1N3QA

Pterocarpus angolensis lectin complexed with turanose
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
241
structure length
241
Chain Sequence
QDSLSFGFPTFPSDQKNLIFQGDAQIKNNAVQLTKTDSNGNPVASTVGRILFSAQVHLWEKSSSRVANFQSQFSFSLKSPLSNGADGIAFFIAPPDTTIPSGSGGGLLGLFAPGTAQNTSANQVIAVEFDTFYAQDSNTWDPNYPHIGIDVNSIRSVKTVKWDRRDGQSLNVLVTFNPSTRNLDVVATYSDGTRYEVSYEVDVRSVLPEWVRVGFSAASGEQYQTHTLESWSFTSTLLYTA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of Pterocarpus angolensis lectin in complex with glucose, sucrose, and turanose
pubmed doi rcsb
molecule tags Sugar binding protein
molecule keywords lectin PAL
total genus 51
structure length 241
sequence length 241
chains with identical sequence B
ec nomenclature
pdb deposition date 2002-10-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00139 Lectin_legB Legume lectin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1n3qA00
1LODA 3H0OA 2NM1A 3IMNA 1BXHA 1OKQA 3POWA 1S1AA 4ZKTB 1JUIA 1DQ5A 2ZACA 4KBBA 1N1TA 2A3YA 2GNBA 2ZMNA 3OBRA 4Y1YA 5SV8A 2DYCA 3D5OA 4F83A 2WSUA 1BKZA 4XJ8A 2JDZA 4Q1PA 1ULGA 1H9WA 4Y22B 2YROA 4XJWA 2ZGLA 4DFSA 1CQ9A 1ZM1A 2GNDA 2LTNA 2DUPA 2OUJA 3IN9A 4GA9A 1R1ZA 4XIKA 4AGVA 3ZSJA 1SCSA 1SFYA 2R1DA 1MS9A 1W6NB 2VH9A 2A6WA 4XBNA 4K1YA 5H9PA 3WHUA 1IS5A 1QNWA 1SBEA 2ERFA 5JMCA 2D6PA 3AZWA 5E89A 5KXEA 3AJZA 4DRVA 1GNZA 4XJZA 1O4YA 5HCAA 2WNEA 1S0EA 4UW5A 5T55A 3WCRA 2R49A 1AXYA 3ZSMA 2WLQA 1DFQA 2YZ4A 1GSLA 3ZXJA 1ENQA 1ULEA 5JOXA 1N3QA 2CWSA 1QGLA 1MVQA 2ZBJA 2DU1A 4HANA 5GZGA 3OBTA 3AP9A 3ZPYA 1QOOA 5F5QA 3ASIA 3V65A 4CTEA 4LBQD 4DQAA 1GKBA 5JOWA 1V6IA 1ULCA 1G9CA 2GN3A 4XBLA 1SLTA 3PVNA 3WDUA 2ZMKA 2UWBA 1YI7A 2C9AA 4H55A 4R9DA 1BZWA 1QOSA 3MEPA 1MS5A 2W39A 2Z42A 5GM0A 1N1VA 2UU8A 4LBOA 3WDTA 2AR6A 3O12A 3RQ0A 1D0HA 4JC1A 1G9BA 3V0BA 1WUVA 2ZHKA 1W6OA 4OZXA 3V0AA 3ZVXA 5GJ6A 1IKQA 3B00A 1WW6A 2A6VA 1CESA 3WDYA 4C1XA 2D7FA 2KM2A 1LHWA 4XBQA 3UJOA 1F31A 1NXD1 2AH2A 3R4SA 4XDQA 4YM0A 3W58A 1G9FA 4U36A 3BOPA 4ITCA 1Q8PA 1OFSA 1VLNA 4XHXA 4FOWA 3UJQA 1UPSA 4YLZA 1UAIA 1QF3A 4Y20A 2HYKA 1YO8A 2ZGMA 1W6MA 4K20A 1VALA 2VW0A 3USUA 3N7JA 1LGCA 2OVUA 3SNMA 4FPFA 3T2TA 2A71A 1BJQA 1V00A 4FPKA 3T1LA 5IK4A 4AGRA 4NOTA 1S0IA 5GZEA 4I30A 1LU1A 2EXKA 2C5DA 3N3HA 4BPZA 3VKOA 2JKBA 4JCKA 4PQ9A 3AZVA 1MR5A 3M1HA 1CR7A 4YGBA 3FLTA 3OYWB 1LOFC 2DWRA 2A70A 2E7TA 2P3KA 1CN1A 3AXEA 1A78A 1WD4A 3IM0A 1W0PA 5GZFA 2D3SA 4GWNA 1GZWA 3POYA 4YZ3A 3O0VA 1DQ6A 5F9TA 4ISQA 1MZ6A 5EYXA 2EIGA 4PBPA 4XXAA 2EF6A 4XE9A 2ZHMA 1IS6A 1JN2P 3L2YA 5EWSA 3WLUA 5BYNA 1DQ1A 5GZDA 4FPCA 1IS3A 3M3CA 3LCPA 1GZWB 4FPHA 1QDOA 2XG3A 3A4UA 3FFZA 1W6PA 4FP2A 5FRAA 3V0AB 2JE9A 4M3CB 2ZGQA 3AP6A 4PBOA 3USUB 2PHWA 3R4UA 4YGEA 2ZKNA 3WG1A 5IK8A 2WJSA 4SLIA 2GMEA 4YM1A 3ZXEA 2E51A 1UKGA 2ZHNA 2A75A 1DQ0A 4XTMA 4LBNA 4Y26A 4YZ1A 1JHNA 4AYUA 3ZYPA 2E53A 3U4XA 5L73A 2R0HA 1DLLA 2ZGSA 3OY8B 1LEMA 4YZ4A 2AREA 4CRQA 1G9DA 4YG0A 5GLZA 2CY6A 3WG4A 3OGGA 1IKPA 3TAYA 1MS1A 1IS4A 1Q8VA 3SH3A 4WVVA 5T54A 2AYHA 1AJOA 1Z0HA 3O0WA 4YW2A 1LOAA 2DVDA 4YM2A 1WLDA 3OJBA 5T5PA 2ZHLA 4NO4A 4BMBA 1H30A 4DS0A 3UK9A 2WT0A 1S0BA 4FPOB 2YV8A 2EXHA 2GNTA 4K21A 3LSDA 1RIRA 4AWDA 3VUOA 3N7KA 1GANA 4FPJA 1N1SA 1SACA 2FMDA 4XJUA 5GALA 3I4IA 4YM3A 1SLCA 1CPNA 1UMZA 3BIWE 3T1MA 2GMMA 2DVGA 2CYFA 4M01A 1F5FA 2D3PA 1HQWA 3MW3A 4XZPA 1DHKB 2GN7A 3B69A 4Y24A 1W6MB 2JJ6A 3AZXA 3MW2A 4HL0A 4RL7A 4YGCA 3DGTA 3VKLA 3N7LA 1Q56A 3D4KA 1B09A 2W08A 4BLIA 1SLBA 4Q27A 2JECA 1Q8SA 2PHUA 4JRAA 1BYHA 1ULDA 4PCRA 1N3PA 2DTWA 1HKDA 2EAKA 2NZ9A 4ASMB 4XMIA 4DPNA 1H9PA 1LESA 4AVTA 3WG3A 5GZCA 1N47A 1LEDA 2D6OX 2PHTA 3VKMA 4M3CF 4GKYA 1LHUA 2LALA 3FBYA 3C2UA 4K1ZA 4WZFA 4Y20B 2DVBA 3RSJA 1AZDA 1WLCA 5KXCA 2JD4A 2V5YA 1WBFA 2E6VA 5DUVA 1W6QB 1LECA 5JOZA 2ZMLA 1Q8OA 2DUQA 2A6YA 4AVVA 3NV3A 1SBDA 3HMYA 4LBJA 1QU0A 3A0KA 1FX5A 5JLVA 4C1WA 3WHTA 2ENRA 1W6QA 2A3XA 2NYYA 4XIOA 3VKNA 2D6MA 4BMEA 5T50A 4BM8A 4L8QA 2D6KA 5T5LA 1XQNA 2A7AA 3OYWA 2WKKA 3NV4A 1KQRA 2EXIA 2P34A 3AX4A 4FQ4A 3FLPA 1MS8A 3AZYA 4FPGA 1ENSA 2CNAA 4MYEA 4LBQA 1LGBA 3RRDA 1LHOA 4YZ5A 1WCSA 2R16A 4GXLA 5JOYA 3AYAA 3SH4A 2ZAAA 5T5OA 2H0BA 1G7YA 1DGLA 1DZQA 1LOGA 3RMXA 1AXKA 4U2AA 1KDMA 4D69A 3A0NA 1V6JA 4XTPA 3MW4A 1RITA 4YG6A 5DG1A 2GALA 5DZEA 4AGGA 2ZGTA 1GV9A 1YRZA 2NMOA 3O5SA 3WDVA 4Q8KA 4FPEA 1CJPA 1N1YA 1APNA 1YYNA 1PZ9A 1JBCA 4M3CA 4WVWA 5KXBA 1LTEA 2D43A 3WDWA 1AVBA 2P3JA 4Y22A 2E7QA 2UURA 2R1BA 1SLIA 1BQPA 1WBLA 2A6ZA 2VW1A 4BLJA 1DYPA 2DURA 3OY8A 3UL2A 1AJKA 2XB6C 4ATFA 3LSEA 4WV8A 4YW1A 1NLSA 1ULFA 4LBLA 3SLIA 2NP0A 3TB0A 1Y7BA 2CWMA 5HCBA 3WNXA 3CNAA 1QKQA 1D2SA 5T52A 4FOQA 3IPVA 1JXNA 4XXPA 2WQZC 3AYEA 1AX0A 5DZGA 1WLWA 1V6KA 2P2KA 1W0OA 5CB7A 3VKFC 1AX2A 3NWKA 2D3RA 1FATA 1LHNA 1YXWA 2EXJA 3HN1A 5GLUA 4BQ1A 1EPWA 1MS4A 4R9CA 1PZ8A 4Q2FA 1WW5A 1W6NA 3ILRA 1FNYA 1DQ2A 5GLTA 1LGNA 5EYYA 2ZABA 4P9WA 5AVAA 5IK5A 3BODA 1W6PB 3WCSA 5DUXA 1G86A 3KQRA 1G8WA 1LOEA 2Q5TA 1FV3A 4YW4A 5T5JA 3ZXKA 3POSA 3QCWA 1JOJA 1LJ7A 1JW6A 2UWAA 2SBAA 5H9QA 2VW2A 1V6LA 5CA6A 1QOTA 3ILNA 2PHFA 1S0JA 1C57A 1RINA 3AZZA 1IOAA 5CAZA 4GALA 4XMAA 3W59A 3FLRA 3AYDA 2AGSA 4YW5A 4AVSA 4Q1RA 4Q26A 3B9CA 1TEIA 4UW4A 1I1EA 3NV1A 1AF9A 4PF5A 3M3OA 3AK0A 2R0FA 3FUOA 1DBNA 1Q8QA 1KRIA 1V6OA 1SBFA 2GMPA 5E88A 1LCLA 1UZYA 1VAMA 1GZCA 4YG3A 1S0FA 2DTYA 3WG2A 3RG0A 4R9AA 3AP4A 1CVNA 1GBGA 2D6LX 1GZ9A 1LOFA 2EALA 4Y1XA 3N35A 3KM5A 3M3QA 1W6OB 5FREA 1O4ZA 3WDXA 4FVVA 1JYIA 2PHXA 3AYCA 4Y1UA 2A5ZA 3V64A 1LHVA 4LBMA 3ZYRA 3N36A 4FP3A 4M3CE 1PZ7A 1SLAA 1MS0A 3B01A 5LK5A 3AP5A 1WW4A 2AUYA 4GWMA 4R9BA 2GNMA 1MZ5A 3GALA 2SLIA 3Q9OA 1C1FA 1HLCA 1LULA 1FAYA 3B3QE 1KJLA 4Y1VA 3SH5A 1LENA 1CIWA 2ZGKA 3RMYA 4YFZA 1AXZA 3WUDA 4TZDA 3SISA 2D6NA 3RS6A 1QMJA 3ZXLA 5IK7A 5HCFA 5EXOA 4P14A 1N3OA 4FQZA 1KITA 3WOGA 1GNHA 2ZA9A 1X50A 2DUOA 1GYKA 2BQPA 2NMNA 2ZZJA 3JU9A 2RHPA 3M2MA 4FOVA 1C1LA 4RA0A 2ZGPA 5GLVA 3FUQA 5IUQA 1MACA 2DU0A 2VY0A 3ENRA 4YGDA 1F9KA 4BOWA 2A6XA 5JDBA 4XJ9A 1LOBA 1Z78A 3AP7A 3IPVB 3ZSKA 1UN1A 5H9SA 1I3HA 3WUCA 5KXDA 2ARBA 2OW4A 1GICA 1CONA 4TYSA 1G9AA 1CPMA 1FNZA 3PVEA 2NN8A 4GKXA 1SLLA 2G4IA 5CBLA 1AX1A 4ATEA 2CTVA 5GLWA 3ILFA 3AFKA 3O0XA 4LBKA 1A8DA 5DUUA 3VV1A 2PHRA 1WW7A 3PVOA 2UWCA 2ZGOA 2V73A 2DVAA 1UX6A 2P37A 1V6NA 2JE7A 1A3KA 1QDCA 2ZGUA 4XYXA 5IT6A 1S0CA 1UL9A 3V0BB 2WT1A 3WVJA 1C4RA 2ZGRA 1ZA4A 3ATGA 4YZ2A 4UW3A 4XOGA 1S0GA 3WZ1A 5JVVA 4XJAA 1J1TA 2P3IA 2W52A 3BTAA 4UW6A 3AJYA 4Y1ZA 3SITA 2OUHA 1ONAA 3JUUA 1VIWB 4M00A 3WV6A 1HQLA 1LU2A 3ZSLA 5DUWA 2D44A 4IQPA 1YIFA 1URXA 2ARXA 2FHRA 2ZGNA 3NV2A 2GDFA 1SCRA 3IKWA 3R05A 1HDKA 2CL2A 3DUIA 3M3EA 2VXRA 1FYUA 3MPPG 2I2SA 2PELA 1V6MA 3PJQA 1JYCA 2AENA 5DXDA 1MS3A 2WT2A 1DYKA 3I8TA 1WD3A 3OPZA 1U0AA 1KDKA 4CZSA 2A3WA 1DIWA 4YFWA 4ZXKA 1ENRA 1UZZA 2YMZA 4W65A 3ZXFA 3INAA 2W68A 4P9XA 3HR9A 1KJRA 4FPYA 4Q8LA 2YXSA 2VUAA 4P9YA 4LBQB 5CNAA 5DG2A 3D6EA 1MVEA 4Z8BA 1VAVA 1S0DA 2ES3A 1OQ1A 1FV2A 4ISRA 5H9RA 2B7YA 1GLHA 3PMEA 3AXDA 2YY1A 1DQ4A 2DV9A 4XILA 2TEPA 4DRRA 4YW3A 3QLQA 3GNEA 2VU9A 4XHBA 3APBA 1QNYA 5DZFA 5E8AA 4FPLA 3N7MA 4FOYA 1LOCA 2DVFA 2WSVA
chains in the Genus database with same CATH superfamily
3L2HA 1COV3 4QXKA 1AR83 2I07B 4NPRA 1AYN1 3AL6A 5LK7B 5FYUA 1N1TA 2O1QA 2ZMNA 4Y1YA 5FZEA 2JICA 3MICA 1GR3A 5FPLA 5CZKA 2FCTA 1JYIA 4MV2A 4QPWA 4DFSA 5JSOA 1CQ9A 1ZM1A 2GNDA 2OZ6A 4GA9A 5L36A 3NW4A 4UBHA 3DECA 1XNKA 1SFYA 2IFWA 2A6WA 4XBNA 4K1YA 4I09A 3CZJA 3ZN5A 3ZSEA 1IS5A 1SBEA 2D5FA 2ERFA 2XHNA 5D8AB 5JMCA 4XFAA 5FZ0A 2P17A 4EROA 3S6PA 3LDKA 2BEOA 3AJZA 3WF3A 4TSVA 2HWC1 4OI4A 2IWGB 2R072 5FZHA 4E4DX 5JXHA 3AVRA 4NPMA 3JD73 1V9U3 1GSLA 1ULEA 4QQHA 1QJEA 1Y3TA 4QDRA 1N3QA 5CISA 4HK8A 5GZGA 3OBTA 3TYJA 1RJ8A 4AFBA 5F5QA 2RDSA 3ASIA 3ALQA 4LBQD 5AVPA 4Y5Z0 1V6IA 3FX3A 2QBXA 5CKMA 4XBLA 1SLTA 2WFF1 5BNQA 2ZMKA 2D40A 2HEVF 1YI7A 1B35A 2VO5A 1NQDA 4H55A 1MS5A 2VL4A 4CDUB 3PIJA 4XUTA 1GWLA 2YDEA 2AR6A 3RQ0A 1TME1 5I0RA 1G9BA 5ACA2 2VPVA 2KR2A 2AACA 4R4ZA 2ZTNA 2RM21 4ZU4A 3T0BA 5LBEA 3T2QA 3UESA 3EHKA 3GCWA 4OZXA 5EQUA 4PLNA 4AHXA 3V0AA 1A6CA 4V2WA 1QQP2 3WW2A 4NRPA 1WMXA 1UYXA 4EWEA 2KM2A 3UJOA 5I8YA 3ECQA 1NXD1 4QGMA 4QQ2A 4KH9A 4XDQA 3BOPA 3JBG2 2ZX0A 1F15A 4HKLA 4D6SA 2VCBA 3WP5A 5E6HA 3HBKA 2VM9A 5A3UA 5JXJA 4MGYE 2VMDA 1PMIA 3T2PA 3VBHB 3RVHA 1O7FA 1QF3A 3PL0A 4Q4X1 5CU1A 3POIA 1RXFA 1PVXA 1VALA 1PGW2 2VW0A 4TTGA 4RR3B 4FPFA 3T2TA 4Q4V2 2IXHA 4FO9A 5FZ6A 2IVJA 3KCCA 5IK4A 3ELNA 3HWJA 3VDAA 5GZEA 4FAGA 3O1MA 4BPZA 2JG9A 3T30A 1HRI1 1F35A 5A32B 5BPXA 1HRI2 4IEOA 4D6QA 1UOFA 4PQ9A 2WAAA 2XMLA 3AZVA 1J3PA 1W99A 4YVWC 4B7KA 3FLTA 3OYWB 4BB3A 3O1VA 2BBVA 1RVF1 1OQEA 3VB9A 3VZKA 4URAA 2JB4A 2BPA2 2JX9A 3AXEA 3IM0A 3POEA 5GZFA 1HB3A 1GP6A 3B5LB 2R7EB 4UBGA 3WP4A 2HEYF 1GU3A 1GZWA 1UW8A 1BK0A 4ZS3A 5F9TA 3POGA 1AL21 1QJY3 3KSCA 3WF4A 2RS12 2ADDA 1QH7A 4BYYA 2BOIA 3IDEA 1W06A 4FPCA 1VBC3 4A42A 4F3JA 1NZIA 1YJLA 1NZCA 3E5XA 3LA2A 3LCPA 3WINE 5C8CB 2FBEA 4MX3A 4N90A 2XG3A 4ARYA 3KF5A 5I0TA 3V0AB 1BEV1 3KT1A 4YVSC 2PHWA 3POBA 4SLIA 3FMGA 4FFIA 1ZZ7A 3D0JA 1HJFA 3KCXA 4XTMA 5FZOA 5LBFA 4NIGA 4Y26A 4EWDA 5A3OA 2LS6A 5L73A 5L9BA 4UFHA 2XLAA 5DAXA 2BNMA 1DLCA 4J25A 1PO21 3CQOA 5GLZA 1OPOA 3O1PA 4N43B 4PLOA 4OMCA 5JSPA 3LEMA 5K0UA 2CGNA 4RHV1 1FMD1 2MEV1 5ABJC 3B94A 1FMD2 5FZLA 4WVVA 3NJXA 2AYHA 4JHZA 1AJOA 1NG0A 1NUKA 1Z0HA 4QPIB 1X36A 1LOAA 4OUMA 4AVBA 1VMHA 3T3YA 4HPKA 2HWF3 2P5BA 2HWF2 5F5AA 2JDUA 1F4AA 1RGSA 3UK9A 2WT0A 1ALYA 4FPOB 1YQ2A 2GNTA 3ZFFA 3LSDA 1TVGA 2QQNA 3N7KA 5LBBA 3PU8A 3I4IA 4PI2A 5IVEA 3A7QA 1JUHA 1SLCA 1CPNA 5CFDB 3BIWE 4PT6A 2GMMA 4M01A 3PUQA 3AMQA 4LO4B 3H7YA 3MW3A 4XZPA 5F3IA 1DHKB 3SLIA 1BMV2 2JJ6A 3AZXA 3I59A 3MW2A 4RL7A 4YGCA 4BIOA 3DGTA 2LM3A 2JG8A 4L99A 2W94A 4BLIA 4CUBA 1CAVB 1OH4A 4PQQA 1OI6A 4Y5SA 2Q0AA 2Q1FA 1BYHA 4JRAA 4AFDA 4FTSA 1N3PA 2GC1A 1ODNA 3I3EA 1TMF3 1ULPA 2XVLA 1LEDA 4NN0A 3LB9A 4AI1A 2D6OX 2PHTA 2W5FA 3I3DA 3POJA 4M3CF 1ASJ1 3RSJA 5F37A 4S2GA 3O1RA 2Q8DA 4XFIA 1S4CA 4QU1A 2R071 1W05A 1WBFA 2PHLA 3U07A 3THCA 3H1YA 3MLJA 3VBRB 3HD8B 5HXVA 1U12A 5CFCB 2RS53 5FBJA 1TMF1 2RS52 4AVVA 3RZLA 3I7DA 4KWUA 5D8AA 3WHTA 1W28A 1W6QA 1VBD2 3NNMA 4XIOA 3DN7A 5FMOL 2ATFA 5C70A 5I8TA 4BMEA 2D6KA 5D8AC 1XQNA 4L9BA 5FXXA 4GJYA 4Z82A 5A33B 5KC6A 3T0AA 4CXYA 2EXIA 3J7HA 3FLPA 1MS8A 3AZYA 4FPGA 3DYPA 1QXJA 3J4UH 1DGRN 4MYEA 3WX5A 5I93A 4LBQA 2CDPA 2CDOA 3GYDA 2Y64A 5I8SA 5FKBA 3TBDA 3AYAA 5T5OA 1SFPA 5ACA1 1PK6B 4BDVB 1G7YA 4TN7A 3LWCA 1VE0A 1DZQA 2R042 3LAGA 4YW6A 3RMXA 3VDDA 1IZ3A 3R0RA 5A70A 1KDMA 4ZZ5A 4JGYA 3A0NA 2XJUA 1RITA 3MW4A 5DZEA 4CDXA 4OHYA 5C3SA 5IVCA 2PYTA 1IG0A 2CU5A 4FPEA 1CJPA 4XQWA 1APNA 1YYNA 3IDCB 5FP3A 4FAHA 1PZ9A 1JBCA 2VMEA 5KXBA 2OYZA 1LTEA 2D43A 5HCHA 2MEV3 3IZOA 3NJVA 3IDAA 1GOFA 1HXS3 2C9KA 3MIDA 1W8OA 3MIEA 2FDIA 4FFHA 4I0BA 4Q4X2 3QH7A 3VHOA 3ETQA 1DYPA 1UY4A 2V4VA 2WYFA 3LQCA 1C28A 1E5HA 1PGW1 2DURA 4CP9B 3UL2A 1XOYA 2QE3A 3AKRA 3FE5A 2W92A 5FZ8A 1QXRA 4Q29A 3TB0A 1W2NA 2B5HA 4E4ZA 2R30A 1D2SA 2O8QA 3N9LA 1JOPA 1RUH1 1JXNA 2R32A 4XF0A 3AYEA 3I2JA 2P3YA 2B9UA 5DZGA 5A1LA 4AHYA 5FZCA 2VTXJ 5JMOA 1OOPC 4DY5A 2WYSA 1V6KA 2XGXA 3ZFGB 4GZ9A 3HJRA 1XNAA 1YNAA 2HYXA 3EXUA 4WZCA 1F2NA 2HWE1 1O3RA 2EXJA 2HWE2 3M7AA 4BQ1A 2MHFA 5FYSA 4OZOA 5LZ6A 5FPBA 2VMCA 4JDNA 4Q2FA 4COVA 3ILRA 2ID4A 4RQPC 5BNPC 3VDBA 5D2AA 5AVAA 5IK5A 3KHCA 3BODA 1W6PB 1X8MA 3MO4A 5DUXA 1TQ5A 2QQUA 2Y6FA 3WCSA 3ZX7A 5F8PA 1PIV2 1W39A 1EY2A 3R6SA 3DYMA 2Q4SA 2VVFA 3M3IA 1HW5A 4A3XA 3C7EA 4YRDA 3ZKUA 1QEXA 3NNLA 3HQRA 3H3LA 4NR1A 4QMAA 2VW2A 3VDDB 4ES9A 1D2QA 2ET7A 2WWSA 3C3VA 1QOTA 1YJKA 5J98B 5CAZA 1EUTA 4GALA 4XMAA 1I9RA 4IEXA 3J8F3 4KG8A 1W8WA 4Y4RA 2ZAHA 3SHRA 4CU8A 4AQTA 1VBB3 1J58A 2E32A 4Q26A 3DL3A 3NV1A 3KLSA 2RR12 4P9IA 5J09A 1KXGA 4CDUC 1PO22 3FUOA 2GH2A 1TZOA 3VL9A 1KRIA 1V6OA 4DUVA 2YBKA 4CDWC 1RUF1 2GMPA 1LCLA 2J1TA 2BGOA 1GZCA 1I5ZA 1S0FA 4FCAA 4YG3A 2DTYA 3LE0A 1H1MA 3AP4A 3PMSA 3S30A 2JD9A 2OT7A 2VBPA 1GZ9A 3UKTA 5FY9A 4NAMA 5L19A 2WNUA 2WS92 2XXZA 4WM7C 1MZFA 1XNCA 4Y33A 3WDXA 5LB6A 5C33A 4XETA 4FVVA 2MPFA 3S5AA 4Z2WA 2PHXA 2R061 2VC9A 2VOVA 2W46A 3LKJA 3J8F1 3ZYRA 3N36A 3IAQA 1PZ7A 4K3UA 3SEPA 1MS0A 5HV4A 3VGIA 1NCQB 1TNFA 2FD8A 4MGZE 2B4KA 1NQJA 3HT1A 4MVTA 4AHWA 2G9GA 2KXLA 2XJSA 3ZFEA 5K7PA 3KVAA 2SLIA 1UOBA 3Q9OA 5FZBA 4HVQA 5A1AA 4LKFA 1FAYA 4OYUA 3KB5A 4QPYA 3B3QE 5DDJ2 2P1BA 4IW3A 4Y1VA 1O59A 1RUC1 1NCRA 2NPIA 3RMYA 4ZXEA 2DDUA 2X5IC 4KL1A 1WCDJ 2FMYA 2ZX1A 3VN4A 2VOXA 3LEKA 3WNPA 4TZDA 2D6NA 1PVC3 5KHGA 1U5IA 5IK7A 4A7YA 4E9KA 4GH4A 4LO8A 4X6QB 5IJRA 4QB1A 4J1WA 1XU2A 3QBQA 4AI3A 1RUJ3 2WINB 2Y6JA 4OHZA 3FFQA 4KGGA 4DY3A 1X9TA 2WNVA 3PIGA 5T5PA 5IATA 3M2MA 1C5IA 1WMFA 5HI0A 2VY0A 1AR73 4YGDA 3T09A 3W21A 1B35C 2H6CA 4MADA 1REFA 1UN1A 2TNFA 1CAWB 1BBT1 4CEYB 1GICA 4JKLA 3W20A 4TYSA 1G9AA 4ONUA 1WKYA 2OQ6A 5JPMB 2GU9A 3AMNA 5C71A 1FPN1 4RFT0 2CTVA 3LZZA 1YI9A 4UFKA 4XCBA 4CEWB 3KF3A 1H6YA 1XSRA 3RGBA 2UWCA 2V73A 2DVAA 4K9SA 3CHXA 4IV1A 2RS31 4B4RA 4BQ5A 1A3KA 2C6SA 2XLGA 5JSRA 5D21A 4QT6A 3T4HB 3VBUA 3KD4A 1C4RA 3ATGA 3NNFA 2XDVA 2A1XA 2Y34A 3UT0A 4NIAA 1S0GA 4XJAA 1J1TA 2JDPA 2W52A 1ND2B 1H2LA 1C8M2 4N53B 1W9SA 3OD0A 1C8M1 3JUUA 1SZBA 1LU2A 2ORZA 4AAPA 2D44A 4A7ZA 5IWFA 1M06G 5JCTA 2Y60A 3U75A 4EE2A 2FHRA 1CAVA 1NX9A 2ZGNA 2GDFA 5F2SA 1KFXL 1Q3EA 1XNDA 3R05A 1HDKA 5F5IA 2VXRA 4COUA 2RDQA 2I2SA 1FI2A 4JGYB 1J59A 1NAEA 1T2XA 2WT2A 1DYKA 4MXWB 3OSDA 5FPVA 4NIDA 3JCIA 3ES4A 1NKGA 3E97A 5ANQA 2DCKA 3VZOA 3ZXFA 3Q8BA 4AE2A 1VBA3 4DUXA 3SCHA 2VVDA 2BFUL 1VBE3 2W68A 4P9XA 4FPYA 1ENXA 2RJ2A 3ABZA 4H14A 4LBQB 2VE1A 4NRMA 5DG2A 1RC6A 2VMHA 3D6EA 1POV0 2QQMA 3MV01 5FUIA 4BQYA 1VAVA 2YU2A 1BBT3 5I0SA 2XQXA 3AM2A 2R073 4AFCA 4ISRA 5H9RA 3GGLA 2B7YA 3PMEA 5A3TA 5BY5A 2DV9A 4DRRA 1RUC3 1X8EA 3IB3A 3QLQA 2VU9A 5E8AA 4E4SA 5B2GB 4FPLA 3I2HA 4FOYA 1LOCA 3WY6A 4ASLA 1PGL2 5FO9B 1UPIA 3NNJA 3IMNA 2W1WA 1F5JA 1OKQA 1S1AA 3VZJA 3WF2A 3JBG1 4MUVA 3WQ7A 4GB33 4ZKTB 5LWBA 1JUIA 5IVJA 3B7MA 3OBRA 5SV8A 1POV1 1VRH1 4P02B 1YUDA 4LMFA 4W50A 5FMOS 4XFCA 3VBUB 2P6HA 4R52A 1UQXA 2P6CA 1MQTB 2DUPA 2ILMA 4XVHA 5FTTC 4NHKA 4AGVA 3ZSJA 2R1DA 1MS9A 3OOXA 4EN0A 1PIV3 4CCEA 4RGAA 3WHUA 4Q4V1 3AZWA 2VECA 4BU2A 3RZJA 4JDOA 5JXIA 1YLLA 4DRVA 5DAVA 3UKNA 5T55A 1S0EA 3O7OA 4UW5A 2QZ2A 2R49A 3WNNA 3ZSMA 4E27A 5C3PA 1VB4A 3ZXJA 1XNBA 2Z69A 4IEZA 2IXCA 2ZBJA 4Y5TA 1PK6C 2DU1A 2XHKA 4CVUA 5CADA 2RMU1 5FOBB 3ZYIB 2IXLA 3WNKA 2VNVA 1XJAA 3GZEA 5AC91 5AC92 4QDQA 5JOWA 5A3PA 3ZKYA 3C7OA 4N9IA 5FPXA 1DGWX 1KD7A 1R083 4TLGA 3OD4A 3KMHA 4D6RA 2E9QA 4RQPA 1IHMA 2RS11 3IIIA 5BNPA 3BOWA 2WZEA 4R9DA 2ZCWA 1BZWA 3VD5A 4LJHA 5GM0A 2UU8A 3ACLA 4DINB 1RMU1 2J1SA 1IQAA 3ZFGA 1RMU2 3OGRA 4CDWB 2FZ2A 1WUVA 1BEV2 2VTFA 5EV7A 1BEV3 4GMP1 5EJZB 4B4PA 4BJ0A 2K9ZA 1H1AA 2F17A 2WZ8A 1WW6A 2DF7A 4C1XA 4QKDA 5JR2A 1X82A 1F31A 2VUCA 3ACFA 3GDBA 4WM7B 5FPZA 3WQ0A 2ZX3A 5K9YA 3R4SA 4AW7A 5C3RA 1G9FA 1MEC2 3VBRA 2G19A 2VVEA 3U4SA 1DCSA 4NPLA 4XHXA 3UGFA 4AHZA 5FUNA 1D4M3 1TG7A 1UPSA 2R043 1UAIA 1OOPB 4Y20A 2JKXA 4MXVA 5FP8A 2ZGMA 3HQUA 4K20A 5C5TA 1K12A 4CCCA 4AI0A 1JZ2A 5A33A 3QOPA 1ZX5A 3USUA 1OBNA 2YPJA 3MIGA 2VJXA 2OVUA 3N7JA 1R082 4PDWB 4CCJA 1AR63 4FPKA 3IWZA 1SPPB 3T1LA 4GWJA 1ASJ2 1M4WA 2X5IB 1LU1A 1NY71 2C1FA 5BNNC 1BBT2 4WVMA 5FZFA 4OQ8A 4HG6B 4LNVA 2VZVA 2DWRA 4XC9A 2WABA 4DXRA 3NRUA 2E7TA 2B42B 3DPRA 1R64A 3NO8A 1W0PA 2AEZA 5LY1A 4KGQA 2D3SA 3FJSA 3PJYA 3O0VA 1W2OA 4UOJA 3I2FA 2Z2SB 4ISQA 4EYUA 2JEMA 1OUXA 3SEEA 3VBSA 2EF6A 5FO7B 4B3NA 5EWSA 1HV1A 4G4FA 4QX7A 3HT2A 2QQOA 4NIHA 1IS3A 4I02A 4NHYA 3M3CA 1OD3A 3ZFEC 1GZWB 3WQBA 1F4HA 1O6UA 2IXKA 3CJIC 5FRAA 3OPTA 4M3CB 3JQWA 1CZSA 1NXMA 1XE8A 2ZGQA 3USUB 2VMFA 3KGZA 4RGKA 5IK8A 4GIQA 4YM1A 4QKBA 3D8CA 1ZBE1 4NJ4A 4HFSA 2O14A 4MGQA 5L7OB 2WO1A 4CA9A 5A32A 4LBNA 2IZWA 2RS51 1JHNA 3U4XA 2NQYA 2VD7A 1QY4A 1U5YA 2VQ0A 1DLLA 2ZGSA 5F6LB 2Y0IA 5K4LA 1G9DA 4LO7A 4YG0A 1QJU3 4TWTA 5EIYB 1UOJA 1IKPA 3OGGA 3TAYA 5I0DA 3WW4A 2F4LA 1YC61 5APAA 2PLV1 4P9LA 2Z79A 4DOUA 4ES8A 4N53C 4OULA 3IIAA 3NKTA 4N7IA 5FXZA 5T54A 1E57A 3Q8CA 4AEJA 4D0QA 4YW2A 5BV6A 2YG0A 2YGLA 4L97A 4YM2A 5FYMA 5J48A 2RDRA 3GF6A 2J1VA 4NO4A 4DS0A 1GFF2 3EO6A 1ZRCA 1S0BA 2BOJA 4WVMB 2YV8A 1RIRA 5DQ0A 4AR2A 4JKMA 3ZXGA 1GANA 3V56A 4AWDA 4YM3A 4PIXA 2XVKA 5FOJB 3UGHA 1ZBA1 1WMDA 5LEJA 1RVF2 3RYKA 1OH3A 2DVGA 4RFRB 2CYFA 5LA1A 1STMA 2W1QA 2D3PA 2DCZA 1UU4A 1POQA 2E33A 3B69A 4I01A 3B93A 5GALA 4AF9A 1EAH2 2Q1ZB 4JDMA 3BTYA 3ORJA 2YC2A 3D4KA 1VRH3 1VRH2 1B09A 1BHGA 3QH6A 5A1FA 1SLBA 4Q27A 2VOTA 5C8CA 4XEZA 2VMGA 2HBTA 4LOTA 4YVSB 5A6ZA 1UIJA 4UT5A 3WP6A 2E26A 1QJX2 2XONA 4OMDA 4CEYC 1HKDA 4DPNA 2NZ9A 4WBBA 1VBC2 3NAPB 1VBA1 4N53A 3I2GA 2O0OA 3ES1A 3OEBA 2V72A 2WL1A 3B02A 1LHUA 2LALA 2VQTA 1D0GA 2YBSA 2I45A 3FBYA 4PHZA 4RS5B 3CZUA 3O1SA 2JD4A 3ZLIA 5LBCA 1HB2A 4LR4A 4LIVA 3MYXA 4QKNA 1OSGA 3DXUA 3E5QA 4A7KA 1I6XA 2A6YA 5A3WA 4K6BA 1QU0A 2WNOA 1QJFA 3ZN4A 2GP5A 3ZR6A 4C1WA 1JYVA 1JHJA 5FY5A 4EQVA 2WC2A 1H4GA 2NYYA 4P08A 3VKNA 2VUDA 4D7SA 5A7SA 4O9GA 2A7AA 4BCUA 3MDPA 1WCUA 1XE7A 4A4AA 4B7EA 2JG8B 2XWBB 1EAH3 4M4RA 4Q0SA 4YWAA 1HQNA 1ENSA 1LGBA 2OPWA 4HMZA 4BK4A 1LHOA 5FAXA 4YZ5A 2G1MA 1GUIA 2R16A 4Z1VA 4HVRA 4QQOA 5LW9A 4AVCA 4IEVA 3KVBA 3SH4A 1OPMA 2V09A 2DFCA 5IHRA 1DGLA 1JU3A 1HX6A 2CGPA 3PVBB 1V6JA 4XTPA 5LY2A 4D94A 1ZVFA 5E16A 3ZDVA 4AGGA 2KD7A 1YEWA 3LPGA 3CF6E 1BLZA 4CU6A 2L9LA 1R1A1 4J1XA 1PMHX 1R1A2 1N1YA 1RVF3 1ZZCA 4CU9A 3A22A 4ORFA 3RYPA 1W2UA 3JXSA 4QX2A 3T2OA 5FZ9A 2E63A 2B45X 2P3JA 4H7LA 4MGSA 4Z07A 5AFEA 3VBOB 2R1BA 1K42A 4CU7A 4A41A 4QWNA 1UY1A 1WBLA 3SCGA 5FP9A 3G7DA 3OY8A 4FFFA 1AJKA 3U11A 4YARA 4FSJA 2QQIA 2G9FA 3UNPA 2ZX2A 1UWWA 5IVBA 4IV1C 4MGTA 1Y7BA 3POFA 5HCBA 1UYYA 4N9HA 2WQZC 3DCQA 1AX0A 1OHFA 4GH4C 4CDWA 3RZKA 2VBDA 3VBUC 1WLWA 4P9JA 2ZEZA 1W0OA 3HEIA 3DV8A 1TMF2 3B9IA 4UYBA 1T6GC 1R091 1AX2A 3NWKA 2BW8A 1K3IA 1LHNA 1CJDA 2D3RA 2VZPA 4NVPA 4Q5OA 4CEWA 4PDWC 1EPWA 2RE9A 5FZ3A 5C9AA 5F1RA 1D4VB 3H8RA 1UCXA 4M0HA 1WW5A 1FOD3 1L7RA 5EP9A 1FNYA 5GLTA 2JDAA 3WW3A 1LGNA 1RHI3 4GAZA 5EYYA 1PVC1 2ZABA 5FKCA 2PLV3 4M4PA 3VHNA 4LXLA 2BGPA 1DP0A 3BPSA 4MHRA 1HB1A 3GZTB 1G86A 3PUSA 4BQWA 1RUD1 5FLJA 1LOEA 4HZFA 3QCWA 4HLTA 4QM8A 4KBZA 1JW6A 2EA7A 4NHXA 4QX5A 1JU4A 3PTYA 1UF2C 3ZXAC 1V6LA 3CLPA 2NLRA 1RINA 3AKTA 3JZVA 5FZOB 2HEWF 3FLRA 3AYDA 5FZ4A 1Y9MA 1FOD1 2WQ8A 4AVSA 3LEIA 1J1LA 3B9CA 3H8OA 4UW4A 4QQLA 3OUJA 3AK0A 2R0FA 1DF0A 1UY0A 4XPVA 5E88A 1BK1A 2X10A 3RG0A 5I0UA 3H50A 4ZU7A 1LOFA 4UF0A 2EALA 1QJZA 1W6OB 2VCCA 1O4ZA 2PMWB 4G9SB 3VZMA 3ZFGC 4XQDA 2O8OA 5FYBA 4MGIE 5JR7B 5JIUA 2CGOA 3VZNA 4P5HA 4UFLA 5FYVA 5FY0A 1W8ZA 3PNAA 2FQPA 1LHVA 1DYOA 3DEMA 1ZZ6A 5JI9A 1H8TC 1BCXA 1H4HA 5LK5A 3AP5A 5J7MA 3GM8A 1COV1 2AUYA 3CJIA 3E5UA 4R9BA 4LHLA 1XBFA 4IV3B 1AUYA 1E5RA 1H6XA 1MZ5A 2BWCA 3GALA 5CEHA 1SMVA 1HLCA 1LULA 4IERA 3MIHA 4CDQA 2VULA 3S0MA 1GOGA 4CCMA 1RUNA 5FZIA 4XDPA 1LENA 4NROA 3N9PA 4YFZA 2ARCA 4CDQC 3WUDA 2C0ZA 5EPAA 2W91A 4INDA 3P3PA 5BNNB 2UYAA 1QMJA 1GQHA 3ZXLA 5A3LA 4JV4A 1D4M1 1HRV2 1YQ8A 1N3OA 5LRRA 4FQZA 4JGZA 4C91A 1OLRA 4GULA 2X53S 1H2NA 1X50A 1KFUL 2WZR2 3VBFA 1UKRA 1GYKA 1VR3A 1XYPA 2ZEXA 2ZXQA 3GJBA 4YVWA 2NMNA 4FOVA 3ZYBA 4Q0QA 2VCAA 5IUQA 4EN8B 4AG4A 3ENRA 3NJZA 2A6XA 1UU6A 4XJ9A 1Z78A 3IPVB 5FV3A 2VZUA 4QXCA 4Z2AA 5KXDA 1RUE3 2OW4A 3ZN6B 1RXGA 4LE4A 2OQ7A 2WZR3 5BNOA 4JX0A 2RR13 3ZFEB 2NN8A 1SLLA 4I0AA 2OS2A 2WNUB 3CJIB 2JG9B 3O1OA 4UF0B 4NIIA 4WM7A 2XH6A 2WA3A 4XFBA 1O3TA 5JZGC 3VV1A 5FMCA 1CAWA 1WW7A 1L7LA 4OFGA 1RUI2 4HBNA 3ME2A 2Y33A 1UX6A 1NCQC 2K2SA 5JZGA 1AL22 3ZIWA 3ZFFC 2P37A 4RD7A 4FBFA 2FDKA 1V6NA 1QDCA 3ZYJB 4DEVA 4IGQA 1UL9A 4Q4Y3 2QUOA 4NWVA 2XJRA 4AI8A 2ZGRA 1OQDA 1ND3A 2OZJA 3TN93 2XL9A 5LA9A 3VL8A 4YZ2A 5JVVA 1UYZA 1OUSA 1TME3 3K4AA 3SITA 1JZ5A 1VIWB 3WV6A 1VJ2A 2RJLA 1UOGA 3OCPA 4DO0A 4IQPA 1YIFA 1R093 4PIZA 5IFTA 2ARXA 1D7PM 3J7MA 3NJYA 4A44A 2WFF3 5A7PA 3U37A 4CEYA 3NV2A 1SCRA 3IKWA 5J1XA 1HV0A 1NYWA 3DUIA 2CL2A 2VAUA 5JI7A 1RUD3 3MPPG 4IETA 2PAMA 3ZPOA 5J37A 2RMU2 3PJQA 5EZWA 2AENA 1CAUA 1QH6A 1MS3A 2XL7A 3DPRB 1WD3A 2VZSA 2WS91 3ZMOA 1CD3G 4CZSA 2XBO2 4ZXKA 4NAOA 4RHV2 4KWKA 4W65A 4ZY9A 1BVVA 2ETEA 4AOCA 1KJRA 4Q8LA 3WSOA 2VUAA 4JTNA 1L3JA 3C7FA 4LQRA 1OQ1A 4AQ2A 5KHKA 4URTA 4ASKA 1O3SA 2W1SA 3AXDA 2YY1A 5JAXA 4CEWC 1H1IA 3ZN6A 2IVIB 1QIQA 1DQ4A 2GSYA 4DXTA 4YW3A 3OEAA 1ASJ3 3NAPC 4COZA 5DZFA 1QNYA 5HV0A 2DBNA 3LIHA 4K40A 4KU8A 2DBIA 4BK5A 4HT1T 2HWB1 2XVGA 3AKPA 1FPN2 4H7MA 4IV1B 3BU7A 1UXXX 3VBSB 3JD72 4QD2A 2ZPXA 1ZBE3 4CPBA 2H6BA 1JH5A 1YFUA 2GNBA 3CBNA 3OPWA 4GD4A 4KBBA 1ND2C 2EIDA 3D5OA 4W8JA 4F83A 3MZHA 2JDZA 1ULGA 2DCYA 4LULA 4Y22B 4XJWA 2D93A 2BVBA 2TBVA 2YPDA 5FK7A 1CAUB 2RS33 2BYVE 1TE1B 4EN9B 1SCSA 5F39A 2C4XA 5H9PA 1RB8G 5F6KA 3O1UA 5J96B 2OA2A 4LLFA 3LPFA 1C8M3 4LA3A 4XUQA 4LE3A 1NY72 4XJZA 5FXVA 1O4YA 5HCAA 4JTOA 3WCRA 2J42A 4QHZA 5A6QA 5A3MA 2YZ4A 5JOXA 1ENQA 1OF4A 4HANA 1QGLA 1RUE1 4MZUA 1RUE2 3M70A 4XUOA 3AP9A 4MO3M 1QOOA 1US2A 3M8LA 4CTEA 1U5XA 4DQAA 2XLFA 1GKBA 1O5UA 1ZZBA 1ULCA 2GN3A 3PVNA 4CCOA 2YB7A 3I97A 1OVPA 5FYZA 2UWBA 2VGDA 1QOSA 4CDXC 1EPZA 4QGNA 3J7LA 3MBWA 2C26A 2G9ZA 3WDTA 3WXPA 3O12A 4UXAA 3G6JB 1D0HA 4JC1A 4C0HA 2ZHKA 1CGPA 2FDFA 3KV4A 4LOSA 4O61A 5TSWA 1W6OA 5FQ0A 2RM22 3GXUA 2K46A 4LHSA 3I2IA 1W2TA 3B00A 1CESA 2WO7A 2D7FA 1LHWA 1WZXA 2LW8A 2OIIA 4V1PA 3O14A 5CKNA 3VBHA 4DIQA 2BUKA 4YM0A 3W58A 2VNRA 5K0UC 1HRI3 4ITCA 1W3XA 2XKPA 5FZ1A 2VZ1A 2PHDA 3AMMA 5KHHA 5LASA 4YLZA 1W8NA 1HJGA 4GMP3 3J7NA 3N4MA 2HYKA 1YO8A 1K45A 4IE7A 2AZ5A 2WA4A 3DF0A 1RMU3 1AR92 1LGCA 4LTAA 2LROA 3MLLA 3SNMA 4CUAA 2VUJA 1NA1A 2A71A 5GKAC 1V00A 5HBAA 2RS13 3P5BA 4IEQA 1ODMA 3VZLA 5IAXA 3S5QA 3AL5A 2WWJA 4Q4W2 4META 2EXKA 2C5DA 2XKOA 4PF1A 3QACA 3I2KA 4JCKA 3HNYM 3M1HA 1CR7A 2WNVC 4YGBA 2YU1A 4XW3A 2EICA 3BALA 1IPKA 2VZRA 5FZKA 3MFAA 3I2DA 4AXOA 3LEGA 3HVDA 1CZTA 1ZRRA 4BXFA 2BNNA 4DUWA 4GWNA 4N8MA 3POYA 4YZ3A 4Q4X3 2JDYA 5C5UA 2J1UA 4K7JA 2ET1A 1MZ6A 1PK6A 5EYXA 3PTRB 4CE8A 2EIGA 2BVVA 4PBPA 4XXAA 3QD6A 4XE9A 2IC1A 4CPBD 1JN2P 1S2EA 4Q4V3 2DCTA 4E2QA 5BYNA 1DQ1A 5GZDA 1GNYA 2J22A 2VCMA 2OKXA 1PNGA 5C4WC 3LA3A 3ZR5A 4FPHA 1QDOA 1SQ4A 1W8FA 3A4UA 1W6PA 5DAPA 5G04L 3E6BA 2JE9A 1CAXB 4JRLA 4MH0E 1NA1C 2WN2A 5JZGB 2EIBA 2WJSA 3S57A 2GMEA 3TN92 2E51A 1ST8A 1W8TA 3VD9A 1V9U1 1RUG1 3ZYGA 3LFMA 5FYIA 2WFPA 3BN6A 4EV0A 1OF3A 4AYUA 3ZYPA 2E53A 2HWD2 4IEUA 3P3NA 3CJXA 4RR3C 4CP9A 1LEMA 5A6YA 2AREA 3S7EA 4JHTA 1H8TB 2CY6A 4OHXA 3T0DA 4I2OA 4PDWA 1QHDA 4QPIA 1IG3A 1AR61 4XUNA 3RI8A 1Q8VA 2QKDA 3P1IA 5BXXA 2JENA 1A8MA 4LKDA 2DVDA 3OB8A 4XZUG 1WLDA 4IE4A 1QJX3 5FK8A 4BMBA 1J84A 2HJIA 4HN0A 1XPWA 1C3HA 2XUEA 3DPRC 1XYOA 4FPJA 4QXBA 4Z92B 2QQJA 2ZS6B 1UMZA 4CSWA 5CVRA 1CAXA 4A6OA 5FPUA 1BMV1 1HQWA 4Y24A 3GZUC 3SH5A 1W6MB 3DXTA 4HL0A 4S2FA 1KGYA 1Q56A 4A45A 3RYRA 1GQPA 1UZWA 3U1XA 1ZRIA 3ZO0B 2JECA 1Q8SA 1V0AA 4PCRA 4WM8B 5FFOC 1VBD3 4QM9A 1AYN3 1YFXA 4CYDA 3UETA 4E8CA 1YHFA 1HXS1 2EAKA 2FZ1A 4XMIA 5C3OA 1H9PA 4AVTA 3WG3A 3SQOA 3VKMA 1SEFA 4TLFA 4W6XA 2PXJA 2JG9C 4GKYA 5L7OA 3C2UA 4WZFA 4P5YA 3LF7A 1JOBA 1WLCA 2YYOA 4X8PA 3LA7A 5FWJA 4Y4YA 4HONA 1PO11 2E6VA 1VPHA 3AC0A 5DUVA 2ZEYA 1W6QB 1VRBA 2ZMLA 1Q8OA 4PLMA 4CXWA 1IGOA 5KC5A 3C7HA 3NV3A 4XFGA 1SBDA 4LBJA 4S2HA 1GP4A 4HN1A 1FX5A 3OGVA 5JLVA 2RG4A 3MF9A 1VBD1 2A3XA 1K5JA 4HVOA 2Y6LA 4Q0PA 3CDZB 5T50A 4L8QA 5T5LA 2Y6GA 4BZ4A 2BNOA 2JDMA 3OYWA 4B4QA 3NV4A 1KQRA 3FHAA 2P34A 5FY1A 3THPA 2BTVC 3T08A 2YBPA 3ITQA 5CFDC 1WCSA 4GXLA 4XQ4A 2IUWA 4JGZC 4IEWA 4KQ7A 1A34A 2Q8EA 2ZAAA 2ZX4A 5FXWA 2H0BA 4MOAA 5F3CA 1O4TA 5BUVA 2WN3A 1AXKA 2EIEA 3VBFB 3LDRA 4GJZA 3I3MA 4DXSA 2GALA 1GV9A 1YRZA 2NMOA 1WA6X 4XURA 1OA3A 3JQXA 1OLMA 4WVWA 4W6WA 3WDWA 2PQSA 4CDXB 5A7NA 4Y22A 1CWPA 4EZHA 5A7QA 2FDJA 1JYXA 1SLIA 1DGRA 2RV9A 4RS5C 1POV3 4HOOA 3RZHA 2CV6A 4FI9A 4OHWA 2A6ZA 2OXBA 2VW1A 5FZMA 1DG6A 4IDZA 4MHUA 1UXZA 1AYM3 2VZQA 1AR91 4P00B 2BP6A 3ZYHA 4B8EA 4QB6A 5CFCC 2CHHA 2WUHA 3HOBA 2R063 1NLSA 1ULFA 3H42B 3LSEA 4LBLA 4NE9A 4QHBA 4W6YA 2NP0A 3JB4C 1KS5A 1Y43B 3KS7A 3WNXA 4JVAA 5K0UB 4FOQA 3IPVA 1PX3A 5B4XA 4XXPA 5ISLA 3GHMA 3H1WA 4XABA 1PNFA 2JB8A 1QJU1 3K46A 4PI0A 1RUF3 1UO9A 4CCNA 2VNOA 3UYJA 2W1UA 4O7XA 2VMIA 3MPBA 1FATA 1YXWA 5FZAA 5C6CA 4R9CA 4KWJA 1H0BA 2XOMA 1W6NA 1DQ2A 4UI9L 1OVSA 3K4ZA 4LIUA 1HB4A 2WO3A 3NVCA 1OLME 2GP3A 4P9WA 3K3NA 3BTZA 3PUHA 1Y9GA 1WCQA 2D98A 3ON7A 4J6GA 4CP0A 3E6DA 3OTFA 5FWEA 3KQRA 1EV13 3DKWA 3IAPA 2Q5TA 5IVFA 2ZOEB 4YW4A 3GBWA 4YNIA 2D97A 3POSA 4AQSA 1UD1A 1JOJA 1LJ7A 2SBAA 1W9TA 3I3BA 2QQLA 2V5DA 4H3WA 1RUOA 3AMHA 4FT8A 3F95A 5DAQA 4AAXA 1S0JA 1C57A 4IXLA 3AZZA 3W59A 2PA7A 4CCLA 3OG2A 2PAEA 1ND3B 4AVAA 4YW5A 4CXXA 4Q1RA 3E6CC 1SFNA 1TEIA 2IXIA 4QDSA 1I1EA 2Y0OA 1AF9A 4PF5A 3RFRA 3WNMA 4A6SA 2DFBA 1DBNA 3UV9A 1Q8QA 4BQ2A 1MZEA 1PHMA 1SBFA 4K8FA 1UZYA 1VAMA 1XXNA 1OURA 5C9AB 4RSUA 3WG2A 1B35B 1CVNA 4L2NA 2D6LX 1SDWA 1NA1B 5B4NA 4COYA 1RUH3 3M3QA 3N9MA 5FREA 3RWNA 4RYDA 3Q8FA 4LO6B 3X29B 2JXAA 4PIYA 3V64A 3J8F2 5IVVA 5BNOC 3IBMA 4FP3A 3RZZA 1SLAA 3ZDSA 3PUIA 5EHDA 4RQPB 5BNPB 3B01A 1SHWB 1Z7S1 2Y38A 1UZVA 2Y26A 1WW4A 4GWMA 1RJ7A 2GNMA 1XB9A 5JIAA 5CG9A 5FYHA 1GWKA 1WMEA 1C1FA 3TEWA 4KU7A 2YFUA 1HN0A 4DZGA 2ZGKA 3CEWA 4OI0A 2HWB2 4IEYA 5C8WA 1OC1A 2QCSB 1V70A 2QQKA 3FC0A 4NUBA 1XSQA 5L9RA 1AL0G 4LKEA 4LKSA 2RDNA 2D5HA 4P14A 2WNVB 3MF6A 1GMMA 4ZHNA 3WOGA 4GQ7A 4A3ZA 5LA2A 5EJ1B 1QWRA 3D3AA 3WF1A 4KWLA 1JZ3A 2MNGA 4EJRA 1S2BA 1Y9QA 2QNKA 3GBGA 2BQPA 2ZZJA 3HBZA 3JU9A 4JGYC 4QX1A 4RA0A 5GLVA 2Z5WA 4OUSA 5EFUA 3WG1A 4A2UA 1MACA 5SV5A 4BISA 2DU0A 3AKQA 4QX0A 3UKVA 5JDBA 4QX8A 2UY9A 4LHKA 4XFFA 3ST7A 1K5MA 5H9SA 4YSFA 1I3HA 2AEYA 3WUCA 2QQWA 2ARBA 4AEDB 2UYBA 1CONA 2HBUA 1CPMA 2PTMA 4IV3A 5HXMA 4BQXA 4I0WB 1AR93 2G4IA 4H2AA 5CBLA 1HN1A 1AX1A 3BI3A 2UY8A 4UFIA 2B9VA 5GLWA 3ILFA 4DB5A 1LRHA 3O1TA 2F4PA 2PHRA 4XACA 4LT5A 1RUD2 2BRTA 2HWB3 5CIRA 5C4WA 3FWEA 2XJQA 1H2KA 1S0CA 1ZBA3 1LB2A 3THTA 4NRQA 3EB7A 2P4EA 2Q8OA 1ZA4A 2W87A 2WAOA 3ACGA 3N9NA 4GMP0 4QAWA 1OKOA 4UW3A 4XOGA 1LKNA 2P3IA 2HWC3 2Q1MA 4CDQB 3D0SA 4UW6A 4EZ4A 4IE6A 2OUHA 4M00A 4FFGA 4NWWA 3LIGA 4QPGB 4NHLA 3W5NA 4UAPA 4LORA 1FT9A 3TNPB 5BNNA 1URXA 1ND2A 5LEKA 1QQP1 2GC3A 1W03A 4KMQA 3WF0A 1YQ6A 2W2IA 3M3EA 4JGZB 4QU2A 1K5MB 1RUI3 1FYUA 2C24A 1UMIA 4JQTA 3H3ZA 4MLOA 4CUCA 4TXWA 4D3WA 3VBFC 1QJY2 5FCCA 5FY7A 5A7OA 3I49A 5DAWA 1KDKA 4YFWA 1UZZA 3INAA 3HN3A 2WFF2 1UY3A 3HR9A 1UNBA 2YXSA 5L9VA 1RUH2 3ZIXA 1W8HA 4E2SA 3A23A 2ES3A 2J1RA 4NHMA 1FV2A 2IFRA 4DXZA 5M0TA 2FDHA 2VQAA 3PDQA 1QJU2 4HPKB 2I74A 1ZREA 3NSTA 4LLOA 2ZKLA 3KT7A 1IQDC 4XILA 2TEPA 4AI9A 3VD7A 4BQ3A 3BIEA 1JYTA 4Q0UA 4XHBA 3APBA 4M0NA 3SXWA 3ZFFB 2DVFA 2WSVA 2QZ3A 3D82A 1LODA 3H0OA 2NM1A 4LPLA 3CKHA 3WR0A 5ABJA 2J7MA 3LOIA 1BXHA 3POWA 2CAVA 1WA4A 1NCQA 4L11A 5FLIA 5A6XA 1DQ5A 1IPSA 1D4M2 2ZACA 2A3YA 2VZOA 5FBZA 3RJ2X 3WNOA 3FBMA 5F32A 2DYCA 3H3UA 1PM4A 1BKZA 2WSUA 4LITA 2QDRA 4XJ8A 4Q1PA 3URFA 1H9WA 2YROA 1ZNPA 2ZGLA 2WZR1 2OUJA 2LTNA 4BWOA 5J36A 3IN9A 1U5ZA 2VTXA 3HQXA 2VG9A 4N7UA 1R1ZA 4XIKA 5DPNA 5FYCA 1VBC1 1NE6A 1W6NB 1NLQA 2VH9A 1ZZ8A 1QNWA 5KXEA 4B1MA 2D6PA 2VBBA 5DABA 2GH8A 4XAEA 5E89A 3VBHC 4CP1A 1F8VA 2W95A 4K8RB 2X05A 1PM7A 4Q4W1 4QB2A 1GNZA 1MPXA 1GZTA 1FPN3 2WNEA 4SBVA 5ACA3 1AXYA 4IEPA 2WLQA 4GB32 1DFQA 4Q4Y2 1V9U2 4O65A 2CWSA 5C7GA 1MVQA 3ACIA 4HETA 3ZPYA 2W3JA 4L0PA 3V65A 4C8DA 2Y6KA 3Q8AA 4XUPA 5I91A 3NQHA 5A7WB 1G9CA 3WDUA 1QQP3 3KHBA 3U10A 1O8PA 2C9AA 1RUJ1 1RUG3 2WO2A 1EV11 1RUJ2 3MEPA 2Z42A 2W39A 4IL7A 4LK6A 1N1VA 4LBOA 5CG8A 3BKZA 2GZWA 4BH9A 4XFHA 5FY8A 3V0BA 5KHJA 2WWUA 1NT0A 1TNRA 5C9AC 1EYBA 1YQCA 1LNSA 1DU3D 1C8NA 3C7GA 3ZVXA 2Z4FA 5GJ6A 2JIGA 1IKQA 1GP5A 5FDBA 2A6VA 3MIBA 3WDYA 2BU9A 1YQ5A 4PJYA 4FTBA 4XBQA 5FJKA 1RUG2 1VB2A 1UYPA 4D8MA 2AH2A 3WW1A 1ZA7A 1MEC1 4U36A 2HWD1 1Q8PA 4LUMA 1OFSA 1VLNA 1AYN2 1J3RA 4AFAA 4WM8A 4ZONA 3ZM8A 4FOWA 4ZPIA 3UJQA 2RM23 4B1LA 1VMJA 3KV9A 3PHMA 1W6MA 1GWMA 2PQQA 2PAKA 4I3GA 4MSVA 1UX7A 3AMPA 4XF3A 4L92A 3H8XA 4FTEA 2B39A 2GAUA 1BJQA 4RHV3 3HIFA 3WEZA 4AGRA 1XE0A 4NOTA 1S0IA 4D7YA 1E5SA 5A3NA 4FXGB 4I30A 3TOJA 1OXCA 3N3HA 2W9XA 2HWD3 3VKOA 2JKBA 1MEC3 1XU1A 5FY4A 1MR5A 2ARAA 3AKSA 1PO12 1W9FA 3LD8A 3S7IA 3BB6A 3SMHA 1LOFC 2ADEA 3KGLA 2A70A 2BDRA 3ETPA 1HIXA 2P3KA 4QX3A 1CN1A 3JD71 1A78A 1WD4A 3W9AA 2XJPA 2J1EA 2BFUS 3VD4A 1DQ6A 5KHIA 4OLLA 3JBG3 3MIFA 1KS4A 1ND3C 2VXJA 2ZHMA 1IS6A 1ZRFA 3L2YA 2A73B 3WLUA 2JDNA 4ZZ8A 4ZU5A 2X09A 4LO5B 1OA2A 1AL23 5CYYA 3FFZA 4FP2A 4COWA 3AP6A 4PBOA 3K51A 3F2ZA 3R4UA 2R041 2ZKNA 4LHNA 4YGEA 5CFDA 2RVAA 3ZXEA 3LOBA 1XNTA 4E8DA 1UKGA 1BVP1 2ZHNA 2A75A 1DQ0A 3KT4A 4CUGA 4DMIA 4YZ1A 3OBAA 2HWE3 5JUVA 5LRSA 2R0HA 3BUCA 2QQPA 3OY8B 3FHQA 1PO13 5F5CA 5T3NA 5K8SA 4YZ4A 3KZ4C 4CRQA 4CCDA 2F6BA 3WG4A 1QJY1 4YYOA 3PLQA 5CKQA 1MS1A 2PLV2 4Q0VA 3VBRC 1IS4A 4CCKA 3SH3A 4C0BA 4YPJA 3K2OA 2KA3A 4QPGC 4UFMA 3O0WA 3MUY1 1R1A3 3VDCA 3ACHA 4E2GA 3OJBA 1H8TA 3BU0A 2ZHLA 1W2AX 1X33A 2VZ3A 1H30A 1QXPA 1K5MC 3VHRA 1O8SA 3LFIA 1WWYA 1XYNA 2EXHA 4K21A 4Q4W3 2QJVA 3VUOA 1DDLA 1N1SA 1SACA 2FMDA 3KCYA 4XJUA 1WGPA 4LUKA 5LATA 5CFCA 1PGL1 4C90A 1X7NA 4O9EA 2X8KA 3T1MA 1ZBA2 2LUWA 5KWRA 1F5FA 1NE4A 2JDHA 2BZDA 4EWAA 5EXOA 2GN7A 1EAH1 1MQTA 3VKLA 4QGLA 5C4WB 3N7LA 2GC2A 2YC4A 2XPJA 4OI2A 3WD5A 1CZVA 1G6NA 2W08A 2WIIB 3NAPA 4B29A 3MV11 2PHUA 3MHZA 1KEXA 1RL3A 1QJX1 1ULDA 2RJKA 5ERLA 2DTWA 2XJTA 3PURA 2Q8CA 2ZZQA 1NCRC 3ZXDA 4AEDC 1JI6A 3M4FA 4ASMB 4DEQA 4AZZA 1LESA 1PIV1 5L7OC 5GZCA 3I3QA 5JXGA 1N47A 4X6RB 2YC0A 4BIFA 2IXJA 2PN5A 3C8XA 3VBOC 2LRPA 4K1ZA 2YFZA 3E1F1 1OOPA 1DZTA 4Y20B 5IT6A 2B8MA 2DVBA 1AZDA 1YFYA 2FCUA 3CMGA 5FZDA 5LA0A 4OQ9A 5KXCA 1RHI2 4KNCA 1RHI1 2V5YA 2HKXA 5JOZA 1LECA 3KV6A 4GB31 4RS5A 2JIJA 1FXZA 2WDBA 4BXSV 2DUQA 3GJAA 3BGAA 1C5HA 3HMYA 1CIYA 2QTWB 4IE5A 5FLHA 2J1AA 3A0KA 4XF4A 1US3A 2ENRA 5G05L 2D6MA 4BM8A 2XJVA 3EBRA 1EP0A 1PMJX 2WKKA 4RN5A 2MEV2 3AX4A 2YUEA 4FQ4A 1W9WA 3CU7A 1SG3A 2CNAA 5IYYA 1RUI1 2ORXA 5IVYA 3RRDA 3H1MA 3SKVA 5KBFA 5FJHA 4JZRA 5JOYA 5FYTA 4QQPA 2QVSB 1UIKA 5LCWL 3TEZA 5AFBA 2XUMA 4IGPA 1LOGA 2ZEWA 3A21A 4U2AA 4D69A 3ZMNA 4AEMA 4DNYA 2TUNA 3TEYA 4YG6A 1UZ0A 5DG1A 3Q8EA 3K48A 2ZGTA 3O5SA 1Z7S2 4WM8C 3WDVA 4Q8KA 1LAJA 2YHJA 3VDDC 4M3CA 4EN7B 3K3OA 3LGRA 3PUAA 4G3YC 5J3UA 1YFWA 1AVBA 5DDJ1 1NLRA 1PGSA 3OBZA 5FUPA 2E7QA 2UURA 2H0VA 5FMDA 1YWKA 1H8VA 1BQPA 1DZRA 1VP6A 3R4DB 4BLJA 1SPPA 5FYYA 2EAAA 2JWPA 2JDKA 3IMMA 3DYOA 5F7UA 2OX0A 2B46X 3BTXA 1P8JA 4HK9A 3VLBB 2XBO1 2XB6C 2HWF1 4MXWA 4YW1A 4WV8A 3RWKX 3WT3A 2E7AA 4ATFA 4QHOA 3N9OA 5IAVA 2CWMA 2WRAA 1QKQA 3CNAA 5T52A 3NKGA 1CX4A 3TNQA 5FP7A 4KG0A 1XRUA 2EVXA 5F3EA 3FN9A 3SCFA 1W0NA 3KV5A 2WLPA 1J83A 3I54A 1IPJA 4LEJA 2JG8C 2P2KA 3EYPA 3U78A 1JYWA 1O91A 1R092 2DCJA 2W0XA 5FZGA 5CB7A 1RTVA 3VKFC 2WQ4A 1OFNA 2WBKA 3AVSA 3HN1A 4R4XA 5GLUA 2N7GA 4RGGA 3RPQA 3VHPA 4BHPA 1UMHA 1MS4A 1Z7S3 2GC0A 2E31A 3MFCA 1PZ8A 3VD3A 4F7ZA 2FDGA 3UGGA 2VOKA 3PU3A 3THDA 1PVC2 1AR72 3GZAA 1AR71 4GWIA 4QKFA 1HXS2 4IV3C 4OI1A 2BWAA 3U14A 1I5PA 1AHSA 1REEA 3BYWA 5E1RA 1G8WA 3MLKA 5FO8B 1FV3A 5T5JA 3NL1A 3ZXKA 4ET7A 3SC7X 2UWAA 2AC1A 2HLEA 5H9QA 2VOWA 3OUIA 3DKQA 4R8HA 3OUHA 5CA6A 3ILNA 2PHFA 2BV4A 1H2MA 4HKWA 1IOAA 1OLQA 4S2DA 3OGJA 4ZS2A 4ARXA 1ZBE2 4AQ6A 3ZOIA 4AI2A 4JQRA 2AGSA 3NNGA 4QXHA 5FPAA 1FOD2 2HWC2 4OHVA 3KWVA 3P6BA 1ZYBA 4YW7A 3M3OA 2FCVA 3W5MA 5C8CC 3EMRA 2CAUA 1VMFA 2VR4A 5DMYA 4BE3A 4CDUA 4UWDA 1NOVA 3J9SA 1OT5A 3HPNA 3USSA 1UY2A 4R9AA 1GBGA 5IW0A 5IFPA 3RJRA 3WP3A 1WCKA 1GOHA 4GH4B 4Y1XA 3HAGA 3KM5A 3N35A 1S55A 2CSGA 4HKOA 4RR3A 5HPOA 1J3QA 2RS32 1OMIA 1Y4WA 5FIXA 1JS9A 1HRV3 2VNGA 2WNUC 3AYCA 3K4DA 4Y1UA 5A80A 2A5ZA 2XBO3 4IGOA 3LDBA 3RNSA 2OPKA 1X9PA 3OGSA 1JZ7A 1SDDB 3TRSB 3EJKA 1Q5OA 4M3CE 4P9GA 3H9AA 5FMBA 1O3QA 4N43C 4OVEA 1TME2 2XWJB 3WQ1A 1GQGA 1XC6A 1E5IA 3N9QA 3MGUA 1COV2 5ABJB 3FZ3A 3HNBM 1YCIA 1JMUB 1T6BX 1LR5A 5F3GA 4YVSA 5JPNB 3GHNA 4X8NA 3H8UA 5FZ7A 3GBFA 1KJLA 2XR4A 4HXCA 2BGCA 1CIWA 1VBB2 2HH9A 2R6QA 1VBB1 3AFGA 5FQ0B 1AXZA 1JZ6A 2JE8A 5AC93 4HSJA 3SISA 3RS6A 4IESA 5C3QA 4OCTA 3ZYFA 5HCFA 4YVWB 1Q43A 1HRV1 3T4VA 1KITA 1W9YA 1VBA2 1GNHA 2ZA9A 2X5IA 3FHIB 2DUOA 3I2OA 3BCWA 1AYM1 4LA2A 1AYM2 3CIHA 5A7WA 3IT8A 2WS93 1DGWA 2RHPA 3ROUA 1C1LA 2ZGPA 1RYYA 3FUQA 4UFJA 2Y6HA 1F9KA 4BOWA 2QFEA 1LOBA 2V4AA 3AP7A 1JZ8A 3IDBB 3ZSKA 3RDIA 4XF9A 3J26N 1JYNA 3NMBA 1YIPA 4MGKE 1FNZA 3PVEA 1L7QA 4GKXA 4AL9A 5JWPA 3WNLA 4N43A 3H7JA 1RUF2 2Y8KA 3RZMA 3GCXA 2PFWA 4ATEA 4OUEA 1PX4A 4CP2A 2YGMA 3CL1A 2XQRA 4V2VA 3BVCA 5BNOB 3AFKA 3O0XA 4LBKA 1A8DA 5DUUA 3OF1A 3PVOA 3RI9A 2ZGOA 4AEKA 1ACCA 1VAKA 4E4HA 4Y3OA 3I59B 4WVZA 5ANNA 4MG2A 4I3PA 2JE7A 2X29A 1CX1A 4XYXA 2ZGUA 5FP4A 2BBAA 3L9JT 3V0BB 2R062 2WR9A 2WT1A 3WVJA 3JB8A 4AK3A 3RZGA 4XCAA 1EV12 3VBSC 3WZ1A 1W8UA 3K77A 3MUZ1 1EUUA 3BTAA 4AFMA 3U0ZA 3AJYA 4Y1ZA 3BPZA 3VBOA 4BA6A 2VQUA 1ONAA 2QDNA 1HQLA 3ZSLA 1MQTC 5DUWA 1AR81 1W90A 4IE0A 2RR11 1AR82 4QPIC 3TN91 1REDA 1VBE1 3CO2A 4NMIA 1VBE2 4AEDA 1ULOA 4Q4Y1 3KQ4B 2K0GA 1RUC2 4JAAA 4XDOA 3SKJE 5DN2A 3TWIA 1FMD3 4EN6B 4BQ4A 3FL7A 2PELA 1V6MA 4D7TA 1JYCA 1ZZ9A 5DXDA 3I8TA 1PO23 4QPGA 3OPZA 1U0AA 1WLTA 2W47A 5F2WA 3MI8A 2A3WA 1DIWA 4XF1A 5EJ3A 1ENRA 2YMZA 4F8AA 4LK7A 5FR3A 1AR62 2BJSA 4FXKB 4XAAA 2WZPP 2ZJCA 4P9YA 5CNAA 2VZTA 2BERA 2Q30A 1MVEA 4JKKA 4Z8BA 1JTZX 1S0DA 1JODA 1O5LA 1R081 1S2KA 5D1IA 1JZ4A 1GLHA 5KR7A 1ZRDA 4HSLA 1UU5A 5DDJ3 4KI5M 3AB0A 1OD5A 1NCRB 2QQVA 2RMU3 3K75B 3GNEA 1W04A 3HNMA 3EQEA 1W3VA 4IUGA 3TEXA 3N7MA 4W4ZA 4LBMA 1OA4A
chains in the Genus database with same CATH topology
3L2HA 1COV3 4QXKA 1AR83 2I07B 4NPRA 1AYN1 5LK7B 1N1TA 2O1QA 2ZMNA 4Y1YA 2JICA 3MICA 1GR3A 4MV2A 5L36A 4DFSA 5JSOA 1CQ9A 1ZM1A 2GNDA 2OZ6A 4GA9A 3NW4A 4UBHA 1XNKA 1SFYA 2IFWA 2A6WA 4XBNA 4K1YA 4I09A 3ZN5A 3ZSEA 1IS5A 1SBEA 2D5FA 2ERFA 5D8AB 5JMCA 4XFAA 2P17A 4EROA 3S6PA 2BEOA 3AJZA 4TSVA 2HWC1 4OI4A 2IWGB 2R072 4E4DX 3JD73 1V9U3 1GSLA 1ULEA 4QQHA 1Y3TA 1N3QA 4HK8A 5GZGA 3OBTA 3TYJA 1RJ8A 4AFBA 5F5QA 3ASIA 3ALQA 4LBQD 5AVPA 4Y5Z0 1V6IA 3FX3A 4XBLA 1SLTA 2WFF1 5BNQA 2ZMKA 2D40A 2HEVF 1YI7A 1B35A 1NQDA 4H55A 1MS5A 4CDUB 2YDEA 2AR6A 3RQ0A 1TME1 5I0RA 1G9BA 5ACA2 2VPVA 4R4ZA 4ZU4A 2ZTNA 2RM21 4AHXA 3EHKA 4OZXA 3V0AA 4PLNA 1A6CA 1QQP2 3WW2A 4EWEA 2KM2A 3UJOA 5I8YA 3ECQA 1NXD1 4QGMA 4QQ2A 4KH9A 4XDQA 3BOPA 3JBG2 2ZX0A 4HKLA 3WP5A 4MGYE 1PMIA 3VBHB 1O7FA 1QF3A 4Q4X1 5CU1A 1PVXA 1VALA 1PGW2 2VW0A 4RR3B 4FPFA 3T2TA 4Q4V2 2IXHA 4FO9A 5IK4A 3KCCA 3ELNA 3HWJA 5GZEA 4FAGA 4BPZA 2JG9A 1HRI1 5A32B 5BPXA 1HRI2 4IEOA 4PQ9A 3AZVA 4YVWC 1J3PA 4B7KA 3FLTA 3OYWB 2BBVA 1RVF1 1OQEA 3VZKA 2BPA2 2JX9A 3AXEA 3IM0A 5GZFA 3B5LB 4UBGA 3WP4A 2HEYF 1GZWA 1UW8A 5F9TA 1AL21 1QJY3 3KSCA 2RS12 1QH7A 4BYYA 3IDEA 4F3JA 4FPCA 1VBC3 1YJLA 1NZCA 3E5XA 3LA2A 3LCPA 3WINE 5C8CB 2FBEA 4MX3A 4N90A 2XG3A 5I0TA 3V0AB 1BEV1 3KT1A 4YVSC 2PHWA 4SLIA 3FMGA 1ZZ7A 3D0JA 3KCXA 4XTMA 4Y26A 4EWDA 5L73A 2XLAA 2BNMA 1PO21 5GLZA 1OPOA 4N43B 4PLOA 5JSPA 5K0UA 2CGNA 4RHV1 1FMD1 2MEV1 5ABJC 3B94A 1FMD2 4WVVA 2AYHA 1AJOA 1NG0A 4QPIB 1Z0HA 1X36A 1LOAA 4OUMA 4AVBA 4HPKA 2HWF3 2HWF2 1RGSA 3UK9A 2WT0A 1ALYA 4FPOB 2GNTA 3ZFFA 3LSDA 3N7KA 3I4IA 1JUHA 1SLCA 1CPNA 5CFDB 3BIWE 2GMMA 4M01A 4LO4B 3AMQA 3H7YA 3MW3A 4XZPA 3SLIA 1DHKB 1BMV2 2JJ6A 3AZXA 3I59A 3MW2A 4RL7A 4YGCA 4BIOA 3DGTA 2LM3A 2JG8A 4L99A 4BLIA 1CAVB 1OI6A 2Q0AA 4JRAA 1BYHA 4AFDA 4FTSA 1N3PA 2GC1A 1TMF3 2XVLA 1LEDA 4NN0A 3LB9A 4AI1A 2D6OX 2PHTA 4M3CF 1ASJ1 3RSJA 4S2GA 4XFIA 2R071 1WBFA 2PHLA 3U07A 3H1YA 3MLJA 3VBRB 3HD8B 5HXVA 1U12A 5CFCB 2RS53 4AVVA 1TMF1 2RS52 3I7DA 5D8AA 3WHTA 1W6QA 1VBD2 4XIOA 3DN7A 5FMOL 2ATFA 5I8TA 4BMEA 2D6KA 5D8AC 1XQNA 4L9BA 4Z82A 5A33B 5KC6A 2EXIA 3FLPA 1MS8A 3AZYA 4FPGA 1QXJA 3J4UH 1DGRN 4MYEA 3WX5A 5I93A 4LBQA 3GYDA 5I8SA 3TBDA 3AYAA 5T5OA 5ACA1 1PK6B 1G7YA 3LWCA 3LAGA 1DZQA 2R042 3RMXA 3VDDA 1IZ3A 3R0RA 1KDMA 4JGYA 3A0NA 2XJUA 1RITA 3MW4A 5DZEA 4CDXA 4OHYA 2PYTA 4FPEA 4XQWA 1CJPA 1APNA 1YYNA 3IDCB 4FAHA 1PZ9A 1JBCA 5KXBA 2OYZA 1LTEA 2D43A 2MEV3 1HXS3 3MIDA 3MIEA 4Q4X2 4I0BA 3VHOA 3QH7A 3ETQA 1DYPA 1C28A 1PGW1 2DURA 3UL2A 2QE3A 3AKRA 3FE5A 1QXRA 4Q29A 3TB0A 2B5HA 4E4ZA 2R30A 1D2SA 2O8QA 1RUH1 1JXNA 2R32A 4XF0A 3AYEA 5DZGA 2B9UA 4AHYA 1OOPC 4DY5A 1V6KA 2XGXA 3ZFGB 3EXUA 1YNAA 4WZCA 1F2NA 2HWE1 1O3RA 2EXJA 2HWE2 3M7AA 4BQ1A 2MHFA 4Q2FA 4JDNA 4COVA 3ILRA 4RQPC 5BNPC 5AVAA 5IK5A 3BODA 1W6PB 1X8MA 3WCSA 5DUXA 1TQ5A 3ZX7A 1PIV2 1W39A 1EY2A 3R6SA 2Q4SA 2VVFA 3M3IA 1HW5A 4A3XA 4YRDA 4NR1A 4QMAA 3VDDB 2VW2A 4ES9A 1D2QA 2ET7A 2WWSA 3C3VA 1QOTA 1YJKA 5J98B 5CAZA 4GALA 4XMAA 1I9RA 4IEXA 3J8F3 4KG8A 3SHRA 2ZAHA 4AQTA 1VBB3 1J58A 4Q26A 3DL3A 3NV1A 3KLSA 2RR12 4P9IA 5J09A 1KXGA 4CDUC 1PO22 3FUOA 2GH2A 3VL9A 1KRIA 1V6OA 4CDWC 1RUF1 2GMPA 1LCLA 4FCAA 4YG3A 1GZCA 1I5ZA 1S0FA 2DTYA 1H1MA 3AP4A 3PMSA 3S30A 3UKTA 1GZ9A 5L19A 2WNUA 2WS92 4WM7C 1MZFA 1XNCA 3WDXA 5C33A 4XETA 4FVVA 2MPFA 4Z2WA 2PHXA 2R061 2VOVA 3LKJA 3J8F1 3ZYRA 3N36A 1PZ7A 4K3UA 1MS0A 3VGIA 1NCQB 1TNFA 4MGZE 4AHWA 1NQJA 3HT1A 4MVTA 5K7PA 2G9GA 2KXLA 2XJSA 3ZFEA 2SLIA 3Q9OA 4HVQA 4QPYA 1FAYA 5DDJ2 3KB5A 3B3QE 4Y1VA 1RUC1 1NCRA 2NPIA 3RMYA 2X5IC 4KL1A 1WCDJ 2FMYA 2ZX1A 3VN4A 2VOXA 4TZDA 2D6NA 1PVC3 5KHGA 1U5IA 5IK7A 4A7YA 4GH4A 4LO8A 4X6QB 4J1WA 1XU2A 3QBQA 4AI3A 1RUJ3 2WINB 4OHZA 3FFQA 4KGGA 4DY3A 2WNVA 5T5PA 3M2MA 1C5IA 1WMFA 5HI0A 2VY0A 1AR73 4YGDA 1B35C 2H6CA 1REFA 1UN1A 2TNFA 1CAWB 1BBT1 4CEYB 1GICA 4TYSA 1G9AA 4ONUA 5JPMB 2GU9A 3AMNA 1FPN1 4RFT0 2CTVA 3LZZA 1YI9A 4CEWB 2UWCA 2V73A 2DVAA 4K9SA 4IV1A 2RS31 4B4RA 1A3KA 2XLGA 5JSRA 4QT6A 3VBUA 3KD4A 1C4RA 3ATGA 1S0GA 4XJAA 1J1TA 2W52A 1ND2B 1H2LA 1C8M2 4N53B 3OD0A 1C8M1 3JUUA 1LU2A 2D44A 4A7ZA 1M06G 5JCTA 2FHRA 1CAVA 2ZGNA 2GDFA 1KFXL 1Q3EA 1XNDA 3R05A 1HDKA 2VXRA 4COUA 2I2SA 1FI2A 4JGYB 1J59A 2WT2A 1DYKA 4MXWB 3JCIA 3ES4A 3E97A 2DCKA 3VZOA 3ZXFA 4AE2A 1VBA3 3SCHA 2VVDA 2BFUL 1VBE3 2W68A 4P9XA 4FPYA 1ENXA 4H14A 5DG2A 4LBQB 1RC6A 2VMHA 3D6EA 1POV0 1VAVA 1BBT3 5I0SA 3AM2A 4AFCA 2R073 4ISRA 5H9RA 2B7YA 3PMEA 5BY5A 2DV9A 4DRRA 1RUC3 1X8EA 3QLQA 2VU9A 5E8AA 4E4SA 5B2GB 4FPLA 4FOYA 1LOCA 3WY6A 4ASLA 1PGL2 5FO9B 1UPIA 3IMNA 1F5JA 1OKQA 1S1AA 3VZJA 3JBG1 4MUVA 3WQ7A 4GB33 4ZKTB 1JUIA 3B7MA 3OBRA 5SV8A 1POV1 1VRH1 1YUDA 5FMOS 4XFCA 3VBUB 4R52A 1MQTB 2DUPA 2ILMA 5FTTC 4NHKA 4AGVA 3ZSJA 2R1DA 1MS9A 4EN0A 1PIV3 4RGAA 3WHUA 4Q4V1 3AZWA 2VECA 4JDOA 1YLLA 4DRVA 3UKNA 5T55A 1S0EA 3O7OA 4UW5A 2QZ2A 2R49A 3ZSMA 4E27A 1VB4A 3ZXJA 1XNBA 2Z69A 4IEZA 2IXCA 2ZBJA 5CADA 1PK6C 2DU1A 2XHKA 2RMU1 5FOBB 3ZYIB 2IXLA 5AC91 5AC92 5JOWA 4N9IA 5FPXA 1DGWX 1KD7A 1R083 3OD4A 3KMHA 2E9QA 4RQPA 1IHMA 2RS11 5BNPA 3BOWA 4R9DA 2ZCWA 1BZWA 5GM0A 2UU8A 3ACLA 4DINB 1RMU1 1IQAA 3ZFGA 1RMU2 4CDWB 2FZ2A 1WUVA 1BEV2 5EV7A 1BEV3 4GMP1 4B4PA 2K9ZA 1H1AA 1WW6A 2DF7A 4C1XA 1X82A 1F31A 5FPZA 4WM7B 3WQ0A 2ZX3A 5K9YA 3R4SA 4AW7A 1G9FA 1MEC2 3VBRA 2VVEA 4XHXA 4AHZA 1D4M3 1UPSA 2R043 1UAIA 1OOPB 4Y20A 4MXVA 2ZGMA 4K20A 4AI0A 5A33A 3QOPA 1ZX5A 3USUA 2YPJA 3N7JA 3MIGA 4PDWB 2OVUA 1R082 1AR63 4FPKA 3IWZA 3T1LA 1ASJ2 1M4WA 2X5IB 1LU1A 1NY71 2C1FA 5BNNC 1BBT2 4WVMA 4LNVA 2DWRA 2E7TA 2B42B 3DPRA 3NO8A 1W0PA 4KGQA 2D3SA 3FJSA 3PJYA 3O0VA 4ISQA 2Z2SB 2JEMA 3VBSA 2EF6A 5FO7B 4B3NA 5EWSA 1HV1A 4G4FA 3HT2A 1IS3A 4I02A 3M3CA 3ZFEC 1GZWB 2IXKA 3CJIC 5FRAA 4M3CB 3JQWA 1NXMA 1XE8A 2ZGQA 3USUB 3KGZA 5IK8A 4GIQA 4YM1A 3D8CA 1ZBE1 4HFSA 5L7OB 5A32A 4LBNA 2IZWA 2RS51 1JHNA 3U4XA 2NQYA 1QY4A 1U5YA 2VQ0A 1DLLA 2ZGSA 5F6LB 2Y0IA 1G9DA 4LO7A 4YG0A 1QJU3 4TWTA 3OGGA 1IKPA 3TAYA 3WW4A 2PLV1 4P9LA 2Z79A 4DOUA 4ES8A 4N53C 4OULA 3IIAA 3NKTA 4N7IA 5T54A 4AEJA 1E57A 4YW2A 5BV6A 2YGLA 4L97A 4YM2A 5J48A 3GF6A 4NO4A 4DS0A 1GFF2 3EO6A 1ZRCA 1S0BA 4WVMB 2YV8A 1RIRA 4AWDA 3ZXGA 1GANA 3V56A 4YM3A 4PIXA 2XVKA 5FOJB 1ZBA1 1WMDA 5LEJA 1RVF2 3RYKA 2DVGA 2CYFA 2D3PA 2DCZA 1UU4A 4I01A 3B69A 5GALA 3B93A 4AF9A 1EAH2 2Q1ZB 4JDMA 3D4KA 1VRH3 1VRH2 1B09A 3QH6A 5C8CA 1SLBA 4Q27A 4XEZA 2VMGA 4YVSB 1UIJA 3WP6A 1QJX2 4CEYC 1HKDA 4DPNA 2NZ9A 4WBBA 1VBC2 3NAPB 1VBA1 4N53A 2O0OA 3ES1A 2WL1A 3B02A 1LHUA 2LALA 3FBYA 1D0GA 4RS5B 2I45A 2JD4A 4LR4A 3MYXA 1OSGA 4A7KA 3E5QA 1I6XA 2A6YA 4K6BA 1QU0A 3ZN4A 4C1WA 2WC2A 1H4GA 2NYYA 3VKNA 4D7SA 4O9GA 2A7AA 4BCUA 3MDPA 1XE7A 4B7EA 2JG8B 2XWBB 1EAH3 4Q0SA 1HQNA 1ENSA 1LGBA 4HMZA 1LHOA 5FAXA 4YZ5A 2R16A 4Z1VA 4HVRA 4QQOA 4AVCA 4IEVA 3SH4A 1OPMA 2V09A 2DFCA 1DGLA 1HX6A 2CGPA 3PVBB 1V6JA 4XTPA 4D94A 1ZVFA 5E16A 4AGGA 3CF6E 1R1A1 4J1XA 1R1A2 1N1YA 1RVF3 1ZZCA 4ORFA 3RYPA 1W2UA 5AFEA 2E63A 2B45X 2P3JA 4H7LA 4Z07A 3VBOB 2R1BA 1WBLA 3SCGA 3G7DA 3OY8A 1AJKA 3U11A 4YARA 4FSJA 2G9FA 2ZX2A 4IV1C 1Y7BA 5HCBA 4N9HA 2WQZC 1AX0A 1OHFA 4GH4C 4CDWA 3VBUC 1WLWA 4P9JA 1W0OA 3DV8A 1TMF2 3B9IA 1T6GC 1R091 1AX2A 3NWKA 2BW8A 1LHNA 2D3RA 1CJDA 4NVPA 4CEWA 4PDWC 1EPWA 2RE9A 5C9AA 5F1RA 1D4VB 1UCXA 4M0HA 1WW5A 1FOD3 1FNYA 5GLTA 3WW3A 1LGNA 1RHI3 5EYYA 1PVC1 2ZABA 3VHNA 2PLV3 3GZTB 1G86A 1RUD1 5FLJA 1LOEA 4HZFA 3QCWA 4HLTA 4QM8A 1JW6A 2EA7A 4QX5A 3ZXAC 3PTYA 1UF2C 1V6LA 3CLPA 2NLRA 1RINA 3AKTA 3JZVA 2HEWF 3FLRA 3AYDA 1FOD1 4AVSA 1J1LA 3B9CA 4UW4A 4QQLA 3AK0A 2R0FA 1DF0A 4XPVA 5E88A 1BK1A 3RG0A 5I0UA 3H50A 4ZU7A 1LOFA 2EALA 1QJZA 1W6OB 1O4ZA 4G9SB 3VZMA 3ZFGC 4XQDA 2O8OA 5JR7B 4MGIE 5JIUA 2CGOA 3VZNA 4P5HA 3PNAA 2FQPA 1LHVA 1ZZ6A 5JI9A 1H8TC 1BCXA 1H4HA 5LK5A 3AP5A 5J7MA