1N3NB

Crystal structure of a mycobacterial hsp60 epitope with the murine class i mhc molecule h-2db
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
99
structure length
99
Chain Sequence
IQKTPQIQVYSRHPPENGKPNILNCYVTQFHPPHIEIQMLKNGKKIPKVEMSDMSFSKDWSFYILAHTEFTPTETDTYACRVKHDSMAEPKTVYWDRDM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural analysis of mycobacterial and murine hsp60 epitopes in complex with the class I MHC molecule H-2D(b)
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
molecule keywords H-2 CLASS I HISTOCOMPATIBILITY ANTIGEN, D-B ALPHA CHAIN
total genus 14
structure length 99
sequence length 99
chains with identical sequence D, F, H
ec nomenclature
pdb deposition date 2002-10-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1n3nB00
3CXHJ 5T5FH 4U1NB 3W0WA 1J0YA 1KB5H 4DN3L 3D2UD 2CUMA 4RFOH 2A38A 1YECH 5H37H 2FLBT 1BQUA 3BVNB 4X4ZA 4LASL 5C0IB 4N5ED 1IAOA 5CSZB 1GSMA 1FZKA 1QRKA 3EFFB 2W0FB 5KS9A 4MAYA 2EIDA 1BM3L 3U7WH 2XN9B 3CFCH 1Y0LB 1B0GB 3IXAB 5BV7L 4Y19D 4GMSL 2NTSP 3RQ3A 3MRHA 4WEUD 5JNYA 4Q9BA 3BT2L 4FQHA 1CT8B 1T0PB 2VZVA 5ENWB 3KPOB 1ED3B 4WUKL 5D5MA 5E24E 4EI5B 3TH2T 3REVA 3MUGB 1SHMA 4ORGA 2CPCA 3QO0A 2WINB 2M8XA 3ZTNH 3QG6B 3LD8B 4L3EA 1R3KB 3RDTD 5I1HL 3HRZB 3D85A 1K9TA 4Y16C 5EC2B 1NEZB 2Y5TB 2X1OA 3NACH 4I77H 3IAGC 5K33A 5HYEA 4AMKL 1IM9D 5CLTA 1R0AL 2PO6B 4XHQA 1VCAA 3QUYC 3GBNH 1MRDL 3SDXF 3V5DB 3C6LC 4N0YH 1MAML 3HI5L 4O02L 4M8VA 5C07E 2FJGB 3DARA 4IDLA 4MHHI 3D6GA 3MRNB 4K94C 2Q20A 3N1PC 1A8JH 2IQAB 1FL6B 1EK3A 1I7TA 1TXKA 1KGCD 1KJVA 1NC4D 4TVPD 1JE6A 3VXRA 3GMOB 3SDXA 5IEHA 5I6XB 3ZDYF 3NABH 3WFZA 5KSAB 4KXZH 5C9JA 3JVGC 4JRYD 4PJFA 5F7LB 1WC7B 4HK0B 1LHZA 5IR1A 1ODAA 1JYVA 2HFFB 1KCLA 1IT9L 1QHOA 2P7TA 3VFRA 5I76A 1NGQL 5FGBA 4L4VE 3BP7A 3GSQA 4X4XA 1EHLL 5D8JL 4YQXL 5BVPH 2P45B 3PGDB 2IAMB 4IRJC 4R9HA 2AV1B 4Z0XB 4WFEE 4LLDA 2XZAL 4CVWA 2CIKB 4UDUA 2CR3A 3RBSA 5L9DH 5F93C 3QZWB 4YHLH 5C3TA 3TVMA 2XPGB 4ERSH 5AUMB 5CP3A 4G42B 4YUEL 5BMFH 3ULUH 4PTTA 3HMXA 3BQUA 2DI9A 1FV1B 4ODBD 5EZJA 5I1AB 4M1GH 1P7KB 1MVFA 4LFHD 1JRHL 5AYUL 2EIEA 1MQKL 3QDJE 3T4AA 5DMJB 1QBMH 3MV7B 2FRGP 3O3EB 25C8L 3I6GA 1NL0L 4S1RH 1FLRL 3QO0B 5ADOH 4G9FE 4ZO8A 1EHXA 2AJSL 3VGEA 1BQHG 1B4JH 1N0XL 4LLYA 4QHLB 5GGQL 4N8VA 1X5AA 3MX0A 4GUPB 1OAZH 4HJGB 3MA7A 3O3BB 5JIKA 1JN6A 1GOFA 4JFPA 2GYSA 1CK0L 1OTUD 4S1DC 3TFKD 1DL7H 3OXRA 4MNHA 1S8DB 1PLGH 2O5XL 3DROB 3PV6A 1JV5B 1QR1B 2AAVA 5DD5L 4N8VG 1B0GA 3IXAA 5IFHH 4JFZH 1GC1H 3ZKSD 1D3CA 1GPOH 2HJLA 2JCCA 4JRXA 4YIQA 1ZKAA 3UTSE 4PJ8B 1OTTD 1F6AB 4LKCB 1TCRB 3JVGA 5FDWA 3TZVD 4JFDE 4JDZA 1NFKA 3OMZA 4L4TA 3HI5H 4O02H 2P48B 1QVOB 5CBEA 3W2DL 2VE6A 4ETYA 1BWWA 1Q1JL 2DYPD 3LD8C 3ZTNL 4HWZB 3VRLF 1JHLH 4KHXL 4CVXA 4J8RB 5I1JH 4OJFL 4WV1C 4D0DB 5L2KB 1QA9A 4MXQC 2LU4A 3NACL 4QYOA 2VKWA 2YEZB 4YNYA 1H8NA 5GS0H 3WFHA 3V5DA 2YR3A 3QDHA 4ZSOA 1Q94A 2VR4A 1FNGB 1HWHB 2ARWA 4JB9H 4OF0A 3PQYE 3T1FB 1UM6H 2NY7L 5GJTL 4MQ7A 5K9JL 2AKRA 4HFWA 4P46B 1DQQB 3QQ3B 1RUPL 1YEJH 3FKUS 5IQ9B 5F3BB 1E4KA 4TPRL 4WU7B 3BZFA 1INQB 2MWCA 1UWGH 4OFYD 5E2WL 4Z7VE 3BXNA 3KXFA 4LLMA 1QSEE 4P4KC 3P77A 4U6VL 4IRSD 4YHMH 2CQVA 3P9LA 1NPUA 2Y9RT 2VLRA 4KKLC 5C08E 3TPKA 3OR7A 5C6WH 1INDL 3MJ7A 1KNOB 4LPVA 3TC9A 4XAWH 1F4WL 1VFBA 3QA3B 4N1CA 4OCRL 3WUZA 4XBGA 5C7XL 1HHHA 3VGBA 3VDCA 1H0DA 2XZCL 3IT8D 2HFEA 3UC0L 5I1AA 43C9A 1RFDL 2QQQA 3VRJB 3QDMA 1R3JB 4GW5A 1J0ZA 3NFNA 4GRLA 3QUMH 1YJDC 4X80H 1M1SA 4NC1C 3A6BL 5DJ6A 3OKMB 3MFFB 4MXVE 1BZ7B 1A0QL 1NMAH 1MCBA 3QPQC 4JO2H 2V9QA 1FZOA 5KS9E 4P23C 1MI5E 3BKJH 4ZXBC 4EDXB 3OQ3B 3RPKA 2AXJA 4WW2F 2FATH 5TDPB 3BESR 2QKIA 5F7MC 3OX8A 1HYRC 5ADOL 1FG2B 3X3GH 2HTKC 1B0RA 4YHIA 1PJ9A 1Z5LA 2HT2D 3C6LB 1GJIA 1X5ZA 4JM2A 1QA9B 4YK4C 2C1PA 1MNUL 5HGAA 4MB3A 3ZT5A 1FIEA 1D5MA 4ZO9A 2I60L 5T3XH 3PP3K 5EU4B 3CFJB 1UJ3C 3PGFH 5HHMB 1D5ZA 2VQ1B 3OHXB 5D5MF 4RGNB 3LPGA 5TE6H 3AXLA 4X0KA 3RWJB 1K85A 3MLWL 4S1QH 3DV6A 4K2UL 3K46A 4P2RD 1YYLH 2EO9A 5C0JB 5I15H 1HH6B 3PUCA 3EDKA 4G9DB 4NZTH 1V8HA 1HZHH 2IBGA 1A21A 5E1HB 5L2JA 3ESVF 1NGYB 4W6WB 3TBYB 4MNQB 1A02N 4F15B 2A9NH 4M5ZL 2B0SH 4K9EH 4IHOB 2ICEB 2W0LA 4DGYL 2EDDA 3D3VA 1PKQA 2H6PA 4HIXH 4M00A 3VXMD 4KWUA 5LGJA 5DMKA 1UWEH 3MRBB 2H3NB 4U0RB 5BQ7A 3DPBA 2NXZD 4KXZI 1S5HB 1UWGL 5BS0B 5E2WH 1XIWA 5HDBF 2FL5B 1JGUH 2XNAA 1UXWB 1IGMH 5F9OL 4A6YL 3GUTA 4ONGL 1GAFH 5EZLA 5IVNA 4OIAA 3VFVA 4BH8A 4LNRA 4M4PA 4TNWK 4Y4KB 3WN5C 4LSVL 12E8L 4P46C 1SMOA 5HDQH 5F1IA 4ISVA 3QIUC 4KY1H 5DI8A 3W39B 3WS6A 43CAB 1U3ZA 5LQBH 2B1AH 5I8EB 4C4KO 1FN4A 2FBOJ 2HKHL 4OGAD 1A6UL 1KN4L 4PRPB 2OL3L 1T0MB 4G80B 3U7YL 4U1MB 5FB8B 5ID1A 1MIEH 4OZHF 4YDLB 3DYPA 3TYGL 4FQCH 4X7CC 43C9B 5MEND 2YMXH 5DMIH 1KJ2B 5D6CB 4NKDA 3DGGA 3N0PB 2A74B 3UZVB 1RZ7H 3WXVH 1QBAA 5EO1B 4IMLB 5E9DE 2DQEL 5LKNA 1WBYB 4IDJL 4U2YA 4NUJB 4A6YB 4EOWL 1CVRA 3WLBA 3MREB 1YYML 4GLRI 2NPLX 1CLZH 3MLZL 3LS4H 4DWHA 3AC0A 3HZYA 1GVIA 2VZ1A 3V4UL 5ECJE 5BVJA 3DXAB 3VGAC 1HZHL 5CJXC 5KVEH 4JHZA 4JCMA 1G7PB 1PGRB 1U93B 2IJ0C 3V5KA 1S9XA 4QWWC 4C4KT 4WY7L 4TSBH 1G7LB 2YOCA 5KS9F 5T3XL 4P23B 3VFTB 1G9ML 4KU1A 1HH9B 4J23A 4RWYH 1Q0YH 3B8YA 1B2WL 3TO2A 4OI8A 5F3HA 2XWJB 1MCPL 4PJ7F 3VXQB 5K9OA 5KSAA 3NA9H 2VO5A 3OKNA 3GSWA 5TDNB 3RUGA 2CLZA 1FGVH 3L5JA 5HHVL 2C26A 5HHOB 1JHTB 1NUFA 3UTTA 2ICES 3UTPE 2B4CH 4LLDB 4U1SB 3DO7B 3EOBB 4HKZA 3C8HA 4WUKH 3SDAD 4Z7UA 5DUBB 4L8SC 1HIMH 5F7NC 2ESVE 4PJFB 3OL2A 1INEH 5EUOE 5EC1B 3UPCA 5CUSH 1MCHA 3HE6A 1KLUB 2AK1L 3P11H 4PGCA 4OZGE 4X99A 1VKXB 1JTOA 1AGFB 1YEIH 5DWUH 4ONGH 1QSEB 3KPRD 2FIKA 1F5WA 4OCXL 2BNUA 3LEXA 2FCBA 5B4MD 1JWSB 4MQXC 4LGRB 4X5WB 2R1YA 3GM8A 2ZG3A 3BW9A 4P5MB 4DOHE 4TQEL 1FZMA 1BP3B 2AABL 3FQNA 3LQAL 1A9EA 2F74A 3CDGB 4OFKA 5CJXA 5LQBL 4G8FA 3GSOA 5I66A 3KG5A 2YZ1A 3QISA 1CXHA 4I48A 4OIBA 1A7RH 4R90H 4DEPC 3QEQE 4L9LB 3X11A 4TTDD 1KLFA 1AHWA 4YDKL 4XPTL 1J18A 1R0AH 3O2DH 4QOKD 2BVTA 4QY8B 2OYPA 1U36A 4KMTH 1J1PH 1ZT7A 5GISH 3UP1A 2A9MH 1IKFL 5T1LB 4I3SL 4OTXH 4L3CA 2UY7A 5DZOA 1ZLWH 3OKDB 4L4TB 1HNGA 3IKKA 1LO2L 3HNTH 4M6OL 4UDTB 5I71B 4PGZA 4UTAL 2D7NA 5DVKA 3TT3L 3GMPA 5GIRA 1X44A 2W0KA 3BISA 1NMCC 1F45A 2ZOLA 4LGPB 3DX7B 3Q2CA 1MWAL 4NWTL 4DN3H 4YWGL 1EDQA 4P59H 3PNWA 4M3KB 3LIZH 4NQSB 4RMTA 1P1ZA 3RFZC 3DX9B 1MLCB 5J06A 5F1OB 3ZYZA 1KENH 3HLAA 3MLVL 1K4DB 5HGDA 2NY1B 2OTWB 3HN3A 4B7IA 3KWWA 1LO3L 2ZSWB 4PJAA 2HJLB 1ERNA 1OAXH 2ARJQ 2WLYA 3VFMB 2D4FA 3BP4B 1DUYA 4YE4H 5SWSA 3T1WA 1X7QB 2VL5B 1GHFH 1UACH 2C1OB 3H0TB 4ZS6D 4CVZA 5D2NA 2QQNH 2X4SA 4YFEA 2DKUA 3GMLA 4X5WA 3G6JE 2X4RA 1S7WB 4L4TE 3QIBC 3MLWH 3BGFC 4OLVH 4S1QL 4X4YB 3T3ME 1BOYA 5DRNA 2L7JA 5GGRY 1R5VB 4OSUH 3S3JA 2PTTA 4LEXL 1DQMH 2QV2A 5TE7L 5JQ6H 1TIUA 3DJ9A 3H3BC 5CEZE 2JJWA 4U1NA 3QZWG 5CIPB 1CGXA 2IF7A 2ZUUA 4KDTC 3K1DA 2YD4A 2FEDD 4ZAKC 1T20A 5D7IB 3VXME 2DLGA 2WBJD 2E9WA 3ILPB 1ORQB 3AB0C 4X7EC 4FZ8L 1IGYA 1T7YA 4PJ7B 2QJDA 1AP2A 3D2UA 3VFGH 3P77B 4KK8D 2G75A 3LS5L 4WV1B 1A9EB 3CDGA 4KQ4L 4NKQB 3WKNA 2LVEA 5C0DA 3RNQB 1U8NB 2CGRH 5LJYH 2O5ZH 3MV8B 4PJEB 3TBTA 3W2DH 1O0VA 1LE9A 3RL1A 3T0BA 3T0XA 4CW1A 1D5MB 2AXGA 3VMOA 1WK0A 2X9YA 3M8OL 1QKZL 3BKCL 1PW3A 4OLYH 5CZVH 5AZEH 4TUKH 4WHTB 1N2RB 1CD1B 2I26N 4LLVB 3S37H 5MEOB 1YPZB 2C3HA 1TPXC 2YPLB 5E8OB 3SCMB 4HGWA 3PGCA 4KVNH 2HT3D 1B90A 4JFHE 4FQPA 3GSNL 1NCWH 1RK1B 4BA8A 1I1AB 1T3FB 1YEJL 5CMAA 5T1DH 7CGTA 5FKPB 3MBXH 3MTRA 4X9BA 2CKBH 4KI1A 3RGVA 4XNUH 1OPGL 3SGKC 5I16B 3KXFE 3VG0L 5DJ0B 3MRBA 2B1HL 3QEHA 2J8UF 3V6OE 2XFXA 4PJEE 3WIHA 2FB4H 2GKIA 3RZCC 3VD7A 4MDIB 1TQBB 4OD3L 5TF1H 3SGEI 1OB1A 2J3SA 3EDJA 4P4KA 4JRYA 1LDPH 2AI0H 4E41A 3AAZB 1WAAA 1DQJB 3P40A 3MXVL 1JZ2A 4CU7A 2ARJB 1I7TB 4JR9L 1A3QA 1F8TL 1XF2B 4EDWL 3ZHLA 3X3GL 1R3HA 5JO5A 4ZPTB 7FABL 1NAML 2PTVA 1C7TA 5B39B 3FO9A 5IW1A 4POUB 2V7HB 1QG3A 3KPNA 3ULVD 3DETC 2XTJE 3FFCB 2GJ6B 1HCVA 4LLQB 4NQED 1PSKH 1ES0B 4PLKC 2ICCA 4ETQB 3QQ9C 1F11B 2VXSL 5HYSA 2PTTB 4L3ED 3D9AL 3X3FH 3OKEB 4KHTL 4U6YB 5DJXB 4PLOB 2PXYC 1T21B 1TDQA 2HT3C 1S9WB 5DA4A 1IKNC 3EO1B 4JFQA 1CFTB 3GI9L 1FV1A 5EZJB 4Y4FD 5CINL 5CGTA 3GMMB 3V95A 4ZD3L 5HYSG 1RK0B 4FQIL 1JP5A 1Y6NR 4P57A 4HS8H 2HFTA 3TCLA 2IH1B 1AHWC 4HXBH 4FFYH 4HKBA 4X7TB 4M8QA 3FT4A 4G80A 4I18B 1I1CA 4BK4A 1ORQA 3LKSB 3O45B 3ILPA 2CSPA 4OCMC 3CZFB 1LK3H 3PDDA 5AZ2L 3PJSA 3Q48A 4XMPL 3VU2A 5JR1L 5C09E 4P9MH 1TLKA 3UAJC 2WZPD 1A5FL 1QR1A 4U6XB 4UUJB 1WUNT 4JN2B 2MPAH 4YPGA 5GGTL 4HT1H 5HI5D 1U8KA 1IZKA 4J4PD 2B7DT 4N0YL 4PJCF 4XZUB 2DMKA 2YWYA 1MEXH 4PBVC 2CMRL 3DX8A 2HLFD 1NCDL 3FQUB 4NWUL 4PS4L 5GGUB 4Z78A 3VFTA 4G43A 4FQ1H 2HKHH 5C0ND 2FNBA 5EOQL 3RWDB 4K3DH 4P48A 3VE0A 5TE4H 3TNNA 2NY1C 3GI8H 2K3TA 5FDWB 2K9UA 3G5ZB 3TA3B 3RHWF 4Y1AD 1UZ8A 5IJKC 5A3IC 3K2UH 5ISZB 5K59E 1KPVB 2PF6A 3V6BR 3GSNH 3TVMC 2YMXL 4WDIA 3FN0L 4XBPB 1T89A 5C0NC 1X5HA 2ZWLT 1EXUB 4WHDA 3BN3B 5HY9B 4NM8H 4NN5C 2EDOA 3S4SG 4NFBA 1HQ4B 1OPGH 1MCQA 3CFKB 4XTRD 4K7FB 4X5LA 3EYUL 3BWUC 1V7MH 5TQ0L 2NX5D 1EFXA 3WFBH 2R4RL 4HH9B 3WEXB 1F90H 2PR4H 3TBWB 1CE6A 4OIIL 1A3LL 4K94L 3QQ3A 2HVJB 1QLFA 4G7YH 3O2VH 2VLRB 1FFNA 2XKNB 4PJHA 1DFBL 4NZRL 2EO1A 4KPHL 3I50H 1A7QH 2CXKA 3MRKB 3ZSSA 4HS6A 3RY4A 4AM0A 4C54A 4ZUSA 1N6QH 3VXOA 3QDMB 1ZLSH 1CLCA 3MUZ1 2DIAA 2GSIB 4NIKB 1EUUA 2QEJA 4NNXB 1CDCA 5FUZH 1MWAB 3V5HA 1MFAH 1FQ9C 3ELAT 2I9LB 5DD5H 1F00I 1FNAA 4OF8A 3UTZB 4UNTA 5EBWB 1KV3A 4U1KA 3B6SA 4R0LC 1NCUA 4R4BB 2FX7H 1YNTA 4JFFB 5BXFB 4GRLB 1XIWD 1HWGB 4JN1H 4CU8A 3DVGA 1RAMA 3BWAB 3MLTB 1DCLA 1WCBA 4WUUE 1G6RA 2X4QA 4E41E 1O5DT 4Z76B 4PJBE 3U1SL 3MRDB 4L8SB 2R2HA 1V3KA 3SKUD 4JN2A 2YWZA 3KNBB 4ZFGL 2DL9A 1L7IL 5E70A 1RZKC 1NLBH 1FL6A 4UT6L 1KXQE 3QO1A 4LF3A 3GEWB 1FRGL 1SM3L 3O6KL 3FQWB 2EDXA 2BSRB 2BVEA 3PXJA 2V5MA 3IKCB 5C0AE 1KJ3H 3RWJA 1K5NB 3QUKA 3VXNB 1R3KA 1MIEL 3MZTA 3PL6B 4GRWE 2V17L 1ZVYA 4UILL 1FBIH 2P8MB 4HUNB 3ARYA 3MCG1 4WI8A 1N3NB 1G9MC 3NIGF 5FAAA 4CDHA 2GI7A 3QDMD 3RUGE 4L8BB 2WWKO 3K4ZA 3LHPH 5JHDB 1N5AA 4IDJH 4Q97A 1DEEB 4U3CA 4EN3A 3OTTA 5D1ZD 2H2SD 3MMEB 3O2DL 5C8JB 4JDTL 2NXYD 1EH9A 1L9MA 1AGCA 1F4WH 2FX9L 2A6JB 4QHMA 2HMIC 1KACB 5F9DC 4M93C 5HVWA 3RJQB 4J6RL 4KKCD 4X9GA 4K8RH 4KI5E 3HG1A 3SO3B 3HNTL 4M6OH 5B3NA 1ZLSL 4NHCL 1RPQA 5D4QA 2OR9L 3N85H 4XB8A 4GKSA 1A1NA 2RAMA 3KPSE 4XC1H 4NQCA 2BJML 4GG8A 4BQCA 3DMMD 4PRAA 2I07B 4MJ5B 2FB4L 5T33L 1I7ZB 3RL2A 4POZC 1U92A 4R3SA 3DI3B 5E0QA 1QSFB 1AFVL 3BMVA 2H9GB 3CUPB 3EAKA 1YEGH 4ODTL 4NKDB 2PW2A 1KSRA 1RIUL 3ZKMD 2OTUB 2BK8A 3B2VH 4DVBB 4PJDB 3KS0J 2JJTC 4JE4B 5ID1B 1JMXA 2ENSA 4DCQA 1W0VB 2EEBA 2FJHB 5DQJB 1Z9MA 5TE6L 3VFPA 1LILA 5EORH 1A22B 5FUOL 2IQ9L 4R4ND 5IHBA 4WHTA 5JLZB 1BD2B 5DLML 4ZFGH 3L3OA 1HOCA 4Q9QL 3P9MB 3V2AR 1DL7L 1FJ1B 1UXSB 4UDUB 1CD0A 5J6GB 3EJYD 3HE6D 5D1ZB 1LE9B 3FB6B 2VOTA 3LQAC 4PJFE 2AK1H 1T1WA 3LB6D 4CBPA 2R0KH 2I25N 3D2UB 1RIHH 1KB5B 4OB5L 4FXGA 4XCNA 4ONOA 2GQHA 4OD1L 2VLJB 3RDTB 2W9LA 4DUVA 4AJ0A 2MOVA 2JCCB 2QQKL 4YIQB 3O9WC 1TETL 4I4WB 3ZHKA 5L8JB 4RRPG 4X9FA 3NGBC 2A6KB 4HJJH 4F15C 4OZ4B 4E42A 2JELH 1NLBL 4XXDA 4X6DE 1MIMH 4AEIH 3KLHC 2UZIL 3SJVA 1Q9OB 1XR9B 3ARGC 4N8VB 3SPVB 3T2NL 1IRAY 1ZSDB 1TJGH 1XF5B 3DSNA 4P3CL 1XGRB 3TO4D 2CIIA 4H88L 3HHRB 3OAUH 4AEEA 5I73B 2V17H 1JPFB 2O61A 3QWRD 4LCYB 3WSQL 3FO1A 2LQRA 2IFFL 2Y06L 2W9DL 4QRUA 1CD8A 3FB8A 2F53D 1G7JA 3L3JA 4LNVA 1HYSC 2BOCA 3PWJB 3OKEA 1UEMA 1WWAX 4EXPX 3VH8G 1G7MA 5FV2A 1OD7A 5DJ2A 4PJGF 2C3XA 1NMCB 1WGOA 1FZJA 5AWNH 4F7PB 1EO8H 4HX1B 4JHAH 2FGZA 2Q8BH 1D7FA 3QEUB 4JRWA 4PY7A 3MLVH 3QHZH 2MHAA 1KFAH 3CFBB 1XCQA 4TOYL 3STLA 3HCVB 1CXKA 5I1KL 4HIIB 4QXUL 4PP1D 1YYMH 2AV7A 3PWLB 3S37L 5KZCB 2VDQH 1NFIA 4G6ML 1CD9B 4HH8A 4MA3B 1PEWA 4PRID 5LAXB 5LXGH 1GGCL 1YMMB 5TDOB 4FQLH 4QOKA 1T22B 2QQLL 5EPMB 4M6NH 2IH1A 4M7LL 2I5YL 4OFYA 4LL9A 5EU3B 1KJMA 3T4YB 3WFDH 3ARSA 1JBJA 3G08A 5F7HA 5DC9B 4PD4J 1IQDA 3RGHA 3RX5A 1FFPA 1RVFH 3TO4B 3KJ6H 3Q1SL 4F9PA 3KYMA 5DSCB 2VLLB 2OK0L 2NQCA 5C2BL 1M7IA 4RBPH 2ESVD 3I2CL 3IDJA 1XFPA 5EORL 2XWBB 5HDBE 3VI3F 5HHXH 2EKSB 3NTCH 5GGSA 5F7KC 2OXHA 4X6CE 4NQDA 3EOTH 3LKSA 3O45A 3DX7A 2OP4L 1N8ZB 5IKCA 1U3HA 2HT4C 4NM4H 3UTSB 4DQOH 3ROLA 3EZJB 4QRQA 1DBMH 5HGBB 3HLAB 1S7QB 3O81A 1NEZG 5E99L 1OCWL 1IQWH 1PQZA 2HWZH 4XWOD 5GGUA 1HSAB 4EUPB 3CD4A 5AYQA 4CMHC 2IPKA 3WJLC 1M05B 4JO4H 3UBXI 4DAGL 2ZOLB 4EBQL 5D5MB 5D1QB 5DK2A 3HUJA 4H26A 5SWSD 4Q6IC 2BHZA 5F89B 2P1YA 5ICZA 1GOGA 3BPNC 2Z93A 2W9DH 4NKOB 2HT4D 1AE6H 2XQBH 1XR9A 3LSOB 3CAFA 2DJ4A 4IS6A 1MIML 5H2BA 3T0WA 2OBGA 1R3IL 2R9HD 1AD9A 3ZTJH 5GQBA 1CGUA 1AXTH 2ID5A 3KPTA 5IMMA 2VR5A 4WY7H 2Y07L 4G6KL 5FK9A 3D25B 1RQ5A 4Z7OE 4DGVL 4OLXL 1EMTL 1EAPA 1CR9L 3SCMD 1NMBL 3VXOB 2MCG1 3ISWA 2HJFA 3IDGB 2J4WL 3MNVB 3CIQA 3UYRH 1NC2D 3PWNB 1F13A 5BJTA 2P8LA 3C60B 1MHPL 2IADB 3CVIL 3RVVD 3RGVD 3V0AC 2BXYA 3CK0H 2BY3A 3BI9X 5D7JD 5I76B 3RI5K 1FNFA 4ZYKB 2OL3H 2BRRH 4E9LA 4OZIE 5E94A 4LARL 1W0WA 3MGTB 2QADD 1NBVL 3VFUB 1H3GA 2RGSA 3BH8A 4MJIE 2BSSB 2HTKD 1CICC 1S5HA 3TFKC 1QFOA 2FGWH 4HKJA 4JR9H 3R8QA 1F8TH 1U95A 4PTUA 4ZFZB 3MRKA 3C5SA 4P46D 1FPTL 4UAOC 1FC1A 5CAYB 1A6AB 3U6RB 1WBXB 1WBZA 1S9KC 2ZCLL 3MV01 4HUWA 2OJEB 5GGVH 1GGCH 1INDH 3DVGB 3FO0H 3C2AH 4K7PL 3PF2A 4CADB 4GQ9H 4Z7QF 3ALXA 4Z76A 2AXGB 5HYQB 1NFDE 3HPJA 2VDLL 3EIFA 3IETA 1I3GH 4TQEH 1MVUA 2VLLA 4MNGB 5IT2L 3ZKXC 3MLUH 1VGEL 1VEOA 5BXFA 1E0OB 4MD0B 2A83A 1CFSA 4NP4L 5KVDH 2Y7QA 3SDCD 4F57L 3AREC 4JZNB 2NY2D 4WFFE 3LY6A 3MNWB 4U6HB 5MEQA 1X5YA 4BQ8A 2BZDA 4JLRA 4HUUB 1KC5L 1FORL 4XP6L 4PJEF 3ULVH 4IRJD 2BOBB 4QRPA 3VFOA 3D1MC 3HNVL 4C56A 4Z77A 3BIKA 3RWHA 2YBRA 3O9WD 5EUKB 3WIHH 1FSKC 1IAKB 5D9SA 4Y4HB 1ADQL 4PJ8C 2YKLL 4WFED 3QYCA 5LGKA 1I8MA 4WFHE 1C1EH 3NCEB 4YHNA 3TIEB 1JK8B 4B41A 1N0XH 4CMMA 5EO0B 2W59A 5DC0A 4TVPL 4IBLT 3L7FA 3QFJA 5SX4I 2VDOH 5INCB 3QPQD 3E6HA 2LTQB 2YC1B 3U7AA 4HULB 1RZIA 3ILQD 1XGUA 3FFCA 1G0YR 3L3GB 5CWSA 5C09B 4Y16D 2VABB 4OT1H 4RFOL 3O8XD 3WO3B 2X6MA 1ZTXH 4N0CD 4UILH 4R6UA 3FQTB 4FABH 1RURH 1T1YA 32C2A 3PJSB 3S36L 3G6DH 8FABA 2X70A 2KZWA 1MJUL 4Y4FA 3SHSA 1RIVH 5HYJA 4ZO6A 5TF0A 4OCLC 3O6KH 4PG2C 4URTB 2JJVA 4X80L 4YFLI 4S1DD 1NKRA 1A4KA 1A6WL 5TE7H 5JQ6L 3SJVD 3Q6GH 3DMMA 4BQ6A 5CCKH 3P3YA 1DBAL 4D9RD 1SJXA 4K7PY 1AGEB 1YNLL 4UOJA 1KLUA 3CNKA 3D39B 2X4UA 4H1LG 4HQQL 2IBZX 1ND0A 4J4PC 2Z8WC 2HH0L 4PRPD 1HKLL 4HG4J 1F4YL 1FNHA 4JQIH 4Q9RH 2BERA 5KVGH 5DEZA 2GFBB 1W72L 3WDHA 3U7YH 4G6FB 1EJOH 4LP4A 1BVKA 5IESH 1KIQB 2R2BB 5DA0B 4XB7A 5I0DA 4H8WC 3HPLA 1ZK9A 3KYNA 4NCDA 3EFFA 5GJSL 2HVKA 2FH8A 1U8QA 1J1OL 4JY5H 1ZHNB 1ZGLP 1ZHKB 2P5ED 35C8L 3ARGD 3X17A 3RY6A 5FKAB 4DN4L 1R5VA 2IAMC 5HHME 1J05A 1C1EL 3AREB 2BDNL 2D9CA 1KCKA 1RFDH 1WFOA 5DD1H 1CXFA 1G1YA 3F7VB 3HAEH 2D7QA 4U2ZA 5A43C 3S88H 3QP3A 3TBWA 4BZ2L 1KCUL 1K6QH 1NFDA 2F5AH 5I1CH 5IF0A 5TGBB 4XI5C 3B2UC 4BK5A 4RNRA 4PV9A 4AK1A 4K7FA 3UBXA 4QRPE 3F6LA 1T1XA 1EAJA 4Y5XB 1VFAA 1T1YB 4OM0H 1RJLB 1LP9E 4LLUB 1NFDF 3DSFH 3WCYA 4F9LA 2JCCE 3MXWL 3PHOA 2RFXB 2Z0BA 4Y5XC 3BFOA 3WBDA 5FYJL 3TV3L 3QIWB 1EZVX 3BSZL 3ARRA 3TJEH 1WLHA 1QLEH 1I3VA 3SDXB 5IEHB 2DQFB 3O6FB 4MWFB 2WUCL 2JCCF 2EDYA 4XI5D 4OLZH 1ZEAL 3ZYOA 3VFWB 3WUWG 2WBWB 3VXSD 5IGXH 1U8MB 1ZLVH 5CHNA 1KJ2A 5DURB 2EDRA 4BSWB 1GGIL 5BO1H 5IOPB 1RUMH 4R97C 2ADIB 2DLFH 2YPLA 4QLRA 4I0PA 3STLB 2VLRE 1BVKB 2C5DC 32C2B 3NCCB 1H3VA 3FRUA 1J0HA 5DD6B 3P4MB 4HIHB 8FABB 5C0BB 4U1KB 4BELD 4KQ4H 4X7FC 3BP6B 3AM8C 5MENE 1UZ6E 3TN0C 3NA4A 5IFAH 3IDJB 3ZTJG 3NPZB 2HN7B 3CH1A 4XVSH 2R15A 2AEWA 5DRNB 3SE8H 1CBVH 1YEDA 1DN0A 1JN6B 3OPZL 2RJMA 3KYKL 2X4QB 3QEHB 2J4WH 3JV4A 2NY0B 3A6OA 3ARDA 1AGEA 4PRIA 4NBZB 4NO0B 5JNYB 1CFVH 1I9IL 1XGPB 2XZQL 1SQ2N 3K1KC 1Z0NA 2F5BH 3MOBH 2O26U 4GKOA 4M1DL 5ITBH 3CCHA 3KPQB 1VESA 2RR3A 3E8UH 3HUJE 4HGWB 4P2QE 1J12A 2XZZA 1R3HB 3MR9A 3SE3A 3TIDA 3Q5TA 1NC4B 1UKQA 1JWMA 1QVOA 3BHBA 1IGFL 4ODXA 3PP4H 4NJ9L 4V1DD 2AJUL 5FF6B 4E0RB 3S7GA 4XX1G 1OP3K 4OUOA 2WBJC 4OF3A 5D7JA 1F6AA 4LKCA 5BZDB 4X6BA 3B9EA 4LVOC 3W5MA 5J8OA 4BH7B 1N7MH 4LPXA 1C12A 4NJAL 3QXDA 3PIQB 1G7LA 4LPTA 4LSRL 5I8KH 3ILQC 2Q3AA 4X8JA 1BBDH 2MSPA 4HZLA 2VITA 3MA9H 3ZDZF 3ZYIA 4GRWB 2R0KL 1KPUB 5E6IB 5LG1A 3STBA 4LDOB 4MA7H 4YWGH 3WNPA 1IAIL 4PJ5D 1EV2E 3K2UL 4HF5H 4E5XB 5ICZB 2DJSA 3BZFB 1LEKA 5JA9A 2XI9A 3D18B 3MLZH 4XCEA 2J5LC 4ODVL 4LLUA 3BZ4A 4LCCB 1IAMA 5D1XD 2E7HA 1A1OB 2VAJA 5I16A 4G42A 4MQ7B 1NANH 3P9LB 3SOBH 5IIEB 4KQ3L 2HJFB 3BJ91 3RUGF 4LLQA 3H7LA 3FQNB 1GZQB 2BSSA 1I85A 3EYUH 5SWQA 2JJSC 1FVEA 5F3BA 1T0NB 3WIHL 4P5KB 4HKJB 3L6FA 4MS8C 3MCLL 3D25A 1W0VA 2EH7L 2HLAB 2VDRH 1VADA 4ZQKB 2F8OA 3EO1A 4WFHD 5I1IH 2OP4H 4N1HB 2AABH 1MRFH 4RFEA 1XF2A 4EJ1C 2XKSA 3U0WL 3WNOA 1YEEL 2I9TA 1SM3H 3RVTD 2IFFH 4F3FB 2XT1B 3W0WE 3TCLB 1JNJA 2VWEC 2CRMA 2YUZA 4N9GB 3TNNB 2FO4B 3SKMB 4C56D 4EN3D 5EIIA 1HHIA 4OF7A 1ZT4A 1T5XA 2VDPL 4DOHB 1NDGA 4G6KH 2V7HA 3TZVB 4FXKA 5E8EA 2P46B 2VLKB 3N1GC 4JO1H 3FT3B 4PJGE 3ZMRA 4YO0B 3DTXA 3HRPA 3GIVB 3LDBB 5C0IA 1U58A 4XGZA 1JI2A 3VMPA 1AE6L 2XQBL 3L5XL 2VUOA 3LHPL 4LPWA 2Y23A 1CI5A 2O93L 1BGXH 2VQ1A 3HMXH 3O3UN 1TJHH 4OV5A 4FXGB 4NQCD 4UQ2B 1Q9OA 1ULVA 4WW1B 1CFVL 4X6DA 4PLJD 4Y8AA 3QUYD 1U6AH 2EDWA 1DBBH 4QRRD 2FJFA 4XNYH 5E4IA 1CQYA 5F88A 4XVJH 4F2MA 3BN9D 4GRLC 1JNNL 3T77A 2EH8H 4M1CD 4XAWL 3FZUD 3QWRA 1JWMB 4HBCL 2BC4B 2AJYL 1FE8H 4ZXBB 1LO3H 1KG0A 1EVTC 4I1NB 1S7WA 1P7QB 1FG9C 1IAIM 5DVMA 5BQ7B 1JZ8A 1NH6A 3A6BH 1B3JA 3QRGL 5E03A 1UYWL 1YPZE 4O9HH 3BDYL 1X5JA 4Z7UF 4LSUH 4F9LC 5I2IB 5IB3B 5LBSL 3QEGH 3IS0X 5T5NF 4XHJC 4G7VL 3BE1H 3UXFA 1FL3B 3LKNA 1IC4H 1FVCB 3UJIH 1NCTA 1E4KC 2W65B 2MCPH 4X9HA 1DBML 4FTVD 2BNQB 4APQD 4X98B 3G6AA 4RMVA 2EYSB 2CIKA 4W70A 2IPUG 4TTGA 1TMCB 5GRUH 3D69B 2R9HC 5DQ9A 4XP4H 4HAFA 2DWDA 5GS2H 1YEHH 3C09C 4K71B 1FORH 4Y88A 4PJGA 1PG7H 1SBSL 2BY2A 4LSDA 4P2QA 2IAMA 2FSEB 3S88L 4QXTA 2AEQH 1B6DA 1JGLH 3SOBL 1NCBL 3LPFA 5L8LB 4LFHG 4WRLA 4OB5H 2J12B 4XP1H 2X4OA 4K3JL 3IDNB 4MA3A 3V0WL 4XNZB 5C0RL 1CICD 3FFCD 3ZE0F 2ZCHL 1I75A 4JGUA 2VZ3A 4JRXB 3D0VA 4KKNA 2OMBA 4O58L 5JXAH 1FHGA 3R4DA 3C8KA 5EUOF 3QIBD 5E8OA 3T4YA 5GS0D 4OZGA 3EKCA 4MSWB 1U91A 4NQEB 3WLBB 4X6FA 2WIMA 2Z91A 4C59B 1KEMH 1TCMA 3H3KA 4DVRH 5T1KB 4N5UA 2ESVA 5EUOA 3WD5H 1NCCL 4KKAC 1BJ1H 3SKOA 3OAZK 1EA9C 2AGJL 4NC0B 4GXVH 1HILB 2C3WA 3CVHA 4P2OC 4QHUA 1SY6H 4LCWB 5IKCB 3C5ZA 2IFGA 5GS2D 1MCNA 3MACH 3IB4A 2XY1A 3TA3D 3F65A 1TVBB 4OV5B 1JV5A 2BVQB 4RGND 4NDMB 1QR4A 1WIUA 4MHHG 3V4VH 2WW8A 2GJZA 3QUKB 3VXNA 3QIUA 4ZMAT 4TVPE 4J3UA 3ARVA 3P0YL 4IHOA 4GAFB 4OZFB 4UT9H 1G7IA 2EECA 1UGNA 5EU6E 5DC4B 4M7ZB 5DS8A 1NAKL 4ODWA 5EBGA 4YNYB 3K7UA 3EHBC 1MFNA 2NY4C 3L9RA 4M9OA 3KNBA 5BS0A 1NBZB 1RZFL 1ZS8B 2G9HB 2AJZB 5JOPE 3MMEA 3MRGA 4JFXA 4P2QB 1UXWA 4TUOB 4C55A 4JQIL 3IDXL 2F8VA 5DQDH 4MWFA 1WJ3A 3B5TA 4WENB 3H2WA 4Z7OF 4OGZA 5DJ8A 5B38B 3SDCC 4MGXA 1AO7A 5H35A 1S9WA 2J88H 5MP6H 5CCKL 1JGDA 4HUKB 3QI9C 4X98A 1BF2A 3TBVA 3F62A 4QCIA 2CUHA 3MPCA 4YHOH 4WO4C 4P2RA 2BY0A 1UKSA 4Y5XA 3RTQA 1AKJB 2R29L 3CZFA 1OP9A 4WUUB 5DJYA 1S9YB 3SE9L 3SKJH 5F7EH 3EYQD 5HYJE 4CL7A 4FQIH 4Y4HD 4GW5B 3C87A 2DLHA 4LU5H 5KSAC 3NABL 2FR4B 3GDBA 5EFIB 1LK3L 4HWBL 4KPHH 1I9JL 3R1GL 4TVPH 4ZO7A 2EZ0C 5DD3L 4YFLF 4JZOA 5CHNB 1G9NC 1H3PL 1HHJB 4Y8DC 4YDJB 4CN1A 2E7CA 2F19H 3JWOH 1LDSA 2XV6B 2ZCHH 3L7EA 4GS7B 3WHE1 5E6ZA 2Y5EA 3O6ML 3OGCA 5I1EL 2YD2A 4I5BB 1J8HA 1N6UA 2H26B 3QAZB 4OLZL 4MCZB 4ODXB 3EBAA 1A6PA 1NBYA 3D85D 2WANA 1A7PH 5C92A 4BFEA 1LEGB 2QBWA 1RUAH 3TT1H 4YEFA 1LP9A 4KUZL 4U1GB 1MRFL 3CCHB 4G6FD 1Z5LB 2ZUYA 4U31A 3RVUD 3UJTL 1KN2L 3W0WD 2BHUA 3B43A 5MI0C 1HNFA 4NN7C 1KCRH 2BVQA 1DE4B 1IE5A 3S34L 4H8WL 2R4SH 1I1RA 4Z78B 3ARUA 2VLJE 5IVZA 4Z7WB 2WM0A 1Y18A 1BX2A 4JPWH 1QLFB 4KKLD 2MHAB 3MOAH 5AZ2H 1RULH 1I85C 4Z5RB 1NGXB 1VACB 3O8XC 4IRSC 1YDPA 1DQLH 1RMFH 1QSED 3QXDB 4XPFL 4LCYA 3HAEG 4LSSH 5HYFA 2R1XB 3PP3H 4L5FH 4YDKH 4JG1H 2OR8A 3TA3C 3GKWL 3BJLA 5C09A 3LEVH 1NCAL 4YBLC 5E2VL 6FABH 4LLWA 2R2EA 3EOAB 4NQVA 1MCSA 1I7RA 5M7QA 3Q5OA 1RZJH 4NCC2 3WNKA 4JHWH 1HINH 1MHHA 3CXDL 1J10A 1OT1A 1KUMA 1LEKB 2G5BA 1NANI 3SE9H 3ARGB 1HEZB 1T83C 3BIBX 4L8CB 1UM5L 4NO5A 2Q1EA 1R3IH 4D9RE 5HVHC 5EOCH 5CJ5A 2VITB 3IRPX 4IIQB 5TE4L 3NCYP 4BH8B 3C2AL 4F3FA 5F21B 1T6VN 1NGWA 3V0VA 2EYTB 3QIWD 2XN9A 3CLEL 2AERT 4BUGA 4U1LB 5IG7A 1S7VA 1VADB 1DDHA 4MAUL 3GSOB 3DROA 3PV6B 4OCYH 1KENL 3HZYB 2YD5A 2XZCH 2DWEB 4MQSB 3ULSB 3WO4C 4RSVA 4KJWC 1U3JA 4PJ8A 4XGZB 2OCFD 1JPGA 4P4RA 5JPNA 3S5LB 2VLMD 2ADFL 2IALB 5I0ZA 1IBGH 1A0QH 3SDAA 1EEUA 4K7PX 3T0VA 5B8CB 2PKDA 3MBXL 3FFCE 3O2VL 4G7YL 2E7BA 1AXSA 2KQNA 2R69H 1KCSL 5TFSH 1EHAA 1JPTL 3PGCB 1ADQA 3GMPB 5GGSY 1G9MH 4XP9H 1DQML 4LKXB 3RWCA 1LO5B 2PYFA 4ODSH 4X7SH 5I8CB 2XOTA 1QBBA 2R0LL 3KPRA 4P5TD 4F7EB 3V0WH 4HIJB 3ZKNC 1ZLUH 3CVHL 3F12B 4N0UA 1YPZA 3DVFA 4QWWD 3BKYL 3KPRE 3QNXB 3U36A 2JK5A 3EYSH 3ECBB 1MCDA 3HS0B 4BKLA 2H45A 1FFPB 2Y6SC 5IT2H 2Q6WA 1BM3H 4GBXA 3U7WL 4UTBH 2R23B 2DLTA 1P84J 5ESVB 4IOIB 1UEYA 2C3VB 3JZ7A 3I6KB 3VW3H 2FHCA 4DVRL 4NQDB 2UVEA 1NFDB 5L88H 3GBNL 2YA1A 3GSUA 1CICA 2X7LB 2H41A 5KSAD 4NNYA 5EZOH 3BPOC 5A2FA 1F97A 3IDYB 2CLZB 1VFBB 3QA3A 3LH2H 3IRZA 2F9BT 2NZ9D 5KS9B 1BFOB 3MRIB 1I7ZA 4OCXH 3VH8A 3BDXA 3SGEH 2XACC 1IJ9A 3KHQA 1VKXA 4QHMB 3K80A 5HSFA 1H15A 3G6AB 1SMAA 3QUZD 3GSRB 4CADA 2XQYG 4H5SA 4XCFH 4NOFA 1MRCH 4KI5C 2P8PA 5EC1A 3VG9B 5DVOA 3IFNH 5T3ZH 1B9ZA 4Z7VB 2NW2A 1UADC 1FBIL 5CD5C 4ERSL 5IOPA 4HKBB 4X7TA 4XPTH 5C0GA 3QULA 4MJIB 5HYSB 4IRZH 2ILLA 2J6EH 1B0RB 3MGOA 3QIUD 4YHIB 4X6DF 5DQDL 4A6YH 1AGDB 2V5RA 4PR5A 4TNVK 5GS1A 2IG2H 4UUJA 4XVJL 2CMRH 3IDGA 1QBML 3CH1B 5C07A 4QY8A 1MHEB 1KIPB 1VB9A 2OJEA 1OT2A 1L9NA 1KJ2H 2YD9A 2QHLA 3CSYB 4JM2D 5L9DL 4I18A 5HI5C 1K2DB 3ARDD 2VAAB 4JJ5B 3RIAF 4PRIB 3IDNA 1XGTB 4XXDB 5CLWA 2AEPH 4YUEH 4CDGC 7FABH 1E6OL 1PYWA 3C6SB 4RGNC 4OI7A 4KJYA 5E08H 2ZSWA 4RWHA 1LO4L 4JFOA 2R23A 1G6RL 3ZL4H 1CF8H 3T0EE 5DDHA 3QEGL 4KRLB 4XX1E 4U7SA 5IHUL 1UZ8B 2DM3A 3MNWA 3KJ6L 3Q1SH 2UZXB 4ONHB 2Z8SA 1FNLA 1UACL 1TZIA 2YPLD 3WFBL 2H2SC 4PV8B 4YHLL 5DHYA 1OSZA 2WQRA 1ADQH 4I4WA 4AL8L 4RDQF 3VFVB 3BP4A 1U41A 3S97C 1CL7H 1KPUA 2BOCB 1ZEAH 5E1AA 5KSUB 5ID0A 4PIRF 4CVZB 5FCSH 3LAFA 4MX7A 1I8MB 1C8PA 5ADPL 1FO0B 3GMLB 5DLMH 1SJEB 4C57C 1KEML 3FHAA 4Y5VB 5KBNC 4CMMB 3QIUB 1A1OA 3P4LA 5D1XA 4GW1A 3HC0B 3VWJB 3X14B 3O4OC 5SWSB 1U8LB 4OD2A 1ITBB 1DQTA 3T0EB 4EVNA 4I0KA 1AR1C 4XCFL 4HJ0D 3L3DB 4IRJA 4DZ8B 5I71C 1NC2B 4M03A 1MFAL 3E6HB 2X40A 1KN2H 1WCQA 4GS7C 4JAMB 1BBJA 3I02A 1KCUH 2VZTA 4HCRL 3IJHB 4A2MA 4DKEL 2APXA 1C16B 1FDLH 1J8HD 4RFEB 4X4YA 3BGAA 5D96B 3RNQA 5HHMD 3TWCL 1LE5B 1FZOB 1IFHH 2YRLA 2X4PA 1OGAD 3TO4C 1KJMB 2OTPA 1AO7D 1A1MB 3NH7L 5TPWH 4L4VB 2K7QA 4W4NA 2E7LA 4R4BA 5EA0H 4D9QE 5DO2D 3KPLB 3C6LA 1UWEL 4GT7A 3TEUA 3AU1A 3OAUL 4YO0A 4LIQE 4LAJH 5D7IA 4WHYG 2VR9A 4OLYL 4X7DC 2RIKA 3O41B 5DDHB 5FOBB 3QFDA 5DRXB 1N6VA 1P4LA 1XT5A 5GXBB 1IGFH 1MREH 3DBXA 4FTVA 1HH6A 4K71C 1P4IH 1YEIL 4PJ5A 2ZPKH 5EPMA 5C0DB 1ND0B 3N9GH 1BFVL 3QUMA 3GIVA 1A7OL 5K9QG 5I30L 4KTEL 3SDCB 3FB7B 1X6LA 1P84K 1MJJB 1CFQB 3TF7C 4OAWA 5EOTA 1PY9A 3UO1H 5EIQA 5IQ7H 5HYJB 2X1WL 4JZJC 4LVEA 4XVUC 3CXHK 4HUXA 3MA9L 4NKOA 3VXTA 4M4RA 1I8KA 4LLVA 4TN9A 4WI3A 1W8OA 4RFNC 1E6OH 3JBG7 1OAUH 5ISZA 1BIIA 1LP9B 3KPSA 1J0KA 3WO4B 3PV7A 4S10A 3X14A 4YHYB 4S11A 1TENA 4WTZG 4M7ZC 4U6VH 1Q9WB 3IKCA 3EYFB 4KJQD 4Y4KA 3LIZL 2BMKB 3MOBL 3T2QA 5F7DA 2X5PA 4JY4A 3NPSB 4F33B 3VRJA 2IPTH 5FM5M 2R29H 5IBUG 5IWLA 3EFDH 1IAII 4HH9A 4HFWB 1BX2B 1MCKA 4HLJA 4LPYA 4J3VA 3TN0B 4F37F 3KR3H 5FO7B 1DE4A 4P4KB 3WL9B 3MCKB 2DM4A 2NX5B 1TZGH 3B9KB 4PUBL 2EDFA 2YRZA 5IW1B 5HHNA 1YEEH 1GGTA 3IFPB 4PJGB 4Z0BL 5EIVA 4FQQA 4P2QD 1CDGA 3AU1B 4GG8B 1S78C 4I3RL 3OB8A 3QUXA 4HIEB 1T89C 5TPWL 4FFWD 4I48B 3FOMA 3FOLA 3QT2A 1EAPB 4P3DA 3B5HA 4PTUB 5D1ZC 1BEYL 4ELMA 3DBXB 1JNLL 3MBED 1QSFE 1TVDA 1OSPH 4DAGH 3IYLW 5D7KD 1QFWL 5TGBA 4NQXB 3QI9A 5I9QC 2QR0A 4PV9B 3V0VB 4Z95L 5FO8B 2PNDA 2G5BB 4PRAB 3F7YB 1AKJD 5ACMA 4MD5A 3AGVA 4FFVD 1GAFL 1KBGL 1TQBC 4KHXH 5I1JL 3D39D 4KH2A 2HJKA 5DK0B 5SWZA 1CDBA 5BV7H 2W92A 2PXYD 2R4SL 3OKKA 1JMZA 1ONQB 5D7LE 4M6MH 1CDIA 1A2YA 2YXMA 2BFVL 2WMPA 4Q9CA 1S5IL 1XR8A 3QDGD 1G6VK 3GNMH 5F7DB 2Q86A 2PYED 4OLWL 1S7XB 3HE7B 5AZEL 3AB0B 5CZVL 4PJ9C 4PJ9D 4LNRB 1UCBH 2WAHA 1OGTB 2GUOB 2F15A 1CFQA 5LGHH 1MFDL 3VFGL 4WI7A 4NZJA 1TZHA 3GMNB 4D8PA 1RU9H 5FO7A 4KVNL 4G6JL 5GZND 3ZLQC 5EO9B 3SJVB 4MVBC 5B38G 1JZ5A 1OM3H 2VZSA 4LCCA 2VLJA 4LAQH 3EUUA 2NY5L 1T2QL 2Y7QB 1N5AB 2NY0C 1MUJA 2C1PB 2IMMA 2FGWL 5A2JH 3ECBA 4UIMA 4ALAH 4RX4D 3O2WL 4FFVC 3FO1B 5DD0H 1GYAA 3PHSA 1B2WH 1PG7L 3ARFA 2ADFH 1FIGH 2W60B 2R56H 1LEIA 4I2XE 4NRXB 4R0LA 5F7UA 1RZIB 3H9HA 3MGAA 1GCFA 4M61A 2X10A 2F58L 4KROC 5J4MA 4FP8H 5JZ7D 1FGVL 5GHWH 1H15B 3L95B 4MNGE 5TFSL 3BRDA 2MKWA 3V7MA 2FECI 4O2EB 3QG7H 3GJFH 2DMBA 2NX5A 4QHKJ 2AJVL 4E0RA 5T1LD 3FCTB 4ZUSB 4X4XB 4M9PA 5DFVD 1S78D 3SBWA 2V6HA 3C5ZD 2ITCA 4PRHB 5C0GB 2A1WH 1AQKH 3RZCA 3OB0H 1CLZL 2H9GA 5I73C 4NNYB 1A64A 1IBGL 4I9WE 3SGKA 2VXSH 5GRJH 3VXUD 1W0YT 3HE7D 4PR5B 3UJJH 5EOCJ 1NCCH 2Z8VC 5JDSB 4PREA 1TNMA 4HZLB 4NN6C 4DW2H 4N0FA 3MXWH 1YNTB 4PGBB 1N2RA 1MOEA 1WFUA 2AJSH 4GFTB 4PJ7E 2NY3D 4MAYD 4LSSL 3QULB 1JPSL 3BSZH 4KVCL 3TJEL 2DD8L 3BH9A 3NPSC 3MRCA 1WBYA 5EULV 3QDME 1S7TA 4MQXD 5CZKA 5JA8B 5DJCA 4WFFD 2HYMA 1Z9SA 4LSQH 1D9KC 1N5YL 4H25A 4JM4H 4KRPD 3SY0B 4OZIB 4YHYC 3FAXA 3CFDA 1HINL 1E4WL 1BOGA 1OCWH 4P2OB 4BYHA 1A4KB 1AGBB 2X89D 5ILTL 4CU6A 1RUML 3C9NA 3U82B 3JTTB 4YBHA 3RDTA 1CGVA 3KYOB 5EZIL 2NY4B 1G7PA 2D4DA 5CEZL 3CDCA 2E27H 2OJZL 4FQHB 1DQDH 5JW5A 1OM3L 3SE4A 4DJMA 3REVB 1CGYA 4BJLA 4M6ML 5ABDE 2VXVL 4LGSB 3K8MA 4YEEA 3GBMH 3EW3B 2OLDA 4PYHA 4JJ5A 1CCZA 5I19L 1YY9C 1T7XA 3WV0A 3DUHA 5D2LA 3UTSA 1KT2B 4OGAC 5GS0L 3WFEH 2EC8A 4ODHL 5FV1L 5AG9A 3WIIH 4QEGA 4HT1L 3A67H 4KGLA 4XP5L 2I24N 4M7LH 2ITDB 2I5YH 4J3SA 4NC1E 2A6JA 1J05B 2JB5H 1EGJA 4TUKL 2KBGA 5DO2C 4PLKD 1T21A 1BBJB 2W91A 5CD5D 5J57B 1CFTA 1IZJA 4X5XB 4YJZL 1OSZB 2F53B 1U8HB 1F02I 4KJQC 5K93A 4XPHL 5JPMA 1WF5A 4EI6A 4KK9C 3QUZC 1XGQB 2XN9D 5IBLC 3Q6FB 4OLVL 3VFPB 5IG7B 5A16B 4OCRH 1YJDL 1F3JB 3C60C 2Y4SA 3QCTH 2ZUQB 4G6AD 2Q76A 3NCJH 3KPMB 1OLZA 3BW9B 4NQTA 1CG9A 3GIZL 4KV5E 4AIZA 4OZIA 1QACA 3ALWA 4HKZB 3BEWA 3GJFA 4J3WA 1KIRA 5F7YC 1CLYL 5IHZB 1MHCB 5ERWA 1EBPA 5E8PA 3RL2B 2MNUA 2LV4A 3WE6A 1DEDA 2H32H 1B0WA 3GSVB 3L3OB 4WW2A 3UJJL 1MPAL 4PJ8D 1PD6A 1RIHL 1I1AA 4AH2A 1A7QL 1FJ1A 3VFSA 1JZ4A 3RWEB 2ICWJ 5KAQG 5DT1H 1T1WB 4K8RD 1PSKL 4HUVB 1PZUB 4PB0L 1U3HB 1ETZB 2Z4QB 4P5TC 2ESVB 5EUOB 1NMBH 4JVPA 4RMSA 4XBPA 4AY0A 3REWA 5I8OL 4YXHL 4CMHB 4JRYB 2JKXA 5IW3A 3QNXA 2EDBA 4NQUA 3U4AA 1X4ZA 2DF3A 5F7WC 1MLBB 1WZ1L 1D5IH 1P1ZB 3SE3C 3VD9A 4QRUB 2J6EL 4HIJA 1X5XA 1QEWA 3U2SB 2EKJA 1VSCA 2XG4A 3F58H 3SDXE 3KPQA 1X6NA 3LQMA 3KVQA 4HWEH 3K4AA 3MUY1 4ONFH 1T7VA 1B4RA 4ZS7L 3PDGA 4HEPG 5D2LB 5HPMA 4E5XA 4FFZH 3A6CL 3WL9A 4PJ7A 1EFXD 1P53A 1BFTA 5IMMB 4KK5C 4PJHF 4NQDE 3V9FA 2BXZA 5J6HB 4QRPB 3MRNA 2NY6B 2A77H 3RKPA 3RTQC 15C8H 4WFGD 3ABZA 3PG2A 5IHLB 4RGOL 2CIIB 3DRTA 3BEWB 3CFBA 2N4IA 3FO0L 5JUEH 4GMSH 1LVEA 3DXAE 1NCWL 12E8H 2FX9H 3H9SB 4CW1B 5HDQL 5GGTA 2DBLL 4DFIA 5DJDA 4XH2B 1FZJB 2F53A 3F7RA 3LB6C 4OF6A 1YC8A 3GBLA 5E6IA 1IEBB 1S7RB 5BW7C 3TH3T 3VFSB 4ZPVA 5GPRA 2AV7B 3RAJL 3I6LE 1ZT4B 2NZ9C 1CL7L 2BVOA 3BKML 4HFUL 4QHNA 5KN5B 5GS1B 4UV4L 1IC4L 2X4NA 2EIZB 2JLLA 3HZVB 1PDKA 2C7UA 4GKNB 2VABA 4RBPK 2J8UB 2PN5A 4LCIH 1EJOL 5HHPA 5IESL 3LRHA 1ZHBB 4ZQKA 1AO7B 5HD8C 2Z31B 1IQDB 4YZFF 1VGKB 3E6FB 3F7PC 3EYOB 4P9HH 2CK2A 4PPTA 2AJVH 1S7XA 4MQTB 1JNHB 3RTQD 3NA9L 1AC0A 4MNGA 4Q9QH 5E7BA 3RVWC 1QFUL 3ARFC 3OX8B 4D0CB 4XWOC 4EBQH 2LU3A 3FT3A 4WI5A 5DT1L 5FUZL 4PB9H 4R26H 2V7NB 5DHYB 1OQXA 3H9SD 1FNSH 5IB2A 4OD1H 1KXTB 4L4VD 5JMOC 4JQVA 2AJXL 3QCUL 1FYTA 1H8OA 2GUOA 1EVUA 3QH3B 2VYRE 3BYTA 2FZ3A 4P9ML 3X13A 3K3QA 5C6PB 1DVFC 5I2IA 3FMGH 4NRXA 3WS6C 1RIVL 4HPYH 1ZHKA 2WLZA 2X2YA 3DIFA 4KKBD 4PJ9A 4P46A 4YAQA 3BAEH 5K9KA 2L4OA 5FDYA 4LCWD 4X4ME 4XC3H 4C83B 5JHDE 4PJIB 4M7KL 5D7IF 2ZSVA 4AIOA 4D8PB 1P7HL 4F8QA 4Y2DC 4Q0XL 5C0AA 1QSFA 4PRNA 2I27N 4ZDHB 2ORBL 3QEQB 2EEDA 2KDGA 3NFSL 2J5LB 3U83A 5TQ0H 3V4PL 1Q9KB 3P11L 3B8SA 4KAQH 4IMKA 2CLVB 2A77L 5SWZE 2AXFA 3C60A 4PRIE 1BGXL 3HMXL 3TBSB 3ROOA 3KYAA 4M62L 4G6JH 5E56A 1J1XH 3V52L 5L88L 4K55A 2BX5A 2C3GA 3BUTA 4JY5L 3FN0H 4W68A 3C6LD 3VRLE 1CE1H 5B22A 5I9QB 5E94B 3L95A 3W11D 3OKMA 3BH9B 5EU7E 1OGAA 5TH2A 4H1LB 5MENA 2UWEE 1P2CA 3O4LA 3RWFA 2VN7A 3P4MA 4HIHA 2VXQH 3OAYK 4NO2A 1FO0H 3LPWA 1BLNB 1CL7I 3HZVA 4BZ1L 4R7NA 4BFGA 5BW7A 4JKMA 2P5EB 4I0CC 4K8RL 5GZOD 1MI5D 4MJ2A 2OL3B 1UM4H 2X9XA 3LEYH 5EO1A 3ES6A 5T1MB 4NP4H 1D5XA 4L9LA 1MJJA 3CFEB 5E2UH 4DK6A 3WFCH 4JHAL 2FO1A 3QFJD 1J88A 1TVHA 4UNUA 3KLHD 1KCSH 2DQUL 4AL8H 4YXKH 4NJ9H 1II4E 3D85B 3U1SH 2C3VA 1I8LA 4QGTA 4XP9L 4XNZC 4YGVA 4RAUA 3U9UA 3MBEA 3GM0A 1FFNB 2XKNA 1IM3B 1O7VA 3ZT7A 1G7IB 2HP4A 3M07A 3QPXH 3MO1A 3K2MC 5I15L 4CVXB 1CK0H 4MNQA 4HUUA 3WHXB 5HHOD 1BVLA 4JPKL 3VWJC 3AREA 3NCBB 4LEXH 2AJZA 5C0JA 1EBAA 4AENA 1BIHA 5ISZE 1G9NH 1MWAA 3V5HB 3BRGC 3MJ9H 1Q9WA 2D9QB 3QCVL 1AQKL 5C9JB 3P30L 3RI5F 1KT2A 2Q6WB 1J8KA 3MQIA 4TULL 4WNQB 5KW9H 3EO9L 1XGQA 2EC9U 1U8IA 3PHOB 3F7QA 4FHBD 4P5TA 4ODWB 2N1KA 2FWOB 1IILE 5CSBA 1KNOA 4OLUH 3U4BH 2Q76B 1BFOA 3MRIA 1JYNA 4JO4L 1LD9A 4ZDHA 3IFPA 1MAMH 1PX4A 3MJGX 1QOKA 1BJ8A 4OLXH 4PJFF 4DCQB 3U79A 2WK2A 1YZZA 2F5BL 1T22A 4PJAF 3SBWC 2ITDA 1E6JL 2Y72A 3WXWL 2R8SL 1CIUA 1KTLA 4BSWA 1FH5H 2BCKB 1RUQL 4FG6C 4XCCH 3GMQB 4IOFC 3DXAD 2X70B 4JG1L 4ZUWB 5T3ZD 4X5XA 3W11C 4RCAA 2A74A 2YZ8A 4ALAL 2PETA 5CWSB 1XIWC 4PRHD 5T33H 2APFA 3GI8L 3T8XB 1DANT 3LN9A 4RAUB 3AVEA 2HFGL 3U30C 5IQ7L 3MGOB 1MQ8A 5C0BD 3UBXG 2AQ1A 3MRDA 3ARWA 1A14H 3EDEA 1WWWX 1UVQA 3GBML 4PJDF 5HGBA 3HI1B 5E00B 2EEAA 3OWEA 4JY6A 3KPPB 4YXLL 3QDGA 1IFHL 3MUGA 4OV6F 2GJ6E 2NY3B 3QJFB 1IGML 5F9OH 3ES6B 5I1EH 4ODUA 1X5KA 4Y19E 3UTZA 2VAAA 3ARTA 3V5KB 1DANU 4LSVH 4X4MA 3QWOB 3HC4L 3WUWA 5GS3A 2X4UB 1Z3GL 4WW1A 3T0EC 5CILH 5B39G 3HE7A 1QBLL 2NY0D 3C5JA 1AH1A 4QHKI 2V2WA 5MERA 2VC2L 3UJTH 3EDFA 5JOPD 2WP3O 1JYWA 4NHCH 4BZ2H 2BNRE 3W81A 1AGDA 4NN6B 4MCZA 4XTRC 4H8WH 1FYTE 5DMKB 1ZV5A 4TULH 3BT2H 4LHJB 2DD8H 2Z92B 1WIPA 3AS2A 5LBSH 1OAKL 2DICA 1S7UA 1PKQE 4U1SA 5IF0B 4LBEA 1CZ8L 1NGZB 4RNRB 3GHBL 1A6VH 2B4CL 5FYKD 3MRMB 4A2LA 5EG6C 1CTOA 3DO3A 2OQJB 2M26A 3W9EB 1NAMH 5D6DA 4ZUWA 2YPLE 4V2BA 2VSDA 4DKAA 1HSBB 1M4KA 4Z95H 2NY4D 3SDYL 1PFCA 3V8OA 4PTTB 4RAVB 2VQTA 2NZIA 2DKSA 4PLNC 1VEMA 2R0WL 5DJAB 5DUBA 5ACZB 5SWQB 5JW3L 1Q0XL 1JL8A 2IPTL 4JAMA 3AY4A 3T4AB 4NO3A 4PP2A 5CINH 1R3LA 5BOPA 4HUWB 1QNZH 4PFEA 2FIKB 4LEOB 2X1XR 4P2YA 5DHXB 3VXUA 4EI5A 2Z31A 1G7HA 1S5IH 2APVA 5J3HD 3AUVA 1T03H 4KFZC 4ZTOL 4K9EC 4FXKB 1P5VA 3CGTA 1D9KD 2YS4A 3BX7C 4NKMA 1YY8A 1DQLL 1RZGB 2EXYC 5F9WB 3VCLB 2BRQA 2DQJL 4FQXD 2DTMH 1ZGLB 1UCTA 1FFOB 3K81A 5ALBH 2OS7A 3G5VB 3NIFF 1F4AA 1KB5A 1ZTXL 3QUZB 3UC0H 3BN9C 4HC1A 1Q72L 4ENEC 1V05A 4HMDA 1V3MA 4R8WL 3ULVC 4PJDA 1JNHA 3O11B 1F4HA 4TOYH 4J6RH 3TH4T 3UCRA 1TVBA 4LK4A 4OAWB 5EOTB 1ORSA 1R24B 4RGOH 5JLZA 1DBJL 5DJ2B 5DEGA 4QRSB 3MJ8A 5DZNA 1SJHA 3P4NB 3HR6A 1DFBH 4NZRH 1H3UA 3O9WA 3SKOB 3I6KA 2VNCA 4C83A 3MV7D 1HILA 3EYSL 2GJJA 3BP5A 1JWUB 2BFVH 2Q8BL 4FTVB 5EU6B 4UOW1 4UTBL 4PJXF 5GGVL 1JHKH 4OCSH 4WWKB 4Y2OA 3C09B 1NJ9A 4OLWH 4XNXL 5JZ7C 1K4DA 5HGDB 1XF3B 5BJTB 2GJ6D 3OF6D 1KGCE 1P7QD 3FB8B 3RAJH 2WUBL 5IV2B 5J11C 5D5ME 3RVTC 1HQ4A 4YBQD 3MLUL 1VGEH 4LEOA 3QDGE 2BNQA 3LN5A 5H8DA 5C0FA 4J12A 3DURA 1AY1H 2UYLB 3TO4A 4M02A 4YH6A 4F7CA 1IAOB 3MV8D 3WS3A 3MZGB 1CICB 4L3AA 4TUJA 1BEYH 4YHKL 2G60H 2Y1VA 3Q6FA 1IGYB 3OKKB 4H1LH 4HIIA 3ROOB 4AYFA 4JY4B 1QFWH 2F58H 1L0YA 5LAXA 2ZNXA 4JKWA 4NZTL 3ARBD 1S7QA 2YPKB 1H5BA 1A3RH 3MRLA 4UU9A 5ANME 1IVLA 3A6CH 1AC6A 3HPJB 3BPNB 4ZAKB 5JOFB 2X09A 4PJIE 1OF2B 5FYLH 1KIRB 1I1AD 4RISL 4N9GA 3UPAA 4R2GD 3D0VB 5IEKA 3FTGB 3VWKD 5FO8A 4M7KH 3FT4B 5CGYD 1S9YA 2J6EA 4HUVA 4JVWA 2X42A 3UEZA 1TJGL 5C86A 3T0ED 4P3CH 4PJBB 3Q0HA 4JRXD 2A73A 3ULVF 1J0IA 4M7LT 3IFLH 4YBLB 3OJMB 2Q7YA 2EKSA 5GGSB 2Z9TA 3FN9A 4OZFH 4LPUA 5JW4R 2YPVL 3PHQA 4NGHH 4GXUN 3WFEL 4I5BA 4ENED 1V7NL 1E28B 2YEZA 2ADGB 4Y16A 3OZ9H 3WHXA 4XNMB 4OT1L 4ZXBA 1YMMA 4ZSOB 2AJ3A 4IRSB 4UV7L 5C07B 3F7VA 1AD0A 2Y07H 5DMIL 1GC1C 4HBCH 5IMOA 4ZOEA 3TESA 1BQHA 2BHYA 4U4BA 4U0QB 1A47A 4MLSA 4MXWL 5K9JH 3LN4A 3WN5B 1YY9D 4ZS6C 4Y4KC 3GMNA 5D7LD 5J1AA 4PBWD 2DQDL 1V3JA 5KG9B 4XPFH 5MI0B 1H3WM 3LKQB 3PL6A 1CU4L 1BWMA 3BXNB 3KXFB 4I77L 4LLMB 5L0QC 4X6DB 3SGDI 1N59A 3N9GL 3HTLX 4IRZL 2J8UE 2B39A 2Q8AL 1NCAH 3JTSB 5E8NB 2P47B 2QSCH 4MDIA 4CN4A 1A2YB 1RZ7L 3A0OA 4NWTH 5E5RB 3WXVL 2ED7A 3VFWA 3Q3GB 1OTSC 1RSFA 4FQLL 1J8HE 5F9JA 2UVFA 4I8DA 4N0FB 4PGBA 1URLA 4O5LH 1EZVY 1T6WA 3NIFE 5I18L 2L7UA 2XICA 2EICA 5C71A 4O2EA 1UWXK 3MSPA 3H9SA 4GRWH 3B3IA 4JGMA 3SKNB 4F7MA 2OK0H 5ESAA 4EI5C 1KELL 2WBKA 3F5WA 1FYTD 4NZUH 4DN4H 2OX5A 4ODVH 1N4XH 3S98A 3IJYA 2JF1A 4LVOB 3T8XA 2IGFH 1XF4B 1F42A 2XWTA 4F7TA 3FMGL 3EOAA 1IGTA 4I0PD 2AS5M 4UIMB 5DD1L 4HUMB 5HHPB 2H2PD 2R0ZL 4IMLA 3RIAK 3EDDA 3GMQA 5EWIL 2P43B 3QCVH 2GFBA 3C5SB 1FCGA 2YA0A 4HV8B 4UU9B 5FYKH 4A6YA 4HW6A 5IVOA 4M48L 1JTTA 4Q6IA 3CVHB 3QNYB 3MLXH 3QHFH 1TJIL 1FNEA 2BSTB 5EN2B 3KXFD 2PXYB 3WJLA 4D0CA 2FH6A 3EJZC 1XCTB 4Z7UE 5I17B 4JKKA 3FQUA 4ODSL 4X7SL 3U46B 5B8CA 5C2UB 3OAYH 5HVFB 3FRPG 4NZDA 3LMJL 1UXSA 2IBZY 3QJFA 1INEL 3IVKB 4WHCA 3KPSB 4L29B 4P4RB 3V6FA 5T3XE 3QH3A 1UB6B 3Q5YA 1U91B 3QQ4B 3P0YH 3UYOD 2PYFB 2PYEE 4DGVH 5BS0E 5IJKA 5JHDD 5GZOC 1DVFD 2GW5A 4WTXA 1XH3B 1F58L 4JQXA 5D72L 3ZT6A 1JYXA 1XGUB 4OM1L 5CBAA 5HYIA 4DKFH 5HBBA 3L3HA 3RA7L 3RWDA 5C6TL 4PGDA 1T03L 1HXYB 2JJUA 3ZKND 4LSTH 1G84A 3V6ZA 4LCWA 3MRMA 4BZ1H 2GK2A 2C1OA 1Y18B 3IDMB 1AR1D 1F6LL 4PYGA 5J1TC 4UIKL 4ZUTB 1DR9A 4Z7NE 3LH2L 4LPCA 5DMGD 3OR6A 5C1MB 4NBYB 3VD5A 1V7ML 3E2HC 1KF9B 4WI6A 1OL0A 2DQUH 1JPFA 4MNQE 5MHSD 1A3LH 3HZMB 3N06B 3VDBA 1UH4A 5E9DD 3ZE1F 1QSFD 5JDJA 1D5BA 5KJRL 1J5OL 2IGFL 2UUDH 2D0GA 4TUOA 3O6LH 1N6QL 3TBVB 1LO0L 2XXMB 3BGMA 1UC6A 2R0ZH 3SKMA 4UTAH 1FNEB 4HGKC 5GS1C 1T83A 4RMUA 5TDPA 5ACZA 3O3DB 4TSAL 4HK0A 1H9VA 5IR1B 4JFFE 5H35B 1NDGB 1UENA 4JO3L 4YDVB 2OXGA 3QNZA 3DNKA 4B53A 4D0BB 1KELH 3OXSB 5BVJB 2NLJA 1NAMB 3S3SA 3UTQB 3S8WA 4NNXA 5JW4Q 5I8KL 4UZGA 2AEQL 1CDYA 3B4NA 4MB5A 3IS1X 4XP1L 5D7SL 5FM5O 5C08B 3CC5A 5C2BH 1P9MC 2ERJB 2MJWA 3NZHL 3MV8E 4JKPL 5GRUL 4LASH 3G9VA 3FQTA 2C4FU 4HGMA 4NKMB 4NO0D 3RWEA 3O3EA 1AXSB 4YR6A 1IC1A 1K6QL 1ITCA 3IDMA 4G3YH 5CP7A 1BVLB 4G8EB 1HHJA 1TITA 2YD3A 3P4NA 1RUQH 3OR6B 4LLYB 3ME0A 5FGRA 3B5GA 1GRWA 1MELA 3EZ8A 3U0TB 4EXKA 4OFPA 4XPGL 5IHZA 2QLVB 3QB7C 3DRTB 3KWWB 2O5ZL 5E8PB 5CJ8A 4P9HL 2A6IA 2QSVA 1KLGB 2ORBH 1Q9LA 4YK4B 5GRVK 1PQZB 3MNZA 4CVUA 1YEKH 1OP5H 5ELIA 2L0DA 3LRGA 3GO1L 4ONFL 2CK0H 2ZOKB 1RHHB 2R2BA 2JJTA 5EC2A 1AXTL 4XNQB 5ALCH 5C6TH 3RA7H 3VGHA 4KROB 4JGJA 3LEXB 3LN5B 4HPOH 3ZKQD 1T1XB 5DQ9B 3O3DA 5KVMC 3I9GH 5CJOH 4EN3B 1XF3A 3CXDH 5BRZB 1X4XA 2EIZA 5FUCC 3SQBA 3W9DA 1ZANH 4JFDA 4FP8L 4AM0B 4K23L 4D0DA 1MUJB 3EO0B 1NUNB 2FHBA 1KJ2L 2VLKD 3DV4A 3LZFL 1JWUA 3FQRB 4EVNB 3T0EA 1PZ5B 2B1HH 3VI4F 4LSPH 4NC2B 4PRHE 5CFHA 5IB4B 1BD2D 4WIQA 1OAXL 5B4MC 3OPZH 1WTLA 5L7XH 3T1FA 2E8ZA 2MQ3A 1OD9A 3THML 3EGSB 2QQNL 3CC5B 2YK1H 4W4OC 4RA0C 3MROB 5F6HJ 2XZAH 5DGQA 4KY1L 4G9FD 3FTGA 4JEGB 3L5WB 3MRCB 1W72B 4ZG1A 1QRNB 3M45A 4KQ3H 3DXAA 3BWAA 3DURB 4YDVA 5C0BA 1SYVB 2DYPA 3GMRA 4QRTB 2JJSA 1IC7H 4L1DA 3QHTC 4D0BA 3SGDH 1NLDH 5JXEC 2K7PA 5FUOH 3I85A 1AGBA 2GT9A 4HKXA 4U6TA 1IAIH 2DQFA 3O6FA 3C8DA 5JQHC 1FZKB 4GQ9L 2G5RA 2RB8A 1IGJA 4OZHB 3U4EB 3I6LD 5F7FA 4HD9A 1VGKA 4JY6B 2V5SA 5C0CA 1U3HD 2IWGA 3AFLA 1PYWB 1VHPA 3BUYB 4Y5YC 1OF2A 1IEAA 4U1IA 1ZLVK 2V2XA 2R39A 2XTJB 3D0LA 4HJGA 1L7TL 2RBLA 3EHBD 4GBXB 4HIXL 1J7VR 5FOJA 1GGYA 2AJ3B 4IRSA 3BZ4B 4UAOB 4N1EA 3OXRB 4MNHB 5D7JC 4B7LA 3U0WH 3ULUF 1DP0A 3OB0K 1A7PL 4J1UA 1QKZH 3BKCH 3TWCH 3OKLA 4KC3B 4QF1A 4Y1AA 5DD3H 3VWJD 4JJHA 4YC2B 4UBDD 4HPYL 2ZCKL 4ZXBD 5JW4M 1N64L 2HLAA 3CFCL 2VRAA 4DW2L 5CJQH 3HC3L 2B20A 3WEXA 1VPOH 3UDWC 3SPVA 4KKAD 5IMKA 1FE8L 3CX5K 3MROA 4N0UE 4M93B 5DHVH 1T7WA 4V1DA 1J11A 3TIEA 1NL0H 1U8LA 4S1RL 5J9PB 3ARDC 4WCYH 2ICEA 3S9DB 1OTTC 1B4JL 4PRDA 1OWRM 3THMH 1N59B 4NO3B 4PP2B 3DX6B 1U2CA 2G75B 1F3DH 5C0CE 4MDJA 3FQRA 3WDIA 1U8NA 1OTSD 2XN9E 4KTEH 1NCDH 4QXWA 5IW6A 3ULVE 2QQKH 1G0DA 3GSRA 4P57B 2YXFA 3QDAA 2OTUA 3MODL 1TTUA 1L6XA 1OTUC 3LZFH 1I9RH 4HQQH 5BRZE 1DTUA 2P8LB 4JZJB 2J2ZA 5HHNB 1U8HA 1PX3A 1MHEA 1SYSA 2NY2C 2R2CA 1PBYA 4FQQB 4WW2B 4Q6IB 4X83A 4NQCE 5EU3A 4R7DA 2VXQL 4FXLA 5DFVC 1AIFA 1L6ZA 2P5WE 4XMLH 1ZA3A 3HUJF 5FOBA 3ARXA 2F54B 3I50L 1J8HB 1RK1A 4GG6A 4QRTA 1FFOA 3D3VD 2C4XA 4JFOB 1REIA 4ZFOL 4WO4A 2W0FA 4APQC 5CJBA 3S3PA 1RZJL 2HFEB 4CKVX 1JF1A 3VDAA 2EDTA 1T0NA 1XF1A 1TFHA 2R4RH 4R2GB 2BSTA 1UCBL 2OL3A 1MCEA 1UM5H 5IJVB 2CKBB 3BZDA 3VG0H 2WSKA 1YUHB 3BKMH 3IAPA 4I2XA 2DL2A 3UTOA 5DEGB 3GK8H 2I9TB 1OARH 2FX7L 4AH2B 3O9WB 2W65A 1I8KB 1P2CB 4AIXA 1HHIB 3KLAB 1KXVC 1IM3A 4MA8H 5CJQL 5C0RH 1P6AB 5SWSE 2Z4QA 5E5MA 3M17A 3CFKA 4Z9KB 4O58H 1OSPL 2EDJA 4LVHB 4NUGL 4ZFFA 3ARZA 3I75B 1A9BB 3L1OH 1NUDA 2AK4A 4DUWA 3HE7C 5I1CL 5M94B 4EIZC 4NWUH 4N0RA 4N8CL 1SBSH 5CIPA 5CUSL 2KQMA 5FGSA 1RJZA 4FMFA 4Z7QE 2IANA 1C08B 3WIFB 1QBLH 1JGLL 4JFQB 2W0PA 5J12C 4GKZA 1KEGL 1JPTH 3MRRA 5C09D 1I9EA 5H2BB 1P4BH 2XWJA 1YECL 4F58H 2A1WL 4KK9D 4RZCA 1TQCB 2X4PB 1IARB 3M1BB 1OAQL 3FQXA 2HG5B 4OLUL 3RUGB 1A6ZB 3CU1A 3PWVA 5KTEL 1INQA 2DBLH 2HTLD 1QUNA 5C0FB 3L5HA 3GRWL 5JTWA 4YHPB 2D3VA 2MQCA 1MHPH 4Q58C 4M6AA 3CVIH 3IJHA 1U0QA 2DM7A 1E6JH 5E00A 2FL5A 4GW1B 3DO7A 4Y2DB 4JFEB 1M71B 2XYCA 3QIWA 4JDTH 4XC3L 4P4KD 4UB0H 4XCCL 2CLRB 4GRWF 5J0BA 2A0LD 3NIDF 2ZKHH 3LMJH 1HHHB 1BQLH 4JANA 3U0PA 1FL3A 3LKNB 2KH2B 5GRXG 4LP5A 3JWOC 1JIBA 4LIQL 4N90D 1U8JA 3SDDC 3QUMB 4XVSL 1P4IL 5JOFA 1QSEA 3VFUA 4R4FH 4U05A 2NXYC 4I0PB 3VWKA 3O0RH 1F58H 1JZ7A 2RCSL 3KLAA 1JWSA 3AMKA 2LFGA 4O2FA 2BVOB 2XTLA 4NQEA 1LO5A 2J88L 3INUL 4WO4B 2Z92A 4YHML 1I9IH 3JWNC 4P2RE 3KPPA 5JORB 1YEFL 3MLSL 4KRNA 4LLAA 1B88A 2DQEH 3RZWA 3QFJE 4M1DH 5I66B 1NGPH 2UZYB 2RHEA 2W1NA 1CLOL 4FQXC 4W81A 3P4OA 1KCVL 3V7AE 1H3TA 5FHBL 4W4OA 2Q3ZA 2IANB 3HB3D 3QWOA 3QJHB 4ODHH 5KOVC 1RHHA 4S1SH 2NR6C 3ALPA 2APTA 5D8JH 3I2CH 2UWEF 2AXHA 3P2TA 2H8PB 3HMWH 5DJAA 5D7LA 5E2UL 2ZSVB 2AVGA 2EYRA 5E5MB 3MLXL 3RVXC 2BMKA 4GOSA 3RWHB 2AQ2A 3IJSB 3LQZA 3TNMB 2ATPA 4R96B 3TN0A 2Y25A 1OWWA 3C08L 4ELKA 4IJ3C 3LRSB 3BD3A 1A1NB 3BMWA 4OQTA 4Q0XH 2VDOL 4JANB 3DHMA 3CSGA 3TJHD 3BP7B 3MLYH 3IGAA 3VA6A 4WWKC 3UTTB 3CUPA 2DQTL 3L7EB 3QXAA 3G04A 4ELME 2X4SB 3BDBA 3RZCB 3MUJA 5E9DB 1FVDA 3O4LE 2A9NL 4I13B 1DQDL 4KUCD 1BLNA 3BPLB 3N50A 1JTPA 2HJKB 5DK0A 2YSSB 1EUTA 5IFHL 4LBEB 1BD2E 4R7NB 4KRPB 5HGGS 1T0MA 3S96B 3MOAL 4XXCC 4WW2C 1YYLL 1MHCA 5DJ8B 1RUAL 2HKFL 2OQJA 2XA3A 2OR9H 3N85L 3VXUB 5LWYH 3U4BL 1QO3A 1F3JA 4LHUD 4YHZH 4R2GC 5C0CB 5DJZB 5GGVY 2WIIA 3FHQA 1KCRL 1RZ8A 4MAYB 1KJ3L 2CD0A 4H25B 4RAVA 4PJAE 3KPRB 5F8RC 2R8SH 5GS0C 1FZMB 3KYNB 1CLOH 4FS0A 5I1DA 5KVGL 4R4FL 2FEEL 3MREA 5F1SA 1A3RL 2H26A 3V8CA 2ED8A 1ZOXA 5JHDA 1D5IL 2X1QA 3D39A 4L8DA 4M1GL 5F6HI 1UYWH 2ZCLH 3QG6A 2VH5H 4PJEA 2ZPKL 1OGTA 4FRWA 5KSVB 5AYUH 1ZT7B 4YFDB 4IIQC 4AQOA 1MCFA 4MAUH 1H3XA 3EOYG 1CIDA 4JPKH 4POZD 4FABL 4CRPA 1AQDA 2AJYH 2H32B 1ZHNA 5GSRA 2PO6A 5IMLA 2BNRD 5CD3A 1SJHB 1C5CL 2B8OT 2LAAA 4PGDB 5J11B 2E9BA 4XBEL 4J1UB 5E2TH 5L6YH 3VGAB 2SEBB 3VCLA 4UINL 3GSQB 4WHYH 4IOFD 5EBMA 1OQOA 2MFNA 4JCLA 5FYJD 3IXTA 1N4XL 4QRRE 5C7XH 4NQSA 4JFEE 2XPGA 3H9HB 1IM9B 4HS3B 3PABB 3TNMA 5JW4N 4X6CA 1YEGL 4ODTH 3S96A 2NW3A 3PWNA 3VGDA 2ZUWA 3GRWA 4Y4FC 4F9PC 1W8NA 5EBLA 2NTFA 2FYYA 2YKLH 3NGBB 4YXKL 4RGMC 1OAKH 2GCYA 3MV7A 3KLSA 4NO5B 4UV4H 1J1PL 3PQYD 5GISL 3QHFL 1X3DA 1YNKL 2QHRH 4MDJB 3P9MA 1CZ8H 4U3HA 5IIEA 2HKFH 3D69A 1IQWL 5D1ZA 1FYHB 4Y89A 4ZUUB 1Q38A 3RWCB 4UNVA 2VXUH 4ZOAA 4H20L 1I1FB 1LMKA 3NBNA 2HAZA 2YSSA 4YLQT 5FA4A 1AD0B 1HI6B 2NY7H 3F58L 1XGTA 4G8FB 3KJ4C 2R0LH 5E6IC 2Z8RA 5EZOL 3CDFA 1EGJL 1DJSA 2CKBA 4NN5B 1DUZA 1HIML 2X4OB 5FHAL 3IU4H 4FFZL 2OZ4L 2QSTA 3GB7A 4JDZB 4OKVB 1N8ZA 2OSLA 4QXUH 3DUUB 4KZEH 4I3RH 4LSTL 1HXMA 5IWLC 1V7NH 4WJ5B 1KBGH 4XPBL 3T3PF 2FX8H 3FT2B 1A6TA 2GAZA 4J2XA 1LNUA 2WBJB 3STZB 1HSAA 1L0QA 4EUPA 3QCUH 1DDHB 1L4IA 3CLFL 3QUYA 4QRRA 3WHE0 5L2KA 5BZWA 2A6IB 4G8IB 4G8GB 4HXAL 1JF6A 1E4XI 4Z77B 1G7JB 3L3JB 1WT5C 4ZFFB 2MQ0A 4NRZB 3HG1B 3LOWA 1U42A 1LO4H 2JB6A 3PQYB 5DWUL 4I3GA 2E6PA 2BVPB 2BC4A 3L3DA 3VFMA 2I07A 5I1GL 1HSBA 1I9RL 4PY7B 5AWNL 4FG6D 4BSVA 2JIXB 3IDXH 1YMMD 3KAAA 1XCQB 5D2NB 5FXCH 4LCIL 1NKOA 5D93B 5AUMA 3UROR 4OM1H 3PGFL 4GAJL 1SVZA 4XCYB 5HHQA 1WVZA 3DIFB 2DQHL 1FIGL 2VDKL 3BIAX 3PL6C 2GSGA 1MWAH 1AXIB 2UWEB 2IG2L 5IHUH 1R5WA 4G5ZL 2HG5A 3NFNB 4U3XA 1K3ZA 5EBLB 3WYRA 4J7RA 4NZUL 1D6EA 5KSBF 3BVNA 4JKLA 2FBJL 1VFUA 4FOMA 4GG6E 4ZPVB 3GSVA 1MFEH 2DDQL 3ARBB 1DZBA 2VC2H 1CN4A 3JV6A 4DGIH 3DI2B 4WWKD 5JPMB 5TH2B 3QIBB 4G9FA 3FQXB 3GGWA 4PG2A 3FONB 4B0MM 1ES0A 4ETQA 5IB5B 5KVEL 1FG2A 1MSPA 3MV9A 5IK3A 4M48H 5KANI 3QUYB 2AQ3A 4QRRB 4KUZH 3KPMA 3U30B 4X9IA 1I3UA 1KEGH 3QUZA 2GIYA 3BKYH 3CSPA 3EYOA 4H20H 3AXLB