1N3NB

Crystal structure of a mycobacterial hsp60 epitope with the murine class i mhc molecule h-2db
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
99
structure length
99
Chain Sequence
IQKTPQIQVYSRHPPENGKPNILNCYVTQFHPPHIEIQMLKNGKKIPKVEMSDMSFSKDWSFYILAHTEFTPTETDTYACRVKHDSMAEPKTVYWDRDM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords H-2 CLASS I HISTOCOMPATIBILITY ANTIGEN, D-B ALPHA CHAIN
publication title Structural analysis of mycobacterial and murine hsp60 epitopes in complex with the class I MHC molecule H-2D(b)
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
total genus 14
structure length 99
sequence length 99
chains with identical sequence D, F, H
ec nomenclature
pdb deposition date 2002-10-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1n3nB00
4OZHF 4X83A 2BVYA 3B5HA 4X6CF 1T1YB 3V4UH 4GLRH 4F2MA 2MCPL 4C4KT 4Y4KB 3H3KA 1ORQA 1T7WA 4FZ8H 4I2XE 5A2IH 3A0OA 4UNTA 3AUVA 1UWGL 4I0CC 3V5DB 1FZKB 3ROOA 4HIEA 5JLZA 1VACB 4OZFA 2QL1A 1NFDE 3CVHL 1IAIM 4OGXL 3MMEA 3HPJA 4U0RC 1D5MA 4PB9H 3G6JE 3ARYA 2VAJA 3QDJA 1CXIA 3RWHA 5KSAC 1QSFD 1IC5L 4I8DA 5FM4A 5FK9B 3BISA 2F5BL 2W65A 4N0YL 1EHXA 4G80B 1K4CA 2APWA 5BZDA 2BHZA 2AKRB 4XGZA 4GUPB 4YHKH 4XNQB 1MVUA 1JIBA 4ZS6C 2CXGA 2RHEA 1H3GA 3MXVL 2F5AH 4M4RA 4X5WA 3I9GL 3V8OA 3KJ4C 3RVTD 3NH7L 2IADA 3BDYL 3NVQA 4UV7L 4U7MA 1RHHB 1MNUL 3DUSB 5DT1H 4A6YL 2OCFD 4PGDA 2R0LL 4F57H 2BSSB 2W9DL 4M00A 1CDGA 1ZK9A 4OF5A 3QEQB 3I2CL 2BC4A 5EU4A 5IK3B 5HVWA 1OY3B 1DVFD 1MREL 4OCXH 4IM8A 5IB3A 3HMXL 3UJTL 4BH8B 1EAPA 1N6QH 4XAKE 4HIIB 1JV5A 4HWNA 3SBWA 5JW3L 2OL3H 3H0TB 5TE6H 4XC1L 4YQXH 2KZ1B 3LDBC 4NQCE 5IROC 4HX1B 4APQB 3H3PL 3IVKA 4LLYB 1CFSB 3WDIA 3DRQB 5IBUG 4L29B 3TJHD 1OARH 5AD0A 5ETUB 1T2QH 4GRWE 2OM5A 2RBLA 4GQ9H 3RTQD 5CJXA 4O4YH 4KVNL 3WIHL 4C56A 3RPIA 43CAA 2X7LA 3KYNB 3HC3L 1DJSA 5GGTL 4D9LL 4ODVL 1J1PH 2B20A 2CIIB 3A6BH 4WNQA 4WWKA 4K3HA 2WBJC 4GXUM 5KJRH 1YEDA 3OR7A 2R1XA 4Y5YB 2AAVA 1X5GA 2ESVD 5DR5L 1YQVL 4FTVA 2EXWD 4NO2A 4X9HA 1S3KL 3OZ9L 2OTUA 3GMQB 3UJJH 3UAJC 1NSNH 1YEFL 5TDPA 5CZKA 1T5XA 2GTZA 3MLUH 3GSQA 1CDIA 4WI9A 3AAZB 2V2XB 2R56L 1KCVL 4WW2F 3BPOB 3IU3B 3ESUF 4ZSOA 1AR1C 3NABL 2BOCA 2YMXH 1MY5A 1DBML 2NYYC 1CGVA 1A7QL 5B22A 2Y06L 1CN4A 4NQDE 5EO9A 2EIDA 3QHZL 1G7MA 2GAZA 2ITDB 5C0GA 1JPGA 3NIGF 4XTRD 5DFVD 3TO4A 5EB9A 4MNQD 3F12A 1EHLH 1UZ8A 4G42B 4M43L 4BELD 3F7RA 3IU4H 2LTQC 1FIEA 1NFIB 3T2NL 3L3JA 1CCZA 4PY7B 3HMWL 4PRHD 4M1CC 3EHBC 2G75B 3GSNA 1HZHH 2Q8AH 4D0BA 3VGHA 1CG9A 5J4MA 3WIFB 1CQKA 3T1FB 3HE7A 5D71L 5L2JB 2MMXA 3S96A 2HA1A 1KIRA 4Y2DB 4HH9A 2X05A 2A1WL 4PYGA 1CICC 4X5LA 5INDA 3HC0A 3EJYC 5HYSA 1JZ3A 2WUBH 1TZGL 3L6FB 1I85A 1P6AB 2B7DT 5D1XC 2YHGA 2P8MA 4P2OA 3T2OA 5ESQB 2ZKHL 3IJSA 3QFDA 5CWSA 1A1NB 1MUJA 4OIAA 5K9KA 4FP8H 4PREB 1NMCB 4HIJA 3VI4E 4K7PL 5E70A 3D25A 3KPRE 4OIIH 3ARDD 1FE8H 3E3QC 2EE3A 4M9PA 1ZAGA 1FFNB 2QSQA 4JANA 1A47A 5JXEC 3IFOB 4LSSL 4F7PB 1AFVL 5F1NA 2IG2L 4JRWA 5GS2D 4CU7A 2G5RA 3B6SB 4XBEH 3I3EA 5E6ID 3TJEH 1TJHL 1K5NB 3KYMA 1TPXB 3RL1A 1P4BL 5J3HC 5C0BD 1LO0H 4GW5B 4DW2H 2Z0BA 3LQZB 3RKDC 3KLDA 3FT3B 4Q9BA 1YYML 3AMLA 3ZKNC 2HT4D 2QV2A 3MUGB 4HIHA 1ZT1A 5IHLB 3O3BA 4XPTL 4PGEA 1SJVA 5FEBA 4RAHA 2UVFA 4N1HB 2O5YL 3VFPA 2QQLL 4PG9A 4FHBD 4HUMB 4ONGL 1S5HA 3AS3A 3GHBL 1FV1B 2CK2A 3MGTB 2DD8L 1HOCB 3OKDA 4Z77A 4K71C 1X6NA 1QLFA 3NFSH 3T8XA 3IFNH 1BJ8A 3IJYB 3PNWA 1AC0A 3GMLA 1G7LB 5LXGH 1KLGB 2BCKA 3RU8H 4XBGA 1ZWIB 2JCCB 3B2VH 5LAXA 1YEJL 2P46B 5JQ6L 1JI1A 3UTTB 1IM3B 2ADGA 4HH8A 2ZCKL 4JZJC 4PJIA 2ERJC 2FCBA 2NX5A 2DWDB 3ARGC 4Y5XC 2HVJA 3D0LB 4YXLH 5T5NF 2BNQB 1K6QL 5L2KB 1CFQB 2DI7A 1HHHA 4BK5A 1BLNB 1PD6A 1HHGB 4N0FB 4Y8DC 1KB5A 2K7PA 1PSKH 1LP9B 4PJDE 2NR6D 5DQJB 2XQBH 5D1QA 1ND0B 4QNPE 1A4KB 4KQ3H 3PGDB 5FCSH 3P73B 1N5YL 4F7MB 1B4JL 3LRHA 2Y7QB 4ZUVB 4CDHA 2XZQL 1D5ZB 1H3WM 4OD2A 1S9YB 2VH5L 3PG2A 4JPKL 4WTZG 1FO0B 2IBBA 4JM2F 3KDMB 3H9HA 4KI1A 4HHAA 3HR6A 4HF5L 3TT3H 3UZEA 3U0PA 1ORSA 4LHQB 3PJSB 4MA3A 3SKOA 1S5IH 4JY6B 4MX7B 4L4TB 2EC9U 1KB9J 1OTUD 3U79A 1INQB 1FHGA 1ERNA 4ZUTB 3U7YH 1HYRC 2YPVL 1PG7L 3ULVE 3MV7E 4O51A 3W39B 4PBXA 1RV6X 1XGQB 4HC1A 4RX4A 2FO1A 4WV1A 2E27H 4RQQB 5CHNB 3BAEH 4KK8D 5CZVH 3OG6B 2XKNB 2BSRB 1QRND 1YZZA 2XWTB 5EUOB 1T6VN 3UJIH 3QQNA 4U7KA 2ZCLH 2GIYA 3T0BA 1MCWM 2BP3A 4NQSA 5CD3A 4Z8FL 5H37G 2VE6A 4YFEA 4JN1L 3UBXI 3ULVL 3D5OF 5T3XH 1A6UL 1QSFB 2BRRH 1I9IL 4N8CH 4NQED 5CZXD 5HHNA 4PJHF 3CFJA 3GI9L 3WFBH 3BT2H 1RJLB 5CIPH 2A38A 4KDTC 3QCUH 2VIRB 4P3DB 1DVFA 3L3OB 3U0WH 3VXMA 1UWGH 4G8GE 4M1GL 3ILPA 1NCUA 3DO7B 1AXSA 2VXTL 5GRXG 1LEIA 4PS4L 4NUGL 3WO3B 4OGXH 3TC9A 4AY0A 4ZPVA 4RZCB 4HWBL 5FKAB 4RMQA 1PY9A 4U1LA 3SGDH 2BY3A 4LEXL 1EERB 2F5BH 2H2PD 3T0EE 2APXA 3IXTB 4N0YH 1ZLUH 2XIDA 4XXDB 1FFQA 4YHYC 4P5MB 1IC7L 3DSFL 1H3XA 4TUJB 4Z78B 3FOMB 2V7NB 4O58L 3BQUD 3V7AG 4C4KO 3RQ3A 4G6FB 1VFAB 3MXVH 2LVEA 3TCLA 4XB8A 3I9GH 5CSZA 1MCQA 2GK0B 4JB9L 2ESVA 4QOKA 4UV7H 3UC0L 2P44B 2FGZA 3WHXB 3D0VB 1MNUH 3RTQB 1QRKA 4A6YH 4JRXD 4FQJL 1EEYA 2W9DH 3HE6B 4PJEE 3I2CH 3EDJA 4NGHL 1MREH 5CP7A 1T20A 4NIKB 3ULUD 3MLTB 3HMXH 3MFGB 3UJTH 5IVNA 3DX7A 2CGRL 1YC8A 3WCYA 5HPMB 5JW3H 4M6NH 4XC1H 2FX7H 4ETYA 4MJ5B 2YN3A 5DFTA 4R7NB 1QEWA 2YBRA 4JJHA 5IB1B 3MUY1 4RA3A 1NEZB 5C07D 2V7HA 2R1YB 1BZQK 4MNQA 3WJLC 5MENA 4YPGA 1IEBA 3TBTA 3BGFC 1A2YB 2CDGB 2Y1VA 2EEBA 1FGNL 2IFFL 2QEJA 4LDOB 4KVNH 5F3HA 1U3JA 1A14L 3PP3H 4NO0A 1HKFA 1XF5B 4CVXA 2UWEE 1CDYA 1KCLA 5D9SA 3FQWB 5EU5A 5FUZL 4NN6C 5DD6A 3DO3A 2XQYG 4TRPL 1BJ1H 2ARJQ 3PL6D 4JZOA 5DR5H 3W5MA 4F58L 2AEWA 3DX6A 4YDKL 1YEGL 2VTFA 1S3KH 3OZ9H 3O0RL 4P3WA 3STZA 1YEFH 3MRNB 4DZBA 4YFLF 1I1YB 2YA2A 3GKWL 2I9LB 5JA9A 5F7FA 2R56H 4Y4HB 3NABH 1JMZA 3OXRA 3LKNB 2IH3A 2J5LC 5DRWB 5FO9A 4OZIE 1A7QH 2Y06H 1PKOA 3F5WA 1M6OB 1SY6A 4XCCH 1WC7B 3S5LB 3L5XL 4GG6E 5KANI 3RWCA 2JB6A 2EDYA 5C09E 1OT2A 2H26A 2MHAA 2CO6B 3EOYG 1U8IA 4E5XA 5D7LE 4M43H 2P45B 4H25A 5BO1L 1I3GL 3ARDA 7FABL 5DJZA 1Y18A 5BVJA 4E0RB 3EYFA 1CWVA 5HGBA 3O2DH 3T2NH 3KYAA 3INUH 4MNGB 3HMWH 2NY3C 4O2EB 1DEDA 4LKCB 2NY6C 3TGXA 1ED3A 4NRXB 1JGDB 3NIFE 2XG5A 3L3HB 4U6HA 8FABB 3PIQA 4L8DB 2KQNA 5C0BA 2VC2L 3PWLB 5T1LB 3TZVA 1GOGA 2BXYA 5IMMA 3EO0B 3WFHB 2DMBA 4XVUC 4J6RL 4JFPA 4PPTA 5IM7B 2APFA 1K4DB 4GQPH 5CKAA 2BVPA 4OM1L 2A1WH 2J6EL 3ES6A 2R29H 1B0WA 1MCDA 2VRAA 1TZGH 5E6IB 4PRDA 1WAAA 1CVSC 4PG2A 3VXQA 4BFBD 2ZKHH 1CGYA 4I48A 1QQDA 3F6LA 3D85D 1IGJB 3IAQA 1T0PB 2DQJL 3BFOA 1NLBH 1U58B 4X9FA 1KJVA 3UXFA 5D96B 4CN6A 2AQ2A 4N5UA 4K7PH 1QFHA 2F8VA 3MV01 4I9WD 3SY0A 4BK4A 4J3XA 3K8LA 3QP3A 3TO2B 1G7IA 3PWPE 2HMIC 4WO4C 5GS1A 3KJ6L 4LSSH 3EDKA 2Y25A 2WINB 3MNZA 2OZ4A 5F88A 3RJQB 1E0OB 2C5DC 5CCKL 4HKBB 4FFVD 3RDTC 2YPLE 3MBEA 4MJ6A 1UKTA 5FF6A 4XT1C 5J6HB 1YYMH 2EH7H 5I73C 5C0AE 2M2DA 3O8XB 4GRMB 4QRPA 4J3VA 1MIML 3MTRA 3O6ML 1OGTB 2O5YH 1V3KA 1P53A 4P57A 2AVGA 3QUYD 1JJUA 4JVWA 4ONGH 3H9SD 5DGRA 3GHBH 5DHVH 3ROLB 1IKFH 2ED7A 5D70H 2A74B 2DD8H 4JE4B 4PJAB 4X6EB 1EFXB 4X4ZA 4P4KC 4Z7WE 4YC2C 3VWJA 1DUZA 3MNWA 4OLVH 1FNSL 3TF7C 1F6LL 4CVZB 3FO1A 2FBOJ 1YEJH 5CGTA 5JQ6H 1ZHNB 4G6AC 1R5WB 5EA0H 2FBJL 5FA4A 4E41A 5ESAA 4KTEL 5D6DC 1OL0A 2VDOL 5B8CB 1K6QH 1WFNA 4NQVA 3I02A 2IANA 1A9EB 3I3BA 1H8OA 2OSLB 5HDOA 1QRNA 3MLXL 2FEDD 4JM4H 2VERN 1SYSA 1CD8A 4PD4K 4ZXBD 2DDQL 1K2DB 1KTRL 3AROA 1GCFA 2XZQH 4YZFE 3LN5A 4N0RA 5LGJA 1JYVA 4BUGA 4PP1C 1KIQA 3BP6A 4XNZC 5B38G 4JPKH 5HJ3A 5I66A 2XPGA 4X9IA 4YK4B 2R39A 1B9ZA 4I1NB 4OLYH 4R2GB 1BBDL 2DIAA 5E94A 4UQ2A 5IMOA 3QH3B 2YPVH 3VD9A 3I75A 4YBQC 5FM5M 4U1JB 2VLRA 5J9PA 1HEZB 2LU7A 4WHTA 3CH1B 4G6JL 4NQEB 3L3IA 5IEHB 3U1SH 3FN0H 5FAAA 4JLRB 1OTSC 4HAGA 4P9ML 1QSZA 3BWAA 2ZUSA 3GJFH 5D72L 5JHDD 5D5ME 1LO3L 1CU4L 1HSBB 2X09A 1I7TA 5EOCH 2JJSA 4F9LC 4GAYA 2ORBH 4LIQL 2VLKD 5DA0B 4AL8L 4LLMB 4F37K 4LHUG 3LQMA 3ISWA 2XNAA 4HEPG 3H7BA 1KPUA 5L0QB 1A6UH 4PRPA 1FZMA 2AQ1A 4L3CB 1ZSDB 1P9MA 1RUQL 2LAGB 4JFXA 3BIBX 3DBXA 4JRXA 1A4JA 3DPBA 3QIWD 5F7EH 3CU1A 3BQUB 2X4TA 2FHFA 4NM8L 3DGCR 1CGWA 1YA5A 5SX4H 4MCZA 4WY7L 3MLSL 3S37L 3CX2A 2DRUA 1EV2E 2YD7A 3BVNB 4L8SC 1U8PB 3RWDA 1RUPH 4OKVB 1SJHB 4I0PD 2VXTH 4U33A 5JA8B 1G1YA 5EIQA 2SEBA 1FNHA 3ARFB 5L7XL 3MJ8A 4D2NA 4HFUL 3WJJC 1NUFA 4BFIB 5IHZB 1T03L 1FNEA 2QSCL 4HWBH 5IB4A 3CFDB 4PGZA 3BRFA 1R0AL 5KVFL 3IDYB 5FGCE 3HKFA 1LO5A 4LEXH 2PNDA 2FDBP 2EDXA 1A0QH 1P4LB 4I3SL 3G9VA 1MHPL 1FNGA 3X13B 1IC7H 3DSFH 5F97E 2P24A 5C8JB 4O58H 3MLVL 1AD0B 3BZFB 3FFDB 1KIPA 3RVUC 1AKJA 2GJ6A 4Y16A 1UJ3A 5KVEL 2D9CA 1YDPA 1YMMA 4YLQT 1I1AC 5IFJA 2V5TA 1MCLA 1N7ML 5C07B 4UTAL 1NGZB 4U2YA 3UC0H 5DWUL 2AGJL 1MH5B 5F71A 1FIGH 2XXMB 1HI6A 3MRPB 4FQJH 4Y88A 2BOBA 3UZQA 1KTDA 5EU6B 4HUUA 3CPLB 2EE9A 3CVIH 4LVHC 5I1DB 5ICYB 1QR4A 1RZ7L 1F90L 1MJJB 4KMTL 1FYTD 3ARBB 3B9KC 4BM7A 4EQ2A 4JRYD 4PLKD 2C3WA 4U1KB 4MNHA 4NWUL 4LU5L 1C5BL 1EAJA 3QFJB 3PF2A 1FGNH 2IFFH 4QHKJ 4QRSA 5E1HB 1IVLA 4WTXA 1YEEH 1KCSL 4LCYB 4X7DC 2C3XA 1MCOL 4GG8B 3UTSE 1CXLA 4U6TA 3RI5F 5B3JE 1NLDL 3UYOD 4X6FB 1CLYL 1T22B 5BVPL 2YPKA 1AO7D 2W07A 2X1XR 4IRZH 4NCC2 3RWEA 4F58H 1FQ9C 4YDKH 4JPWL 5JOEA 4AT6B 1BEYH 4HK0B 3ULVC 4HZAA 4LEOA 1C7SA 1JRHL 1W0VB 1F5WA 3GKWH 1UA6L 1T4KB 5L8KB 3MYZA 2NPLX 1WWAX 3ZTJH 3IKCA 5I1AB 5JNYB 2NTFB 1IC1A 3JVGC 2FJHA 2VL4A 2NMSA 3RZCD 1RZ8A 1NMAH 5HVFB 4U1IA 4S0SD 2FO4A 2RAMA 4L9LA 4Y19A 4ELME 3GSWB 4X7SL 1T0NB 3D85A 4DUVA 1L9NA 2V2TA 1OB1B 3O41B 5GS0L 2YEZB 4GKSA 4JFEB 4P2RD 4C54A 3GFUA 3AREC 4HQQL 3QUXD 5GRYA 1I3UA 7FABH 1S9WB 4OZHE 1MI5D 4X6CE 1OP3K 5E8OB 4M62H 4DAGL 3WUWG 2B2XL 1XGYL 2G2RB 1D7FA 1BQHB 2H9GA 1GRWA 3IDXL 1O7SA 3LMJH 1AQDB 5E9DD 1RZJL 1G0YR 1QR1B 1GHFL 5EZOL 4YHLL 4U31A 3OKYA 2VC2H 3KPSE 1BJ1J 4KRPC 3GSUA 1WIUA 2E7MA 4V2BA 5TDNB 4J6RH 3MA7A 2J8HA 4OM1H 5CLTA 1TCRB 5IVXB 2J6EH 4H0IA 4L8CB 3R0NA 4RFOH 3EFDL 3WFZA 3CDCA 4HUVB 4WI4A 2C1PA 1OAQL 1EHNA 3MLZL 4FG6C 2QKIA 3T0EC 3ZKSD 4Q97A 5MEPA 2DQJH 4U3HA 5H94A 3S9DB 3C9NB 3NFPB 2ZJSL 5H35B 1E28A 2ZUWA 3D69B 3P4MA 1XF2A 1I3VA 43C9A 5DEGA 2HJFB 3G08B 3QHFL 1YECL 1XR9B 3O4OC 5T1MB 4WVRA 5KSBA 1OPGL 3E6HA 4DKEH 1ZLWK 3H9SB 3KJ6H 2XTJB 1DQDL 3GKZA 3HZYA 4MQXC 4NNPH 4POZC 4ZFGL 3LD8C 5CCKH 1E4KC 1HQ4B 5AAMA 5I76A 4X8XA 3SDDD 3MRMA 3IXAB 3ELAT 5H8DA 3G6AB 1CLZL 1FLRL 2VDRL 1AGBB 4ELKA 2Z35B 3DURA 5F7NC 5C0DA 4KPHH 5DO2D 3L3KA 4XNXH 3O6MH 35C8L 1UH3A 2ZNXA 4F37F 1H5BA 1U8HB 1DL7L 1WSST 3GHEL 3MA9L 4FQ2L 1MFAH 5CJQH 3Q5TA 1ZOXA 4YFLI 3V5KB 1TNNA 5DJ0B 1BMGA 3V79C 4MD0B 3LEXB 1KB5L 1WITA 1CFTB 4M6ML 2H8PA 4CMHB 5HI3D 1I8MB 1HYSD 3ORJA 3CX5K 1OAKH 3KR3H 3MLWL 1C1EH 1D5XB 5E5MA 5DRXA 1PDKA 3OPZL 4AEIL 4Y5VC 2FBJH 1NQBA 5EULV 4HUKB 3SE3A 5JDSA 4QY8A 4WCYL 3PV7A 1JGLL 2WW8A 2I27N 4EI5A 1I9EA 4DK6A 4NO5B 5ACMA 3ZTNL 3GB7B 3S97C 1MJ7L 4MXVF 4P23C 2G5BA 1FZJB 4Z6AT 3VGAC 3ZKQD 4ZG1A 5JHDA 2NY1D 2NNAA 1AI1H 1C08A 5D7KD 1KTKE 4XHQA 3MGAA 5JOPE 3CCHB 3CLEL 1JFQH 1Z9LA 1NCWL 5GGSB 3FO9A 5DUBB 2ENYA 3QWOB 3SDAC 3JXAA 2H2SD 2R23A 5I18L 5HHQA 5IWLA 2ZSVB 3RNKB 3EO9L 3MRKB 1A3LL 4H1LH 3ZYZA 4NNYA 4L1HA 4NYLA 3NFNB 1QUNA 3OJDB 1BBDH 5FYJE 3C5ZD 3M07A 4OBSA 5IR1B 4QRRD 5DJ8B 2X4NB 3HI1B 4QHUB 1N59B 4CN1A 5DMIL 2AKRA 3IT8D 5A40E 4BKLB 2AEPL 2F58H 4HCRA 2ZOLB 4I0PA 3TYFA 2GHWB 4KI5F 2Z92B 2VO5A 3QIWB 1JE6A 1M05B 1T7VA 2GUOB 5D72H 4WUUD 1FSKB 4LLWA 4JFZH 4V1DE 1CU4H 2AXFB 3QZWA 3BZEB 5DS8B 1WBYB 4MA7H 4OFPA 3TIEA 1KEML 4WFFD 4XP6L 4J8RA 1DBBL 4LIQH 5FYJL 3RVWC 4QOKE 4G6ML 3VFGL 5DHYB 2EYRB 4OZFH 5B4MD 5GRUL 3VXSA 3QULB 3ZL4L 1PZ5A 2NY0B 3ZYJA 2GTWA 3I50H 4PJIF 1IMHC 3ARVA 4JHWH 4JVPA 4HX1A 3OAZH 4XH2A 4OUUB 4JFFB 5C6PB 4H8WH 5F6HI 2Y5EA 2X41A 1YY8B 5KSUB 4QKXB 4TNVK 1OAYH 4NM8H 5IOPA 5J11B 1LD9B 4WY7H 3MLSH 2R0WL 3GBML 4ZAKC 2AJZB 2A77L 4JPIB 1FYTA 4L3ED 1R5VB 4N8VB 5L7XH 5HPOA 3VH8G 5MHSD 1N3NB 2QSCH 5KVFH 1SBBA 5EC2A 5DVKA 3MO1A 3NZ8B 4I3SH 5FOBA 3MRHB 5F3BA 5E2WL 1MHPH 3R1GH 3CFCL 2DQFA 4D8PB 4HS3A 3VFVA 5JUEL 3S36X 4NPYB 1A6AA 3QXWA 4G9FA 3UTPE 3RBGA 3IU3A 4PFEA 3O3UN 5E08L 1VEPA 2BNRD 2VLMD 1AO7A 5EPMA 4OCMC 4UTAH 5CGMA 1H15A 5DWUH 4HK3J 3CH8A 4NKQB 2AGJH 3NGBB 4JFYB 5H2BB 1PJ9A 4PJ7B 3AM8A 3C60B 4QXGL 5DJ2A 1DQQA 3E6FA 3QG6A 4NN5C 1V3JA 2VXSH 5AEAA 3EOAA 3WEXA 3G5VB 3P4OA 1D9KB 2W9LA 5KSAD 3VD3A 5DRNB 1IEAA 1RZ7H 4M93C 4KMTH 4BZ2L 4WU7B 5MEQA 2C3VB 1WFTA 4CN4A 3VCLB 2I24N 1VFMA 2E9WA 1NANH 4KGLA 4M8QB 5MEOA 4FQXC 4PTTB 3MRFA 2J2ZA 5DDHB 5KS9B 3QI9C 1FL5B 4ZS6D 3P4NB 5E8DH 1I8IB 3LSOA 2WNGA 3R8QA 3V6OA 4NWUH 1XCTB 4LU5H 1ZVYA 2FR4B 4S1RL 5FKPB 5GZNC 3G5YB 3RZCB 1KCSH 4ODUB 2PYFA 3QUXA 4BQ8A 1BD2A 4Y2DA 5FYKD 4U1SB 1N6VA 1MI5A 4U3XA 4R90H 1U8QB 3U83A 3N0PB 1SY6L 2V2WA 4WHDA 3OR6B 5DEZA 1X5YA 2KH2B 4JPWH 4U6YB 1F6AA 3V95A 4P2RB 2G60H 1KJ2B 3PHQA 5CEZH 4U1MA 1JRHH 1A1NA 1UA6H 3FQRB 1HNGA 5F7HA 2PW1B 2DM2A 3O3EB 1J1XL 2B5IC 4H1LG 1WAAE 3M17A 4NM4L 4Y1AE 1BGXL 4LNRB 1LNUB 1E4WL 6FABL 2HH0L 3ARWA 1WFOA 4ZFOA 4PJ8C 3GSNH 2KQMA 1GZQB 3ZE2F 4FQQB 4DWHA 3QWRD 1UXWA 1WCBA 4LQ1A 2IQAA 4X7SH 5ERWA 5T5FL 2WBJD 3BKYL 4Q9CA 4PRBA 2HLAA 2OI9B 4MDIA 1AGFA 4PJHE 4B50A 4X99B 1PKQA 3UAJD 4OCYL 5EIIB 4DAGH 3MLYH 2XYCA 1NBYB 4TVPL 1XGYH 1JWMB 1W72B 4GAGH 4BQ6A 2IH1A 5JR1L 4CUCA 4ZUWA 1TENA 3MV9D 4KAQL 5SWZD 5EZOH 1DDHB 3EAKA 4NFDA 4YHLH 3RGVC 3SDDA 1NBVL 1KUMA 1MHHA 2NYYD 3GIZL 4U1NB 3JWOH 3WKML 4S1DC 1QBLH 3GGWB 1I8LA 4MS8C 5CGYC 1BOYA 1ONQA 3OHXB 1G7LA 1U91A 1Q0XL 3IDJB 2NXZC 1U8NA 4OZ4B 5D93C 2OZ4L 4QHMB 2HN7A 5CJXC 1R3LA 1WZ1L 1ZHBA 1IM3A 3UTTA 3NOIA 3Q2CA 3OAUL 5I2IB 5DMGC 1YNKL 4GW1A 5HD8C 3QIBB 4J3TA 1OP5H 4NP4L 5IV2B 5C0JA 4DVBB 2ZJSH 4MD5B 1ITBB 3Q0HA 2FNBA 4M1CD 1Z5LB 3EHBD 1MCWW 3F7YB 1AY1L 2J8UB 5FECA 5I9QB 2GI7A 4YBLC 1G6RA 1CTNA 1UEMA 2NW3A 1QBML 3D3VA 1LDPL 1OPGH 3V6ZA 1R6VA 4NRZB 1DQDH 4PJ5D 2QADD 2X9XA 4EUPB 1LE5A 3BYYA 5ISZE 1CICD 1YYLH 4YO0A 4ZFGH 3UDWC 2CLZB 4KJPC 3CFIC 2P4AB 4PJGA 3TN0A 3UBXG 3F7PC 2M1KA 5F1KC 5D1XD 1FLRH 1OGAD 3C6SB 1VENA 1IGMH 5E5RB 3QB7C 3U4EB 4LVEA 4HGWA 2ENSA 5K93A 4HUXB 5EC1A 4TTDC 5IBLC 35C8H 2WIMA 5TQ2L 5FXCH 1X4YA 1IKNA 2K9UA 1DL7H 3MA9H 4FQ2H 5HDBF 2P7TB 5JXED 4LHJB 3FCTB 4MHHI 5E6YA 5TDOB 4RQQA 2X1WL 4PP2B 2NY1B 4PUBL 1WICA 5I8OL 1UZ6F 3GJEA 1I7ZB 4NNXA 1NMBL 2JE8A 4XWGH 4U05A 5J3HD 2A2QT 5C08E 5AWNL 2IALB 1QFOA 3RKDD 5AZ2H 3C5ZA 4AEIH 1BQLL 2VISB 3HG1E 3ZT5A 3ZKND 5GS0C 2WQRA 2PF6A 4WJ5B 5J12C 2NLJA 5ICXB 1RUML 4WCYH 5DYOA 4EDWH 1TLKA 1QFUH 2VR9A 3ZTNH 4RMVA 2CDEB 4J2XA 1MJ7H 4P2OC 1N4XH 4WUUA 5BQ7A 1RZJC 1U92B 3DUHA 3MOAL 4X0KA 2V5SA 1XR8B 3CLEH 4TSBH 2NY5H 4HC1H 1MSPA 3SDXB 3AB0B 5J1SC 4LKXA 4S1QL 2F54E 1C8PA 2I60L 3SGEI 4O9HL 3ULSB 5GIRB 1WQVT 3UTQB 2DQHL 3PWUB 1A3LH 2CSPA 1R3JA 3AS1A 4N5EC 3DO7A 3QDME 3ARGD 3VWKB 4I77L 4DCQB 2J4WL 3BP7A 5HHMD 2F53D 3C6LC 3ME0A 1ZT4B 1S7VB 4WHYG 1YMHB 1LK2B 4IOIB 4FQHB 4Z7VB 3LH2L 3IXTA 3DUUA 1EEZA 4RNRB 1AH1A 1TJIL 1Y6NR 3SJVE 3TBYA 2X4UA 2V5YA 3FFCE 5BS0E 1Q9KA 4KROC 2DQEL 3P0VL 3IDGB 4GBXB 5DMKA 3BZ4B 3NN8B 3T77A 5BJTB 4PGBB 4MCYA 2D31A 4R97C 3TPUB 4X6BA 1YUHA 3QDAA 3BPLC 3QXTA 5C2BL 2Z91A 2V9TA 5I1JL 1NGXA 3FO2A 3HUJA 4QF1A 4Z7UA 4G8IA 1SEBA 4NZUL 2CRZA 3SE4A 3HE6A 1KEMH 1DBBH 1TNMA 3FB6A 3BGMB 1IGYB 3VFGH 5GISH 1VEOA 2WBKA 4FXGB 3ZT6A 1ZGLP 2CKBB 5D2NE 4JDZA 3ZL4H 1Q9WB 1RIUL 2BNRA 5IMKA 1J8HE 5LVEA 1EXUB 5C7XH 5TGBB 2P42B 3OGCB 4RGNC 5KANG 1B0RA 4Z0BL 3BMVA 1EEUA 5IFAH 4KWUA 4FQ1H 1A2YA 3RVVC 3OL2A 5KSAA 2FIKB 2R0WH 3GBMH 3QA3A 1J0JA 3KXFE 1WTLA 2X4OA 2A77H 4IS6A 5D1QC 3VXOA 3NA4A 4WFGD 2FX8L 1ZA6B 3P9LA 5HGDB 4X7CC 5GJSL 3MJ9H 3O6FC 1BJMA 5TH2B 4GKZB 4AIOA 1WEJH 2AERT 1IEHA 2VZ3A 3SDCB 5DLML 2OR8A 1CFNB 3PQYD 1PX4A 3K74B 3CFCH 4LPVA 2VKXA 2AXGB 4YEFA 1AGEA 4YUEL 5JUEH 5C9JB 5ACLA 1M7DB 1ETZA 2GY5A 1JYNA 4WRLA 4OB5H 1ZA3A 5HY9B 3VFTB 4FN0A 3L5WB 2IPUG 1IAMA 1ZXQA 3BKCL 4MDJB 4ZTOL 1QFWM 4UT6L 3KPOB 3K2UH 4O00A 5DRWA 4YNYA 2P48B 5HYJD 3LB6C 4QXGH 1D6VL 2PCPA 1JPSL 4FFZL 4R96B 1IM9A 3KG5A 4LF3A 4QRQB 4WW2C 3VXUB 3VXRE 1F4WH 1RZFH 3OKMA 2VLJA 5GSVB 3GUTA 4Y19E 2JIXD 1T66D 4XNYH 3CFEA 2YKLL 3GI8H 4UMGA 3DYOA 1MRFL 4I5BA 4ISVB 2OQJA 1J10A 1JHTB 3DVGB 4P5TD 4OLXH 3TBSA 4GW4B 1JZ5A 1CGSH 5HYIA 3M1BB 2OR9L 4FRWA 3K7UA 5FGSA 3RPKA 4L4VD 5FA3B 3PHOA 3JV0A 4BFGA 2WIIB 2A6DA 3DX9A 1KG0B 3MFFB 2YUXA 5FYLL 1AGDB 1T3FA 2YD8A 4S1RH 5T1LA 3S35H 4W6WB 3F7VB 2VDLL 3LS5L 3WS6C 3MV8A 3EYOB 4X4XA 1H3TA 2FWOA 2R0KL 3L3DA 3RUGA 5I17A 1DSFL 3JWNC 3QXUA 3E1F1 5LWYH 2C4XA 1SY6H 4H5SA 4XCEB 3ULUF 3SO5A 5AAWA 4DUWA 1ZT7A 3OQ3B 2ADJA 1HHJA 1KFAL 3BP5B 4PJ9D 3K8KA 5TF0A 4Z95L 4I18B 1BBJB 5F89A 4JAMA 3L7EB 3WUZA 1Z6JT 1HH6A 1UM4L 3BUYB 3JTTA 5BV7B 4HFWA 5MI0C 1J1XH 5KOMC 2DM7A 4NM4H 3FRUA 4RWHA 4NBXB 1BGXH 4PB0L 4HJGB 2HH0H 4Z7OE 3TNMA 4ZNEA 1FFOB 2WLZA 2W60B 3GSVA 5EFIB 1ZLSL 3NZHL 15C8L 2W59A 1JZ7A 5T5FH 3Q3GB 1VKXA 3BD4A 4QHNB 4X6DE 4ZDHA 1Q38A 4J1UA 3OSKA 3ZDYF 4D0CA 5GGSY 4QT5A 3FT2B 4NDMA 4OCYH 1MCHA 4D94A 4EI6A 4CADB 2VZTA 1DUYB 2LTQB 3QUMB 3P11L 1RZIA 2XXCB 1BIIA 3LKPB 3R06B 4IMLB 4TVPH 4JO3H 3D39A 3KHQA 1YN7B 1CICA 2VAAB 4MQSB 4R7DA 5JR1H 1T2XA 1GAFL 1N26A 3ROLA 5IKCB 1NBVH 2IBGA 4LLUA 1S7SB 2EEAA 1BFOA 1RJZB 4N9GB 2OLDA 4PJ5B 2QADB 1Q0XH 3CLFL 2Q6WB 1IBGL 1UB5B 4NQXB 2OZ4H 4CW1B 1H3PH 1TQBC 2DOCA 5CEYA 4HKJA 3OAUH 3WMSA 3MSPA 4JDVA 3BIKA 5D1XB 5JXEA 1OGAB 5TE4H 2XI9A 4Z76B 3T0AA 5F6IC 4KKCC 4NP4H 5FUOL 1VFBA 4OZGB 2NY3D 1X4XA 2D2OA 2NY6D 3N9GL 3HNVL 2OL3B 1J9CT 4G9DA 1S9XB 4MQ7B 5EO0A 1B0GA 2JELL 2HFFB 4LBEB 3NPSC 3OKLA 2VUYA 4XVUD 3KYOB 4C83B 1HQRB 1J0IA 2GK2A 5A3IC 2P8PA 1A7RL 4LCCC 3WYRA 2VABA 2V17L 4RCAA 1FRGL 4DTGL 4H26B 4O5LL 3V4VH 1X44A 4B41A 1P84K 4KUCD 2ITCB 1IC4L 2YD3A 3TV3L 4X7TA 5TQ0L 5C0CB 1MHCB 3CMOH 3EOTL 4Q0XL 4WO4D 5E2VL 5BOPA 2VXVL 4IEFB 4JM2C 4MJIB 3G5ZA 4JZJA 1GSMA 4K71B 3ARGA 2YUZA 4Y5XA 3WNNA 1MHEB 3MX0A 3KPNB 1RMFL 3RDTD 4WDIB 1T89A 4AENA 1XIWD 2CLRB 1BQLH 5BZWB 1AE6H 2IC2A 3HZMB 4LRNL 5KOVC 5T3ZL 1BPVA 5JW4Q 3U9PL 4FABL 5ENWA 4YDVA 2J1KA 3S3PA 1FBIH 5T5NG 4NQCD 4ACPA 5F7DB 2VZVA 1CLOL 1KLFA 3IGAB 3FRPG 3WN5C 4GT7A 4OQTL 3HB3C 1RQ5A 4LLMA 4D0DB 4HWEH 5HHMB 2F53B 3MRRB 3TFKC 4PLJC 2A6KB 1JZ4A 2HLFC 3QEQE 5DJXB 4ZFFB 4WWID 1II4E 1FJ1A 1A7PL 1RK0B 1LEKA 4P4KD 3SPVB 2N7BA 2ZUTA 3WFEL 1WIPA 1XF3A 4PRAB 4WU5B 3CUPA 4S1QH 3MRBA 1YN6B 3C5SB 4JHAL 4O9HH 4Z0XB 1S9KC 4G6AD 1AXIB 4TN9A 2DQHH 3VG0H 4KJWD 3JV5A 4P9HC 4WW1A 3TLRA 1DN2A 3CFDA 3REVB 1OF2A 3REWA 5K9QI 1BVLB 3ALPA 3MBEC 2DAVA 4IHOB 3FKUS 2GSGB 3U0TA 4C57C 5FHAL 1VGKB 1FFPB 3X17A 1TJIH 1QD0A 4ODXB 3PGCB 4AM0A 2XN9B 2Q1EA 2UY6A 3HAEG 2DQEH 3P0VH 4S1SL 1I8KA 3QDGD 2GJJA 4NQDD 4PJXA 1GYAA 5DJYB 2DQGL 2J8OA 3IDNB 3IDIA 4HLJA 1KTLB 4JN2A 4NBYB 2B4CH 5C2BH 1VSCA 3P0GB 1IGTA 1NGZA 3DV6B 4XCNA 3F62A 4CNIB 4PP1D 1HHIA 1LEGB 1JWSA 2R0ZL 4TUOA 4UDTB 4EIGB 4DKFL 4NZUH 5DSCB 1MEXL 3VWJC 4M6AA 2GEEA 3PQYA 1CZ8L 3LEYH 5EU6A 2CLVB 2IAMB 3CPLA 2Z8WC 3NMEA 4JHBA 3SDYH 4RAUA 3ALXA 1MPAH 4QTHB 5L8LB 4IRSC 4KDTA 4XP9H 1NBZB 3MRLA 3U9UB 4YBQD 4O2FA 1RIUH 3ZDZF 2P5EB 4HIXL 1GGIH 1O0VA 1TETH 5CSGA 3HS0B 4J3SA 4Z0BH 4U1KA 3TBVB 1B3JA 5BRZD 1NBQA 1RY7B 1OTSD 5T33H 1WZMA 5I0ZA 3P3YA 1OLZA 5KTEL 2B39A 4F7CA 3GSXA 5C9KA 5HYJB 2YA0A 2NTSP 4LLQB 2BDNL 2AJXL 2FX8H 1UENA 3W0WA 1MF2H 5HHOA 2EYSA 5EU3A 3T0XA 1RURH 5EOTA 4L4VA 2NZ9C 2CK0L 1X5FA 2R2BA 5A16A 5DLMH 2YK1L 2JIXB 2Z93A 2F74B 3FZUC 2PXYB 1QFWH 4GJTB 3UPCA 3X11A 1BVKA 2YRPA 3L5HA 2IJ0C 4P5TB 4QCIA 3ZT7A 3LQAL 1T04B 3MGOB 2PYEA 2PR4L 3SKMB 4ZTOH 4HEME 4UT6H 1T6WA 3QJHB 5EBWB 1FPTL 1NDMA 1YEKL 4HJJH 2A0LD 4M1DL 1JPSH 5FOJA 2W0FA 5SWQA 4K3EH 5K9OA 4K3GA 4MXVE 1A9BA 4JQIL 2MOVA 2FGWL 5C92A 4UT9L 4K9EL 4L3AA 5FCUL 5I8KL 3VXNA 2P49B 2I07B 2YKLH 1Q0YL 4MVBC 2MWCA 1MRFH 4PBWD 2E7BA 2GITB 1YPZB 5I8EA 4PJ9B 1ZGLB 2OJEB 3RVUD 4NKOA 1WZLA 4QGYA 1EVTC 5IHBA 3S3JA 1I1AD 2I9TB 5FYLH 4RMTA 2Q87A 3U7WH 3FB7B 1P9MC 3BGFB 2X4SA 2BRQA 2QBWA 3E2HC 5SWSD 3DX8A 2VDLH 3UX9B 2C7UB 1EBAA 4EEEA 5JO5A 2PTTB 4LPCA 2D3VA 3OXSA 3TVMB 5DJDB 2DM3A 3TH2T 3WXVL 1NCBH 3WBDA 4QYOB 3C5JA 4QHLB 3G04B 5JORA 1KFAH 2DQIL 2ID5A 1CL7H 1UC6A 1T1WA 5ANMB 3RL2B 1RUAH 2UZXB 1N6UA 2JCCE 2LAAA 2FYYA 3FTGB 1EDQA 4X5XA 3UTTE 3VD5A 4BJLA 1FVDA 4JFOA 4MWFB 1Q9OB 5I6XC 1XR9A 3G5XA 1Y6MR 3CVHA 5KSVB 1CT8A 4Q2ZA 4PJ7F 2XFXB 2BNQE 3LKQA 3QO0A 4MZ3A 5L2KE 2E7CA 1Q9LB 4NUJA 2J5LB 3O3AA 3QIUC 5CIPB 3QPXL 4JY5L 3NZHH 5JPMA 4XP5L 4Y16C 5CD5D 1HQ4A 1LP9E 1YC7A 2ADIA 1GXEA 5DJCA 1OW0C 3O9WB 3SCMC 1QSVA 3SGJA 9CGTA 2NY4C 1BFSA 2GFBA 3OKOA 3BDBA 1HXMA 5LGHH 1VPOL 1LGVA 2IPKA 3MV7D 3ULVD 4WI5A 5KS9F 3GIVB 4I2XA 1NCNA 4MXQC 3V0VA 1DQJA 1JWUB 2P5WE 3BESR 4E9LA 4G6KL 1NFDA 2NY3B 1GAFH 3HLAB 3G6JA 3ZKXC 3WNOA 4L4TE 4YR6B 3T04D 1SJEA 2QLVB 1QPXA 4OV5B 1AXTL 3LRSB 2BVOB 2JJVA 1VDGA 3P2TA 2H32B 1RZGB 4ZPTB 1S7TA 3RA7H 4A6YB 3ARED 2CDFA 1LVEA 5HHVL 5DMJB 3CFKA 3VFOA 4WO4A 3NTCL 3RX8A 4DJMA 2E8YA 3STBA 1VADA 4OT1L 5FUOH 1PGRB 2XY1A 1KT2B 2VOTA 5EUOE 4ZFZA 1U93A 1U8MB 3WIHA 5ESVB 4R4BB 1CF8L 2A83B 2Q20A 3MRCB 5F7WC 3JWDL 3GRWA 1V7NL 4GRLB 2E3VA 4K7FA 5GGTA 3RDTA 2NY2D 3M8OH 5BMFH 1DBKL 1F8TL 4KRPD 4D9RD 3RWFA 4JVUA 4PYHA 5DVOA 4G8GD 4WIQA 1MCJA 4H88L 4LPWA 4KUZL 1A7RH 5LGKA 1QSFE 5FDYA 5IFHL 2JK5B 5ID1A 1N0LA 3MZTA 4M7LL 1BZ9A 3HPLB 2Q86B 1TZIB 4FG6D 4O5LH 5JIKA 1XIWB 5SX5K 3T0ED 1T0MA 1G1CA 2NY7H 4BSWB 5B38A 3U4AA 4JGMA 1F00I 2UV3A 1IC4H 2X44D 5I73B 3OJDA 2DL9A 4BUHA 3TV3H 4GFTB 5TQ0H 1MCPH 1OAUH 4Q6IC 3EOTH 4OF7A 4HV8A 3QJFB 3S35X 4KJYA 3MLRH 4IRJA 5E2VH 4ETQB 2VXVH 1XF4B 1QYGL 3NCYS 3EYSH 1G7HB 4MQXD 3NBNA 4P4KB 3ARTA 3T4AA 1NGPH 3VJ6B 2D7NA 2HG5B 5D6CB 3P4LA 1FVEB 4GKOA 1CVRA 4YXHH 4ZS7L 3ETBF 3CDYA 5T3ZH 1W8NA 4YX2L 1J88A 3U9PH 1BF2A 3EYUH 1JPTL 1CLOH 3HCVA 4JO4L 2W0PA 2VZSA 1B2WH 2J8UF 3WL9B 4NQDA 4F7TA 4ODWB 1U8LA 5GGUA 1UKSA 4PR5B 4UUJB 5TPWL 4LHUA 1N2RB 1A7OL 3DHJA 4MLSA 5IBTH 1UCTA 1T83C 4OUUA 5BXFA 2ICWA 5FO7B 2XWJB 1QG3A 1UJTA 5KSUA 3QDGB 1L6XA 1JHKH 3C8HA 4RGMC 4M3KB 4HCRH 4P5KB 4ONFL 4JHAH 3PGFL 2DLHA 1NH6A 2AXJA 2FSEB 4XNZB 4K3JH 3MUJA 4EVNB 1N3NA 4NZJA 4PJGF 2P8LB 5I1LA 1D5IL 5FIEA 2ZUYA 3WHE0 2X4QB 3IRPX 4JKKA 1EA9C 5IMLA 1T1ZA 1B88A 4P23D 5FHAH 1AP2A 3O6LH 4D8PA 2VKWA 1PX3A 1IAKB 4S1SH 1FORL 4XMPH 1UB6A 3QUZD 2P47B 4AQOA 4F9LA 5C09D 1RK1A 3B2UC 1E4XH 5BRZB 3LHPH 4YHNB 2R0ZH 4DEPB 5GRJL 4ZODA 4OBRA 5I71C 5D7LD 4P46D 3VE0B 3C60A 4RIRA 3KPRA 2QJDA 1C5CH 2VWEE 1CZ8H 4QXTB 2HJLB 1FN4B 2HTKC 2DKSA 1WK0A 5J6GB 4WU7A 4U7SA 4CDGC 1KPVA 4GS7C 2X4PA 1AQKL 4PTTA 2X89A 3SE3C 4CAGA 3FQTB 3NAAH 4IJ3B 4QEGA 4XPAH 3SDXF 4BA8A 3WJJA 5DHVB 4EI5C 3PWJA 1TVBB 4XNMA 1JK8B 3VFRA 4KH2A 4CKVX 3UP1A 2VN7A 4MNGE 1A02N 4NCDA 1I1RA 2HFEA 4L8SB 4RISL 4HLZH 1MAKA 2AJXH 1REIA 3DROA 2CKNA 3K81A 3KGRA 5GHWL 3RVWD 4Y4KC 5HDBE 4JFHD 4Z7VF 5D1ZA 1C5DA 5IWLC 3EKCA 1AJ7L 3JBG7 5DURB 5E95B 5C0RH 4U6YA 5IEKB 4JJ5B 5IB5B 4G8FA 5E00B 1JYXA 1UZ6E 2YK1H 1HHKA 3PWPD 3ZDXF 2R4SL 4NO3A 1NC2D 2FZ3B 1XGRA 2W92A 1WLHA 3ARRA 3BH9A 4OGZA 4LNRA 4WFHD 1GZPA 3X3GL 4BSVA 4ZAKD 1NKOA 4URTB 2IWGA 1IE5A 4LSPL 5EBMA 3STLB 2BERA 2Y23A 1P69B 5B21A 1PQZB 4FQQA 1FPTH 2IPTL 3B9KA 4UU9B 5SWSB 2A9ML 1A3QA 4PJDA 3O4LB 3KPLB 5DFWH 4PTUB 5C0AD 1G84A 4OF6A 2QTEA 4ZNEE 2A6JB 3IYLW 3KWWB 2FGWH 1U41A 3K1DA 4K9EH 4UT9H 5FCUH 4D3CH 4UINH 3WNKA 5I15L 3C2AL 5IT2L 1QSEB 2AK4D 3FAWA 4MA8L 2Z4QA 5IESL 3LN4B 4UAOB 1RUKL 1QBAA 1NDGA 5ILTL 3IETB 1DQLL 3GSOB 1WBXA 4LCWD 4AH2B 2MPAH 2I26N 3MBXL 3HFML 3WUWA 3BPCB 3U6RB 3C8KA 1Q72L 1DDHA 1RJYB 2AS5M 1K8IA 2LVCA 3QPQC 4GAJL 4APQC 1MAMH 4NRYB 4QRUB 4XVJL 1HINL 3MV7A 4TQEH 3MRQB 3GJFB 4YHPB 2UUDK 3P77A 1P7HL 3WHE1 1HXYA 4FQLH 4KKLD 3WXVH 4FQCH 3JVGA 1Q94A 4QHMA 5J8OA 4PJAE 4ONHB 3ARUA 1NUDA 4UQ3A 2DQIH 4P2QD 1NGYB 4YHZL 4MHHG 3QEGH 5F9JB 1PW3A 3QI9D 4R8WL 1M4KA 3IDMA 4LSQH 4RGOL 2Q8BL 4Y5YC 2WK2A 4R3SB 4FA8A 2FIRT 5TJWK 3U46A 1NCTA 1KNOA 4N1CA 1SYVA 3QPXH 3QQ3A 4NKDA 2RFXA 5ITFB 4D9QD 3BPOC 3D18B 1X6LA 2Y5TB 3UTZA 3VFUB 1MRDL 2FJFA 1JPFA 2WP3O 1FDLH 2JF1A 1FAIL 3AM8C 3AREB 3V5HA 1HDMB 4FFWC 4MAYB 1NGQH 3QDJD 1KEGL 4G8GA 4PJBF 2JJTC 1S9VA 2H3NB 5JOFB 4P59L 4Z5RA 1MJUL 1KCUL 1AC6A 5IB2A 2HYMA 3LQAC 4PJ8D 4L1DA 3Q1SL 2X5PA 4UTBH 5TDOA 2NY2B 5J1AA 4KRPB 5I16A 1ZHKB 2OJZL 3T0EA 1G6RH 1AXTH 4PRNB 4MXWH 3LOWA 3SO3B 1R24B 5FB8A 3HZVA 4JY4B 1DBJL 4PY8J 4NQEE 2EKSB 4IMKC 2RCSL 4Y2DC 5C0EA 4LFHG 1SVZA 3L9RA 4YHML 1I7UB 3NTCH 3N1QC 4OT1H 3GBLA 3WXWH 2XRAL 3PDOA 4YDIL 3LKRB 1V7NH 5D8JL 3RGVD 4PJEA 3SKJL 1F8TH 3O4OB 3V6FA 4H0GA 4MS8D 1XR8A 5CGYD 3VGGA 1NMCC 3SGKA 4TULL 5ACZB 5IFHH 2NXZD 3AXLA 3NA9L 5KG9B 4M7LH 1G7PA 3HRZA 4I4WB 1FNLA 4HKXA 3BYTA 1TITA 4DZ8B 5DMGD 1DZBA 4NJ9H 1QKZH 3HR5B 2ADFH 3FHQA 3WLWC 5HD8D 1FL3A 4R4FH 1TPXC 3LS4H 3NIDF 1MOEA 4N0CC 2Q76B 2IPUK 3WNPA 1IAOA 1UWXH 4U1GC 2UWEA 4RWYL 2EYTB 4K8RL 2QQQA 3GO1L 3EZ8A 5E8NB 32C2B 5I1GH 4OD1L 5M7QA 5ITBH 3LKSB 3V0WL 4Y5VA 4P4RB 3SE9L 4H20L 4PGBA 3EUUA 3OGOE 3ULUE 1L7IH 3HNSL 4JFDB 5EOQH 4HG4K 1SMOA 4ZS7H 2BVTA 3DV4A 4R4ND 3DGGB 4P23A 1J0ZA 3TO4D 4XCFL 5EO1A 5C07E 3SKNB 1JPTH 4PJFB 4JO4H 2CIKB 4OZIA 5HI5C 4AIZB 1MIEL 3ZE0F 5IBLD 1E27B 1QLRB 1ZLWH 3SDAA 5IF0A 4GG6A 5TPWH 1Q9WA 5EU6E 1A7OH 1F11B 4LVNC 2R1WB 3VA2C 5AG8A 3WFCH 5D7LA 3J8F7 3QQ4B 4UNUA 2R2CA 3I3DA 2HJKA 3VFWB 1EIBA 1QP1A 2DYPD 4CU6A 3X3FL 2X9WA 5HDQL 1HE7A 4KVCH 3QUZB 3ZDYE 2DQUL 4X9GA 4ONFH 4E42B 3RAJL 3PGFH 3PWVB 2Y6SC 3EO1A 4TSAL 4EBQL 5GS0D 3QRGL 5DEFA 5J13B 4P46B 2UYLA 5GJTL 3QFJE 5E6ZA 4YGVB 1HSAA 1JGVH 2EDFA 2I25N 1D5IH 3TN0C 3VH8A 4GKZA 1G7QB 4FXKB 4ZUSB 2DLTA 4P2OD 5GSRA 1JN6B 1PEWA 3PV6A 3THML 4EDXB 3JWDC 3AS2A 2YRLA 3VRJB 1NL0L 2BVQB 1IKNC 3VFNA 1DR9A 1EMTL 4KK6C 3DMMB 6CGTA 5DTFB 4N5ED 5IIEB 4NC2B 4JO1H 3VD7A 5K59F 2IGFL 1ZLUK 1MJ8L 3PWPA 1CFVL 3C6LD 3UYRL 1HCVA 4PRIB 3ZHLA 5CBEB 1FVCB 2BNUB 2W0LA 3W9EB 3FB8B 3T4YA 3OKKA 1BREA 2UVEA 1G9NL 4ZOAA 1FGVH 1MCFA 1AQKH 3UPRB 4KROD 3KPSD 2YPLA 2ATPA 3JTSB 4JFEE 4EN3B 1DLHA 1SHMA 5ICZB 1Z9SA 2DTML 1NC2B 4UIMB 3HZKB 5FYKH 1CBVL 1BFVL 2HFTA 3OB0H 3PABA 5B39B 2BSTA 3KPPB 2YR3A 1RULH 4RISH 2ARJB 4JKPH 4UDUA 3EYOA 4HKZB 4XBPB 5GHWH 4ZYKA 4I9WE 4OM0L 3OTTA 3W11C 4JO2L 4Z7WA 3D2UD 2DMKA 3QCVH 5IVXE 2VLLA 1DE4B 3BP5A 3FQNB 3E8UL 1RHFA 5CEXA 4NCC1 1GGYA 5DRZB 3C08H 4Z9KB 2AK4B 4CMMA 3CFBB 2R4SH 1B4RA 4RGND 1YEHH 4ORGB 5B3NA 3LIZL 1YJDL 3D6GA 4LCWB 1EPFA 3RVVD 3X3GH 4YDJB 5FGBC 3VRIA 3DIFA 1T5WB 2AJSL 5D1QD 5E1AA 1WBZA 4F33B 2IPTH 1F2XK 2DKMA 3S4SB 1N0XL 4FQXA 2ZUQB 1S8DA 1ZANH 1I1FA 3FONA 3RY6C 4XWOD 3MXWH 5C0IB 3H9SE 1JUFA 2XTJE 1LE9B 1UFUA 1RU9H 3GBNL 1I7RB 1F3RB 3R8BB 5I15H 5IT2H 4RAVB 3D9AL 1JNLL 5MERA 1CD1B 3HE6C 3QUMA 4GMSL 1GOHA 4IMLA 1D5BA 1CGXA 3R06A 4P2QB 5JIIA 3GMPB 3K8MA 3BP4B 3HN3A 5D7IB 3ZKMC 3QI9B 4HS6B 4LLDA 4LLVB 1ZS8A 3VI3F 5D2LB 5HHXH 1BZ7A 4RX4D 1XH3A 1M71A 3LB6D 1P1ZA 4GAJH 4HXBH 2DQDL 4XVJH 5JHLH 4LVOB 3KYKH 2HFGL 3BH8A 3EGSA 4F2MB 4OGAC 4NQXA 4PJCF 1M7IA 3V8CA 2XWBA 1ORQB 4L9DA 1OAZL 1J86A 1PYWA 1FNFA 4FZEL 1R3IL 4HIEB 4YHZH 3ROOB 4PJ8A 4S2SA 5JLZB 4Z76A 5F72S 4OZFB 5D5MA 1IGFL 4R8WH 3FT4A 3MMEB 1Z0NA 3L95A 4RGOH 2Q8BH 1QVOA 2FEEI 1D5MB 5I1KL 3WO4B 3B8YA 3QDJB 3RWHB 1S9XA 4I3RH 2B5IB 5F9DC 5KN5B 5E2TL 5LBSL 1S7WA 1F3DJ 2W65B 1NGWA 1K4CB 5E2JA 3VFMA 3WLBA 1JF1A 4XGZB 5DK2B 1QPPA 4Y4HC 1N5AA 1MCRA 1MVUB 1R3HA 4KXZI 4YHOH 2CPCA 1IQWL 1MRDH 4YWGH 2AV1A 2QHRH 1O5DT 3ZDZE 3CZFA 3VXMD 4X5WB 4WI2A 5FYJD 4B53A 1C12A 1YPZF 2IADB 4H26A 5FHBL 3UBXA 3IJHA 3RGVA 4PGDB 5GGVL 1NEZG 4TUKL 2JB5L 5E24E 3RWGA 2BC4B 3FQXB 5EU4B 1ZHLA 3P40A 4P59H 5IB3B 1MJUH 3FQUA 3Q1SH 1L7TL 1JV5B 2VDKL 2MQCA 4V1DD 5GQBA 1J05A 1W2KT 4GMTL 4MA1B 4WEMB 3ALWA 3GRWL 2OJZH 5TFSL 4LCIL 4XPGL 3IVKB 1FC2D 3F58L 4TPRH 4MGXA 4YH6A 5E4IA 3KPNA 1KGCE 3DI2B 3V0AC 1YNLL 5AD0B 5TF1L 5K9QG 4QOKD 5EN2A 4K7PY 2R4RL 1P4IL 4F7EA 4C56B 1QO3A 3RPIB 5FO8A 3BZDA 3DXAB 5F9OL 3BPNB 4S0TD 3DTXA 43CAB 2X7LB 3QYCA 5EH1A 2XRAH 4WNQB 4WWKB 4NHUA 5EIVA 2DI8A 4RMSA 4YDIH 2DKUA 1YEDB 3OR7B 2R1XB 3UDWA 3SKJH 1KF9B 4FTVB 4NO2B 5BW7C 4PIRF 1X5AA 3S5LG 2OTUB 5EZLA 2R2EA 5TDPB 1VB9A 2C9AA 5LG1A 2HT4C 1U3HA 1G0DA 1T5XB 3BEWA 2GTZB 3GSQB 5MEND 4PRAA 2F15A 3NA9H 4N90D 4NZRH 5EBLA 4OGYL 4NQUA 1CXKA 1KC5L 2WLYA 4ZSOB 4JFFE 2B1HH 2BOCB 4NO0D 1KSRA 3MOBH 5LCVL 3CDGA 5EO9B 1AIFA 1G7MB 5DD3L 2GAZB 2NW2A 3VFSA 2D0FA 2VDNH 4KKCD 3IAPA 1JPGB 2FECI 3TO4B 2EXYD 3P0YL 5E0QA 3UMTA 3O11B 3W5NA 3F12B 4MYWB 3UTSA 1UACL 2DYPA 4UB0H 1UZ8B 2GSGA 3UTPD 4RWYH 3MNVA 3GO1H 3T3PF 4ODXA 4OD1H 4Y0GA 5H37H 5DI8A 3O8XC 3QQ9C 3QXDA 3SE9H 3MZGB 4YDLC 5A3ID 3L3JB 3PDGA 3AFLA 1NFDF 3HNSH 5JZ7C 3GSNB 1J1OL 1OSZA 2R8SH 4AEHL 4D0BB 5CBAA 1CG9B 3FB5A 4JKWA 3VGFA 4R0LB 1EJOL 2NR6C 3HE7B 4HJ0C 3LEVH 2PUQT 4XHJC 3S96B 4XCFH 1KIRB 4KUCF 4U6VH 1UM5H 1TVDA 3MROA 5K9JL 1MIEH 2DIJA 5INDB 3HC0B 4PJ7E 5HYSB 3RIAK 4ELMA 3ECBA 3U9UA 5L8JB 2P8MB 1UXSA 2DIBA 4DUXA 3IJSB 3QFDB 5B8CC 1A64A 5CWSB 1EVUA 3QDHA 3FAXA 1MUJB 4OZHA 5K9KB 4X6CA 5EWIL 1HH9A 3C6LA 1G7JA 4HIJB 1OTUC 2HVKA 5K33A 3TH4T 3D25B 3TZVD 4OLUH 5KS9E 1OD9A 2Z31B 4TSAH 5E2UL 3QNZA 4JANB 4EBQH 5DVNA 1MFCH 3ESVF 4LLAA 3CXDH 3BSZL 5F1NB 5GJTH 3KPSA 5ID0A 5F7MC 4DFHA 4XC3L 3HB3D 2FATL 2X4RA 1MFBL 3HI6L 4PLJD 2IQ9H 4TVPD 2HLFD 2FB4L 4Y1AD 2RIKA 1VGEH 3HC4L 3TBWA 4Y4FB 3THMH 2JLLA 3U30B 1RIHH 2PXYA 4M61A 3IS1X 4YK4C 4BH7A 5DXWA 1LDSA 1ZT1B 4KROB 4R2GC 3WS3A 5AUMA 3O3BB 4TTGA 3WV0A 4PGEB 2K7QA 4P2RE 4R97B 1EMTH 3G6DL 4NJAL 4GLRI 3BPLB 4PG9B 5AYUL 1FH5L 1S5HB 3D2UA 1DN0A 1DFBL 5CZXC 3OKDB 4XVSL 4Z77B 2IGFH 2EDKA 5E9DE 1CFVH 1OP9A 1QLFB 5F93C 3T8XB 1NCAL 3PNWB 2EC8A 3MBED 1T89C 3GMLB 2BCKB 4ZNCD 4XBGB 1UVQA 3WFDL 1ZVSA 4HZLA 4U6XA 5LAXB 5E99H 1W0WA 4JGUA 2DBLH 4PGCA 3KLSA 2GITA 5GGQH 2AJVH 4XP1H 4QRPD 2ADGB 1ZGLA 4PJIB 3NCCB 1ES0A 2Z9TA 4K8RC 2NX5B 3RWIA 2HVJB 1KJ3L 2DTMH 3O6FA 5F96L 2YA1A 1JNHA 4MMZC 1ZTXL 1HHHB 4RGNB 5L0QC 2I9TA 1UYWL 4KZDL 3FB7A 1B90A 1CBVH 1BFVH 1GL4B 2XZCL 3R4DA 4OLWL 1XCQA 2P5WB 1YY9C 4JFQB 1MFDL 3VWJD 5D1QB 1DEEB 2PTTA 4GKNA 3CSYA 4K07A 5DJDA 5DUMH 1Z0MA 2N4IA 2ICEA 4IRSD 4JO2H 4XRCA 12E8L 3QXAA 1XZ0A 1I9JL 5T1KB 4E41D 4OD2B 3E8UH 3N1GC 1XGTA 3FL7A 2KZWA 3HNTL 4HWZA 5EU7E 3ARFC 3RL2A 4KFZC 3H9HB 5KZCB 1A8JH 1I4FB 4FFYL 1INEH 4HHAB 1VFUA 1ORSB 4R6UA 3IDYC 3O3DA 4MA3B 3SKOB 5ISZD 2IAND 2VDMH 4POYA 1U8OB 3LPWA 4WW2A 2AJSH 2FD6H 1W72L 2XFXA 4O51B 2BJML 3TEUA 3A67L 1XGPB 1CE6A 2J8UE 1OSPL 2FLBT 4WV1B 4LAQL 4P3CH 1NAMA 1WWCA 3TCXA 4ZUUA 2NZ9D 1YNTA 1DQML 3VI4F 2MFNA 3D9AH 2WMPA 1CYGA 5I1HH 2EO1A 4MZ2A 3FZUD 3JV4A 3N85L 2VL5A 3WS6A 5CD3B 1JWUA 2HT3D 1EUUA 3HI5L 4YE4L 4HPYL 2VE6B 2MCPH 1MQ8A 1BOGA 1BX2A 1S7XA 1N8ZA 4KHXL 2XZAL 3ARBC 4J4PC 5JPNA 5C08D 2VLRD 3IFPB 5GGRA 3FMGL 3U7AA 2WUCL 5HHNB 3HG1D 3CFJB 3CVHH 4HT1L 4JZNB 2HFGH 2H32A 1U8JA 5I30L 1MLBA 3P9MA 1IC5H 1NJ9A 2BFVL 4LSTL 1DVFB 1P7QD 1RIVL 4MVBD 4ZOCA 2D7PA 2V9QA 3VXMB 2MNUA 3QWQB 4FZEH 2R69L 3VXPA 4M5YL 4V1DA 1T21A 3DVNA 1AXSB 1LEIB 4DN3L 1TVHA 1IGFH 5F1IA 1U8MA 4ZPVB 1G9NC 4TOYL 4W70A 4R4BA 5CUSL 4U1LB 1QNZL 4PRPD 4DVRL 5E2TH 3ZHDA 1JPST 3NH7H 3BDYH 5IGXL 5J57B 1AHWB 3TESA 5KW9L 3OAYH 1VESA 1QZ1A 2R0LH 3RWJA 4ZO9A 1IQWH 2MQ3A 3GMNA 3TCLB 4KC3B 2DLEA 2X10A 5CSZB 3MJ6A 1KOAA 5E8PA 2ESVB 2AJ3A 2FLRT 3SDXE 2LV4A 2IEPA 4K94L 5GGVH 4OCRL 3H3PH 1EEYB 1RD6A 1K9TA 2JB5H 4PV8A 3CMGA 3MJ7A 3QEHA 3QUKA 5CP7B 1T20B 2APTA 3AU1A 3RIAF 2FX9L 1DBAL 3DX7B 3WIHH 1L7TH 1XF4A 1YJDC 1Y0LA 3B43A 2HP4A 3GRWH 5TFSH 3HC3H 2EIZA 1QEWB 4LCIH 4Z7VE 5GGTH 1AKJD 1EX0A 1U6AL 2GJ6D 4ODVH 4XPGH 2YBRB 4Y16D 1YMMD 2PO6A 4MAUL 2V7HB 2DLGA 1YNLH 4MNQB 5MENB 2NY4D 1YQVH 2ZUUA 4RFEA 2R4RH 3TBTB 2AV7A 4MD4B 5GS3A 3OF6A 5F3HB 4QRTA 4F15B 3ULVF 2B1AL 3QHTC 4NKIL 3D87B 4G3YL 4NO0B 4MXQD 2X6MA 4CVXB 3W82A 3TNNA 5D9SB 5F6IB 5EU5B 1NC4D 3FRPA 5DD6B 4LCCA 1KCVH 2CQVA 4DOHB 4GRWH 4PRHB 5E8EA 4JZOB 4L3EE 3DX6B 1U2HA 1DBMH 2FH8A 4RRPG 3QHZH 4ZOEA 3KXFD 3NCMA 3STZB 3IF1A 5MHSE 5FO7A 1AD9A 2XA8L 4G8EA 4NSKA 1XGUA 5C86A 4GSDL 4OCWL 4ZQKA 4KY1L 2XTJC 4NKMA 5FO9B 2KKQA 1A6ZA 1OHQA 3UROR 1BQHG 3CU7A 2Z8VC 4JM2A 3DETD 1I3RA 1U8KA 3P0YH 2JB6B 4U3CA 5KAQG 2H26B 1UACH 3SGJC 2CH8A 2F8OA 4MB5A 1U8IB 4E5XB 4H25B 2APBA 3AY4A 3ARDB 5D71H 5DJZB 1Y18B 5BVJB 4KKAD 3EYFB 2CKBL 4JKLA 5HYQB 5FYLD 5HGBB 2Y4SA 4G7VL 3HAEA 3DLQR 3OX8A 3WN5A 3KLAA 1J1OH 1ED3B 5C6TL 4YIQA 3CZJA 4Q6YA 4U6HB 4F3FA 3VXRD 5C70A 3PIQB 1EJOH 5C0BB 3TZVB 4FMKA 4Y1AA 5IMMB 4Y19D 1A7BA 3I6KA 3ILQC 4JFPB 1CR9L 4CMHC 1V7ML 5C71A 1WV7T 1FN4A 5INCA 2BVPB 4UV4L 3WE6A 1ZVHA 1AGCA 1F13A 5K9JH 3ES6B 2GT9A 5DQDL 2YC1A 4M7JL 4OV6F 4PRDB 4M5ZL 1T7YA 3VXQB 2FECL 2ICES 2CMRL 3PDDA 3RI5K 3VXUE 3FQTA 1AFVH 1QQDB 4I48B 2IG2H 4PJHA 1UQSA 4OAWA 1KJVB 3EOBA 5EWIH 2ATKA 1TJHH 3KVQA 1F02I 1P4BH 4PJEF 5D4QA 3SY0B 2VDQL 4J3WA 5E2UH 1G7IB 2J88L 3T2QA 3FO0L 1J12A 1GGUA 4IOFC 2VITA 5GS1B 3IAGC 3BSZH 3MNZB 4NT6A 2B0SL 5F88B 4XPTH 4LSVL 2FATH 4LL9A 4XI5C 3OAZK 3H7LA 2R2HA 2FB4H 2QQLH 3BD3A 4G7YL 5IB5A 4MJ6B 3HC4H 3SE8L 5FF6B 3GMOB 3LPFA 5AG9A 4QRPB 4TNWF 1ZEAL 3G6DH 4NJAH 4P57B 4IRJC 5DD5L 1GC1L 3QAZC 3U36A 4IRSA 3OJVC 4KQ4L 1IAII 4UU9A 2ZCKH 2CO7B 4XVSH 4PJFF 3C09B 3DECA 3VWJB 1GPOL 1SBSL 1DUZB 3MRIA 3QIWC 3MNWB 1LO2L 3TIDB 1NCAH 1EZVY 1FSKC 1AR2A 3FO1B 2OMBA 5ISZA 4K2UL 5CJ5A 4QHKI 1YEIL 3WFDH 1FC1A 3RHWF 3S88L 1Z3GL 3SGDI 1A6PA 3KPQA 3GSRA 4E41B 5FA4B 1NCDL 3MR9B 4LCUA 2CR3A 5ESAB 3A6OA 4OZIF 2GSIA 4DGVL 4AH2A 1CTOA 1KJ3H 1X5ZA 5MP6L 1N5YH 5F96H 1B4JH 1FZOA 1ZTXH 4NQVB 4GG6F 4KZDH 1IL1A 1UYWH 2NY0C 2BMKA 3B2UD 4AEFA 2PW2A 2IANB 3L3GB 4PV9A 5BV7L 1CIUA 4S11A 3EJZC 4OLWH 4XPBL 1EEQA 2VH5H 3EYVA 4JKMA 3Q6FA 3X12A 1MFDH 1QRNB 3ET9F 3NIDE 3JV6A 3RNQA 1KYOK 1MWAA 1QFPA 4HF5H 3EDEA 1SYSB 2DI9A 5C1MB 3KNBA 4OLZL 3BWUC 5I8CA 4MSWA 1PG7H 3LN5B 2OTWA 3UTOA 4PJ5E 5LGJB 1KIQB 3NIFF 2VR4A 3NCJL 4EOWL 3BEVA 3HNTH 5C08A 5HJ3B 5I74B 5I66B 3ARZA 3U82B 2DWEA 3IRZA 4FFYH 3MPCA 2XPGB 4ODHL 4UIKL 3RBSA 5FDWA 3HG1A 4HULB 1E6JL 3EBAA 4EI5D 1LQSR 1RZKC 4R3SA 3QUML 5E94B 1OGAE 4UQ2B 5IMOB 2C1OA 5HHPA 4EZMA 4OZGE 3I75B 4GH7B 1P7QA 2BJMH 2VLRB 3A67H 5J9PB 4WHTB 1F3JB 4YHKL 3ZE0E 4OI8A 5T3ZD 4Z8FH 3DRTA 3KPMA 4Y4KD 3PWNA 2Y5TA 3L3IB 4LAQH 3NCEB 1V3LA 2F5AL 3OKNA 4JN1H 3ULVH 1DQMH 4MB4A 3BKJL 3NGBC 3C60C 4LDLB 1I9IH 5DT1L 1OD7A 2F54A 3N85H 1XT5A 3GI9H 1I7TB 4GAYB 1D9KC 5C0NC 3HI5H 5JOFA 4HPYH 1XMWA 3QDMA 3BO8A 2XNAB 3H7BB 5CJOL 5JXAL 2OL3L 4PRPB 4YQXL 3FMGH 2K1MA 4N8VG 1JL8A 4M1GH 4YFDB 1TZHA 5C0CE 1ZHKA 1WWBX 1JHLL 1ULVA 4JFXB 4LRIA 4NUGH 4PS4H 1A22B 5D7JA 1Z9MA 3DBXB 4JRXB 2EDBA 1A4JB 3SJVA 5I30H 3A6CL 3VGDA 3FFCA 1OARL 5BS0A 2X4TB 1MCSA 4MJIE 3RZCC 5FFLA 2Y36L 3E0GA 5TE7L 4L8BA 4J12A 2FL5A 4IBLT 3MUZ1 3B5GA 3RWDB 2R69H 3W81A 4M5YH 3QEQD 3W9DA 1PLGL 3QIUA 1J1PL 3A6BL 2SEBB 1JBJA 1SJXA 3MJ8B 2P1YA 1FNEB 5D1ZC 5CUSH 5IB4B 3VXSD 5KJRL 1QNZH 3EFFA 1OW0A 1LO5B 3SCMA 3QPQD 2ZOKA 4JB9H 5IGXH 5KBNC 4APQD 1NSNL 4EKXA 5HHME 3TPKA 2F53E 2P24B 5D2NA 1MFNA 3QEUA 3CSPA 1JMXA 1J8HA 1IQDA 1WCQA 3BHBA 1KIPB 1AKJB 2GJ6B 4NGHH 1UJ3B 4X98A 1EUTA 1OP5K 1YDPB 3TA3A 1YMMB 1G9MC 5IFJB 1NC4A 1H3VA 2YMXL 3PL6B 2CGRH 3QNYB 2WWKT 4RFNB 4X80L 1HI6B 4K94H 4OCRH 2BOBB 1QA9A 5D7IF 3KXFA 1KTDB 4JQVA 1H3UA 4HUUB 2OI9C 5D2LF 3GK8L 4W81A 3AGVA 3FOLB 2FX9H 1DBAH 1FG2A 5ELIA 5IVZA 1WUNT 4LFHD 4YZFF 1KN4L 1A14H 1TTGA 4EIZC 3ARQA 1PFCA 2A73A 1GJIA 4G9FD 2YN5A 5FUZH 4JFDA 1FCGA 5IG7A 4TRPH 2XN9E 3VDAA 1HZHL 4MNHB 4XCYA 5C2UB 4HDIA 1YEGH 4P0DA 1CGTA 2PN5A 4QRSB 1IGCL 3EZJB 3O0RH 2A6IA 4G3YH 4FFWD 3VD4A 1V8HA 2CIKA 4LSRL 5EU7C 2YSSA 4OFIA 2YPKB 2DN7A 2WUBL 5JW4N 1P5UA 2H45A 3VXRA 1ZE3C 3QIBC 1OWRM 1P2CA 1FL6A 4NOFA 5D5MF 5E4EB 2EDOA 2XA8H 3MRJA 3L5XH 5DO2C 2DF3A 2P5EE 1S7UA 5I9QC 4OCWH 2OXHA 4K55A 4KY1H 4IIQB 1RZ8B 4Q6IA 2QR0A 5BO1H 1I3GH 1BD2D 1MVFA 1U95A 4Y2DD 1T1XA 2D4DA 4U1IB 4GXVL 2FO4B 4L9LB 3VI3E 1S7RA 3L7FA 3D85B 3TJEL 3T2PA 4OIBA 4ZUSA 5HYJE 2V2TB 4DW2L 3GNML 4GKSB 1JN6A 4F8TA 4M4PA 3ZO0A 3BW9A 4AYFA 2F19L 1V5JA 5CMAA 4G7VH 3CC5A 2PETA 3QT2A 2H9GB 1BIHA 2O93L 3DMMA 5C6TH 3UPAA 4G43A 4P99A 3I6GA 1D6EA 2ZSWA 5IIEA 4BQBA 1F45A 2PTUA 3GSUB 3WLWD 3ZMRA 4RDQF 3MA7B 2X1PA 1HILA 4UV4H 1T83A 4PRIA 4N0CD 3IFNL 4I0KA 5DQDH 5LXGL 3RU8L 4K94C 3FB8A 3RRQA 2ZCHL 5C0FA 4EUPG 4X6DA 1JGEA 2C1PB 2C4FT 3QUYB 5DK0A 2CMRH 2QKIB 4M7LT 4BQCA 5MEPB 2Z8RA 1KPRB 4YXLL 2H1PL 1E28B 2C3HA 3B9DA 1OQXA 3P4MB 4U1HA 1XF2B 1YPZE 43C9B 5DEGB 5DGQA 5FUCE 5EBGA 5EG6C 2O5XL 2VDQH 5KVDL 1PSKL 4RGMB 1S7QA 3FO0H 5KSBB 2YUWA 4YAQA 3E6HB 1MLCA 2GW5A 4BSJA 3GMMA 3LV3A 3SGKC 2B0SH 4UOW0 5EZJA 4LSVH 3HZYB 3AB0C 1X5LA 1MIMH 2AK1L 2G9HA 1X4ZA 5I76B 3UTTD 4XZUA 1KLUA 3MRMB 4G7YH 4HS8L 1INDL 2DBJA 2CD0A 3SE8H 3VWKC 2BY0A 2ICWJ 5CLWA 5L2KD 4KHTL 2Q7YA 4ELKB 5C0DB 1FNSH 3SQOL 1S5IL 3L3KB 1T2JA 5ANME 4M7ZB 2GCYA 2N7AA 5DD5H 3D3VD 2HKHL 1H5BB 2VQ1A 4ZXBB 2XT1B 2Y6SD 5T3XE 4KQ4H 5SX4I 4F33A 4GBXC 2EH8L 2E27L 1UH4A 4KTEH 1J18A 1GPOH 2VDOH 2H8PB 3TN0D 1LE9A 3FHAA 2C3GA 1NCCL 5E5MB 4K2UH 5DRXB 1YEIH 3O45A 3S88H 1H0DA 1J11A 3NIGE 3MLXH 1NCDH 1BF8A 4DGVH 4JR9L 4L4TD 4MB3A 1T1YA 5JDSB 4QY8B 1BQUA 4HS6A 4WEBL 4OUOA 4ELMF 1ACZA 4Y4KA 4KK6D 2DDQH 4EI5B 5T3XL 3T0WA 3V5DA 1FZKA 2BRRL 4OQTA 3BN9C 2I5YL 5JHDB 4X7FC 1VACA 3VGBA 2NNAB 1C08B 3WNMA 3WFBL 2YD2A 5FV2A 3BT2L 3FO9B 2E7LC 3RIFF 4ERSL 3T3PE 3OJMB 3QCUL 4OLZH 2R23B 1IAIL 5FK9A 1LILA 2VLKB 5HHQB 1J0KA 3U0WL 4JCLA 4G80A 3NCJH 4EOWH 1NAML 2OP4L 1V05A 4GUPA 4G6JH 4XNQA 3S3SA 4ODHH 4UIKH 3N1MC 4NNYB 1E6JH 4NYLB 3QUMH 3MYJB 1DQTA 4Z7QF 4HMDA 5KN5A 3B9EA 4P9MH 3BXNB 3SDCC 1LO3H 1RHHA 3DUSA 4DK3A 1KBGL 2BSSA 5DK2A 1HN1A 4F9PC 2E6JA 1A1OB 4K7PX 3QEQA 4DQOL 5IK3A 4I0PB 3TYFB 1G6VK 2WSKA 2DM4A 3W11D 4AL8H 4BH8A 1CD0A 3BKJH 4HIIA 4LLWB 4TSCL 3MACL 3H0TA 3QZWB 4HAFA 1PAMA 1RUQH 2O5ZL 4APQA 4LLYA 3TIEB 1CFSA 3DRQA 2YOCA 4Q9QL 4J8RB 3FQXA 4L29A 1ZLVK 5ETUA 5CJOH 3VXSB 5JXAH 3S37H 1PZ5B 4M6NL 2FX7L 2GTWB 1JYWA 3KYNA 3LCYA 5HI4D 4UOW1 5ECJE 4G6FD 1GC1C 4XH2B 1JHLH 2CIIA 4HFUH 1T03H 3A6CH 3RZWA 2EZ0C 1R0AH 5IQ7L 4Y5YA 2Y36H 2AJYL 5TE7H 1WIOA 5IOPB 2X9YA 3OKEB 2BSED 3GMQA 3DXAA 3HE6D 1FYTB 3T09A 1PLGH 3MLVH 2WZPD 3AAZA 2V2XA 3ZKMD 5JQHC 5KVEH 4JRYB 5CKGA 1N7MH 4LAJH 3SEPA 2EDQA 5EC2B 4Z7NF 2XV6B 4I18C 4RMWA 3MO1B 5FOBB 5F3BB 2ITDA 2DQFB 4HS3B 5BV7C 3VFVB 3F6IA 1A6AB 3IKKA 4OGAD 4POUB 4U2ZA 4IDLA 2JJTA 4G9FB 4G42A 1P6FA 1AO7B 4UILL 5EPMB 1F90H 1H15B 1JZ2A 3QDGE 2XKSA 4LP5A 4X80H 1SQ2N 1NFIA 5DJ2B 3CGTA 1DQQB 3E6FB 4XCCL 4PY7A 3QG6B 3O11A 3Q5OA 4CVWA 4OCNC 2G75A 2W0KA 3EOAB 3GK8H 3P4OB 3WEXB 1WT5A 3B3IB 3WIFA 1C5BH 1IEAB 1PEZA 3T1FA 5MEQB 5L2JA 1KN4H 4IMKA 2UUDH 4Y7MA 1MCOH 5IJKC 5EDXA 5MEOB 2WANA 3O2DL 1NLDH 4PLNC 3MRFB 3UZVB 1CLYH 4Y4HD 4UNVA 3INUL 1F4HA 4UBDC 5BVPH 1PG7X 3LSOB 2HWZL 1JZ6A 3L6FA 4R0LA 2WWKO 1IGCH 5ESQA 2PYFB 3QUXB 1BD2B 2QADC 3BX7C 3PXHA 1IM9D 2F9BT 4LSRH 1MI5B 5BRZE 4PREA 2R29L 3BDXA 2VLJD 2V2WB 5IP4A 3S98A 1FFNA 5E9DB 1F6AB 3IFOA 4F7PA 3N50A 3PHQB 4U1MB 4WHYH 5J89A 1NLBL 3B6SA 4HBCL 2NXYC 4FOMA 1K5NA 1BP3B 1IJ9A 3M17B 5T1LD 3GDBA 3CNKA 5GS0H 4GW5A 3U48A 2B8OT 3LQZA 2Z31A 4HQQH 3FT3A 4ZFOB 3MV8D 5L6YL 3VG9B 3MUGA 4GXVH 1R5IB 1UXWB 1WCBB 2B2XH 3O2WL 2IQAB 5ERWB 5CJBA 3IDXH 1JCKA 3P9WB 1RZJH 4PRBB 2HLAB 1AR1D 1GHFH 3GNMH 4MDIB 1AGFB 4U1GB 1FV1A 1PKQB 4Y4FA 3MGTA 2F19H 4ZD3L 1HOCA 2AJUL 2EH7L 4NN7B 1MCIA 3IJYA 1KLGA 2IH1B 1ZWIA 2JCCA 1TQCB 4ZUWB 4P9HL 3EFDH 1X5IA 1PG7W 1IKFL 5D70L 3SDDB 1MHHB 3CXHK 1OAQH 3MLZH 5JIPA 2DWDA 3D0LA 2BNQA 1ONQB 4OLVL 5L2KA 1CFQA 3NCFB 2D7TL 3CAFA 3HA0A 3S36L 1BLNA 1U91B 1HHGA 3TM6A 4N0FA 1U8NB 3QHFH 1YECH 4RBPH 5SWSE 2ZCHH 2HN7B 1R3LB 4OJFL 1LP9A 1ZHBB 5DQJA 3O4LE 2XICA 3O8XD 3QQ9D 5EA0L 1ND0A 2XG4A 1Q8MA 1A4KA 2E7HA 4Q9RL 4LVNB 4GW1B 3D39D 3PGDA 3P73A 2H1PH 5C0JB 5JZ7D 1QSEE 4F7MA 4ZUVA 3EJYD 2Y7QA 2MTPA 1QTYT 5FECB 1D5ZA 5F7UA 1S9YA 3Q48A 2O5XH 2P5WA 5KVDH 1G6RB 4FNLL 1EFXD 1CLZH 2NW3B 4HJ0D 4JFQA 4NC0B 3LPGA 1DANT 2VDRH 3D3VB 1FO0A 3V6ZB 1DEEA 3KDMA 4XHJD 1UEYA 2CRYA 1IFHL 5I75B 1U3HC 4N0UB 4JM4L 1LE5B 3PJSA 5F21B 4YO0B 2AK1H 4JY6A 4MX7A 1KACB 4L4TA 1INQA 4PJGB 1N64L 4ZUTA 3TN0B 4KMQA 5T1KA 3GHEH 4HS8H 1INDH 4KMLB 3W39A 1XGQA 3OB8A 4JG0L 2IBZY 1I4FA 5BCAA 4KHTH 4HGMA 3S6CA 4Y2OA 5CHNA 1KB5H 4M6MH 4HGWB 4XVTL 3SQOH 1WWWX 4OLYL 5EC1B 1U8OA 2XKNA 3LN9A 2BSRA 3MLWH 1OTTC 5HGAB 2XWTA 2HKHH 4WHCA 3OPZH 4FQPA 5EUOA 5HGHB 1XGPA 2EH8H 1ZMYA 1U0QA 1TTFA 3F7QA 1TFHA 5HXMA 3U1SL 3FN0L 3GJEB 1FCCA 4NNXB 5F44A 2CUMA 1JGLH 3VGEA 1NCCH 1MWAL 4Z18A 3ZYOA 5DZNA 4QLRA 1WAAF 1QSFA 3C5ZB 4W6YB 4QRRB 4WTWA 3NCYP 1UADC 2IAMC 2MKWA 5EOCL 2NLJB 4JR9H 4R2GD 1RJLA 1EJ6A 1NCWH 2ORBL 5DYOB 4WEBH 1JVKA 2VIRA 4P3DA 5I18H 5DD0L 4WI7A 2D4FA 2EDLA 3IFPA 3L3OA 1U9KA 1OT1A 2I5YH 3EO9H 4WUUB 5BQ7B 4J7RA 4X0KB 2DLFL 4JZNA 5I1IL 5I1EL 4RZCA 5FKAA 4OI9A 5F7EL 4ERSH 1JNJA 1T80A 1IAIH 4LKXB 3R0MA 4D9RE 2VB5A 5FGBA 4XXDA 1IARB 1RUPL 1NAMH 2OP4H 4P5MA 4Z78A 4TUJA 1R3JB 5DMIH 3FOMA 2V7NA 2Z8SA 4K8RD 1NANI 2AEPH 3BP7B 5DQ9B 3ZSSA 1VFAA 3RY6A 1A5FL 3VRLF 2GK0A 4QWWC 4Y8AA 3DUUB 1A0QL 1EEZB 4UOJA 3WHXA 1AHWA 3D0VA 1T66C 1YY9D 3RTQA 2PXYC 3TBYB 1K8DB 1KBGH 2X4UB 1Q9KB 4P5TC 2XTLA 4L3EB 4XP6H 5DMKB 4DQOH 5FYJH 3T77B 4G6MH 4MCYB 2D31B 4X6BB 1YUHB 3MLTA 1Q1JL 5GRUH 3WSQL 2Z91B 2H32H 4TSCH 5HPMA 3MACH 1FAKT 1NGXB 3MJ9A 3FO2B 3HUJB 4QF1B 2ZG3A 4Z7UB 4G8IB 1SEBB 3ARFD 4MJ5A 1FIGL 4R7NA 2O5ZH 5DD1L 3UO1L 5IB1A 1MQKL 4Q9QH 3CVIL 1NEZA 3FB6B 1JRHI 4OTXL 2R1YA 1CGUA 1RAMA 2FHBA 1SMAA 2CDGA 4JDTL 4JDZB 3KLHC 2BNRB