1N3IA

Crystal structure of mycobacterium tuberculosis pnp with transition state analog dadme-immh
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
262
structure length
262
Chain Sequence
DPDELARRAAQVIADRTGIGEHDVAVVLGSGWLPAVAALGSPTTVLPQAELPGFVPPTAAGHAGELLSVPIGAHRVLVLAGRIHAYEGHDLRYVVHPVRAARAAGAQIMVLTNAAGGLRADLQVGQPVLISDHLNLTARSPLVGGEFVDLTDAYSPRLRELARQSDPQLAEGVYAGLPGPHYETPAEIRMLQTLGADLVGMSTVHETIAARAAGAEVLGVSLVTNLAAGITGEPLSHAEVLAAGAASATRMGALLADVIARF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Over-The-Barrier Transition State Analogues Provide New Chemistries for Inhibitor Design: The Case of Purine Nucleoside Phosphorylase
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Transferase
molecule keywords Purine Nucleoside Phosphorylase
total genus 85
structure length 262
sequence length 262
chains with identical sequence B, C
ec nomenclature ec 6.3.2.1: Pantoate--beta-alanine ligase (AMP-forming).
pdb deposition date 2002-10-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1580 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1n3iA00
1LVUA 3UAVA 5F76A 3NM4A 1Z5OA 2B94A 3KHSA 1YQUA 3KU4A 5CYGA 4LDNA 1PR6A 3O6VA 4DA0A 4WKCA 3OOHA 1PK7A 5B7QA 5F77A 1CB0A 4TS9A 3NBQA 1OTYA 3DPSA 5F78A 4JWTA 1ZL2A 2OXFA 3PNSA 1JDTA 5I3CA 4LKRA 1ODIA 1N3IA 4F2PA 4ECEA 2AI2A 1A9QA 5F7XA 5EPUA 3E9ZA 4WKPA 4MCHA 2OC9A 1OUMA 4PNPA 4TTJA 5ETJA 1XE3A 1ZOSA 3ONVA 1NC1A 1PR5A 1OV6A 1RFGE 1RR6A 1VFNA 1PR2A 1K3FA 3C74A 4DANA 1PR1A 3INYA 1JDUA 5FAKA 4JOSA 1Y1SA 1Y6QA 1A9SA 1VHJA 1FXUA 3P0FA 1TGYA 4OGKA 2QSUA 4TYMA 1T8SA 3BL6A 3OOEA 4OJTA 1RYZA 3TL6A 1B8OA 1QE5A 4WKOA 3KVYA 1A69A 4D8XA 4L5CA 4EB8A 2ON6A 4OF4A 3UT6A 3OZEA 3LBAA 2ISCA 1T8WA 4QARA 1OU4A 1Z39A 4U2KA 4R2WA 2XRFA 3FB1A 3E9RA 4M1EA 3FAZA 2AI3A 3FNQA 4G41A 1TCUA 4L5YA 5IFKA 3PHBE 1OTXA 4D8YA 5CYFA 4WKNA 4DARA 2A0WA 4DAEA 1ODJA 1M73E 1SD1A 2HRDA 1V4NA 2A8YA 2I4TA 3ODGA 1JP7A 4NSNA 1Y1RA 1U1EA 1RT9A 4YNBA 4TXMA 1LX7A 1PBNA 3MB8A 2QTTA 4GLJA 4TXHA 5B7NA 4OY3A 3PNPA 1K27A 1YRYE 4R31A 2Q7OE 5KB3A 3DP9A 1LV8A 2QTGA 4D9HA 3BGSA 3DF9A 4IP0A 1JE1A 1PK9A 3OCCA 1NC3A 1PF7E 2P4SA 3IEXA 1RXYA 1V45E 1A9RA 1RCTE 4L0MA 4QASA 1U1CA 4K6OA 4TXJA 1PR4A 3UAZA 4YJKA 1JDSA 1Z37A 1JPVA 3FOWA 1A9OA 2PGAA 5F7OA 3PHCA 5CXQA 3KUKA 5B7PA 3F8WA 5CCEA 4L6IA 1ODLA 4M3NA 4BMYA 1TD1A 4BMXA 3KVRA 2HWUA 3UAWA 1OVGA 1YQQA 4GMHA 4DA8A 1WTAA 4NS1A 5CCDA 1Q1GA 1U1FA 4BMZA 1VMKA 4QFBA 4YO8A 3DJFA 4NY1A 4H1TA 3EMVA 1Z36A 3NM6B 4DAOA 1VHWA 4D8VA 4E1VA 2QPLA 1PKEA 4KN5A 1T8YA 3K8OE 3FUCA 3MMSA 1TCVA 5F7ZA 4OEHA 1A9TA 1CG6A 1RXUA 3EEIA 4DA6A 1Z35A 4WKBA 3E0QA 2A0XA 5F7JA 4RJ2A 1Z5NA 3K8QA 4TS3A 4G8JA 4JP5A 5IU6A 4X24A 4TTAA 5DK6A 1ULAA 1PW7A 1V3QE 2OC4A 4LNHA 1V48A 1U1DA 3SCZA 1PWYE 2GUWA 4F3KA 1Z5PA 3U40A 1Y6RA 1C3XA 4F2WA 4LNAA 2IQ5A 4UC0A 4PR3A 2HSWA 1JYSA 1Z33A 1ULBA 1Y1QA 5EFOA 3IOMA 2HN9A 3FWPA 4R2XA 1I80A 1PR0A 4GLFA 5F73A 3T94A 2RJ3A 2BSXA 4DABA 4OGLA 1V2HE 1ECPA 5B7GA 3BSFA 3OZDA 3BJEA 3GB9A 1NW4A 4LZWA 5JPCA 1K9SA 4F3CA 2H8GA 4G89A 4FFSA 4DA7A 3LGSA 1Y1TA 4M7WA 4BN0A 4I2VA 4MARA 1T8RA 3OPVA 4GKAA 4P54A 1JDVA 3OZCA 4TXNA 3NM5A 2QDKA 4F1WA 2OECA 1SQ6A 4QATA 1RXSA 1ODKA 1JE0A 4QEZA 5K1ZA 4TXLA 1RXCA 3OZBA 1YBFA 3LA8A 3D1VA 4YMLA 4EARA 1RSZA 1JDZA 3OF3A 1V41E 3EUFA 1B8NA 3O4VA 3ENZA 2I8AA 1A9PA 1G2OA 1Z34A 5EUBA 4QAQA 5CXSA 3UAYA 3KVVA 1SD2A 4D98A 1SJ9A 4L5AA 5C80A 1TGVA 4TTIA 4MCIA 1U1GA 2AI1A 1Z38A 1T0UA 3GGSA 3QPBA 3UAXA 2AC7A 3EUEA 3P0EA 2A0YA 3DDOA 1YR3A
chains in the Genus database with same CATH superfamily
3VV2A 3I9FA 3CNEA 4XYLA 4BGVA 4B9EA 2V0GA 4TN5A 3I9JA 1QRTA 3OEYA 2J7PD 3A1CA 3HO6A 1MRZA 2I65A 1Q7CA 1XAJA 3LF2A 5GPBA 4IEIA 4BBJA 3GGJA 1Z3CA 2VKQA 3FYDA 4GM0A 4C3VA 1IN5A 1O94D 3AINA 5KKNB 5KYUA 3TBKA 2QV7A 2FMUA 4QU0A 1TJ3A 1IWOA 2W93A 2GILA 5F77A 3RWMB 1TJNA 3U5ZB 5BSRA 1UZAA 3FLAA 5COAA 1L6RA 5BVGA 1P2UA 3OZXA 1RZUA 2FQ1A 4C87A 2ODAA 1TO2E 3BM5A 3PNSA 1JDTA 4OMCA 2MYNA 4P0PB 1RBMA 4EZIA 3U7GA 3EVDA 4M9SA 3RROA 2CLDX 2D7DA 3LUBA 2VDUE 4FYKA 5KC9A 3G5UA 1VPVA 4Y9RA 4AZ3B 2J4CA 4JB8A 1YQGA 1SK8A 2QTLA 4NVRA 1A9QA 2IP2A 3VVMA 2BKEA 2AJBA 2XLBA 1G6KA 3WKEA 2C7GA 1NUPA 3GN2A 3D8NA 2O4CA 4MCHA 3DONA 1TCCA 4G97A 4B3MB 4RHCA 4FPXA 1VJ5A 4CTKA 2DLCX 2CNBA 3KFVA 2JATA 3S2FA 3LC0A 3PA8A 1PX2A 4IGFA 2W9XA 1VTKA 4A2PA 4TOIA 3UUWA 4FIDA 1JI0A 1K2WA 3COJA 2I0FA 2VCHA 3Q3EA 2X8JB 4DGSA 1JKMA 4MW1A 4BDTA 4E4YA 5K4HA 3VSBA 3U4DA 4B0OA 1NNI1 2EX0A 3F9CA 5FBLB 5JLJA 5HTKA 3GLKA 3QITA 4IX9A 4O8CA 4PZYA 4RKFA 1E6WA 3DHYA 3KE9A 2H1VA 3X1MA 2WM9B 3L7JA 2WRZA 2WF6A 1QLHA 2WJHA 4DSTA 4K3UA 1CYDA 3ECAA 8AT1A 1LNSA 4BFTA 1Y1SA 2R2GA 3QHQA 4HNAA 3NVDA 3U7IA 3WRYC 1UT5A 1A8SA 1A71A 2YWBA 1NASA 3FYHA 1PYGA 1FMLA 2R44A 1ND5A 2VIIA 4HZUA 4PSKA 3AEQA 4GI7A 4UVDA 5TS3A 3GJZA 3BBPA 3IQWA 4NU0A 1SUIA 4DC0A 4MPTA 5DTEA 3SBXA 3RS3A 4KR7A 1ZNWA 4MVJD 2QTBA 4A6PA 3BPSA 3CH4B 5IMSA 1RAHA 5DNVA 3ANTA 1RABA 2B78A 1SNYA 1R8SA 4PAMA 1P17A 1RRVA 4ITVA 1VOTA 3GOQA 1C8KA 1BWRA 1F2VA 1CU1A 1DKPA 2WA1A 3TE6A 3TLEA 3LTNC 2OV1A 1VHTA 3NKFA 3MTAA 3LBAA 3WNDA 1RWNA 2JFVA 1I24A 3CISA 2G72A 3AHEA 4EVQA 4F4FA 4CLDA 2FWNA 3HKEB 2NPOA 1HNXB 3AM5A 3SQMA 3OTOB 1PJTA 1T1SA 1TC2A 4E5SA 4TSFA 3TOVA 4C0SA 5IX8A 4UAVA 1WSDA 5SY6A 1VDZA 1CY0A 1FY2A 2WF7A 3ILYA 4R5HA 3FKQA 4DMRA 2K7ZA 1KBOA 3UA3A 2V3VA 4JX8A 2ACVA 1EE1A 1QHSA 2DQ4A 1W1UA 3MJVA 3KELA 2CHUA 3UJAA 3C8DA 1V5FA 3CH5A 1BXZA 3L43A 1LCIA 5CB4B 2H4HA 4F6CA 4AS2A 5DHUA 1QMGA 4IVNA 1NWHA 3KYDA 1XBTA 4M0UA 3DFIA 3AR7A 4QA9A 2HT6A 5HBRA 5IAJA 1EA7A 2RBGA 4NDAA 4MIKA 4N7MA 1DX4A 3FNBA 4OX9B 2C9YA 2PLNA 3CZRA 4R4JA 2P9EA 3B6ZA 5IBCA 2BN4A 1N7HA 1M8KA 1Z12A 4WOPA 4OQMA 3T34A 3R23A 5LOVB 4S1NA 1CB7A 3WGIA 2E4UA 4GNRA 1Y3HA 4WW0A 1HKUA 1CIPA 3Q2IA 4UOZA 1OXSC 4J43A 1EFRD 4PBTA 1F4LA 3QEMA 1P3Y1 3IBFA 2BW0A 3NHKA 1GY8A 3H1GA 3DBHB 3FTPA 5DPMA 1C4XA 1PBNA 1ISIA 1U9IA 1XYVA 2PO7A 3JTEA 4PVCA 5LDGA 4XWAA 1G4AE 2ID8A 4NJEA 1W8DA 3EVZA 4Q9IA 3F3YA 2ZYHA 5AOCA 1WXGA 4Q93A 4Y2RA 4RMGA 2EFCB 1A2QA 2Q99A 3D0RA 3E84A 4PONA 4TL6A 5C8YA 4A0GA 4PQYA 1A5TA 4M37A 6CHYA 4G9BA 1JLLA 3GRPA 4JDUA 2XCIA 1DAHA 3V8VA 3P2IA 3PR3A 4D3XA 3DEZA 5KZMB 2B9VA 2GLXA 2SKEA 2CCGA 2A9OA 3N1UA 4RX1A 4NIMA 4BVJA 1NRWA 2L18A 3MLEA 2BHSA 5F21A 4NU6A 2JIZD 4HYYA 2Q3JA 3PVCA 1XWIA 4AJPA 1AIPA 3JD4A 1SG6A 2Z09A 2F1HA 2M98A 3WLLA 1L5VA 2C07A 1DWOA 2IW1A 4X7MA 5LZ8A 2DPGA 2LCFA 1NU6A 4IR7A 1ICEA 1QH1B 2IEDA 1ZGJA 3OE7D 4I4IA 2C61A 4W5RA 3ZS8A 1IOZA 4TRRA 1P0PA 1W2HA 4BAUA 2ZE8A 1XHLA 3FNRA 4JLJA 3RGGA 1IAQA 5C4GB 3UPTA 3EG9B 1EB8A 1Y4ZA 2WJ3A 4LY9A 3K2EA 3IUQA 1CUZA 1D2EA 1DEHA 1MNQA 3A1FA 3AP3A 3BCUA 4DYHA 5K0EA 4G0VA 2GCGA 1W48A 4DWJA 2WWHA 3CZ5A 4XGQA 3WB9A 4JLKA 4HVAA 3ZVLA 3IEMA 1QOQB 4QC2A 3R3YA 1L5QA 1E1LA 1ZH6A 2AX3A 3CO0S 1P9LA 5CLGA 5TEVA 3RJ5A 3P19A 1UZLA 1AV6A 2Z9CA 2TRSB 4NG5A 5FBRB 1I3CA 3L3BA 3V2GA 5EIHA 1SBIA 3RSLA 2V1UA 2B5VA 3GJ0A 4HGNA 5C7IO 2H1SA 4DDHA 4CR6A 1L7OA 3C16C 4PU0A 2ZR0A 3CB2A 4G0YA 3BFJA 4US1R 4A6XA 3GP5A 4O4IA 1ODLA 1P4AA 1GDHA 3FYUA 4XUCA 4DKXA 4OKSA 4HDCA 2VPIA 4BMXA 2N75A 4NPHA 3RUPA 4MW4A 1R37A 1RLUA 1AUOA 2PSHA 2QG9A 1I1OA 2SHKA 3G1UA 4YJ3F 4DEYA 3BREA 4V1CB 4OXNA 1R9NA 1KIFA 3H2BA 3MM4A 5K0GA 2E48A 3M1LA 4U0JA 2YQ5A 3LV8A 2HUNA 3MTGA 1CWUA 3PE6A 3TNFA 2BM1A 2YN4A 2VNAA 3ONNA 3K6RA 2HQOA 3DEFA 1T91A 5AW4A 5JYBA 3O1LA 3ZJ4A 1VMKA 2GERA 3VDQA 3TUIC 1J9ZA 4M0FA 4KLCA 1FFXB 3ECCA 4IDOA 1W6RA 2WWVD 3X1JA 3RRFA 4H1TA 5MN6A 1Y81A 3GEBA 5FI1B 3AM4A 1YC2A 4H7PA 4XB2A 2WSSD 4IEEA 5SZJA 1KR2A 5TR9A 1NMSA 2ZT5A 1G16A 2ZULA 2GAAA 1LY1A 3CYFA 3N6XA 2DLDA 1CRLA 3NAQA 1M6WA 4OMFG 2C5LA 3HBNA 5IJWA 2VT2A 2AGVA 3CR7A 1CPYA 2C2YA 2J33A 1EUCB 1T2CA 1GFIA 3EUAA 1FFXA 4C2UA 4PYLA 1A82A 1AY0A 1Z2DA 3AUFA 1BX3A 2IIVA 2V7TA 3OLWA 2P4EA 4OU4A 4UNRA 5HCUA 3W6PA 4DIBA 3CUUA 3JASA 4FGKA 1JIVA 2DBZA 1DG3A 1VIVA 1X7XA 2CXOA 3IJ5A 4H77A 5EGSA 1YZVA 2ODQA 4LC0A 4AJIA 2O0KA 4O2AF 3S8EA 5DIFA 2Q1TA 4D0LB 1D04A 4V1CA 2Q1UA 1S8NA 1JNYA 1YRHA 2P1RA 3CH6A 4ZZ2A 4DVGA 3DDSA 1GAQA 2O3TA 5K99A 3J81k 5ELXA 4IXWA 2WYWA 2HDOA 3AYZB 1DUIA 3FZNA 2X9LA 4W7SA 1MJ5A 3WLFA 4RJ2A 5D6OA 3WNCA 3SHQA 1OZFA 1M6HA 1MO2A 4YV2A 5IUKC 4UPEA 1OLXB 1W2WB 2IV3A 2Q3HA 2F9MA 3UMJA 4QTTB 5ANRB 4JBGA 4LYAA 4DCJA 3KR9A 4WNYA 4EKGA 2BRUC 4G0WA 3ESXA 2BEVB 4QUEA 1GQRA 2XMBA 1MJGM 1AGYA 3UH1A 2QI9F 1ZN9A 5J2UA 2BFOA 1Z68A 1BJTA 1NOJA 5H5JA 3SCZA 3SFTA 5REQA 2H1HA 4AJEA 3E7WA 4RAOA 1HM5A 4W5WA 4EWLA 5LIPA 4TVBA 2HR1A 2HLDA 2O1XA 3FCEA 3U40A 1SR8A 3EUWA 3CPEA 5H70A 1K92A 4IIVA 5HKKA 3U56A 3RU9A 1EE2A 4II2A 4ED9A 2AB0A 2H2GA 3DDHA 3N39C 4P80A 4WCFA 3LP5A 4FDLA 1CW2B 4Z6KA 3UXEA 4C5BA 4M99A 5IDWA 3FW1A 5CT4A 3QUBA 4F4UA 1JLRA 4GDFA 3M6AA 5E6RB 3ICQB 1VGRA 1FP7A 1TYBE 3DOUA 3L2OB 4Q1AA 5DXFA 5B1IA 2CFRA 5KOHB 1YKGA 3WMEA 1SVIA 5CDYA 4WK4B 1R6UA 2R1TA 1YZTA 3I1YA 3M49A 3FTFA 1CUEA 4JA2A 3ITEA 2WYUA 3D4BA 4URWR 4B3XA 5GVRA 3PEEA 5E2BA 3MWYW 1XTSA 3I53A 4KXYA 4EVIA 1D4AA 2QZ9A 3D81A 1MNAA 2VTKA 1F14A 2OHVA 3CRW1 1YS7A 3LT4A 1BH2A 5IAKA 5D3KA 1O95A 4P2GA 1NXPA 3OZDA 1ID1A 3LC2O 4C0BA 4ZIRA 2OCKA 3GQVA 3CJTA 4MYHA 4MDFA 1PJ8A 1YBVA 3FSGD 4TWRA 2WYOA 4QSHA 1CK4A 1AQUA 2FP4B 4RVNA 3V9AA 2WSSA 3EX7C 3KAPA 4JASB 1O58A 1TA4A 2RGRA 1KP3A 1AKWA 2QP3A 4XGIA 4LOLA 4Y7CA 1GGHA 4FFSA 4BMDA 3PPIA 1ZJ4A 3L82B 5BUQA 1WCV1 2O52A 2X13A 2ZKLA 5CIYA 1MDFA 5B2ZA 3G2OA 4EH1A 4CBVA 5EXSA 1QE0A 3OFJA 4ZCMA 1MFZA 1KE1A 3GGPA 5YASA 4FEGA 2G7MC 2FEPA 1XEFA 4GBED 1XVUA 5CYOA 3IB3A 5EGNA 4OYYA 3STTA 3W1EA 2CVOA 3PQ2A 4GWGA 4D57A 4D97A 4I9UA 4NF2A 3WNQA 3PITA 4QUGA 4TL9A 3VDNB 1CZKA 2R25B 1VI6A 4O1HA 4DREA 1I10A 1WVGA 2XKKA 3BGOS 4TXNA 1JB1A 4ZT6A 2VNHA 3TQCA 2I66A 2N0SA 2P9GA 2Z5VA 3OQ1A 4KGXA 2W11A 4RDIA 3W6NA 4BNDB 3JR3A 4AWAA 1KTVA 2SKDA 2YNMA 4BAZA 4CI9A 4FX2A 1XWFA 1KQ3A 2X14A 1HNWB 3CUTA 2A57A 2IEBA 4DWWA 2XW6A 4U1RA 2C9MA 3VSCA 3MCUA 5EESA 2A4KA 1C30B 4EYOA 5KS2A 5KMGB 3K8ZA 4D7AA 5TY0A 3HCPA 3CRQA 3HEMA 4BFUA 4TLCA 3LA8A 5A6VA 3NBUA 6Q21A 3F96A 3P7MA 2P0YA 2FMXA 4I3FA 1PZHA 4M0CA 1U8UA 5HBGA 2RK3A 2QD2A 3BRWD 1JDZA 4FGWA 3ZCSA 3KOUA 2RG1A 3ER8A 1XTJA 3NASA 5ADUS 4WY5A 4EKIA 1IUNA 1XA3A 5JNTA 4IXDA 1X86B 1D03A 2XNHA 1MW8X 2VLIA 2R4TA 3LP8A 1NQXA 1WPXA 5DDIP 4TV8A 2O07A 4HCJA 1R3DA 3CUEF 5DYYA 4MWOA 4B9AA 2V6IA 4G63A 4C0WA 1IG3A 1R12A 5AVOA 4EEZA 2CMDA 2OGZA 8MHTA 2OCAA 2PWPA 3BL5A 4TUYF 2GFHA 4V0OA 4JEHA 5C53B 2R6R1 5BVHA 4GI3A 5LU8A 1HKHA 3PNLA 4MV4A 2UZ4A 5C8DA 4DV3B 2D5CA 3JQPA 2HMUA 5G3YA 2YX1A 3FNFA 4ETNA 1UJBA 3BTUA 3FIJA 3GAFA 5TSDA 4EEKA 1RYDA 1KDOA 4HS9A 1UBCA 1EAMA 10MHA 1OC2A 3U4HA 3VR1A 1XLVA 1E3JA 2BISA 2OR3A 3ZN2A 4N5IX 1JEQA 2XKJE 1UMCA 2Z5GA 4NV1A 4HV4A 1MIHA 4D9IA 2YXDA 2HWXA 1ORHA 2BE9A 2H1WA 4IOKA 3EUEA 4LJAA 3Q1KA 1VMIA 3RTCA 1TF2A 2XQVA 1OXKB 2GEVA 2JGRA 1GR0A 1MT3A 2NTEA 3GYBA 3OMWA 2OY0A 2CDCA 3KPJA 3BBLA 3OX3A 4JC8A 4N6GA 4P4NA 4REMA 2DZDA 2GH1A 3QUTA 3LPLA 3ZD6A 3ELUA 2GPAA 2Q5EA 4MZXA 3IVMA 1ZUNB 4CZ2A 3DVSX 1TZJA 3REGA 4OB8A 1RJEA 1DKLA 4N0DA 4B7AA 2VBIA 4CPDA 1IRXA 4LTNA 1CVRA 2WOJA 3FKJA 3OLCX 2RGGA 4DT1A 2OZKA 4B3DA 1TJPB 3V1KA 3DPUA 4M0KA 4HNQA 2LRHA 1C4WA 5DLEA 1F8FA 4KP7A 3TLGA 4RCVA 1DAPA 1JHXA 1TCBA 3T99A 3ZLJA 4Q1EA 3BE5A 3DS8A 2JGNA 5E1MA 1LD3A 3O9MA 3ZE8A 1O54A 3KB1A 1ZRNA 2PMEA 5T4EA 1C7ZA 1U1IA 3PDWA 3FMOB 5EWLA 4YY3B 4WDQA 2GEFA 2HHAA 2TS1A 4U2DA 1AC5A 4GU5A 4CHGA 1C3LA 3FMGA 1TA9A 4FBGA 3R74A 4Z9XA 4YV1A 1APBA 1QG4A 4J0CA 2V96A 2JAPA 3JQAA 3A1SA 5DVZA 4Y2GA 1RW4A 4BV9A 4IDHA 4MQUA 3IX7A 4P98A 1GNRA 2EX4A 2HBQA 3UEOA 3PUKA 1B6GA 4RELA 3CWZA 5D3ZA 3SDSA 4X65B 1U4SA 2NAFA 2Q3BA 4ON9A 5EPUA 1XP8A 4HXYA 3UQZA 3I6QA 1WF6A 2ZI5A 5DEIA 3TUJC 1AKUA 3UMVA 5I9BA 4FHFA 3FJ1A 1EK0A 1LH0A 1TYCA 4P82A 1FLAA 1FNMA 1XZJA 3PGMA 3QU4A 3WR5A 5IJ9A 1W36C 1V7PC 1QAOA 3TMYA 4PBRA 1ZRSA 5ETJA 4CM3A 2FW8A 3NOXA 4W7IA 3F49S 3E15A 2M6KA 5F9FA 1IM5A 2NV6A 1EDEA 3EWNA 3T5MA 2X19A 4Q24A 4G0UA 1PTJA 2RAFA 3JYPA 4DCTA 2EHJA 3G2MA 4MYUA 2Y93A 4IV0A 4AJ9A 2ZAMA 2OBYA 3MQFA 3VZBA 1O5TA 1KZ9A 4CDMA 1WW2A 3UV6A 2H08A 2LXNA 4XSVA 2XAAA 3G8BA 3V4LA 4MV5A 2JGDB 1MAHA 2WKRA 1ZRMA 2YWXA 3MOGA 4I7EA 4K7JA 2PH5A 3VYVA 1CF4A 4XM2A 1A88A 1MO6A 4DLTA 1QZTA 2XYVA 4WCFC 1BGVA 3NNNA 5KJEA 4U02A 5AW9A 2J45A 3B8HA 1Z22A 3BRWA 3E61A 3PDIB 1DQPA 1UEXC 4W1SA 3O9ZA 3OKFA 2DPYA 2JA2A 4OTZA 1N7GA 2KB0A 1TTHA 2BC9A 3B7GA 5JCOA 3WB1A 3X43A 1J0AA 4ZICA 3D31A 3V42A 4F91B 1V6AA 2PUWA 4DCPA 4MUHA 2MSKA 1J06A 2OESA 3X44A 1EDZA 3M4NA 4PN3A 3WLSA 1Z6ZA 2QTWB 3TO5A 1JJVA 4Y6OA 1CUWA 3KJFA 3DHNA 3EGCA 1PZGA 3FYUC 1HORA 1DG1G 1KS2A 1UP7A 5CNJA 4DQLA 5L3ZA 5KINB 5JJIA 3KAJA 2DR2A 2QU8A 1US8A 3DNFA 3PCTA 1C9KA 2QMQA 3O0DA 1Z6QA 1RVV1 3CZAA 2NZUG 2IXDA 3KD2A 4DC9A 1VDMA 2C2WA 4TTRA 1MN6A 1BQEA 4OA5A 4XEUA 3SC2B 1MABB 3F73A 1KZ1A 2REQA 3IQEA 1JB9A 1J90A 4RBNA 4G9EA 4MVJI 3RUAA 3NRCA 2QQEA 5GMOA 3AEZA 3ETGA 4H0CA 1I6KA 5FTJA 1QONA 3JVEA 3KQWA 4U2KA 2X5KO 1EHCA 4H18A 5AVUA 4DG5A 2XXAA 2IYRA 1R66A 2XUQA 2Z57A 4NZPA 1R4AA 3JWGA 1IQRA 1HX7A 3FFAA 2QSYA 4LZNA 3QXGA 4S05A 4DR2B 2FX5A 3HP7A 1K75A 4UJ3A 1N6RA 1JQKA 3PKJA 2G88A 4TMKA 5CVCA 1GRQA 5FOTA 4M22A 5IFKA 1IWPB 2KI5A 1VL2A 2VP0A 3PHBE 4NOLA 4M1QA 2Y2UA 4D8YA 4DCOA 6ADHA 2P41A 5CW2A 3JS5A 1FOEB 2G82A 3GRCA 2NLOA 4R2HA 1SD1A 5JAUA 4Q9KA 4YREA 4YCAA 3WIOA 1BD4A 1O96A 2ZFUA 4M8SA 5HIKA 2J9RA 2DPMA 4H4EA 1K7EB 1WQ1R 1NVBA 5HP4A 2A5FA 4YT2A 3EF1A 1CRQA 3AVXA 1DU4A 5HX7A 1CFZA 1HT1E 3ROGA 3BN3A 1Y1RA 4X6YA 2H2DA 5DSZA 1RT9A 5K0BA 2JIQA 1JQEA 4KN8A 3P9SA 5FO1A 2V54A 5JH7F 3OZAA 5BOSB 5ISMA 4TXMA 3EFOB 1CCWA 3V8EA 5LQRA 1B42A 2WHRA 1SBZA 3O47A 3BB4A 5IXSA 2R68A 3JWPA 4R5MA 4MZDA 4ZO7A 4KODA 2XHEA 1XMVA 2ZJ7A 4JBYA 3KT0A 4L5IA 5DCUA 4ATNA 4D9BA 2GSWA 2Y3IA 3A11A 4ZQEA 3OU2A 1K6MA 3UPDA 2GJSA 2FY8A 1OFIA 2IV7A 3TTXA 2VFAA 3HCEA 1BCSB 3HFJA 1B6SA 5EKTA 5C5CA 1H05A 5K3AA 5JAHA 3KR0A 4KXMA 1OTHA 3QEAZ 2GXQA 3NYWA 4WN3A 2QYOA 4XQ0A 3UOGA 2J3EA 4BLSA 4DJDC 4EUNA 1M1YA 3CLTC 3FCYA 3RSQA 1AG9A 4FNAA 3GJ3A 1KR5A 5CEEA 2P9HA 3KM0A 4P4SB 1HMYA 1J8FA 3D3NA 1L9XA 4XD7D 3RBZA 7AT1A 2ZT7A 3I2JA 1D1TA 1DFHA 1SO8A 3ZY2A 4EVRA 1YFKA 4TM8A 4HL6A 3Q7IA 5AQEA 2WUVA 4MUEA 5AW6A 4BXOA 4OSEA 2QT0A 3V9PA 3LO5A 4LVNA 3HJNA 5IPFA 2W8BB 2VCYA 4IY1A 3HO8A 1HDOA 3D0KA 3GLFE 2LNDA 1YA6A 3AVQA 5KNBH 2Q8PA 4LYHA 3R7DA 1FJ2A 2UYOA 1A1VA 1C2TA 2O19A 2W2XA 3SP1A 2DUJA 1OXUA 2DQKA 2JANA 5JSHA 1G8JA 3ZKWA 4C2BA 3ORFA 3VC1A 1BS9A 4IJKA 4JENA 2CWDA 1T4GA 3QXSA 2C9BA 2X40A 4X8HA 4KWCA 5JRJA 1MO4A 4F4JA 3WB0A 4RDCA 2OPHA 2FSGA 4B40A 4G2TA 5IKMA 4MS1A 4KH1A 2AJ8A 1XVTA 4MWZA 4DWVA 1ABFA 1JDSA 1ISSA 3E48A 2KHZA 3N7TA 1P9NA 2DOKA 2HCTA 4GQBA 1IZ9A 1VBFA 4O08A 3R7BA 1HYGA 3ZBPA 4F4CA 1N6NA 4IEFB 3LQ2A 1CQJA 4FHDA 3WWOA 1AUVA 1KO1A 3DAPA 4KXFB 4BFVA 5LQUA 2I4IA 4HB3A 2IS6A 3MCTA 1BN7A 2XYQA 3KUKA 4J3FA 4QPJC 5BPFA 1WZIA 2Z2KA 3UK6A 2YTZA 2A67A 1XA0A 1KEVA 3TBHA 2IHYA 4B6GA 3PDCA 1RWBA 1XMIA 1JXMA 4YJ2F 1R7RA 2L19A 2I6XA 4D43A 4K6CA 4FB5A 4YCNA 2DULA 3E9CA 2UUAB 4IJWA 1II8A 2J1LA 1XNJA 4G09A 1GPBA 1XGKA 1KPHA 1QVVA 1DHRA 5KAPA 5T4FA 5K0ZA 2VF8A 3H2ZA 3GCWA 1T24A 4PYJA 1P1FA 1EPUA 1VL6A 4B2IA 2GAJA 3MJEA 3N8KA 4F60A 1NW5A 4TWZA 3DMDA 2H3EA 3N2NA 1NMQA 3B36A 4YHHB 4ALLA 1CUFA 4MULA 1QIIA 2PLWA 4G24A 4FI3C 3O21A 1XQXA 2BMVA 1PFWA 4NMHA 4O2BB 2PRIA 1V6SA 4PC3A 1RKQA 1XDGA 4CMGA 3WSVA 2RE8A 1MH9A 4J2OA 3OJFA 4RZXA 2ECQA 4A23A 1CIVA 3B82A 3T3GA 1XD9A 1FYFA 1NW7A 4MITA 4O4LB 3WYCA 3FFWA 1IJBA 4JL5A 2Q3FA 5FBZA 4DBLC 1TVMA 3K0KA 4LF9B 1QDLB 2P8SA 3PD1A 3RU7A 3OHMA 3KXLA 1PJSA 4PCUA 2C8JA 1P9RA 5JNLA 1T0JB 1JF8A 1S96A 3X3HA 2Q6LA 2ZWIA 3DMRA 4D3SA 1R8JA 1WU8A 4Z8YA 1A9TA 1QQ5A 1RXUA 5G4KB 3EEIA 2QMOA 3R4VA 1NE2A 3C0KA 3A4TA 4RY8A 3TZQA 3WJAA 3ZPXA 1RE1A 1SUSA 1M1XB 4BNZA 2ZS8A 1YR6A 2MOKA 3STHA 4Q3DA 4Q0MA 3TPFA 4X45A 4ZHQB 3BMOA 4C4ZA 4QJ4A 3IHLA 2RI1A 5AKZA 1TOAA 4QPNA 5K7SA 1QP4A 1A98A 1Z5NA 1LK0A 4GVPA 4D4MA 5C37A 5A5EA 3U17A 4DDVA 1BCRA 3IMFA 3N2KB 4G25A 4AULA 4DXAA 4F72A 1SIOA 1ZBDA 2CVZA 3D8SA 3V1MA 4W9MC 3QVUA 1NNSA 2WWGA 2W2KB 1WMAA 2FJPA 2JRLA 4AI6A 3OQOA 1QQTA 4G56A 2X7XA 3ENWA 2LW7A 1I51A 1M8GA 4H7HA 3K9HA 2JFNA 1T3HA 1IHYA 2BMJA 3MJDA 1I0ZA 3A6GA 3AHIA 4Y30A 5EPOA 1WVMA 7GPBA 1AD2A 2JZOA 2I6GA 3TB6A 4LBZA 5C51B 4OATA 4OQEA 4L4ZA 5BWBA 1B41A 3L6EA 4CL8A 3TGWA 3PNQA 4QXQA 5JJ5A 1OAKA 1UR5A 3D8UA 2VRCA 2JA1A 1Z0FA 4E5UA 1NBOA 1V7CA 3NRJA 4U7TB 2GYYA 5ENDA 1MB3A 1R64A 4L9AA 2WUWE 4AJOA 3D6VA 4PIPA 1OI4A 2EHDA 3TLYA 3WRWA 5C1BA 3R77A 4AZ0B 5DTQA 1I3NA 2HN9A 3D6AA 4MQFA 4J1QA 4JC0A 4DMGA 3I61A 2Q1SA 1AMNA 1W4CA 3W8NA 4CM8A 4ZEVA 1JTEA 1IK6A 4A1FA 3NIBA 1BJRE 1GCIA 1R4NA 4LS3A 2YNMD 3CZCA 2FCAA 1YHYA 5ALKA 4UBLA 5JBIA 3MUFA 3CX4A 3BFXA 2IYVA 3QGMA 5B5SA 1JILA 3TOXA 4BV2A 4ZPXA 1EFVB 4M9XA 3TIGA 1OX5A 2O8DA 1V7ZA 3CJRA 3OCYA 2JCVA 5H1YA 1MAAA 1M1NA 2EFDB 1X77A 2YZKA 4F97A 2GEUA 1HA3A 2XA9A 4YJ2B 2IYZA 2IZ6A 4ZAVA 1KZYC 3MWLA 4MR9B 4ALJA 3CLKA 5DE3A 3GLTA 5A04A 3PHIA 5BN4B 3EIEA 3L8FA 3QI7A 4JHXA 3QJGA 4KFRA 2H5JA 4FYWA 1KIMA 1W85A 1QB8A 2O2GA 3GPBA 4BV8A 2JI4A 4MW5A 2WM2A 3B3QA 2YJ3A 1BN6A 3OQ6A 4P53A 1QO9A 3G85A 4OYRA 1TMOA 3G7NA 3ICVA 1A8PA 2XDQA 2PZFA 3K1AB 4GX0A 2O0JA 1UZUA 4GZLA 4IHAA 1QO7A 2HMVA 4MGKR 5EXTA 3JWJA 4CCSA 1XXLA 1W1WA 3A6LA 2NU7B 2QVCA 2PGJA 4I55B 3H84A 5AKKA 1EVJA 2CXTA 2PGNA 2B4QA 2OLKA 3FFTA 3GFOA 4MW0A 3CG0A 2LV8A 2POQX 4QUKA 2UYCA 5EIFA 1A9ZA 2MINB 1J0CA 1P1KA 2WPNA 5B3JA 1NUAA 1CETA 3H9EO 3GDHA 3NM5A 1KDYA 5EHIA 4QBFA 3W1WA 5BMVF 1YB1A 1M6VA 1U2GA 2ZBPA 4V2UA 4BB0A 3QK7A 1Y7IA 5H9WA 1S3GA 4NV3A 3JQ7A 3WDSA 4X1IA 2W2KA 2XWJI 1PFGA 2P9TA 1F9AA 2XRZA 2PBRA 4POAA 4P3PA 1L8OA 2NOAA 4FJ0A 4KACA 3ETJA 4HEQA 1BCRB 4EMUA 4H1WA 2PLAA 3OZBA 1STOA 1ST2A 3N7AA 2UVPB 2JZNA 2EJWA 4H27A 5DTMA 5ARDA 5JS6A 1CEXA 1EQ2A 2EEPA 3TX6A 1JFLA 1V16B 1RI4A 1GN8A 1PI3A 1YJAA 3QU7A 1SULA 4MA4A 4OFBA 3C8UA 3EZYA 4Q3OA 4X5OA 5IEJA 2Z9BA 3VBEA 1LVHA 2EQBA 1UAGA 2NYUA 2PGXA 4CV3A 3WWYA 5D5QA 4X1YB 3IEKA 4XLLA 1F51E 2XOKA 1ZW1A 3R9KA 3VPHA 2VP4A 1ZI8A 1YFLA 3KQHA 2EG9A 1H2RS 4IFBA 1EFHA 3THWB 2GAIA 3EZXA 4J8PA 4MQBA 1BE0A 3JD1A 4RJIA 1QYIA 2VNSA 3IQDB 3WGTA 3VKFA 4WKGA 4BFCA 2OM2A 4XX1A 1E2BA 2G70A 3M4ZA 2YVQA 3ZW9A 3H5TA 1NBIA 5FR2A 2WE7A 4HX5A 4Y3UA 1UC5B 1LU9A 1GRNA 4DLWA 1MLDA 3ZGVA 1U7XA 3GNLA 4HOYA 3GF4A 4LDRA 1JIXA 2NGRA 4BZPA 1ZHFA 3STWA 1NUTA 2NW6A 1XMPA 2P2DA 1R0XA 2C0CA 4B6OA 4M54A 1P2TA 5B64A 1DXQA 4BWVA 3CKYA 2EKLA 3OF2A 3E23A 3R3JA 2JFXA 3MAAC 3BGIA 5BQ3A 1SOAA 1FUKA 5EI5A 5FXMA 2AVDA 1V0JA 2ZITA 3NCHA 1GQ2A 4LTMA 4ZU3A 5LNK1 3WHKA 1CQJB 4BGUA 1N77A 2X3FA 2R8ZA 3L0YA 1TAUA 2WM8A 1A4IA 4CQMA 2OQIA 2I91A 4B3BA 4J0EA 1XO1A 1YZHA 4N6NA 4YGXB 3DO5A 1ZNZA 4MI3A 4PW0A 4PLVA 1NF8A 3MUEA 5FADA 1O95D 3KWJA 1Y34E 5FCDA 1FYWA 1FS4A 3QNMA 4KQCA 2HMAA 1PK7A 4HH3C 4OGGA 4EP1A 5G3ZA 4Q4CA 5JE8A 5ALYA 2EKQA 4PZDA 3UXHA 2C2KA 2JHCA 1RZ3A 3B53X 2WD7B 3EAQA 3TR6A 2RGCA 3X1WA 3OECA 3ABZA 1G5TA 3CGGA 3IJPA 3TQRA 3TQSA 3RC9A 1PKXA 1OCEA 1C0LA 4DRZA 4EITA 1HF3A 1THMA 5I3CA 3WAJA 1W94A 3RUDA 2W8BA 2IBTA 1GA6A 1NVGA 4Y2XA 1RPNA 2E5FA 3MCAA 3PGLA 4OSPA 4YRRA 4ZT4A 4XJSA 3TAHA 3LYAA 5B55A 3L0BA 4L0QA 1OLOA 3V7NA 2JLAA 3E0XA 4HDMA 4KQ9A 4DADA 2Y67A 3RVKA 5DSXA 2WY2D 1N2CA 3KKEA 4NCJA 4TTQA 1UKYA 4WACA 2GLUA 3RHSA 2H8KA 2F3SA 3T15A 4BE7B 1OWMA 1TK9A 2YW9A 3QWIA 4G9GA 4LX0A 5A71A 3URMA 2E89A 1QGUB 3GEPA 4JUAA 2W42A 1CTQA 4MGZR 1HE2A 3E35A 3P2OA 4K6HA 2JJ1D 4O33A 5AH0A 2D74A 4TKUB 3SS9X 4M1WA 1KFKB 4OL0A 3WWZA 4DMLA 4DXHA 4WBNA 1ZW6A 4CKZA 3CEAA 3ONVA 1JQBA 4FFRA 2VHEA 4BVGA 1VMAA 3RC8A 2A3NA 3HEAA 1RPTA 3HV0A 1JDBB 4J1TA 1E0JA 1JU4A 1YRWA 3LECA 1PJBA 1ZVMA 4Y2QA 1QU3A 4WZZA 4DIKA 1XRMA 2PJZA 5HHTA 2ZUSA 2VYVA 3BEDA 3FA2A 3U3ZA 3LHIA 1H2HA 4PRYA 1HC7A 1QG2A 2AD1A 4KFTA 4ZYYA 2G9UA 2QBYB 5KNDA 4NC9A 3RUIA 2AXNA 1W29A 1KYQA 3PWKA 4JOSA 4YH1A 1THZA 3QWHA 2XUGA 1Y6QA 3IIMA 1IK4A 3FWYA 1A9SA 2HB6A 1T25A 2IKQA 3R6WA 2GEKA 4GPBA 2PLRA 4OQNA 1X0VA 3PE3A 4ZHQF 5L3SA 2WWTA 1XFAA 3NORA 4A9AA 1GOTA 3ZHSA 4XRGA 2VWHA 3OOEA 1Q6YA 5F33A 4FQ8A 2P7HA 3WLHA 3O8QB 2Z4TA 3Q9LA 1MW9X 3PC6A 3KWLA 2YHAA 3L7AA 3QSGA 1DCMA 3ANMA 3ETCA 4WXPA 1B15A 2VJMA 3FDZB 4UREA 3TW6A 4CM1A 3IL2A 1K6JA 1PD1A 3IUEA 5THQA 5EG5A 3NTXA 3VBCA 2CNOA 4MINA 1HQKA 3HJUA 2TMKA 4ZI7F 1JKJA 2J08A 2N1BA 2QRQA 2ZAIA 1LDMA 1Q6ZA 1W9MA 1IL0A 4TV9A 4YLGA 2XXAB 5ALDA 1JLMA 5G02A 3A7EA 2H5LA 3H9UA 4BYMA 5DZSA 2MCFA 2JFOA 3C97A 3K15A 4Q4JB 4UUOA 3SIRA 1HTTA 2PFSA 3OZGA 4X1OA 1T3SA 3RS2A 3GOHA 1UJ6A 1W581 4HAWA 4OL9A 4OJYA 5DJ5A 1DAOA 2REQB 4BQFA 1L8AA 2GPYA 4X94A 5B57C 3H11A 5T3UA 2LDXA 5J4HA 1WP9A 2JLBA 2OB2A 1FYDA 1NT4A 1O5IA 1L4BA 3QVKA 3KBOA 4KYUA 4QGHA 4MXDA 5FUXA 1KJYA 5ECYA 3KQVA 3G8DA 4ZAFA 4D8UA 3I9MA 4KQ1A 4P58A 2MHCA 4ZCQA 1OTXA 2LVBA 4KBGA 2POCA 1N5RA 5E1DA 3ZWDA 4L2IA 1IOVA 3UMGA 1C1XB 1VZ2A 4YRPA 5LMNB 4RE6A 1R0LA 2O0HA 2VOEA 2XCOA 5ED0A 5ARCA 5LP6B 1ISPA 3RF6A 1N0UA 3ZCTA 2H9AA 2HRDA 3S3TA 3AF5A 3OO1A 3PLRA 3JTMA 2BGWA 2A8YA 4G5RA 5K0CA 2IHNA 5C4MA 3CVUA 1UFKA 4M6WB 1Q0RA 4KDEA 3ED1A 3FNEA 2WIKA 2H54A 4FWTA 4PX5A 4Q9DA 2I7XA 1NVFA 4HPJB 2H59A 1M1UA 3MERA 3GLQA 1IFXA 2JGDA 2VYCA 1Y8QA 2YJ6A 1ZD1A 3E82A 4N5DA 4DYVA 1FSGA 3B1ZA 5IBQA 3VOTA 1SVMA 1O97C 5K8VA 1KS9A 4RULA 4BWGA 3SQNA 1KGSA 1ORTA 3BX1A 3FPEA 1D7AA 1XL1A 2QTTA 1LK5A 2PZJA 3RUFA 2H92A 3O0TA 1K6EA 2RKBA 2FUG6 1L2TA 3GD7A 4K8RB 1GA1A 2FOLA 2WTMA 3ZI4A 4YJHA 4YIHA 3BTVA 2JLYA 3S29A 2PD6A 3HKDA 1ZD8A 3CX8A 3TZBA 3AM1A 1WUYA 1QORA 2QLMA 1N1DA 5D3QA 3B9PA 2X6QA 4R8VA 5EJ4A 2XKBA 1XU9A 3DCIA 4QIHA 3TD9A 5AM1A 3GLHB 2AZXA 4LHEA 2BKAA 2P4SA 4FONA 2J9YB 5IK2A 2OFPA 3TTSA 3HB1A 5ILQA 5AM0A 4A03A 1DRWA 1T0IA 1TIKA 2Y9MB 4B7ZA 5FPPA 1LRKA 5JD4A 1E4YA 3UV3A 3F4LA 1Y37A 1ULZA 2XD4A 4K6GA 3P2JA 2P11A 3WQSB 1O1YA 3AIIA 3DULA 1FUUA 4L1KA 3C4VA 2ZU6A 2ZR8A 4H6PA 2PNFA 2D8MA 4LHVA 3RLIA 1B23P 2GZRA 1GG2A 4EZBA 3GLIA 4HTFA 3ZXIA 1Z8DA 1KI9A 3CR8A 5T6MA 1K2VN 3N7UA 2XPCA 3FGNA 4FDTA 4NK4A 4R54A 1X3LA 1A4RA 4YQEA 4CEHB 4BQSA 1DX6A 3ZQUA 2WBLC 3CW9A 3QX9A 1SXHA 4H08A 5IBPA 5HS4A 1EAYA 1TE2A 1Z37A 1QK4A 1KDTA 1USGA 1Q2UA 2A7QA 1RRGA 3DZ8A 3KEFA 1TMYA 3U7QA 1Z74A 1QF6A 5FPYA 1OT5A 1UWKA 2QSJA 3GGCA 3IVRA 4TMFA 2FGKA 4O02B 4UMFA 3I01M 4BTEA 3JAMA 1QU2A 2ZB7A 4AW9A 4ANFA 5B58C 2OUKA 2PEYA 2RC5A 1UK7A 2JJ2D 4M0EA 4CG0A 5IT0A 1TD1A 5IJAA 3UMFA 2G71A 4JBNA 4EY7A 1R88A 3GFRA 2RAPA 4MA5A 2Z58A 4EPXA 4EENA 1YQQA 3EPKA 2ZP1A 5CT5A 3OIUA 2G4VA 3R3ZA 2YHIA 3FPLA 4NS1A 3CWCA 4BO5A 1XZFA 2DPLA 2P6MA 4OLBA 1VJGA 3D3WA 1SVWA 4UHKA 1XCGB 1ZNQO 4KO1S 4MEAA 1W5AA 1N5MA 1EQAA 1ZU5A 3O73A 2C5HA 4RJJA 4RV5A 4RPGA 3UOWA 3EA0A 1LDGA 4FFOA 3HDGA 3SLKA 1ACMA 2OHOA 2R5NA 1H0SA 1VHWA 3ETLA 1CZNA 3N2LA 2YWHA 3L4JA 2X8WA 2Q9BA 1F48A 1QKJA 3FYSA 3PEFA 4URYR 3RS0A 4EUKA 4C76A 5HOEA 1XPOA 2VCEA 4CEIA 3UK1A 1RWPA 1GPJA 3ETHA 3AT1A 3Q10A 4A3SA 1RXEA 1A5BB 2EP7A 4ASUD 3UGJA 2ERXA 1W7AA 1PV1A 5ALSA 1D8TA 4AZSA 4G5YA 1BX1A 1BXKA 1WB5A 1XB2A 3AUAA 1VGQA 1ATZA 3R7LA 3S40A 3L40A 1D2RA 2Y77A 5HS6A 5CB4F 2HEIA 2P40A 1ZHHA 2BFNA 3RVMA 1JX6A 3WWCA 2Z6AA 1DELA 3TL2A 2V9CA 3K1TA 4FDAA 4X6UA 2FWRA 1J2TA 2Z2YA 2R5WA 4P3XA 3E0QA 4Z1OA 1YQWA 5F7JA 3DC7A 4NBNA 2XMSA 1JVSA 3ANLA 3LWZA 1N8KA 2SECE 1KJ8A 2XVZA 2P79A 2DAPA 3L0OA 3U13A 2JVJA 3UJPA 4B48A 5KMGA 3E22B 1MORA 1DJNA 1M34A 1N7JA 1NQWA 4I0WB 1A5SB 3DZJA 4WERA 4AN0A 3G9QA 4U0KA 3QYPA 1Q1AA 1Q7TA 3CXUA 4OBEA 4KQGA 5F1YA 2W6JA 4RHUA 4X61A 4NZYA 4KIWA 1P19A 4TYWA 2D0DA 3U3XA 1EM8B 1AXEA 4YRAA 4MRPA 1E6UA 1PL6A 2ZPUA 2PWYA 3MUNA 1DC4A 4O4JB 4OKNA 1C3XA 4RTMA 2Z5LA 4W8HA 3K6SA 2QX8A 1OAOA 4LBVA 3GZTB 2IUSA 3UF0A 1G8GA 2IXFA 5IN5A 1A7UA 1GGVA 3O91A 4GT1A 4NBWA 5G1PA 3RTAA 3W8FA 1HQCA 1ZJWA 4UVHA 3R5HA 1FE8A 2OCBA 1T1RA 5B3LA 3L7CA 1VLHA 4LDJA 4QXMA 3ZC3A 3G5AA 3BIWA 1F3OA 4FNGA 4G67A 5IVIA 4CCYB 1PR0A 3EXIB 2CKDA 3IVXA 1O9HA 1IJEA 4BVHA 3E3AA 2Y0PA 1JFFB 4C7OA 1EK1A 1KU6A 4LOJA 2J48A 3CTPA 4OQQA 3RSSA 2FP4A 5EIAA 5TS2A 4BVEA 3KZNA 4WVLA 1QNFA 3FM9A 4PHHA 2MT9A 4ZVSA 3TLXA 1HDEA 5A5GA 2NO5A 4J4HA 1UJMA 2QZ4A 4L76A 4MVXA 2GBLC 5EMNA 3RS4A 3U4GA 4NCBA 4CF4A 4LIPD 4QNRA 2O2JA 1UBEA 4QGSA 1EKXA 5CLFA 4TMXA 1Q3KA 4FT4A 3RBVA 2OK8A 1W88A 2PPVA 4BKOA 4ND1A 2JJYA 2HSEA 1LPBB 4QVGA 4KSCA 1E3MA 1KI4A 1QYWA 4KDFA 5AUOB 4GYJA 4WTOA 1WXEA 2R48A 2H5EA 1N92A 5BP7A 2R1TB 1FMFA 4IXTA 1YZFA 1E6EA 4Y1EA 1FDUA 2QT9A 4RKQA 5JWOA 2REOA 3OT4A 3P2YA 4Q4LA 3FPKA 4BNHA 2EZ4A 3AKCA 2ORYA 4EKYA 1NQVA 4CKCB 3F7MA 5KNDD 3ELBA 1XMXA 3K72B 3QVWA 3NTQA 3LWNA 2OHJA 1RLIA 4DA7A 1UZMA 1NKTA 3EAFA 3IXMA 1Q20A 1GT6A 1T2NA 5D1NA 3TSWA 2IYFA 4YAFA 3TJZA 4BX0A 3GUYA 4KCGA 5AK6A 3W34A 1U9YA 5KYWA 1K7SN 4WEOA 4OGWA 4I9HA 3G6KA 4RD3A 5BUSA 3F7NA 3LSYA 5B37A 4FEEA 3NVKI 1P5HA 1HGXA 2QLLA 1XZEA 2QGFA 5CLHA 5REQB 3SC3A 2VSOA 4UD6A 3TMAA 1ZXLA 3EIUA 4JMLA 2HDHA 1JAHA 1Q0UA 3DW3X 3QPUA 5TX7A 2BGIA 5CURA 3VR4D 1WNFA 4EB6B 5IZ4A 4BVFA 4FS8A 5E7QA 1EVLA 4ZAGA 1C9JA 1XNRB 1EG2A 1LTQA 3A4VA 1P2BA 1ZGGA 3ZU6A 4EABA 1DIRA 1OBVA 3RAPR 1J42A 3HZOA 2O23A 3N6VA 2ZWOA 1K9VF 4HF7A 2R6ZA 5F23A 3KOZA 2ZE7A 4JBXA 4XDYA 3DKPA 1L5KA 2P67A 5F9HA 3OLYA 1NMXA 2BP7B 1K0UA 2D1SA 4LQCA 2PL1A 2DTEA 4QOEA 5EPEA 3U3DA 4A8PA 4BTVA 4E5KA 1R5OA 5I7EA 1U0SY 2HJGA 3GQBA 2NXNA 3CVVA 2GQ0A 2KX7A 4IUBS 2NVUA 4EI9A 1EHIA 5IJZA 1P44A 4V39A 3T4XA 3VR2D 2VATA 2VTVA 4GKVA 5A3RA 2NUPB 4WL0A 4LGCA 1L5YA 3CF2A 1NYQA 3JASB 3PL5A 3R4CA 4Q3KA 2J8ZA 1C3JA 2Q2WA 2PN1A 3BE8A 5U4QA 3WX0A 4G5OA 5LD2B 2IA5A 4NAUA 5AP9A 3ZBUA 1T34A 4WNIA 1AX9A 2FFBA 2XUJA 3HVKA 4LEIA 2JEYA 1E1MA 3FKSA 4MR7A 4ZRMA 1EFPB 1R9JA 3DTTA 3ZD9A 3EBLA 4L4UA 4G5XA 4GSLA 1OYWA 2EKBA 4OXYA 3ML1A 1XDSA 3ZZUA 2CJWA 4CHTA 1S9HA 2HLPA 1EGAA 1KJIA 1Y8RB 3EA5A 4GYWA 3GDGA 5SY4A 4EEXA 5ELMA 5LQNA 4AS1A 5CMLA 2C3OA 2C0QA 3F0TA 2GCOB 1XVIA 4NYIR 1RCFA 2VDQB 4C3ZA 3M89A 4KKVA 3BE6A 1TVEA 5DULA 4B4UA 4CM4B 4YMUA 1NR5A 3ICCA 1W30A 3ABQB 3FFXA 3H2YA 3NTVA 2EL9A 4O2AB 1NW3A 4K86A 2A1UA 3SF8A 3F71A 3ESZA 1JL3A 2JJ1A 4NYJQ 4X91A 4KK4A 4FGJA 3MOSA 3OI7A 4LE2A 1X3SA 1L3CA 1U2SA 2A0YA 2D0PB 1T9GR 3G2JA 4GZMA 3EXFB 4US0R 1P39A 5F5NA 2QVYX 2O5EA 4AX8A 2OHIA 3DM9B 4IDNA 1DE0A 1NJ1A 1QCDA 4PLTA 4TT3D 3ZCQA 3PUWA 5SV2A 3W5JA 2J0SA 2FK8A 5FOXA 3RR2A 4P93A 4IDDA 3N3AC 5EYPA 1R8YA 4XUGB 1TEZA 3ND8A 4L4RA 3PI6A 1P8AA 5CRIA 3QG5A 4ZQHA 2ZTVA 4C3OB 4Y1RA 4RD2A 4DCCA 1OE0A 2CXHA 1G2PA 4DLSA 1IXRC 5CYGA 1A8IA 1J2EA 1PR6A 3I62A 4BQEA 1MTZA 1YZKA 3SBEA 4KE9A 4H3SA 1DOHA 1KMIY 4Z9FA 3TD6A 3VQTA 2WTAA 4OHWA 4LOIA 1YKFA 1YH3A 2B99A 2NTJA 3WMRA 2CF6A 1A3CA 1WUTA 2R7KA 3D4NA 1MRNA 3ISVA 5K0TA 1A5ZA 1YT5A 3L1UA 5K8TA 1WV0A 4R84A 4Q6WA 1SG0A 1VSUA 3CLUD 3LRTA 3LBIA 2BDUA 1Q15A 3PZRA 1SWVA 1UM9B 3T52A 3O93A 4L0CA 1NW6A 1NXTA 5D7NA 1UAYA 4ECEA 3WYGA 5BR1A 2AI2A 3CLRD 4I50F 1NNUA 1XFDA 4K6FA 4YN3A 3OQIA 1W36B 1UBHS 4HN9A 1RIIA 5ALQA 5IDXA 3BSSA 3QFSA 2F17A 1PNVA 3E9ZA 3FBTA 2WWWA 4UNQA 4W6ZA 3V4ZA 3WADA 4E4TA 1WXFA 2A14A 3PXGA 1NG9A 2ECFA 3JARA 3U31A 2V7GA 2QQFA 1SB8A 2JFPA 3WOHA 1EWTA 1EFRA 1XTQA 2JK0A 3DCNA 3ZDXB 1CEQA 2ZS7A 3N2YA 1Z4IA 2R8YA 4IRXA 2VDKB 1H2BA 2Z1NA 4M1YA 4NAVA 2EBWA 5A3VA 3RSGA 2P78A 3N0TA 4HY3A 3L77A 4NECA 3G7UA 4AF8A 3RVRA 1QDUA 2IS4A 1KHHA 4E51A 3GDWA 4BB5A 3PQ7A 2B8JA 4Y9UA 1Z0UA 4M49A 3ZDDA 4HNSA 2GEDA 1QOPB 4JR1A 1AKRA 4Q4HB 4ZU1X 5KTRA 1UDXA 1JNXX 4C2TA 4FSDA 1HZZC 5IF3A 2QD5A 4Q3CA 2X23A 2AKAB 3DD5A 3U0VA 5LZ7A 2G9VA 3HWWA 4PYOA 3WGOA 1TQ8A 3FOBA 4FKZA 1MG5A 2OZVA 4JLBA 2FZEA 3NHFA 4RQUA 3RYIB 3DOFA 4RPHA 2WFMA 4RTJA 3FTNA 3V48A 1RYZA 5I6DA 2R1UA 1RZVA 4PXSA 1SC3A 3AKYA 3D8RA 1R8XA 3F6BX 3P0HA 4DZZA 3W5AA 4M87A 5DMXA 5CFOA 1I1NA 1VMDA 4NE2A 2FFHA 2XUFA 5GJBA 3RJZA 1ZOOA 3A26A 4U3JA 5K6AA 1XMSA 3KX2A 4KWHA 5D2CA 5I7UA 1L7RA 2IP1A 2AMLA 4QPDA 3UHOA 5KYKA 4OLAA 3FZGA 5CM9C 4RD6A 3ADOA 1NGSA 2WR8A 3FHCB 3SDZA 5LU9A 3IIKA 1H0HA 2EFEB 4MWGA 1PVDA 4CMHA 3M1YA 5KOJB 1G18A 1DBIA 1CE8B 2JI7A 4E6EA 4S04A 5GJCA 2NN3C 4YLEA 2NU9B 5DEOA 1GARA 3GGGA 1GZ5A 1HTBA 2QVZX 4JSTA 4E21A 3QVVA 1YJ8A 1NI5A 4GVLA 5FPHA 3SF8B 1P2FA 1H6AA 1ZOLA 5JCOC 3KSAC 2BOVA 1EJ0A 4JT8A 5LP6F 1UJ4A 4PG7A 5JSUA 4KQHA 2AFIB 3KOMA 1WMSA 1F7UA 1L4NA 1J0XO 4HDSA 5JISA 3EHEA 3QA3E 2W83A 4DARA 1MVLA 3AOEA 2C82A 3QUAA 3BB1A 4DLXA 4DYDA 2HM7A 1KZGB 1KK0A 2CJWB 2ICAA 3R09A 4RF5A 3G1TA 4R01A 2YH2A 2C78A 2J4DA 2QR2A 4Y6QA 3QE4A 5LXTB 3N2GB 1T26A 2FPKA 2WU3A 5MGBA 4JUBA 4X20B 3T7RA 1IZ0A 1UMDB 2BCEA 1IPEA 2QL9A 3FDIA 3HGQA 1EFPA 4S0ZA 5FOVA 1VIMA 3DBOB 4QUDA 1BXGA 4TLMB 3H1PA 3HY4A 2YDYA 3BQ9A 1E5XA 2DJ5A 1U31A 3P2KA 4ETMA 4R68A 4J2TA 1V6CA 2KYRA 1EFKA 1M74A 1A96A 2JIOA 4XRRA 3P20A 4K9DA 3EC7A 4MLDA 3WG9A 2WSYB 3JWIA 2H2HA 4QRHA 2NUPA 3T41A 3ZVRA 2I3AA 2FPIB 3U4QA 1T1IA 3RVPA 3FG9A 3H1FA 4DILA 4MUJA 1Y5NA 1Y9JA 4K9PA 3QOXA 2PZ8A 1JJIA 3T7DA 2JIBA 3ZE6A 2INGX 4PGFA 4JJEA 3OQJA 2BP7A 4PSUA 5JNSA 2BGJA 4R8MA 1HSOA 2B8EA 1EG7A 2IU4A 2HD4A 3JATB 4A8HA 2YUTA 4LHYA 3W6OA 3ZK8A 3PQ5A 1HG1A 3W0LB 1U2TA 1CRWG 3ZJ5A 4YAOA 3DV0B 2NO9A 3FTEA 1ELOA 3PQ8A 4R31A 3PIIA 1EXWA 3L1IA 4RVHA 4EJMA 3BZWA 4NMXB 3LCRA 2OO3A 2XNJA 2XVAA 3G88A 3QPCA 2OORC 1T4DA 2YUIA 1JHRA 1W44A 4GD3Q 4JELA 3RFFA 2FWIA 2X15A 3DXFA 2LBPA 5A62A 1Z6XA 2NQ8A 5H9VA 1Q21A 2QD1A 4J0HA 5JT1A 4P6VF 2M2IA 1SQSA 3QKIA 5KJCA 2HMYB 4NQZA 1TU4A 3KR2A 3H42B 5DBEX 3KWMA 4LRTB 3C39A 1Z4QA 2FWMX 5DNDA 5JYCA 3L5KA 4D3YA 5BVGB 3OQMA 1H5NA 1FFWA 2YFYA 4D9MA 1NNEA 3G0HA 3HWRA 1KH1A 1LLDA 3OY2A 5TMEA 4G01B 4LV8B 4C9BA 5BWNA 4AKHA 5TQVA 1TEHA 3Q40A 4JYCA 4PYMA 3W3ZB 4E03A 3K5IA 2Z8ZA 1K4KA 1PR4A 4CG1A 1YKSA 5HJ2A 1A5AB 3OOSA 1MQSA 4NTZA 4BJ5A 1FMJA 2RK6A 1H2FA 5SZIA 3TR5A 1OB2A 2O54A 4OUDA 1NJ5A 2J59A 4G37A 3C1OA 1ZGHA 4RWEA 1JQDA 3WLMA 4AK9A 1X1QA 4NBLA 2ORVA 2ZBVA 2VPYA 3DV9A 1ZVKA 1ZCJA 3JWEA 1SUAA 3RW9A 1L5GB 3TDMA 1T1JA 2JCBA 5FDFA 2HK9A 3P9KA 4MAFA 2R85A 5FFMA 4XYBA 4KHZA 1E1KA 2COKA 3OJ0A 4RTQA 3AJDA 3S55A 2RMKA 5FLXA 4PX9A 2J3MA 2X2FA 4ARVA 1KK3A 4DJJA 2BGGA 3QJYA 1JKFA 1YE5A 1ISFA 3GDOA 4IW3B 1KJNA 3HJBA 3S5UA 3VC3A 1LBQA 3IE0A 2F8MA 4MRNA 2WJZB 2ZUDA 2YXBA 1SWWA 3SJ7A 2B3TA 2JCGA 1UKAA 4LCJA 5DGIA 4GP6A 3O2NA 3A6DA 3CG4A 5HFNA 2WJAA 1L1FA 4ZGBA 3RUEA 2YOFA 4XVCA 3PFIA 5M5BA 1W36D 2VLBA 3EMBA 1EJBA 4Z9AA 3RNOA 5FH9A 3HP1A 4QFBA 1RJ9B 4CVNA 4G0PA 2P3SA 2M9MA 4YCSA 4NY1A 2LCIA 3U48A 4JI2B 1KDRA 4TGLA 5JR3A 1HDYA 4R1TA 1Z5UA 2AFIE 2H6EA 4IWXA 4XIIA 1RWMA 5KWVA 4PR0A 3F3KA 5CYPA 4ALNA 2IIPA 2X6RA 1ECFA 3C43A 1V7QA 3H97A 3TZKA 2V6JA 5GIOE 2CMKA 2XX3A 2EKPA 3AR6A 1DC3A 4RIIA 5I7HA 4CUZA 3RO7A 3CRRA 2WA2A 3FPCA 4B79A 4W7HA 3CX6A 5D87A 1GAXA 4EI8A 4N54A 4RKYA 4CKBB 2H7VA 4REQB 1YU6A 2OHXA 5J63A 1CNEA 3C98A 4NATA 2FP3A 4RPKA 4ZOAA 3E53A 1NRJB 5F2EA 5I7FA 2RKOA 1CP3A 3WGYA 2PVSA 3PJEA 1RHQA 4XPZA 4F4DA 2QVLA 3O94A 2EP8A 2NSLA 4QXRA 2IYQA 2VF4X 4RHTA 4UAJA 1VG9B 4H17A 2HWYA 2IRWA 5ALLA 1M2NA 1N7IA 2GA8A 1A7AA 2O14A 2Q7XA 2QUZA 2W0MA 4DA4A 2CT8A 1QGYA 4IIJA 2BM9A 3GU3A 2W90A 1EIZA 4X24A 1KEKA 3T4UA 4WLFA 5DK6A 4RADA 3E9EA 1GA4A 3LLMA 2P5UA 5TIIA 4EW6A 4MVYA 3W90A 1P1CA 3V7WA 2H65A 3EVBA 4OUDB 1E0DA 5GM2A 4B76A 1V48A 3BRSA 2X4IA 3VTFA 3E2MA 1VG8A 4XQEA 4TTSA 3SHTA 2YWEA 2VHUA 3EOZA 3CVWA 2CNNA 1J2RA 3JRWA 4CEIB 3D2LA 4HG2A 2R8RA 4UJ5A 4C0HA 4DRYA 3LU1A 4QKQA 3DAHA 1K3UB 2WF5A 3WQBA 1ZD2P 2GNAA 2YJGA 1DLJA 1OA1A 3AESA 1GN9A 3A32A 2ZE5A 2QG6A 4GL4A 2RARA 4HX2A 4BASA 1F2DA 4LOKA 4CEJB 1XYYA 2AQIA 4DHEA 5J5VA 3IJEB 5KVVA 3BWEA 1E2HA 3DOIA 4KQWA 1L6IA 2X4GA 2ETXA 4R9VA 1O6FA 3WGZA 4YCLA 3PDJA 4D0RA 1Q57A 2ZJZA 3H3XA 2F8LA 1B43A 1EWRA 1RLJA 1U9JA 2GBFA 2F00A 1XK6A 3CNHA 2ZVJA 3LK7A 5DNAA 2B37A 2Q4EA 5JD5A 4LJKA 4MPDA 4KUHA 4M76B 3DZBA 2ZRAA 4NI5A 3NUZA 4W9NA 2OCGA 1DHTA 3QXCA 1JQLB 4I2NA 1ZN2A 3ICEA 3OSUA 2D1QA 3HBLA 2BFMA 2BFBB 4PRKA 2J0QA 2RBEA 1A76A 2OVBA 3NC1C 3LZDA 4YDHB 1V11B 3UYKA 4CNQA 5DYIA 3UUGA 5JAZA 1FF9A 3ZDCA 3CPHA 3I73A 5EEGA 1E3TA 2WC1A 3NGXA 4B7XA 4DLYA 2X58A 1TYAE 1Y4DE 1YUBA 1F38A 3B1JA 5TQ2A 2G8LA 5TPZD 3STYA 3CT6A 1F4PA 1IG0A 3WLNA 3FVRA 2V3CC 3AWDA 3MOIA 4LGVA 4YWHA 2J3KA 3GK3A 3VR2A 4AKTA 4LRQA 2H31A 1U3CA 3Q87B 2X5NA 2OSBA 4QQ8A 1YZLA 4BC0A 2IDZA 3TRFA 1T9HA 2GF2A 3E3MA 1C8VB 1AQNA 1J1IA 4ESEA 3DBRA 1WB9A 4XDGA 2ZJ0A 1X80A 1GZ7A 3CIFA 5CH8A 3Q7RA 2YCLA 1BAPA 2UYQA 2P91A 1RBYA 3ZIDA 3U19A 4C0AC 3N2GA 4HADA 2VDNB 1BFUA 4MARA 4FLFA 4IXMA 1CJCA 1K8ZB 1IH8A 4GO1A 3IILA 1NN3A 3I0NA 1MT0A 2E6KA 2VDLB 4PLCA 1PO7A 3DH0A 1J2YA 5FX2A 4F1WA 2H07A 5GIPE 1KO4A 3DFKA 2BFDB 4CMBA 3I5MA 3AEYA 1USKA 1BFKA 4IILA 2AR0A 2WB2A 1Y5IA 5M2QA 4V02A 2H4WA 4WASA 4ZYWA 4WESB 2GN2A 3JVDA 4CUKA 3C3YA 1KBQA 1YVPA 3IHTA 4QEZA 4QBIA 3UO8B 3VPAA 5DYNA 1RXCA 1CE8A 4GSYA 5MF6A 2Q4BA 1TK2A 2JDIA 2XMCA 2HMWA 1D2MA 3F5SA 5BQ5A 1SXJC 3PQCA 4AN4A 4CLOB 3MWFA 1N57A 2C20A 4OLFA 5HRUA 4YMLA 3U2QA 1RQGA 3U1BA 2PZBA 1YR1A 1TQDA 2FOXA 3USCS 4M0PA 3UBTA 1L4EA 1CEYA 3AVPA 2FMHA 3FD8A 5FJJA 2IPXA 1XCLA 4Q1BA 2XAUA 1XZQA 2Q9AA 4TM7A 3WBJA 4WXMA 4I99A 1YR8A 4JC5A 1BA2A 3PC2A 3PC3A 4IH9A 3ENZA 4IV5A 4B6PA 3IXLA 4FZRA 1U0LA 2IF0A 3BMNA 5LBUA 4WLVA 5LB2A 2PMCA 2CDBA 1CNMA 3I04A 4QNNA 2P2GA 4JJGA 3QVSA 3ZWOA 1YB4A 2AWOA 3DVAB 4INPA 2QRNA 4YECA 1BS1A 3L7NA 1OGJA 4CR7A 1MB0A 1GR1A 1RYHA 2ZJ3A 1XUOA 3I83A 2GPTA 3PC7A 3PE4A 7YASA 4YJFA 1EK5A 3R5FA 4CLRB 1TYDE 2WI8A 3QKWA 2GWRA 2C00A 5FEMA 5DCWA 2IY8A 3VPBA 3ZG6A 1SJ9A 4G81A 4JOCA 2HGZA 4EYEA 1GEGA 4RF2A 4D0NA 3G2IA 3KR1A 3TSCA 1U1GA 1D6NA 5GAJA 3UPUA 4COOA 3HFGA 1ODTC 1IQUA 2Z83A 5EWMB 4TQGA 1PSDA 3MTBA 3N74A 1VE9A 2RB5A 4RPCA 3F98A 2HU8A 3JZDA 4GOMD 4HMQA 4MJ3A 4V0KA 3VO9A 4YMVA 3B5EA 4KBYA 2AOVA 5IM5A 1Q7RA 4W4TA 3ZIAD 2QG4A 4N65A 5HKKD 3UAXA 2GETA 1JXAA 3SQOA 2HCFA 5JMTA 2ZATA 5F3DA 1WMEA 3BIFA 3RAJA 4EYSA 2BZ1A 2HA4A 3FWNA 3B1WA 3S1LA 4CKWB 2WF8A 1DCTA 4ER7A 4CF7A 3DDOA 3A9TA 1GU0A 3NYIA 4IWNA 2KPOA 4YROA 3L8DA 1KVUA 4BNFA 4D4GA 1VC2A 1RTKA 1DI0A 3JARB 1O6CA 3LFTA 1J25A 4ZCTA 3GH3A 4DSAA 4UCWA 3SPXA 2PJUA 3VHRA 4WHMA 3IAEA 4FE3A 4C1NA 3UKDA 1UJ2A 3BQMB 1IOWA 3U1TA 2HJWA 1YR2A 1P5RA 4BP3A 1YRAA 4AQDA 3WTCA 4B35A 3NIDB 5FLYA 2DWCA 2G1AA 2VJMB 4XR4A 3FPBA 2O5CA 2H7CA 3KXDA 5BORA 4Q9NA 3VOBA 1BMTA 1UM9A 3WOVA 2O9JA 1ZN8A 2DKOA 1JYFA 1SHKA 3C4QA 4HAIA 3R7NA 2IOFA 1KDZA 1BG6A 3R7AA 1UMBA 4ISBA 4IMIB 4AJ2A 1A9XA 3TZLA 3KQKA 2XA2A 3T6KA 5L3SB 1C41A 1PR9A 3VYTB 4Z4QA 3I04M 4Z53A 2FSVA 2JGKA 3G2KA 4OVKA 4Y8VA 2CXXA 4MQ6A 1IOLA 4RYLA 1SHZA 1QV9A 1EQUA 2ORWA 1TADA 3C3CA 3LKZA 4OH7A 4YTEA 3FHOA 5JJKA 4BNYA 2WLTA 2OZLA 5HR5A 1I7DA 3AETA 1ZVJA 4IGKA 1ESEA 4KRYA 3ZWKA 1JEYB 2ALJA 5BW8A 2YRFA 1NG1A 2UZAA 1G5HA 1NIJA 1B3BA 4LHSA 4MMXB 4MV8A 2OC9A 1QOZA 2OT3B 4LXXA 4WX2B 2C94A 2DHDA 4HNHA 4YPOA 1G38A 3TUZC 4QNMA 5IC6A 4EZEA 3NUQA 3L4BA 3GJSA 1YZ3A 2XXJA 2FHSA 3CVYA 1KVRA 3ZTWA 2B4TO 4C7KA 5B1YA 4BMNA 5B4VA 1PNOA 3JAWB 4OU5A 5HZMA 4LOAA 2CLKB 4P9NA 1EZ1A 1QVWA 4KSBA 4XQ9A 5IKOA 1TQ6A 2O6LA 4Z2AA 3P9QA 2IHJA 5DT2A 4JUIA 4LAFA 4MVJE 1EBFA 2NG1A 4ZV7A 1OH7A 1T5HX 2ONJA 1D0VA 1YOVB 3H9CA 5KYYB 1RJDA 1Y89A 2OGWA 5AJHA 3N0WA 3ZWYA 3GLIE 1KAEA 4DJEC 3DFFA 4HDMB 4JBIA 4CGYA 3T9AA 3THXA 2JGEA 2ZAYA 3ME5A 1XLTA 5GOTA 5AW0A 1MZPA 3JPWA 3GLGB 2ADFA 2FPOA 3IUNA 3COSA 3HDJA 4E46A 4QTUB 5KIAA 2FPMA 1J8MF 1HEUA 3K0FA 1RYEA 1NQTA 1IN4A 1GRRA 4OGKA 4CMIA 1TAGA 4LXYA 1YL7A 1FMTA 4KAFA 2ST1A 3BL6A 4MR7B 4QDUA 4E3ZA 3TL6A 2XUIA 1ORIA 4C20A 3A36A 5I48A 1E2LA 4YAEA 2V7XA 3LLCA 2IWRA 3U4CA 1JHZA 3B60A 4GBJA 3IAAA 4XWOA 2B35A 3H4MA 4MIYA 5ESDA 2NPFA 4XPIA 4IBOA 4CQMB 1VP9A 1RM3A 5C1PA 3JQDA 3TINA 3DEHA 1VL0A 4HZIA 4IFTA 4U7WA 4BN5A 4R8LA 4BB9A 2ZANA 2MDTA 4Q9JA 1VKNA 3B6KA 2PQ0A 3LX6A 4LQLA 4FM9A 5K0NA 2QV0A 4EECA 4CMEA 1B2RA 4YQZA 4BRUA 1E1NA 3PPWA 3N75A 1G9SA 5DTJA 4Q5IA 5A5DA 3KZCA 3Q98A 3T9EA 3ZLUA 3Q9SA 4MHSA 2VTDA 2QLBA 2R6FA 1I4LD 2QTRA 2PSFA 4B8YA 1XRPA 4R1LA 5JALA 1QTRA 3MTEA 1JG4A 3LQYA 2PUCA 2JFHA 4QUHA 2AQHA 4BJ1A 4D8TA 1T5TA 3LWDA 3BH0A 2OXEA 2W6JD 5KPDA 4L5YA 2ZRGA 4C6HA 2NT4A 2BEWA 2B7CA 1Q7EA 2D1RA 2EDCA 3KLBA 3MBKA 4RKEA 2FRXA 4H6WA 4LY6A 2XZDA 4WKNA 4FFWA 3SD7A 3AOGA 2ACEA 1SGWA 3H05A 1NT2A 3KCNA 4UM5A 3TKYA 3WXMA 3I9NA 4BLOA 2PKYX 4B17A 5TPWB 1K5PA 3SC4A 1J00A 3A1EA 4B0PA 4LC9A 4MS3A 3O1JC 1V4NA 5HIIA 4JI7B 1HL7A 3PDHA 3GPDG 2AMVA 3G89A 1N5OX 4L3WA 3VH3A 1ZD9A 4ZJPA 1NFRA 1W0CA 1D1PA 1OMOA 1Q77A 1GPH1 3D2CA 3G9UA 5BRJA 4LI3X 1C7QA 2ID7A 1PJQA 2NXWA 4S1PA 4EB0A 3IBGA 2RHOA 1CR4A 1X7YB 3A9RA 3BK2A 3E9NA 4MLPA 4PC1A 2F55A 1CHDA 4TROA 2QUKA 1GNSA 4CR8A 1BU8A 3H5WA 3K0CC 1RYYA 4E11A 1M9NA 2VPWA 5HTOA 3L7DA 3KB6A 4WJLA 4H0NA 4NZOA 3DF7A 4DQKA 1UFOA 3BF7A 2YRXA 5DTRA 4ZQGA 4DJTA 1KORA 1ZM7A 5EP2A 1QFJA 4MEBA 3CA8A 5G0TA 4DJFC 2E7ZA 5KB3A 1DAFA 4B75A 1VSBA 2E4XA 4PTLA 3E5NA 4YCBA 1E4EA 5TPZA 1WZNA 3JQ7B 1E1QD 1FNSA 2XV1A 4K88A 3RLFA 3HXLA 1UBRS 4EAQA 3AJ9A 1BDHA 1KBZA 4K05A 3HCDA 3KYJB 1CY7A 1W73A 4DIFA 3RCBA 5AVYA 4Q1FA 3C8ZA 4YEDA 1U2QA 3NBAA 3RVSA 2VSQA 1TU3A 1X9IA 4CCYA 1Z4LA 1XMQB 3V8NA 1VL5A 4X7PA 1QYCA 2B82A 2MINA 3G13A 3OAAD 5FF9A 4AP5A 5JNUA 1NMZA 2I6SA 4K6KA 5AVQA 5AK4A 2FEAA 1CZLA 4A82A 3ILVA 5JASA 4YVFA 3QBTA 2DRIA 2RGYA 1PU2A 1DXYA 4I46A 4J1SA 1K97A 2BPOA 1T9DA 4MI1A 5AK3A 5FL3A 1KZHA 3TCXB 3ZYCA 3U3KA 4PHFA 1UXOA 2I34A 2R62A 3DEJA 3DE2X 4O4JA 1NVTA 4ZO6A 3THRA 3RAGA 3TLZA 3I6ZA 4K6OA 4ZMRA 1KAGA 1XDBA 2UUOA 4ZVOA 5LYJA 3WNBA 1U5CA 2R97A 3B3JA 1JGTA 3DMHA 4MWBA 1P3DA 3LPNA 5IULC 1SQGA 1CVLA 2AZMA 4FTWA 1YI8A 3K92A 4AIRA 4D9KA 4CV2A 1AKEA 2D2FA 3ER9A 3WLAA 2PPLA 5JD6A 3C5WP 2VHXA 2VWPA 4KVAA 2FGJA 3OH8A 2IYOA 3O84A 3TYXA 5BUZA 1NLZA 2J09A 3Q9NA 4XTRA 1Y6ZA 3Q5GA 4EA8A 1L4GA 4EPRA 5BW4A 1M34B 3AFHA 5LMZA 4HS4A 4CL0A 3B9QA 1OC4A 1UK6A 3IAS6 5GJWC 3UM9A 1M1NB 1ZQ1A 3HUEA 2CSXA 3UJDA 2I2AA 1MB4A 1RLMA 3IDOA 2FHPA 3Q3VA 5TF0A 1DP4A 1CEEA 3DZKA 2O2EA 2PTGA 1P73A 2J6HA 1QG6A 2GSDA 5DHTA 4U7FA 3TIIA 4FEAA 1Z28A 2HHJA 2V5VA 3OJCA 3QH4A 1KE2A 4NWIA 4B8ZA 4F96A 3LXMA 3IV7A 3L4SO 4E2ZA 4NENA 1I7LA 3S0JA 4YAIA 4URXR 3SIXA 2YC2C 3AF2A 1QX4A 1R0BA 1XTUA 3MJCA 2GASA 1DBSA 2YFHA 3TN7A 2YQZA 3OHPA 4JYPA 1RWXA 4ZV4A 1M6EX 1EDOA 3LP6A 1T4BA 1QZUA 2WT8A 2GF0A 1MQ8B 3LK6A 2IPMA 4JT4A 1DUSA 4YO8A 4K9KA 3V4PB 5JCJD 2XB8A 3AMVA 4Y6SA 1SCUB 3ZXXA 2ZSAA 3MLBA 2Z2ZA 4YXFA 1N78A 1Q22A 2IYNA 3M6IA 2GVDC 4YFVA 3KB8A 5JAIA 1JXQA 3OM9A 3JX9A 3IULA 2RSLA 4G26A 3OIYA 1VPTA 2IXGA 1YVRA 4GZ3A 3D1JA 4L5JA 5LBTA 1ZH2A 3W5HA 4FHEA 4Z49A 2DGDA 2OILA 3D3WB 9LDBA 1J33A 1TIBA 2EYQA 3AXSA 1CG6A 2IFTA 3CVJA 3FNIA 2PNJA 5BR7A 5JNRA 4G6ZA 3SZGA 4LSZA 1RTTA 4ZMSA 1JJBA 4DA6A 3ZVMA 2AH5A 1QR6A 2O59A 4NP6A 2FVXA 3V8BA 3F6PA 5HK8A 4P4LA 2QK4A 4RY2A 4Q00A 5I9SA 3DAYA 1LPSA 1AM4D 5ALZA 1OI2A 3X2FA 4XQCA 4ZOLA 3VI4B 9LDTA 3EGDA 2PT5A 3L6UA 4HPWA 1GU7A 1Q1QA 1G6OA 1YACA 1V39A 4DRXB 1N2HA 5BXYA 2NQ2C 1QF9A 3CRZA 5I5EA 2RGNA 2UZ3A 3JALA 2YQ4A 1N9GB 3EISA 4FYVA 4PC7A 1AO3A 2ZRDA 4LNUB 3I92A 2GZMA 2WFAA 1U3UA 4QFCA 3IOBA 1B4DA 5G4KA 2G5CA 4V0ME 1LUAA 4GXQA 1OX6A 2ZVDA 2ZTHA 3F5DA 3EPHA 4MCJA 1TLFA 4JI6B 1EFAA 1CF2O 2XWSA 3DB2A 1XI2A 4M0DA 3BGWA 1T6YA 3B1KA 1LSOA 3H7AA 4HTFB 2XZLA 1ARZA 3HVUA 1IUKA 2H16A 2JLZA 3LBYA 1T1GA 4FWBA 5A4MS 4TV9F 4CLXA 5DNUA 1GCAA 3FRIA 1QYXA 4ND3A 3IUJA 4Q1DA 3JQGA 3FMIA 4KO8A 2J0EA 4PM4A 3U9LA 3GLFB 1I01A 3O82A 2TECE 4C4TA 4TS4A 4JU9A 3GR6A 1D07A 2CNLA 1JN0A 1A9YA 1XG5A 3WGJA 1RHKA 3PNYA 3B1XA 1YO6A 2RGNC 3KHTA 3EGEA 1XZPA 3K31A 1H2AS 1VLMA 3H5NA 2F43A 3I39X 1MC5A 3IDZA 3R7FA 1BHQ1 1P2VA 2VL7A 4Q7KA 3ZDAA 1KZ6A 4TMVA 3U5TA 1S2IA 1B8PA 1MZVA 4EB3A 2CV0A 4DABA 3MSCA 5JH7A 5EERA 1MRSA 1G4UR 1O89A 2BFFA 3AYXB 5GVSA 4BVBA 1V2HE 4TTTS 3WK4A 4ESVA 1Z4JA 1WPQA 1U7TA 1LPNA 3PXEA 2Y92A 3OIFA 3AHJA 3FDXA 4EKDA 1WZ2A 4WCDA 3ZV5A 3L9XA 4HXEB 3TZHA 1AGRA 1Z56C 3K2IA 4ZYTA 3BSFA 1SUCA 1YNSA 2QAGB 3ETEA 1A95A 1JMVA 3AUXA 3PV0A 4IDAA 3ZNQA 1U4OA 3E8SA 4QFDA 2ENWA 4OAQA 5CK5A 4B2YA 1SKBA 1P5ZB 4UMVA 3OUZA 3CB4A 1OD6A 3K0BA 3ID6C 4RDXA 4GEGA 1DV2A 4GXNA 1LS6A 1IXZA 1Z5VA 1P29A 3EXEA 3I30X 4RM2A 2UZ0A 4BO9A 1RQPA 1Y3CE 3K9QO 4GP7A 2I4MA 4L28A 4BL5A 4ENTA 2OXTA 3OZWA 1X87A 2RJOA 3DFUA 1T3LA 3MYRA 4Y6GB 1L7EA 4A91A 2H85A 2IQIA 1C50A 1Y1TA 1TQ2A 3AI2A 3DKVA 1EM6A 1JQ5A 3IQIX 2DHQA 3OCXA 4FZJA 4MYSA 3UN1A 1ORDA 4P83A 1INLA 2CLMB 4QJIA 5BNTA 5MN4A 4YRNA 3AGQA 4EF6A 1ZAKA 2JCSA 2PUVA 3P4UA 4RXTA 3VVBA 1QHNA 1R5NA 3WIEA 1J09A 3MMXA 4DQXA 4WSOA 5MN5A 3QBJA 1MX9A 2NAPA 3B70A 2E4WA 4ZQBA 4IFIA 4B43A 5B30A 2QPOA 2O2HA 2FZCA 2GZHA 4FCCA 5GONA 5K3OA 2PVCA 2Q4RA 4I66A 4PC6A 4UTXA 3OM8A 3SZ3A 4H3KB 1M2WA 4C6SA 2C2XA 2A6PA 4LXIA 1Z5WA 2IHVA 3W5CA 2W2LA 4KIUA 7MDHA 4WLEA 4MB0A 3GCGA 2HX1A 4MA0A 4E1BA 2XITA 2EKZA 2ZI3A 3LFUA 3UZUA 5LWHA 3SEZA 1AN9A 1JW9B 3W5DA 1Y8AA 1WSWA 5AKIA 4LBYA 1U28C 3J7TA 3V4SA 5F1KA 1M0EA 1GTZA 5DGDA 4RS4A 2BKUA 4A8JC 1EXDA 3N2EA 3ITKA 5JOQA 2AJCA 1V41E 1BE6A 2A9VA 1REQA 3HRKA 3OF3A 4IZ6A 1B8NA 2C5FA 3MINA 4RH0A 4RLFA 4H7DA 4K1XA 2OKCA 3R6LA 1TM4E 5I5GA 2WAAA 3GFPA 1K7FB 4LCEA 3SDBA 4BNUA 5BOSA 2C54A 3FCAA 3AO0B 3P97A 1NDUA 4L8YA 4FVTA 3FNGA 1TAQA 3I76A 1KY2A 1H65A 3LFHA 4A26A 2IEAA 3R8CA 5FNVA 1SOMA 3FVWA 2BKXA 1P1HA 1XRLA 3F9IA 3HN2A 3IUYA 4PHCA 4C0JA 3LAWA 1AK1A 2ZIGA 3FSEA 4QAQA 3HU2A 2NX2A 1ECLA 1L7NA 4U2EA 1KJQA 3HADA 4JODA 2ZJ1A 1DJPA 1Z06A 4KU4A 1JQAA 1RQNA 1GTMA 3GRUA 1HYQA 2PAFA 4L5AA 5K3CA 4D56A 1ECGA 2K87A 1E99A 3OTGA 1Q1EA 3NIWA 1PT7A 1SRRA 3N8DA 2C2MA 5IT9A 1GYPA 3EVAA 5DLQC 1NJSA 1XV5A 1ZN7A 1KNQA 3U80A 5KYYA 3PKIA 4ZEWA 5ALVA 4HQOA 3G68A 4G8CA 3VOAA 5KHOC 4QPZA 4HQLA 5KHAA 1BO6A 2O57A 2FKAA 2BCJQ 2GJKA 4OJMX 3EF3A 2DVMA 2AN9A 4Q4AB 3K09A 5F64A 4C4OA 3KJZA 3H9BA 3Q4GA 5ALPA 3OEEA 4FKMA 3EC2A 3IAS1 3WO0A 3R76A 2BFCB 1ND6A 3IR5A 1IY8A 4N0MA 3SYLA 4UHFA 3SX0A 3WLKX 1T0HB 3RK1A 2WQ7A 3NC0C 4OHMA 5FWXB 3VC7A 5KOIA 5MDHA