1N3KA

Solution structure of phosphoprotein enriched in astrocytes 15 kda (pea-15)
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
130
structure length
130
Chain Sequence
MAEYGTLLQDLTNNITLEDLEQLKSACKEDIPSEKSEEITTGSAWFSFLESHNKLDKDNLSYIEHIFEISRRPDLLTMVVDYRTRVLKISEEDELDTKLTRIPSAKKYKDIIRQPSEEEIIKLAPPPKKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Recognition of ERK MAP Kinase by PEA-15 Reveals a Common Docking Site Within the Death Domain and Death Effector Domain
pubmed doi rcsb
source organism Cricetulus griseus
molecule tags Apoptosis
molecule keywords Astrocytic phosphoprotein PEA-15
total genus 30
structure length 130
sequence length 130
ec nomenclature
pdb deposition date 2002-10-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01335 DED Death effector domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.533.10 Mainly Alpha Orthogonal Bundle Death Domain, Fas Death Domain, Fas 1n3kA00
2P1HA 2NZ7A 2HM2Q 4M9SA 2DBDA 1E41A 4M9XA 1A1WA 2N00A 2OF5A 2MPCA 4O7QA 2DBHA 3MOPA 2LWDA 1A1ZA 2OF5H 2DO9A 4EWIA 4NQKA 2N83A 3MOPG 1PN5A 2NSNA 3KATA 4P4HA 4F42A 1DGNA 4IZAB 1D2ZB 2O71A 4N1LA 4JUPA 2NAQA 1WMGA 1WH4A 2L9MA 4F44A 1CWWA 2LS7A 2KM6A 4ZBWA 2BBRA 2N7ZA 2M5VA 3CL3A 3YGSC 2YVIA 1WXPA 4A2WA 1ICHA 3J6JA 4JQWA 1CY5A 4RHWE 4UZ0A 2MB9A 3EZQA 3LQRA 4N1KA 2L6AA 3YGSP 2BBZA 3CRDA 4A2QA 3QF2A 1NGRA 4I16A 3T6PA 2DBFA 3MOPK 4N1JA 2G7RA 2GF5A 4QOBA 3J63A 2YGSA 4O9FA 4O9LA 2N80A 2A9IA 2IB1A 2KN6A 2YU0A 2YQFA 1E3YA 4FH0A 2A5YB 4D8OA 1Z6TA 2MS7A 2LWEA 2MS8A 4IZ5E 4LWDA 2N1FA 2B1WA 1D2ZA 3LQQA 1DDFA 4M9ZA 4DWNA 2D96A 1YGOA 1FADA 4P4HI 1C15A 2VGQA 4O6XA 2F1SA 1N3KA 2N97A 4E9MA 2DBGA 3EZQB 4RHWA 2MN4A 1UCPA 4IZ7B
chains in the Genus database with same CATH superfamily
2P1HA 2NZ7A 2HM2Q 4M9SA 2DBDA 1E41A 4M9XA 1A1WA 2N00A 2OF5A 2MPCA 4O7QA 2DBHA 3MOPA 2LWDA 1A1ZA 2OF5H 2DO9A 4EWIA 4NQKA 2N83A 3MOPG 1PN5A 2NSNA 3KATA 4P4HA 4F42A 1DGNA 4IZAB 1D2ZB 2O71A 4N1LA 4JUPA 2NAQA 1WMGA 1WH4A 2L9MA 4F44A 1CWWA 2LS7A 2KM6A 4ZBWA 2BBRA 2N7ZA 2M5VA 3CL3A 3YGSC 2YVIA 1WXPA 4A2WA 1ICHA 3J6JA 2XV9A 4JQWA 1CY5A 4RHWE 4UZ0A 2MB9A 3EZQA 3LQRA 4N1KA 2L6AA 3YGSP 2BBZA 3CRDA 4A2QA 3QF2A 1NGRA 2MJMA 4I16A 3T6PA 2DBFA 3MOPK 4N1JA 2G7RA 2GF5A 4QOBA 3J63A 2YGSA 4O9FA 4O9LA 2N80A 2A9IA 2IB1A 2KN6A 2YU0A 2YQFA 1E3YA 4FH0A 2A5YB 4D8OA 1Z6TA 2MS7A 2LWEA 2MS8A 4IZ5E 4LWDA 2N1FA 2B1WA 1D2ZA 3LQQA 1DDFA 4M9ZA 4DWNA 2D96A 1YGOA 1FADA 4P4HI 1C15A 2VGQA 4O6XA 2F1SA 1N3KA 2N97A 4E9MA 2DBGA 3EZQB 4RHWA 2MN4A 1UCPA 4IZ7B
chains in the Genus database with same CATH topology
2P1HA 2NZ7A 2HM2Q 4M9SA 2DBDA 1E41A 4M9XA 1A1WA 2N00A 2OF5A 2MPCA 4O7QA 2DBHA 3MOPA 2LWDA 1A1ZA 2OF5H 2DO9A 4EWIA 4NQKA 2N83A 3MOPG 1PN5A 2NSNA 3KATA 4P4HA 4F42A 1DGNA 4IZAB 1D2ZB 2O71A 4N1LA 4JUPA 2NAQA 1WMGA 1WH4A 2L9MA 4F44A 1CWWA 2LS7A 2KM6A 4ZBWA 2BBRA 2N7ZA 2M5VA 3CL3A 3YGSC 2YVIA 1WXPA 4A2WA 1ICHA 3J6JA 2XV9A 4JQWA 1CY5A 4RHWE 4UZ0A 2MB9A 3EZQA 3LQRA 4N1KA 2L6AA 3YGSP 2BBZA 3CRDA 4A2QA 3QF2A 1NGRA 2MJMA 4I16A 3T6PA 2DBFA 3MOPK 4N1JA 2G7RA 2GF5A 4QOBA 3J63A 2YGSA 4O9FA 4O9LA 2N80A 2A9IA 2IB1A 2KN6A 2YU0A 2YQFA 1E3YA 4FH0A 2A5YB 4D8OA 1Z6TA 2MS7A 2LWEA 2MS8A 4IZ5E 4LWDA 2N1FA 2B1WA 1D2ZA 3LQQA 1DDFA 4M9ZA 4DWNA 2D96A 1YGOA 1FADA 4P4HI 1C15A 2VGQA 4O6XA 2F1SA 1N3KA 2N97A 4E9MA 2DBGA 3EZQB 4RHWA 2MN4A 1UCPA 4IZ7B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2P1H A;  2NZ7 A;  2HM2 Q;  4M9S A;  2DBD A;  1E41 A;  4M9X A;  1A1W A;  2N00 A;  2OF5 A;  2MPC A;  4O7Q A;  2DBH A;  3MOP A;  2LWD A;  1A1Z A;  2OF5 H;  2DO9 A;  4EWI A;  4NQK A;  2N83 A;  3MOP G;  1PN5 A;  2NSN A;  3KAT A;  4P4H A;  4F42 A;  1DGN A;  4IZA B;  1D2Z B;  2O71 A;  4N1L A;  4JUP A;  2NAQ A;  1WMG A;  1WH4 A;  2L9M A;  4F44 A;  1CWW A;  2LS7 A;  2KM6 A;  4ZBW A;  2BBR A;  2N7Z A;  2M5V A;  3CL3 A;  3YGS C;  2YVI A;  1WXP A;  4A2W A;  1ICH A;  3J6J A;  4JQW A;  1CY5 A;  4RHW E;  4UZ0 A;  2MB9 A;  3EZQ A;  3LQR A;  4N1K A;  2L6A A;  3YGS P;  2BBZ A;  3CRD A;  4A2Q A;  3QF2 A;  1NGR A;  4I16 A;  3T6P A;  2DBF A;  3MOP K;  4N1J A;  2G7R A;  2GF5 A;  4QOB A;  3J63 A;  2YGS A;  4O9F A;  4O9L A;  2N80 A;  2A9I A;  2IB1 A;  2KN6 A;  2YU0 A;  2YQF A;  1E3Y A;  4FH0 A;  2A5Y B;  4D8O A;  1Z6T A;  2MS7 A;  2LWE A;  2MS8 A;  4IZ5 E;  4LWD A;  2N1F A;  2B1W A;  1D2Z A;  3LQQ A;  1DDF A;  4M9Z A;  4DWN A;  2D96 A;  1YGO A;  1FAD A;  4P4H I;  1C15 A;  2VGQ A;  4O6X A;  2F1S A;  1N3K A;  2N97 A;  4E9M A;  2DBG A;  3EZQ B;  4RHW A;  2MN4 A;  1UCP A;  4IZ7 B; 
#chains in the Genus database with same CATH topology
 2P1H A;  2NZ7 A;  2HM2 Q;  4M9S A;  2DBD A;  1E41 A;  4M9X A;  1A1W A;  2N00 A;  2OF5 A;  2MPC A;  4O7Q A;  2DBH A;  3MOP A;  2LWD A;  1A1Z A;  2OF5 H;  2DO9 A;  4EWI A;  4NQK A;  2N83 A;  3MOP G;  1PN5 A;  2NSN A;  3KAT A;  4P4H A;  4F42 A;  1DGN A;  4IZA B;  1D2Z B;  2O71 A;  4N1L A;  4JUP A;  2NAQ A;  1WMG A;  1WH4 A;  2L9M A;  4F44 A;  1CWW A;  2LS7 A;  2KM6 A;  4ZBW A;  2BBR A;  2N7Z A;  2M5V A;  3CL3 A;  3YGS C;  2YVI A;  1WXP A;  4A2W A;  1ICH A;  3J6J A;  2XV9 A;  4JQW A;  1CY5 A;  4RHW E;  4UZ0 A;  2MB9 A;  3EZQ A;  3LQR A;  4N1K A;  2L6A A;  3YGS P;  2BBZ A;  3CRD A;  4A2Q A;  3QF2 A;  1NGR A;  2MJM A;  4I16 A;  3T6P A;  2DBF A;  3MOP K;  4N1J A;  2G7R A;  2GF5 A;  4QOB A;  3J63 A;  2YGS A;  4O9F A;  4O9L A;  2N80 A;  2A9I A;  2IB1 A;  2KN6 A;  2YU0 A;  2YQF A;  1E3Y A;  4FH0 A;  2A5Y B;  4D8O A;  1Z6T A;  2MS7 A;  2LWE A;  2MS8 A;  4IZ5 E;  4LWD A;  2N1F A;  2B1W A;  1D2Z A;  3LQQ A;  1DDF A;  4M9Z A;  4DWN A;  2D96 A;  1YGO A;  1FAD A;  4P4H I;  1C15 A;  2VGQ A;  4O6X A;  2F1S A;  1N3K A;  2N97 A;  4E9M A;  2DBG A;  3EZQ B;  4RHW A;  2MN4 A;  1UCP A;  4IZ7 B; 
#chains in the Genus database with same CATH homology
 2P1H A;  2NZ7 A;  2HM2 Q;  4M9S A;  2DBD A;  1E41 A;  4M9X A;  1A1W A;  2N00 A;  2OF5 A;  2MPC A;  4O7Q A;  2DBH A;  3MOP A;  2LWD A;  1A1Z A;  2OF5 H;  2DO9 A;  4EWI A;  4NQK A;  2N83 A;  3MOP G;  1PN5 A;  2NSN A;  3KAT A;  4P4H A;  4F42 A;  1DGN A;  4IZA B;  1D2Z B;  2O71 A;  4N1L A;  4JUP A;  2NAQ A;  1WMG A;  1WH4 A;  2L9M A;  4F44 A;  1CWW A;  2LS7 A;  2KM6 A;  4ZBW A;  2BBR A;  2N7Z A;  2M5V A;  3CL3 A;  3YGS C;  2YVI A;  1WXP A;  4A2W A;  1ICH A;  3J6J A;  2XV9 A;  4JQW A;  1CY5 A;  4RHW E;  4UZ0 A;  2MB9 A;  3EZQ A;  3LQR A;  4N1K A;  2L6A A;  3YGS P;  2BBZ A;  3CRD A;  4A2Q A;  3QF2 A;  1NGR A;  2MJM A;  4I16 A;  3T6P A;  2DBF A;  3MOP K;  4N1J A;  2G7R A;  2GF5 A;  4QOB A;  3J63 A;  2YGS A;  4O9F A;  4O9L A;  2N80 A;  2A9I A;  2IB1 A;  2KN6 A;  2YU0 A;  2YQF A;  1E3Y A;  4FH0 A;  2A5Y B;  4D8O A;  1Z6T A;  2MS7 A;  2LWE A;  2MS8 A;  4IZ5 E;  4LWD A;  2N1F A;  2B1W A;  1D2Z A;  3LQQ A;  1DDF A;  4M9Z A;  4DWN A;  2D96 A;  1YGO A;  1FAD A;  4P4H I;  1C15 A;  2VGQ A;  4O6X A;  2F1S A;  1N3K A;  2N97 A;  4E9M A;  2DBG A;  3EZQ B;  4RHW A;  2MN4 A;  1UCP A;  4IZ7 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...