FLX N;  4LF7 O;  1FJG O;  1IBK O;  4NXM O;  1I94 O;  4LF8 O;  1N36 O;  4JV5 O;  4DV1 O;  1AB3 A;  3T1H O;  3J7A U;  4DR4 O;  2HHH O;  1XEQ A;  2FKX A;  4DR2 O;  4DV6 O;  4X65 O;  2VQF O;  5LMU O;  4DV3 O;  1R1B A;  4LFC O;  4DUY O;  3JAM N;  4X64 O;  1J5E O;  4A5U B;  1HNX O;  4DR6 O;  4DUZ O;  4DR1 O;  2ZKO A;  2DOS A;  2JRI A;  2UXD O;  2Z0A A;  2UUB O;  4JI1 O;  4OPH A;  4JI6 O;  3F5T A;  4DV7 O;  1N32 O;  3T1Y O;  2AGA A;  2LW7 A;  4OX9 O;  1X59 A;  1N33 O;  3RT3 C;  1R6T A;  3J81 N;  5LL6 Y;  4JI4 O;  1KUQ A;  3SDL A;  1IBL O;  2F4V O;  1AIL A;  2N74 A;  2UU9 O;  4GKJ O;  1DK1 A;  1XNR O;  4B3R O;  1XMQ O;  3R66 A;  1G1X B;  4X62 O;  4B3S O;  3O65 A;  4JI2 O;  4LF9 O;  1HNW O;  1A32 A;  4KHP O;  5BR8 O; 
#chains in the Genus database with same CATH topology
 2A06 H;  4FLW A;  2CDY A;  3K0D A;  1OCZ B;  2WA4 A;  3W7S A;  2UUC B;  5C93 A;  3MD0 A;  3K5N A;  2AW9 A;  4BIU A;  3ZRW B;  1YJ9 V;  4ASU G;  1Z2G A;  4U7N A;  3CCE V;  1YTF D;  4AQY O;  3AG4 C;  3BA8 A;  1I08 A;  3MHH C;  3ZN0 A;  3WB2 A;  5DEC A;  3SJC C;  4L87 A;  1LR1 A;  1WPB A;  3T1Y B;  4JI3 O;  2QKC A;  1BHA A;  1YEW A;  4G2K A;  2E74 B;  2AHY A;  4DV6 B;  5CN0 A;  2KQX A;  2UXB O;  4UCT A;  4J7K A;  2XAJ A;  1M9N A;  4IHJ A;  3OE7 G;  2R9I A;  1SF9 A;  5BMV A;  1BQ0 A;  2GDS A;  2ZE6 A;  3J7A U;  3T2M A;  4OXS A;  2Y4T A;  2PI4 A;  1WP7 A;  4DR2 O;  4JI2 B;  4O4J B;  3OW2 U;  4DV3 O;  4K3A A;  4LFC O;  2G38 A;  2P7T C;  1XI1 A;  2WLK A;  3QO8 A;  1Q6H A;  4DR3 B;  4ZBM A;  3VQW A;  1KB9 F;  1QVF U;  2P6J A;  3K5L A;  3UO2 A;  5IY5 C;  2ZIO A;  2VWJ A;  2GTS A;  3MHS C;  4B3R B;  5EZY A;  1GN6 A;  3MDS A;  2EIK C;  3ZRV A;  2PYL A;  1U97 A;  1EM1 A;  2LQT A;  3U10 A;  2HKO A;  5HFM A;  1DGS A;  3AG2 B;  4JI4 O;  3IFX A;  4TQF A;  4Z1M G;  4R6Z A;  1I5X A;  4I4T B;  1VF6 C;  3BVO A;  4UV9 A;  4NR1 A;  4GT1 A;  1N34 B;  1VQ8 V;  4B7E A;  4DV0 B;  1Y74 A;  1S76 D;  1NR1 A;  4NB5 A;  4UCU A;  1YI2 V;  1GM8 A;  1HNW O;  3HKD A;  1GM9 A;  1BE3 H;  3K5O A;  1Y76 B;  4LCU C;  4LF6 O;  4FPP A;  3JYC A;  3CCJ V;  3EVK A;  1VQK V;  4YHH O;  5CA1 B;  2ZDI A;  1HDJ A;  4G27 B;  5B1B B;  2ZIN A;  4DR7 B;  4AI8 A;  4JTC B;  1M5I A;  4JTA B;  2YDE A;  3CX5 F;  3HKC A;  4MTF A;  4X1K A;  5CB4 B;  1YIT V;  3OEE G;  1N32 B;  4JI0 O;  1NI8 A;  3KCX A;  4GX1 A;  4R50 A;  4OX9 B;  4JI8 O;  3L74 H;  4UUJ C;  1FXH A;  4RUF A;  1UJW B;  2IJK A;  4I55 A;  5BZB A;  1QLE B;  2XAS A;  1M56 C;  4LP8 A;  2QA4 V;  1FJG O;  2F43 G;  2GV9 A;  2Y0P A;  2Y0I A;  2YUA A;  1VF5 B;  2XAG A;  1AB3 A;  1VIB A;  5H6R A;  4DV1 O;  3A0H Z;  2ZIM A;  1JFF A;  2W6I G;  1XQ8 A;  5LP6 A;  2HHH O;  2JS5 A;  2KB1 A;  3OUS A;  4X62 B;  4RWU A;  5LMU O;  1YCI A;  2M7W A;  1XHX A;  2DWD C;  3OGI B;  2YXY A;  1H2G A;  1JA8 A;  3L9D A;  5GW7 A;  4WFE A;  4ZI7 B;  2WSS G;  3FB8 C;  5FPR A;  2RDC A;  3T4D A;  3JD2 A;  2L6L A;  3JAK B;  1ORQ C;  2Q4P A;  2P06 A;  4CS4 A;  3APO A;  3RT3 C;  3HB3 B;  2RJZ A;  2CTP A;  4GCZ A;  3HKE A;  4J7Z A;  3ZMV A;  1FS0 G;  4PI0 A;  3CD6 V;  1M4U A;  1WPX A;  2UXC B;  5GTI Z;  1AIL A;  3CME V;  5L3F A;  1KP2 A;  3DGE A;  1XNR O;  1XNQ B;  1AJN A;  2OCC B;  3Q4H A;  3R66 A;  2X7R B;  2M6Y A;  1ENV A;  4PA9 A;  4KHP O;  3JCZ A;  3BAA A;  4QGP A;  2QWO B;  2Q0A A;  3OMN B;  4DR4 B;  3ZCC A;  5IWA O;  5KX5 A;  4FFK A;  3ZJZ A;  5B1O A;  1OCO C;  1MZF A;  3WG7 C;  1GTO A;  1HP8 A;  2IH1 C;  3K59 A;  1NTM H;  3DSQ A;  5EZY B;  4LF5 O;  2P22 C;  3JAS A;  1Q3E A;  4Q20 A;  2RCV A;  3DC5 A;  1BCC H;  1W2B U;  1KC8 W;  3F7Y C;  2JGD A;  3ABK C;  5BY1 A;  4UV8 A;  5IE9 A;  4YIP A;  2LP7 A;  5IJ0 B;  2VQE O;  3QVN A;  1NS1 A;  2ATK C;  5FLX N;  3FAV A;  3HKD B;  4DR6 B;  1GKF A;  4YJ3 A;  3UT5 A;  3RYC A;  1S72 V;  5EBW C;  1OCR B;  3ABM C;  2W0F C;  4X1I A;  2YIC A;  3ZHU A;  4LR3 A;  1M57 B;  2V1D A;  4GLX A;  3LDC A;  4DUY O;  5TIS Z;  3JAM N;  3K03 A;  1PL4 A;  1JJ2 U;  4W4L A;  3ASN C;  3KZI Z;  2QM7 A;  3HKC B;  4MVU A;  2Q7E A;  4KUM A;  2XAH A;  3BA9 A;  3D36 A;  4NTW A;  4IYI A;  2WLM A;  4JI1 O;  3DXR A;  1S3J A;  1XOU A;  1H2L A;  3CMA V;  5AG2 A;  1X59 A;  2OIG A;  3VQY A;  2ARH A;  1SQX H;  3CS5 A;  1JMK C;  4N23 A;  3H9V A;  4PHZ A;  4PDM A;  4WFG A;  4BW9 A;  1IBM B;  3A8T A;  4J10 A;  3JAW B;  3GWK C;  2IBZ H;  1JFF B;  4LWS B;  2VRZ A;  5LOV B;  1W0J G;  2UU9 O;  4O2A A;  4BIZ A;  2Q68 A;  4TUY A;  3D8C A;  3B8M A;  5LGT A;  5B5E Z;  4DR2 B;  5JH7 A;  2E75 B;  1QBZ A;  4DV3 B;  1H2M A;  1U96 A;  4GKK B;  3L73 H;  4JI7 O;  1P4R A;  2ADQ B;  5CA0 A;  4LNU A;  1XRE A;  3PJS K;  5EC1 C;  1DF5 A;  1DLB A;  1NKD A;  2BTQ B;  1RP3 B;  4U7O A;  1RSO A;  3HKE B;  3K57 A;  4JTD B;  4BIO A;  3OFN G;  3JAR A;  4E2L A;  1X4T A;  1MZE A;  1RPR A;  5DED A;  2X6A A;  2DJV A;  4R7C A;  1AI4 A;  3ZX6 A;  1H2S B;  2WLI B;  1B3Q A;  4JI4 B;  3Q4H B;  2FYU H;  2PI5 A;  4UCV A;  2A79 B;  4C7U A;  2CTW A;  3JAL A;  3IC7 A;  3T1H O;  4I50 A;  3HKB A;  1GMG A;  4FMT A;  4UVC A;  2EX3 A;  2F95 B;  4GX2 A;  3STL C;  4TWK A;  1R1B A;  3JAS B;  1V55 B;  2X6B A;  4LF6 B;  1FFX A;  3LNM B;  2JEU A;  2R70 A;  4YHH B;  1MSW D;  3RVY A;  2EIJ C;  3EHB B;  3AK2 A;  4LBE C;  5B3S C;  3RYF A;  4FM2 A;  1VP7 A;  2EIM C;  3CRC A;  4X8A A;  4X20 B;  1N33 O;  3FAV B;  1BGY H;  1R6T A;  1Q43 A;  2EIL B;  2NN4 A;  3UT5 B;  4FM1 A;  4JI8 B;  4F6R A;  1S0V A;  1YIJ V;  1THZ A;  1B06 A;  1TVK B;  3SJQ C;  4X1I B;  1TUB A;  2MW2 B;  4I7Z B;  3E83 A;  3BCC H;  3G71 V;  3CC7 V;  4B3S O;  1DTO A;  4JYB A;  1L0N H;  3GB7 C;  3OR6 C;  1HNZ B;  1R6N A;  2IJJ A;  1JX9 A;  3LDD A;  4ICG A;  2EZO A;  2WLN A;  3ZMT A;  5LMU B;  3N2K B;  5KLV H;  4O2B B;  5KMG B;  1K7D A;  4LH6 A;  2JJ1 G;  3AG3 C;  2QKA A;  4KFM A;  4FZ0 A;  3TXS A;  2W0X A;  5EK0 A;  3BPZ A;  2UXN A;  1NZ6 A;  2WAM A;  4LC1 A;  2V4D A;  1BZK A;  5IYZ A;  3ZHV A;  5B66 Z;  4EB6 A;  3VBB A;  4O2A B;  1SER A;  1BT8 A;  3JAT B;  2QTS A;  3JCU Z;  4LF7 O;  4IIJ A;  1KYO F;  1J5E B;  3NXS A;  4XDJ A;  5JH7 B;  1XNR B;  1IX9 A;  4XBF A;  2DN9 A;  2K1E A;  2YIA A;  1SA0 B;  4LNU B;  2N04 A;  4X64 O;  2H3O A;  1F4M A;  2UXD O;  2KG7 A;  2ITD C;  1TGO A;  4FLV A;  4LF5 B;  1VQL V;  1NR7 A;  4I9W A;  1NH2 B;  2JDI G;  2JIZ G;  4EEQ A;  2HJF C;  5CBF A;  1TUE B;  1FAF A;  4JI5 B;  1KUQ A;  2D2C B;  3A0R A;  1IBL O;  4EFB A;  1YJW V;  3FX7 A;  1HWY A;  1W59 A;  4KXR A;  2ADP A;  2ZD9 A;  4AHC A;  1GN4 A;  3N2G B;  4G28 B;  3ZMZ A;  1IUR A;  3RGB A;  2X6C A;  5KHH A;  1FFX B;  5KAF Z;  4O4L A;  5B1N A;  4DV5 B;  4P30 A;  4LFA B;  3B4S A;  3FYE B;  3CJH A;  2ETN A;  4LFB O;  4J80 A;  3LNN A;  2PTM A;  2QKS A;  2OTJ V;  3UKM A;  4EFE A;  4WCE V;  1IXB A;  3CCR V;  1O9H A;  2CTR A;  3IGA C;  2ZXW C;  3G67 A;  3W7T A;  2HJD A;  3CRR A;  3X2Q B;  5JVD A;  3J80 N;  4JI1 B;  1S77 D;  3RW0 A;  4F6R B;  4TV9 A;  3BFR A;  3SPG A;  4LF4 O;  1PM9 A;  1NTZ H;  1SS3 A;  4JAU A;  4WBN A;  3CCS V;  1QHT A;  5B1A C;  1Q7Y W;  4YIO A;  1N4C A;  2QTO A;  1E1R G;  1IBK O;  3ZRS A;  1BHB A;  2Y48 A;  1LUW A;  1O9G A;  2CUG A;  4F6E A;  1EZV H;  2VS0 A;  4DK0 A;  1AR5 A;  2WLH A;  1Y67 A;  1G4Y B;  2FKX A;  5IYB O;  2GUZ B;  1R3J C;  3E89 A;  4KP4 A;  1COW G;  2FML A;  4J7J A;  4DUZ O;  4X1Y A;  1ROP A;  3QO7 A;  4I9Q A;  1K5S A;  2YEV A;  1P84 F;  5LYJ A;  3TGU H;  1GO3 F;  2AZ2 A;  4UCR A;  2PUS A;  2DYS C;  2XND G;  2Q67 A;  1PL0 A;  5CA3 A;  1S5J A;  1M57 C;  2LW7 A;  4CBC A;  1YXB A;  4IIJ B;  1NTK H;  3CP1 A;  2WLJ A;  3OT7 A;  4JYY A;  2E3C A;  3LSS A;  2PZS A;  4FJC C;  2WPD G;  2YS8 A;  1FXK B;  2ZE7 A;  3AEI A;  2BSK A;  2D3O W;  1Z5W A;  2XTA A;  4H33 A;  3C3S A;  2P4K A;  4PA7 A;  4LF9 O;  1A32 A;  1F23 A;  5JCO C;  2HR3 A;  2KG7 B;  2E5L O;  4DR5 O;  4B3T O;  4AIL C;  1FKA O;  2Q73 A;  5C8Y B;  1OCC C;  4P2Z A;  4CS3 A;  4NXM B;  4HNA B;  3CEI A;  3OTO O;  1G6U A;  1US6 A;  4FLX A;  3IJ4 A;  4E4E A;  2E76 B;  3I5D A;  3M99 B;  4I0X A;  2HVK C;  3OTF A;  4O4L B;  4LF8 O;  3CCU V;  2QM4 A;  3K58 A;  4DV7 B;  3JD0 A;  2B1I A;  3K04 A;  1MOF A;  2P4V A;  4JGS A;  2EUL A;  1EBO A;  3P30 A;  3OGC C;  4B7K A;  4PDL A;  4PJ0 Z;  1S5H C;  1ZL8 A;  1YHQ V;  4JYC A;  2QWQ B;  1K8A W;  2QSA A;  4FLU A;  1PKX A;  2NNU A;  1XIL A;  4NKG B;  2YC0 A;  2Z3Y A;  4TV8 A;  4MTG A;  4WBN B;  4PA4 A;  4GKJ B;  3OR7 C;  1QQC A;  5JWP A;  3W7U A;  5J2T A;  1P7G A;  3FYI B;  3ABL C;  2CTQ A;  3T1C A;  3J81 N;  2CGN A;  4BAY A;  4IL6 Z;  1XBL A;  3CCV V;  2CK3 G;  3HPL C;  1YTF B;  2F4V O;  3C3T A;  1SC5 B;  2ZM6 B;  1K5Q A;  1KP3 A;  1F4N A;  3VQV A;  4ZHQ A;  5JCO A;  3OD4 A;  1D5A A;  4DRX A;  3ML0 A;  4X1Y B;  1K3E A;  2YEV B;  4X66 B;  5LYJ B;  4IHJ B;  1SZT A;  1VF6 A;  4MVS A;  4RO2 A;  5LMN O;  4PA3 A;  2DYR C;  4IGG A;  4NYK A;  4B3M B;  1VMG A;  5BMV B;  4OPA A;  3O9O A;  2A7W A;  2UUA B;  4NXN B;  2GBO A;  1OJH A;  1HR0 O;  4X64 B;  2OTL V;  4NTX A;  2P90 A;  2RN9 A;  2UXD B;  5KA6 A;  2ODM A;  1N36 B;  3B40 A;  2DW4 A;  4GX5 A;  4JV5 B;  4DV2 O;  1D5N A;  1YZB A;  3OUF A;  3PN1 A;  4TOI A;  3THO A;  5A2Q N;  3ZRX A;  4PEL A;  5J2U A;  3ZMS A;  2VQF B;  1AP6 A;  2KSD A;  2CGO A;  3ZHT A;  4JAS A;  5CBH A;  3B77 A;  2WWW A;  1NJI W;  3WFV A;  3CXH F;  5FNV A;  1QR9 A;  2YIB D;  3FD9 A;  4X65 O;  3SJB C;  1Z5V A;  1JQ0 A;  2Q8V A;  5KUK A;  3OM3 B;  1Y74 B;  5KUM A;  3F7V C;  4LFB B;  5LXT A;  1B6Q A;  1QVG U;  3ZED A;  4MVZ A;  4H44 B;  1R3K C;  5L3B A;  1M1K W;  1R6K A;  3CC2 V;  3AG4 B;  2Y69 C;  1KKC A;  1KU9 A;  4F4L A;  5BR8 B;  1FFT B;  4TT3 G;  1NQT A;  1AI7 A;  2CE4 A;  4X1K B;  3M7M X;  2OT5 A;  1Q86 W;  2OCH A;  1IBK B;  1XMQ O;  2QM8 A;  2EIN C;  1EN5 A;  3E86 A;  4I55 B;  4AQY B;  1E79 G;  1PPJ H;  5F2V O;  3EFF K;  1SZX A;  2HLD G;  4GZR B;  3ASO B;  4JI3 B;  4TV8 B;  1EN4 A;  3CCQ V;  5IYD O;  2GSM B;  5LP6 B;  2UXB B;  4JYA O;  4DXW A;  5JQG A;  1PP9 H;  2UUC O;  1Y6X A;  2QE7 G;  3ZIA G;  5IY5 B;  2JGU A;  5EYP A;  4WFB V;  1NT2 B;  2ZNI A;  2IW5 A;  5JJJ B;  1CXZ B;  2EIK B;  4L8J A;  3JD3 A;  3X2Q C;  4LFC B;  5LGU A;  4DRX B;  3UO3 A;  1AVM A;  2K9P A;  1AJP A;  3QG5 A;  3W7W A;  5KHJ A;  4O4H A;  1OCZ C;  1NU1 H;  3TET A;  1JVM A;  2ILM A;  4DV6 O;  4LF9 B;  4O4I A;  1WLE A;  4PA6 A;  4CZZ A;  2P67 A;  4JPR A;  1EZJ A;  4BWA A;  1QU7 A;  1VQP V;  1RPO A;  1YDX A;  1GAX A;  2JRI A;  1P7B A;  4DW1 A;  1CP9 A;  3F5T A;  3SPJ A;  3AG1 B;  5KX5 B;  2QWN B;  1QR8 A;  4W4K A;  5JJN B;  1L1F A;  2GTA A;  4DK1 A;  3WB0 A;  3ZHQ A;  4JF3 A;  3UQ8 A;  1BS3 A;  1HNW B;  3RWR D;  3IC9 A;  4FIP C;  3LSQ A;  5FNV B;  4D7S A;  1OZ0 A;  1R73 A;  5LGN A;  2JGD B;  1VQN V;  4B3R O;  1VEW A;  1M56 B;  3G4S V;  3ETQ A;  4WFF A;  1Q5O A;  1GK9 A;  3E8H A;  2WLL A;  5D5Q A;  5H2F Z;  3RYH A;  1FXK C;  1Y4M A;  4J41 A;  2LGW A;  5EBM C;  3JSL A;  1T5E A;  4QNH B;  4JI0 B;  4NTY A;  4YJ3 B;  4QJF B;  1NVP B;  1N34 O;  3RYC B;  4DV0 O;  4KL1 A;  3E22 A;  4NVP A;  2ZR2 A;  4FM0 A;  3H1L H;  5LHI A;  2BTO A;  1XMO O;  1FJG B;  2QDO A;  1K97 A;  4CS2 A;  3CCL V;  3ETG A;  4DV1 B;  3AG2 C;  4YY3 O;  3E2E A;  4QE7 A;  2N05 A;  3GWO A;  2FL4 A;  2HHH B;  4B08 A;  3DXR B;  4DR7 O;  1ZLZ A;  3E8B A;  1IVS A;  1SQP H;  3C90 A;  4ZKI A;  2DQ3 A;  3APQ A;  2F4V B;  4FVM A;  3T4Z A;  1N8R W;  3JD4 A;  1XEQ A;  2DMX A;  2LFS A;  3OAA G;  1V54 B;  5B1B C;  5J9P C;  3CHX A;  3ZHR A;  4BR6 A;  4DR1 O;  2YI8 A;  1OCO B;  4TUY B;  3BAB A;  4CH4 A;  1EN6 A;  1HR0 B;  1UPG A;  3ZHS A;  3SPC A;  2IU3 A;  3QO5 A;  2A9H A;  1YSC A;  4MTX A;  1M90 W;  1OHH G;  4DV2 B;  1QLE C;  5CA0 B;  2JVD A;  4KHP B;  3A2F A;  2F1M A;  1NBM G;  1IXM A;  3VQX A;  5IWA B;  2BOC C;  3L75 H;  4UB8 Z;  3ZBH A;  2FB5 A;  1RSO B;  1GRJ A;  2Q69 A;  4O4J A;  1JCH A;  1MA1 A;  3JAR B;  4WF9 V;  1DK1 A;  1Q90 D;  1WA8 A;  3F5W C;  1L8D A;  3OEH G;  3ABM B;  2UXC O;  3JAL B;  3H1K H;  4I50 B;  3HKB B;  4QPK A;  1MNG A;  1EFR G;  1XNQ O;  1I7F A;  4H13 B;  2VQE B;  4N21 A;  1M93 A;  3ASN B;  3K5M A;  1Y66 A;  3FB5 C;  2JK5 C;  5CBG A;  3CE2 A;  4CH3 A;  5L3E A;  4R8C A;  1GN3 A;  5D5P A;  2F23 A;  1H2K A;  5EIB C;  2HVJ C;  1FXV A;  3LDE A;  4HZ3 A;  1XDC A;  1BL8 A;  1HW7 A;  1XL6 A;  4LH7 A;  3RYF B;  1VQO V;  4BW5 A;  3SJA C;  1QNM A;  4IT5 A;  4DUY B;  1L0L H;  4UVA A;  2WLL B;  2XAF A;  2OCC C;  5GTH Z;  2NLJ C;  2YI9 A;  3RYH B;  1PD3 A;  3ZMU A;  1ZUQ A;  5LA6 A;  3AK3 A;  2BOB C;  3EXA A;  2Q7G A;  4PV1 B;  3IAY A;  4UFZ A;  2F66 C;  1KKD A;  1JOY A;  1TUB B;  4DR6 O;  2AZ0 A;  2LW1 A;  1J95 A;  1VQ4 V;  4GX0 A;  4JZG A;  1N0N A;  1F51 A;  1WP8 A;  4UVB A;  4HBN A;  2L35 A;  5KHK A;  1ZWI C;  3WB1 A;  4JYA B;  1GH6 A;  5FL7 G;  2UU9 B;  1LUV A;  1ZTE A;  4QIW F;  4PDV A;  3SYP A;  5K1X A;  2DWE C;  1UFI A;  1RM1 B;  1R3L C;  3G80 A;  3AG7 A;  1E1Q G;  3OMI B;  1W0K G;  2YXH A;  1PNL A;  4RUE A;  5LBQ A;  4MVR A;  1MMM A;  4D6T H;  1VQ6 V;  5KHI A;  1OCR C;  5E1A C;  4RAI A;  4HYO A;  2ZDI C;  4JI7 B;  5IYZ B;  3A0B Z;  1G1X B;  4EB6 B;  2B1G A;  1SQQ H;  3KKY A;  4ZI7 A;  2QJ1 A;  3R65 A;  1IBM O;  2R9A A;  2YSU B;  3K08 A;  3JAK A;  4CC6 A;  4GUN A;  4PI2 A;  2H8P C;  4J9Z B;  3MAQ A;  1XHZ A;  3B2E E;  1VQ9 V;  1Q6U A;  2PGG A;  3M8A A;  2XAQ A;  3H1J H;  2PY5 A;  4X88 A;  1H8E G;  5EIB D;  1Q8I A;  4DV4 O;  1JJO A;  4CH5 A;  3ASO C;  2EIJ B;  2P5O A;  5B3S B;  3T1H B;  1MSD A;  2EIM B;  1K33 A;  4GKK O;  3RN4 A;  5LP6 C;  1R3I C;  1GN2 A;  2QR4 A;  3TCU A;  2VWK A;  3FB6 C;  3U11 A;  1WA8 B;  3FB7 C;  4I5S A;  3H1I H;  1SQF A;  3LSU A;  3BRC A;  3TJT A;  4UCS A;  2RMK B;  2R72 A;  2UXX A;  2QEX V;  1YF2 A;  1N33 B;  3RVZ A;  4MSW C;  1KBH A;  2ZCE A;  1IDS A;  2DOS A;  2JEX A;  2Q9L A;  2Z0A A;  5IJ0 A;  4OGQ B;  1K73 W;  4JI6 O;  4YJ2 A;  4YXW G;  2JJ2 G;  1XMO B;  3CJH B;  3AK1 A;  3FFQ A;  3CC4 V;  2EJ7 A;  3AG3 B;  4MS2 A;  1AP5 A;  4TQD A;  4TSF G;  1SQV H;  4MT8 A;  3CSX A;  5JJE B;  4B3S B;  2IH3 C;  4YY3 B;  3P3P A;  5LL6 Y;  1KQS U;  5LA6 B;  5JVD B;  2V7Q G;  3AG1 C;  4TV9 B;  4DYL A;  4U3F H;  2WA3 A;  1ARO P;  1AI5 A;  1DF4 A;  1V55 C;  1H38 A;  1OV9 A;  2CAZ C;  1AR4 A;  1SQB H;  2QWR B;  2X0L A;  4Z2W A;  1D2D A;  3ZN1 A;  5IT9 N;  4DR1 B;  2HEP A;  2Q0O C;  4LF7 B;  3JAW A;  2DQ0 A;  2EIL C;  1HNZ O;  4LWS A;  2R9R B;  5LOV A;  1WN7 A;  3STZ C;  2RQ6 A;  3CRQ A;  2GHY A;  3UCS C;  3SYA A;  1P49 A;  5A9G A;  2NR5 A;  2ITC C;  3B09 A;  3RYI A;  3D36 C;  5HFL A;  1MG1 A;  3ICX A;  1FD9 A;  1QCE A;  3L71 H;  4GYC B;  2BSK B;  2BTQ A;  2B9Z A;  3K9S A;  3BY6 A;  1J5E O;  1YJN V;  1HNX O;  2Q6A A;  4K8X A;  1JPX A;  4H0L B;  5DN6 G;  4U3J A;  2UUB O;  1IBL B;  3K0G A;  4OPH A;  2WLI A;  4FK5 C;  4PD4 F;  2HP8 A;  3FKS G;  1V54 C;  1H8H G;  3BEH A;  1SKV A;  2ZXW B;  3LUT B;  2OIE A;  3JSN A;  2O57 A;  3E8G A;  1K9M W;  2YIB A;  3CWB H;  3SPI A;  2A0L A;  4EKW A;  5CMU A;  5H9C A;  1WB8 A;  2N74 A;  5B1A B;  2AHZ A;  1GM7 A;  1G8M A;  4MVM A;  1K92 A;  3B8N A;  1BQZ A;  2FTK A;  3CCM V;  4I0X B;  4JI5 O;  4JZ2 A;  4J42 A;  2DE0 X;  4QE9 A;  1Q82 W;  2LFR A;  4K0K O;  4LF4 B;  4X20 A;  4HAM A;  5L3D A;  4YJ2 B;  3G6E V;  5BXZ A;  1NVP D;  3CRA A;  4CC5 A;  5K1P A;  4DV5 O;  4LFA O;  2DYS B;  1JR9 A;  1TVK A;  5IJ9 A;  1S5L Z;  1PNM A;  2OYQ A;  1ZL8 B;  1VQ7 V;  3K79 A;  2BE3 A;  3W7X A;  2IM9 A;  4MVQ A;  1F7Y A;  5KAI Z;  1RFY A;  4XDK A;  5EC2 C;  1I94 O;  4WFH A;  4DUZ B;  3D3I A;  5J2T B;  2QGN A;  5KHG A;  3N2K A;  3SGI A;  4O2B A;  5KMG A;  2LGQ A;  2MK3 A;  1IZ3 A;  5LHH A;  4RQF A;  3CPW U;  4QPJ A;  1VQM V;  4A5U B;  2ZKO A;  4ZHQ B;  2ZE5 A;  3I55 V;  2YID A;  1ZAU A;  2C2A A;  3HR0 A;  2HFE C;  3ABT A;  3D3Q A;  3E35 A;  3JAT A;  3T1Y O;  1OCC B;  4DV4 B;  1KD1 W;  2CH7 A;  4UB6 Z;  3S3X A;  1N0J A;  5KA5 A;  1YVW A;  2PYJ A;  2B5U A;  1SES A;  3RYI B;  5L3G A;  1WB7 A;  3SDL A;  2E5L B;  4DR5 B;  4B3T B;  4P9O A;  1CPY A;  1SA0 A;  3L72 H;  3SYQ A;  3CB2 A;  4DO2 A;  1SRY A;  1RM1 C;  1Q6I A;  1KMI Z;  4FLZ A;  2EBO A;  2Q7H A;  3BHP A;  5BR8 O;  4JI2 O;  1MAB G;  3K9A A;  5J2U B;  3U0Z A;  4ZOL A;  2Y4U A;  2IU0 A;  3OTO B;  1URF A;  3ETD A;  1FYJ A;  3H1H H;  4U3J B;  5H5N A;  5IYC O;  1NH2 D;  5GON A;  4P9P A;  4DR3 O;  1BSM A;  2ZR3 A;  1Q81 W;  2Q5Z A;  4MW8 A;  1VF7 A;  5H6Q A;  3G6B A;  4J11 A;  3ZS8 C;  4LF8 B;  4JI6 B;  3N2G A;  3WU2 Z;  2EJR A;  4FFB A;  3RFR A;  5LXT B;  1K34 A;  5EBL C;  2PF4 E;  4D7T A;  3ABL B;  2LO1 A;  3CRM A;  2Z5U A;  4NXM O;  4JAA A;  4DW0 A;  4X9Q A;  1ZSP A;  3VOU A;  1AJQ A;  1FPO A;  2ZQM A;  2RNB A;  3OMA B;  3I56 V;  5ITZ A;  3SPH A;  4CH6 A;  3DTU B;  1SQG A;  1QLN A;  2DYR B;  1WJZ A;  5IJ9 B;  2LJ2 A;  3DC6 A;  5L3C A;  4MTO A;  3L70 H;  4DV7 O;  1N32 O;  4FLY A;  2AGA A;  1TAE A;  4OX9 O;  3ZRW A;  1K4C C;  4Z1V A;  1BMF G;  3CYO A;  4X89 A;  5LMN B;  2GUZ A;  1AI6 A;  5JQG B;  4K8Z A;  4MVO A;  3WG7 B;  3QTC A;  2XHB A;  3H01 A;  4WFA V;  2ZT9 B;  4GKJ O;  5EYP B;  3TXQ A;  3TK1 A;  3SR2 C;  2HG5 C;  2XOK G;  4X62 O;  3O65 A;  1WNS A;  2KKW A;  2ZNJ A;  1TA8 A;  4H37 A;  1LNQ A;  3RBZ A;  5IDJ A;  3ABK B;  1AR1 B;  1VAR A;  3SYC A;  2ZM6 O;  4RQE A;  4O4H B;  1HNX B;  2CH7 B;  3ETE A;  3SYO A;  1FXK A;  2BCC H;  3S3W A;  4O4I B;  2UUB B;  4X66 O;  3JD1 A;  2XT9 A;  4B3M O;  2JS3 A;  2UUA O;  4NXN O;  4FLT A;  1XUQ A;  3KCY A;  2QWP B;  4Q6G A;  4UXN A;  2ZE8 A;  4X65 B;  2Y69 B;  1XL4 A;  5DM6 V;  1N36 O;  3UM7 A;  2W6J G;  4ZOL B;  2YXL A;  4JV5 O;  4I4T A;  5GON B;  5C8Y A;  4UCO A;  4DR4 O;  1B04 A;  2EZP A;  2EIN B;  4HNA A;  2VQF O;  2IJI A;  4FZ1 A;  2H94 A;  5FPO A;  1V9P A;  2A3Q A;  4K0K B;  2IJH A;  3N27 A;  1WAZ A;  1Y76 A;  3K06 A;  2OWO A;  4JAV A;  4PDR A;  3E8F A;  4IYH A;  4FFB B;  1VQ5 V;  5E79 Z;  5CA1 A;  3QNE A;  2F93 B;  1XMQ B;  4ZIB A;  3ABU A;  1I0H A;  3E22 B;  3QF7 A;  1SET A;  2AXT Z;  3GVM A;  1K4D C;  2XUM A;  3P32 A;  1CEZ A;  5CB4 A;  1H2N A;  1KEC A;  1PV0 A;  1PNK A;  3CXC U;  3NR7 A;  4J9Y B;  5LHG A;  3P3N A;  1ZX3 A;  1I5Y A;  1I94 B;  5ITZ B;  3K3W A;  4MW3 A;  4ABM A;  4XDL A;  3KG2 A;  4K35 A; 
#chains in the Genus database with same CATH homology
 1IBM O;  4JI5 O;  4LF6 O;  5LMN O;  5IWA O;  1FYJ A;  5H5N A;  2E5L O;  4LFB O;  4K0K O;  4DR5 O;  4B3T O;  2UXC O;  4DR3 O;  4YHH O;  4OPA A;  1N34 O;  1FKA O;  1D2D A;  2ZM6 O;  4DV0 O;  3M8A A;  1HR0 O;  1XNQ O;  4JI7 O;  5BXZ A;  5IT9 N;  4LF5 O;  1XMO O;  4JYA O;  4DV4 O;  4AQY O;  3J80 N;  4DV5 O;  4X66 O;  4LFA O;  1HNZ O;  3OTO O;  2UUC O;  4DV2 O;  4YY3 O;  4JI0 O;  1YZB A;  5BY1 A;  4JI3 O;  4B3M O;  4LF4 O;  4JI8 O;  4GKK O;  2UUA O;  4NXN O;  2DJV A;  5A2Q N;  4DR7 O;  2UXB O;  2VQE O;  1F7Y A;  1NS1 A;  5FLX N;  4LF7 O;  1FJG O;  1IBK O;  4NXM O;  1I94 O;  4LF8 O;  1N36 O;  4JV5 O;  4DV1 O;  1AB3 A;  3T1H O;  3J7A U;  4DR4 O;  2HHH O;  1XEQ A;  2FKX A;  4DR2 O;  4DV6 O;  4X65 O;  2VQF O;  5LMU O;  4DV3 O;  1R1B A;  4LFC O;  4DUY O;  3JAM N;  4X64 O;  1J5E O;  4A5U B;  1HNX O;  4DR6 O;  4DUZ O;  4DR1 O;  2ZKO A;  2DOS A;  2JRI A;  2UXD O;  2Z0A A;  2UUB O;  4JI1 O;  4OPH A;  4JI6 O;  3F5T A;  4DV7 O;  1N32 O;  3T1Y O;  2AGA A;  2LW7 A;  4OX9 O;  1X59 A;  1N33 O;  3RT3 C;  1R6T A;  3J81 N;  5LL6 Y;  4JI4 O;  1KUQ A;  3SDL A;  1IBL O;  2F4V O;  1AIL A;  2N74 A;  2UU9 O;  4GKJ O;  1DK1 A;  1XNR O;  4B3R O;  1XMQ O;  3R66 A;  1G1X B;  4X62 O;  4B3S O;  3O65 A;  4JI2 O;  4LF9 O;  1HNW O;  1A32 A;  4KHP O;  5BR8 O; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...