1N3QA

Pterocarpus angolensis lectin complexed with turanose
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
241
structure length
241
Chain Sequence
QDSLSFGFPTFPSDQKNLIFQGDAQIKNNAVQLTKTDSNGNPVASTVGRILFSAQVHLWEKSSSRVANFQSQFSFSLKSPLSNGADGIAFFIAPPDTTIPSGSGGGLLGLFAPGTAQNTSANQVIAVEFDTFYAQDSNTWDPNYPHIGIDVNSIRSVKTVKWDRRDGQSLNVLVTFNPSTRNLDVVATYSDGTRYEVSYEVDVRSVLPEWVRVGFSAASGEQYQTHTLESWSFTSTLLYTA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords lectin PAL
publication title Crystal structure of Pterocarpus angolensis lectin in complex with glucose, sucrose, and turanose
pubmed doi rcsb
molecule tags Sugar binding protein
total genus 51
structure length 241
sequence length 241
chains with identical sequence B
ec nomenclature
pdb deposition date 2002-10-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00139 Lectin_legB Legume lectin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1n3qA00
3TAYA 2UWAA 4R9DA 4L8QA 4CZSA 4Q8KA 1DIWA 1QF3A 3D6EA 3FUQA 1QDOA 4HL0A 5H9PA 1NXD1 3IM0A 3HMYA 1LODA 2OW4A 3PVEA 4DS0A 1AX0A 1GANA 4XIKA 1UMZA 1N47A 1SLBA 3UJOA 1WW4A 3IKWA 3T1LA 1IKQA 1RIRA 1VIWB 2ZABA 4BQ1A 1W0OA 1CIWA 1DQ0A 2R1BA 5EYXA 4PBOA 4AGGA 3IPVA 5DUWA 1HLCA 4GWMA 3D5OA 4I30A 4YW1A 1FATA 2DTYA 3IPVB 2W08A 3ZXJA 1H30A 1AF9A 5LK5A 1GZ9A 4AGVA 1AXYA 3V0BA 3INAA 3V0BB 3N35A 5CNAA 3OBRA 4BLIA 1X50A 1WD3A 1Q8OA 2WJSA 1OFSA 2PELA 4XBLA 2E7QA 3AX4A 4FOYA 2PHRA 5DZEA 4Q2FA 3ZXFA 3POWA 4YFZA 2WT2A 5HCBA 1BYHA 3BODA 2OUHA 1LHNA 1A3KA 3UL2A 3WDVA 3I4IA 5GZGA 1SLIA 2P3KA 3QLQA 3AFKA 4PBPA 5H9QA 1S0DA 3RS6A 3GNEA 3LSDA 3KQRA 1O4YA 3WDTA 3ZVXA 2CWSA 3JUUA 3IMNA 1PZ9A 1I3HA 3AK0A 2E7TA 1YIFA 1CONA 4FPJA 5FRAA 1QNWA 1MS5A 3ZSMA 1ENRA 1MACA 3V0AA 1S0GA 4D69A 3AJYA 2JKBA 4M3CF 1MS1A 3LSEA 3NV1A 3B9CA 3VKMA 4IQPA 3BOPA 3AZWA 1CPMA 1QDCA 2EF6A 1CPNA 4FPLA 2UWBA 2EXKA 2P34A 5IUQA 1FYUA 5T5LA 4Y1YA 1SBDA 3SH5A 1IS3A 5DUXA 1JYIA 4R9CA 1WBLA 3OJBA 4XTMA 3TB0A 1V6KA 1FNYA 1DYPA 4XILA 1EPWA 4CTEA 2GMMA 1FNZA 1SLAA 4FPOB 2YV8A 4ISRA 1HDKA 4XJAA 1GNZA 2CNAA 2FHRA 2A6YA 3UK9A 1DQ1A 4TYSA 1U0AA 2JDZA 3ZXKA 2V73A 2A6XA 3WCSA 2AR6A 1WD4A 3B01A 3ZXLA 1G9BA 1Q8VA 3WDXA 2SBAA 4YZ4A 4XBQA 2DUPA 4RL7A 2A3YA 3WVJA 1QOTA 4ATFA 5KXDA 3WDYA 3ILFA 4XHXA 4DPNA 1S0EA 4UW6A 3FFZA 1AVBA 3B00A 4RA0A 1N3QA 3PVOA 1KJRA 1MS0A 2LTNA 1LULA 1H9WA 5CBLA 3AZXA 1BJQA 1QGLA 1A8DA 1A78A 4XJ9A 1HQWA 1AJOA 3AXDA 1URXA 2YXSA 4C1XA 4LBOA 1LECA 3D4KA 4Q1RA 2ZAAA 1WW6A 4LBKA 1W6NA 1ENQA 1CESA 2WQZC 2PHWA 4JRAA 2EALA 2DVBA 2TEPA 1W6NB 4LBLA 2R0HA 2GN7A 4P9YA 3SH4A 3WG2A 5IT6A 2HYKA 1XQNA 3WG4A 3WZ1A 5KXCA 1JBCA 3A4UA 4DQAA 1LEMA 2WT0A 2XB6C 2ZBJA 2YY1A 3M3OA 4FP2A 2PHTA 5GLWA 1N1TA 5GZCA 3WG3A 2LALA 2D3SA 4XOGA 2UURA 4YGCA 4AVVA 2DURA 2DWRA 5T55A 2Z42A 1HQLA 1KJLA 1JW6A 5GLUA 1JN2P 3RQ0A 1S1AA 1LGBA 3O0XA 2D6LX 2GNBA 1LOGA 1WW5A 1N1VA 5CAZA 2ZGOA 4YG6A 2R0FA 1V6JA 4FPFA 1N3OA 3VKFC 3RRDA 2NN8A 5GZFA 2G4IA 1C57A 1N3PA 1SFYA 1MZ5A 3N7JA 3WHUA 4YZ1A 4YM0A 2ERFA 1WBFA 4AVTA 5T5JA 1I1EA 2DVFA 2ZGUA 2ZGTA 2NZ9A 1W6OA 3AJZA 1DYKA 2D6KA 1UKGA 1UZZA 1ULCA 1WCSA 1W6OB 3VKOA 5JOYA 2ZGQA 2WSVA 1LU1A 4AGRA 4YLZA 4PCRA 1DQ6A 2KM2A 1SLCA 1MVEA 1V00A 1MS8A 2ZHMA 3AP6A 1MVQA 1ULEA 1KDMA 5GLZA 5JMCA 2GNTA 3BIWE 2A75A 2D6MA 1Q8PA 1DBNA 5JDBA 1GZWA 3SLIA 2D6NA 1WUVA 2CL2A 1LOEA 1YI7A 1GZWB 3FLRA 4JCKA 2UWCA 2C9AA 2ZGSA 2D6OX 1AZDA 4U36A 5JOWA 1SLTA 4BMBA 2E51A 3U4XA 2VW0A 2YZ4A 2P37A 4XXPA 1G9AA 4UW5A 1V6NA 2WKKA 3AP4A 4AYUA 1PZ7A 1LJ7A 1UAIA 1LTEA 2NYYA 3AP9A 4ISQA 1QNYA 4WVVA 2VH9A 4M3CE 1JUIA 1Q8QA 2AYHA 2ZZJA 4GA9A 4FQ4A 1S0FA 3A0KA 3WCRA 1KRIA 4UW3A 1IOAA 4YW3A 3MW2A 3ZSKA 1UL9A 1Q8SA 1QU0A 2EXHA 2R49A 3V0AB 1APNA 1R1ZA 1D0HA 3ILNA 2DTWA 4ITCA 2A70A 1IS4A 1S0IA 3ASIA 1S0CA 1RINA 1JXNA 2ZGMA 3AYDA 5HCFA 1FV3A 1F31A 1SCSA 1TEIA 1GZCA 2ZGPA 4BOWA 4P14A 4C1WA 4DFSA 5CB7A 1SCRA 1O4ZA 2ZA9A 3WG1A 5JOZA 4AVSA 2JJ6A 1DHKB 3NWKA 5DUVA 1VAVA 2A5ZA 3B69A 5T54A 1JOJA 4XMIA 5DG1A 4DRRA 3VKLA 3UJQA 4R9BA 2YMZA 1FV2A 3T2TA 1IS5A 4YW4A 2WSUA 2DUOA 4K21A 2PHXA 2EAKA 1UZYA 1VLNA 5EXOA 2DVGA 1V6OA 4WZFA 4K1ZA 3GALA 3M3EA 5DUUA 2ARXA 3O0VA 4FPGA 4UW4A 4GKXA 1LENA 3AZZA 1LCLA 1B09A 1FX5A 2E6VA 3OPZA 4Y22A 4H55A 4BM8A 2DU1A 2AUYA 3BTAA 4XDQA 2NMNA 2E53A 2ARBA 2CYFA 5BYNA 4Q26A 3HR9A 3WNXA 1AXKA 3NV2A 1LGCA 2D7FA 1ULGA 4XZPA 1WW7A 2EIGA 5EYYA 2A6VA 2R1DA 4GWNA 4ZXKA 2DYCA 1ULFA 3USUA 4YM1A 2A3XA 4PF5A 4Z8BA 3USUB 1S0JA 3IN9A 3MW4A 2DVAA 2ES3A 2W68A 1DLLA 1GBGA 2PHFA 1CJPA 4GKYA 3ZPYA 3APBA 2CY6A 1GYKA 1ZA4A 2P3IA 3M2MA 1G86A 2ZGLA 5GZEA 3O12A 5E8AA 3WUDA 4ASMB 2YROA 4Q27A 3WV6A 1YO8A 3ZXEA 3H0OA 3MEPA 4U2AA 3WOGA 5HCAA 2AREA 2GNMA 2W52A 3O5SA 4YZ2A 2ZMKA 1C1FA 3ILRA 5IK4A 1JYCA 2B7YA 4Y1VA 1GSLA 2VUAA 4YG3A 3W59A 1MS4A 2ZGKA 4WV8A 4XE9A 4XBNA 5L73A 4BLJA 4FVVA 4AWDA 1AJKA 4XJUA 3AYEA 1KQRA 3R4UA 5F9TA 1W6MA 4ZKTB 5KXBA 4FPKA 3ZSLA 1Q56A 4FOWA 1W6MB 1DGLA 1DQ5A 2PHUA 1QOOA 1WLDA 1BZWA 1QOSA 1C1LA 1YRZA 1BKZA 3FLTA 1G9FA 4YW5A 2D43A 2I2SA 2GDFA 3AXEA 4YFWA 2GALA 5GLTA 5T52A 1JHNA 1LHVA 1G9CA 2XG3A 2ZHKA 1BQPA 4FOQA 3SH3A 1ULDA 1Z78A 4WVWA 4XJZA 1MS3A 1V6LA 4OZXA 1RITA 2BQPA 2JE7A 3V64A 5JOXA 2ZMNA 3L2YA 1V6IA 5DG2A 2ZGNA 1GICA 5JLVA 1LOFA 1UX6A 2D3PA 2GNDA 2A6WA 3CNAA 1CVNA 4Q1PA 1DQ2A 1Z0HA 2NMOA 3M1HA 1N1YA 3SITA 1LOAA 1LHWA 5H9RA 5FREA 2DUQA 2DVDA 3VKNA 4FPEA 4XJ8A 4P9XA 4NO4A 3PVNA 1GV9A 3WDUA 3O0WA 4LBJA 1YYNA 1FAYA 1DZQA 2AGSA 2A3WA 2WLQA 3PJQA 3N7KA 3T1MA 1OKQA 2WT1A 4P9WA 2VXRA 5IK8A 1VAMA 4Q8LA 5T5PA 3WUCA 3ZSJA 1SBEA 2R16A 1LHOA 1MZ6A 1AX2A 1V6MA 3C2UA 3MW3A 3AP5A 1LOCA 4PQ9A 4YM3A 1WLCA 2DU0A 4K20A 2WNEA 1F5FA 1F9KA 3NV4A 2EXJA 3I8TA 3V65A 1GLHA 1LHUA 3ATGA 1NLSA 3AYCA 3OY8A 4Y20A 4YG0A 3WHTA 4BPZA 2D6PA 3OY8B 1G9DA 5IK5A 4Y20B 1WLWA 2A7AA 5T5OA 1W0PA 2VW1A 2ZACA 3FUOA 5KXEA 1KITA 3AP7A 1Y7BA 3QCWA 2JD4A 3AZYA 4M00A 2VY0A 2GMPA 5SV8A 3MPPG 1AXZA 2V5YA 4NOTA 2P2KA 4HANA 4Y26A 4XYXA 4SLIA 1LGNA 1CQ9A 5GALA 1AX1A 3B3QE 3JU9A 3PMEA 4LBMA 4DRVA 4FQZA 4XTPA 1LESA 5DXDA 1LOFC 2ZHNA 1W6PA 4KBBA 4FP3A 2Q5TA 2A71A 4Y24A 4XIOA 1UPSA 1W6PB 1YXWA 2NM1A 4YM2A 2CTVA 2SLIA 5F5QA 5GM0A 2ZHLA 3W58A 1D2SA 1PZ8A 1IKPA 1DFQA 2RHPA 3RG0A 3ENRA 3Q9OA 3RMXA 4ATEA 4Y22B 3SNMA 3VV1A 5CA6A 3M3CA 2VU9A 4XHBA 4F83A 5IK7A 3POYA 3FBYA 1N1SA 1KDKA 3A0NA 3AZVA 3POSA 2OVUA 3OBTA 3OYWA 1GNHA 2NP0A 4BMEA 2OUJA 4Y1ZA 5E88A 5DZFA 3SISA 3OYWB 4XXAA 1LEDA 1G8WA 2AENA 4MYEA 2H0BA 1LU2A 4R9AA 4M01A 1SLLA 2VW2A 4Y1XA 4YGBA 1IS6A 3OGGA 4YZ3A 3M3QA 5EWSA 5GJ6A 4FOVA 1H9PA 4CRQA 1SBFA 5H9SA 1CR7A 1MR5A 1ONAA 2ZKNA 5T50A 2A6ZA 3RMYA 5DZGA 1ZM1A 2C5DA 1CN1A 1G7YA 3AYAA 1HKDA 4FPYA 4K1YA 2ENRA 2ZMLA 1C4RA 4GXLA 2GN3A 5AVAA 2EXIA 3DUIA 1W6QA 4LBQA 3N7LA 3KM5A 2JE9A 3N7MA 2FMDA 3ZYRA 1GKBA 2AH2A 1W6QB 4LBQB 5GZDA 2UU8A 1LOBA 4XMAA 1MS9A 2CWMA 4LBNA 5E89A 2ZGRA 3DGTA 1SACA 1ENSA 3WDWA 4LBQD 1UN1A 4JC1A 4YGDA 4GALA 3RSJA 3N36A 2P3JA 1DQ4A 1J1TA 2W39A 1VALA 4W65A 4TZDA 4Y1UA 3WLUA 4XJWA 1OQ1A 4YW2A 4FPHA 2GMEA 3N3HA 2JECA 5GLVA 3VUOA 2D44A 3NV3A 3ZYPA 3FLPA 3R4SA 3R05A 1BXHA 1QKQA 5JVVA 4M3CA 2D3RA 4YZ5A 2DV9A 1S0BA 4YGEA 4M3CB 4FPCA 3LCPA 1QMJA 3HN1A
chains in the Genus database with same CATH superfamily
1JZ7A 4GMP0 4JGZC 2UWAA 1MQTC 4Y4YA 1CD3G 1PHMA 2C24A 4S2FA 2HWD1 2J42A 3Q8EA 5FUIA 3IM0A 1LODA 2OW4A 1FT9A 4DS0A 5L9RA 1GANA 4NIGA 4AHWA 1UMZA 3POGA 1CZSA 3SMHA 3GBFA 3LOBA 3ZMNA 4Z07A 3UJOA 3ZIXA 4AL9A 1WW4A 2V4VA 1RIRA 2WDBA 3LD8A 3U10A 1AL23 1QEXA 1J58A 3BPSA 1XU2A 3S5QA 3GDBA 3NVCA 3ACLA 4BQ1A 4E8CA 1DQ0A 1OSGA 3OTFA 3KVAA 3JBG1 4PBOA 2ET7A 2JXAA 4AGGA 4RHV3 2VZ3A 4I30A 2Y26A 4YW1A 2DBNA 3ZXJA 1XJAA 4YW7A 4ZS2A 5LK5A 4AGVA 4EJRA 3I97A 4UFLA 5FOJB 3INAA 1UNBA 3FFQA 1JZ8A 5A70A 1RUJ3 5FZHA 3WQ7A 4W6YA 3KZ4C 1OFSA 2JG9A 5LB6A 2XVKA 2E7QA 3I2DA 4AEMA 2PHRA 2RE9A 3J7NA 4Y5Z0 5DZEA 4GAZA 4Q2FA 4A45A 5C3OA 2VXJA 5FZOA 3POWA 2HWD2 4G4FA 5CVRA 1ACCA 5CIRA 4P9GA 1BYHA 5FFOC 4CEYB 4CEWC 1AYN3 4BYYA 5GZGA 1C3HA 1C8M3 2R072 4GWJA 1ENXA 1S0DA 3MFAA 3GNEA 4FTBA 3WDTA 1O4YA 3A22A 3JUUA 3X29B 1H8TA 4AFAA 2BBAA 1PZ9A 1I3HA 2VZQA 3VDAA 2E7TA 4FPJA 3M70A 4QQLA 2WN2A 3VD5A 3POFA 3ZSMA 4N53A 1ENRA 2W92A 4KGQA 4RQPC 3DKWA 3T08A 4O61A 1I9RA 4GH4A 4ASLA 5JZGB 2RG4A 2BV4A 1YWKA 1ALYA 2HWE3 3JBG2 4M3CF 2BUKA 1MS1A 2BNNA 2O8QA 4O9GA 3VDDA 3NV1A 3RJRA 2BPA2 2DDUA 4QB6A 1QJEA 3I2KA 3J8F1 3GZEA 4YW6A 5A3LA 3KV9A 4FPLA 4ARXA 1X9TA 4XF4A 1ZBA2 1UY2A 4CDWB 1SBDA 1J1LA 1IS3A 1WA6X 4N7UA 3SQOA 3ES4A 1JYIA 2GP5A 4D8MA 2EIEA 1POV1 2GAUA 4IE0A 2XL9A 4AI8A 3E5UA 4DMIA 3JQXA 1PO12 2E9QA 2O14A 5DDJ3 5IVCA 3B02A 2HWF3 1JOPA 1E57A 1TME3 2LS6A 2VTXJ 4ZY9A 4CTEA 1ZRDA 1HDKA 5BNOA 1GNZA 2A6YA 4TYSA 2Q30A 3WCSA 1YQ6A 2AR6A 2BW8A 1G9BA 2Y6HA 4B4QA 5FKBA 1VMJA 1Q8VA 3ZFEC 3OGVA 3ZMOA 1FXZA 3R4DB 4YZ4A 5ACA1 3ACHA 5D2AA 5JPNB 1WCUA 1FI2A 1QOTA 5J36A 3A23A 3ILFA 4RGAA 2B5HA 2R041 3TBDA 3T0AA 1XBFA 4DPNA 2RDQA 1XNCA 3FFZA 1AVBA 4HKOA 2PLV3 4UW6A 1GUIA 3T4HB 3HWJA 5FZ6A 1VE0A 3JB4C 4BJ0A 1DF0A 4QQPA 3J9SA 2C4XA 1ND2B 3KV5A 5FXVA 4BQXA 1LULA 1KGYA 4MO3M 2PXJA 1H9WA 3CQOA 5FO8B 1DZTA 1YQ8A 1OLRA 2YDEA 1A78A 1CX4A 2QQOA 1NX9A 1PGW1 4CU8A 3CJIA 3D4KA 1XSQA 4Q1RA 2XHNA 3HBZA 3PDQA 2F6BA 1QQP3 4CEWA 2FMYA 3C7GA 1UCXA 2GN7A 2Y34A 5EIYB 4CPBA 2KD7A 2HYKA 2VQUA 2VOKA 1O8SA 2C1FA 4GJYA 4DQAA 3IAPA 2ZBJA 1QJX1 2XB6C 3H8UA 3M3OA 5DAVA 1DDLA 5GLWA 3CHXA 2J1EA 5T55A 1OFNA 1PO23 3AKRA 1AR82 1H2LA 1KJLA 2R042 1JN2P 4QPIA 2XQXA 3O0XA 3AVSA 4GQ7A 2GNBA 2ZXQA 1ZRIA 3MGUA 1LOGA 2VVEA 2G9ZA 1RUH1 1FMD3 5J09A 5JIAA 1NA1B 1B35C 3E6DA 3K3OA 4XFFA 5IYYA 5GZFA 2QZ2A 3N7JA 1N3PA 5LY2A 1ZRRA 1CIYA 5BNPB 3DEMA 2WLPA 4IEWA 1ZZ9A 4YM0A 4YZ1A 1QJFA 2OPWA 5C8WA 1WBFA 4M0HA 2DVFA 3K48A 5A7QA 2X5IB 2ZGTA 1DYKA 2V4AA 3I2IA 5I0TA 4S2DA 4AGRA 3UKVA 4YLZA 2KM2A 3LFMA 1Y3TA 4NHXA 2ZHMA 3PMSA 1OOPB 2RDSA 3S7EA 1KDMA 3BIWE 4IETA 3MF9A 3H7YA 4XF0A 1F35A 3HT1A 5J1XA 2IVJA 3H1WA 2CL2A 1AYM2 1OLQA 1YNAA 4QGMA 1RMU3 5FPZA 2PQQA 1VRH3 1HN0A 3VB9A 1Z7S3 4Y4RA 2E51A 4PDWB 4PF1A 4KU7A 5FYUA 5A6ZA 2VW0A 4WM8C 4XFCA 3ZYGA 4XXPA 4B7EA 3VBRC 1JYVA 1G9AA 4UW5A 4AVAA 2YYOA 5FZFA 5FZKA 3VBOC 1XE0A 3VBRA 5DMYA 1JZ5A 3ZFFC 1ZREA 5C9AB 2H0VA 1TMF2 3RYRA 1JUIA 3H3UA 4QQOA 4GA9A 2Y6KA 4NHKA 4RYDA 3E5QA 4FQ4A 1S0FA 1KRIA 4UW3A 4HPKA 4Q0SA 2NPIA 3S6PA 4AXOA 5I8YA 5I0DA 1VBB3 3ZSKA 4BB3A 1UL9A 5JPMB 3ZXDA 1R64A 2EXHA 1AL0G 1TQ5A 5FYVA 2QQPA 1RUI2 2EICA 5FMDA 3ILNA 3MV01 1PVC3 5ABJA 5EHDA 3DYOA 2BRTA 2OXBA 1F4AA 1S0CA 1RINA 1JXNA 1BCXA 2ZGMA 2OX0A 3AYDA 2JD9A 4LA2A 4XQWA 1C8NA 4LKSA 5A7SA 1YQ2A 3SHRA 4CE8A 4UF0B 4IV1C 1VJ2A 2BVBA 1UU6A 5I0RA 4MV2A 3VBHB 4DUVA 3POEA 4BK4A 5LA1A 5CFDC 3NWKA 5DUVA 2IFWA 1JZ6A 1GOGA 1NLQA 2IVIB 3LPFA 4XMIA 3VKLA 3KGLA 5FP3A 4GB31 4AFCA 3VZMA 1FV2A 3T2TA 4JKMA 3K51A 1IS5A 1EV11 4PI0A 2WSUA 3D82A 1CAVA 2W1UA 2XJQA 5A3WA 3KT1A 1R093 1UOGA 1V0AA 4LO4B 5KHKA 1RB8G 4WZFA 4K1ZA 3GALA 3FBMA 2CGPA 3LEKA 5DUUA 1XE7A 5LWBA 1FOD2 3O0VA 3GHMA 2GP3A 2EVXA 2VC9A 3KGZA 4CDXC 1QH7A 5APAA 2ID4A 4E27A 3S30A 2JG8A 2NMNA 2E53A 1OLME 1XOYA 3NSTA 4NMIA 3WNXA 3MICA 3QOPA 4RS5A 5G05L 3NV2A 3SXWA 2P1BA 5HPOA 3AMQA 1ULGA 4IEPA 1JZ3A 2EIGA 2A6VA 3IBMA 2LM3A 4QAWA 2KXLA 5FLIA 2XJSA 2A3XA 4Z8BA 1R083 1XSRA 3OOXA 3USUB 4EYUA 1F5JA 2ES3A 2ARAA 3IWZA 4WM8A 1DLLA 1M4WA 2H6BA 2R073 1ZZBA 2JDPA 2PHFA 4GB32 4GKYA 5CYYA 2WZEA 4JDNA 3USSA 3WD5A 2CY6A 5FZ4A 5GZEA 5E8AA 2ETEA 3WUDA 2PAKA 3SKJE 3ZXEA 4KQ7A 3MEPA 1WMXA 3WOGA 4QHZA 5FJKA 3TEZA 1DYOA 1RTVA 1UIJA 3O5SA 4YZ2A 4NIAA 3E97A 3EMRA 2JDHA 3JBG3 2QQLA 3Q8AA 4HLTA 4CCDA 4ZZ8A 1HB1A 4XE9A 2J1RA 2JIGA 4WV8A 3GJAA 3K75B 3A21A 1RUF2 4N9HA 5L73A 4BLJA 2VTFA 1H2KA 1PGL1 1W9FA 1ZBA3 4OMCA 4FVVA 3P3NA 4OUMA 5F5IA 1WZXA 4AWDA 1AJKA 3WF3A 5FCCA 1DGWA 3EYPA 1W6MA 5KXBA 2Q8OA 1Q56A 4FOWA 1DQ5A 1PO13 2AEYA 5FY7A 4Z1VA 1W8FA 3VBSA 1C1LA 3OUHA 1BKZA 2CSGA 3FLTA 3IDEA 3PURA 4TN7A 4YW5A 1ASJ2 4YFWA 3C3VA 5T52A 3PIGA 3W20A 5A1AA 4QM8A 1ULDA 4XJZA 1V6LA 4OZXA 2WWSA 4RR3A 2ZMNA 4Q29A 3L2YA 5LK7B 1PMHX 1CWPA 3RZLA 3OD4A 1LOFA 1UX6A 1W2OA 2D3PA 5FZBA 5BY5A 2GNDA 1W0NA 3GCXA 1CVNA 1Z0HA 2VNRA 2NMOA 4D6QA 3H3ZA 1PGL2 2VZSA 1LOAA 4AI9A 4CDXA 3E5XA 3AMNA 1NE6A 2WNUA 3PUQA 3VKNA 4ZONA 2IXHA 5KHHA 3HT2A 5IHRA 1HB2A 1POV3 1GV9A 3PVNA 3LDRA 5FZ9A 4B4PA 3O0WA 4C0BA 3P3PA 5FYBA 5A33B 4Z92B 3CKHA 2WC2A 3G7DA 1V9U1 4QB2A 2A3WA 2BEOA 3DKQA 1RYYA 1KS5A 2WT1A 1TE1B 1H8VA 4P9WA 5L9BA 1KXGA 4IXLA 4NAOA 4AVCA 3MZHA 3K2OA 1VAMA 1PIV2 3VZJA 3WUCA 2DF7A 5B2GB 1WCKA 5IW0A 1LHOA 4OI1A 1VBE1 5FO7B 4IGOA 3MW3A 4DEVA 5FIXA 3ZPOA 3TNQA 5FYMA 3B5LB 1ST8A 4Y33A 4YM3A 2ET1A 2DU0A 1J59A 3FN9A 1UKRA 4CEYA 4JQTA 1AR83 1A34A 3PHMA 3ELNA 2WNEA 4XACA 1F5FA 2C0ZA 4E4DX 1UMHA 3OY8A 2WNOA 3IAQA 3LIHA 1OH4A 5HXMA 1OLMA 4J25A 4AQ6A 5F6KA 5T5OA 1UZVA 3AP7A 1S2KA 2VD7A 1AL21 4IV3A 4ZXEA 4QXHA 2ZZQA 2YBSA 3CLPA 5KC5A 2VY0A 2GMPA 3H1MA 4LO8A 3FC0A 5SV8A 4RHV1 5FDBA 1UU4A 2J7MA 4NOTA 4Y26A 2PHDA 5EJ1B 4Y5SA 4SLIA 2RJ2A 4P00B 4LPLA 4JGYB 4DRVA 3I3EA 5HV4A 1RUJ1 4MGIE 1PNFA 2WNVB 4KBBA 2J22A 1UPSA 2PAMA 3U1XA 1RXGA 1TNRA 5GM0A 4AEDB 4CDQB 2ZHLA 3HNYM 4E2QA 1D2SA 1AYN1 4QHOA 2VBPA 1J3QA 2E63A 1C8M1 3Q9OA 3RMXA 5CU1A 1GP4A 4CXXA 3VV1A 5K0UC 4UXAA 1AYM3 5FY1A 2P6CA 1N1SA 4QDSA 3T0DA 3M7AA 2UY8A 3AKSA 4KWJA 2OVUA 4OFGA 3ZX7A 3OYWA 1DCSA 1HW5A 1ZNPA 2HBUA 5E88A 1YFUA 3SISA 4UI9L 2HWE1 4KG8A 4QX1A 2Y33A 2YG0A 2H0BA 1LU2A 2BWAA 3TYJA 4M01A 2VW2A 5JXHA 4Y1XA 4YGBA 4YZ3A 4XAEA 5EWSA 4DIQA 5GJ6A 3I59A 1TMF3 2YUEA 2XLAA 1ND2A 5H9SA 5JSPA 2LW8A 4JHTA 2A6ZA 4MXVA 1ZM1A 4XF9A 1CN1A 4ZPIA 1HQNA 4FPYA 4ARYA 5C5UA 3VZNA 2GN3A 4X6RB 1RUI3 5DDJ1 5AVAA 1ZRCA 1AYN2 1TME1 3MIHA 2KR2A 4D7SA 1W6QA 1C8M2 2WBKA 3N7LA 3N7MA 4L0PA 4LBQA 4Z82A 4AI1A 1GKBA 4CCNA 5JCTA 5JOZA 1R1A2 2CGOA 2KA3A 5IVFA 4CYDA 1YCIA 3G6JB 2ZGRA 3ES1A 2Q1FA 4XUQA 1ENSA 2VCBA 3PVBB 1LRHA 3HN3A 4GALA 3N36A 4YGDA 3ZDVA 5FPBA 4W6WA 3QD6A 3JQWA 1AR72 1BHGA 1CJDA 1D4VB 1AR62 1DG6A 3WLUA 3FX3A 1OQ1A 4QKDA 2GMEA 1W8NA 3NV3A 3RYKA 3FLPA 3R4SA 4D6RA 5A3UA 4RQPB 1O8PA 4JDOA 1HJGA 4LO5B 5L9VA 1GP5A 4YPJA 1S0BA 2YPDA 3AC0A 3MIEA 3PL0A 4M3CB 2OYZA 4AHXA 1NA1A 5FOBB 2QNKA 5FZAA 5JAXA 5K9YA 5J37A 3MUY1 1NZCA 3TAYA 3DF0A 4Q8KA 1DIWA 1FOD3 1QF3A 3D6EA 3HQXA 5DDJ2 3RYPA 3UETA 3S57A 3IMMA 4HL0A 4JAAA 2PTMA 2XXZA 1NXD1 1W2NA 1X82A 3HMYA 4Z2AA 4IEUA 1QQP1 4UOJA 2BVVA 2I07B 2XBO2 5FBZA 1SLBA 2WL1A 2GU9A 4CDUB 4XZUG 1WMEA 2QQWA 3OUJA 4NWWA 5C70A 1BEV2 4WVZA 3NAPA 2ZABA 4NJ4A 3CZUA 1W0OA 1CIWA 2I45A 4NUBA 2R063 4IDZA 3ZFEB 3GJBA 5BNQA 1OMIA 1W9YA 4GB33 2W9XA 4XCBA 5C8CC 3IPVB 3BTZA 1JMUB 1H30A 3T4VA 1LR5A 3V0BA 1AXYA 4LK6A 4A7KA 1EY2A 4WM7C 4QX3A 1FMD1 5CNAA 3OBRA 1X50A 2VQ0A 2XJRA 3KHCA 1WD3A 2ILMA 3AX4A 3GBWA 2FBEA 5EJZB 1NE4A 3UL2A 1WMDA 5FUPA 4COZA 3WDVA 1SLIA 3VD3A 1RUF3 2P3YA 1UYXA 1PK6A 3ZVXA 1TNFA 3KQRA 3B94A 4GD4A 3LKJA 4XVHA 2VJXA 1GMMA 2WYSA 5GKAC 4O9EA 1Y43B 5FRAA 2Q8DA 1MS5A 4K40A 2TUNA 2XUEA 4WVMA 5F3GA 1RUD3 2VZOA 5J3UA 5D8AB 3WW1A 1US3A 4OI4A 1W2AX 1OQDA 2ATFA 1QXRA 3KVBA 1ASJ3 3AMMA 1KFXL 2OZJA 3BOPA 3AZWA 3QH7A 4IQPA 2WUHA 4P02B 2EF6A 1CPNA 5FKCA 3BIEA 2UWBA 1RMU1 4QDQA 5CG9A 1FYUA 1T6BX 1DZRA 4QQ2A 1VRH1 2Z69A 4Y1YA 2ORZA 4A3XA 5FLHA 3SH5A 3DXUA 2JB8A 3PU8A 4R9CA 1Z7S1 3BU0A 5AFEA 4FBFA 3OJBA 4XTMA 5BNNB 5K8SA 5FXZA 4XEZA 4AAXA 1FNYA 2X05A 2IFRA 3BYWA 1B35B 1HB4A 4FPOB 4ISRA 1ND3A 4DXSA 3ZXKA 4MGZE 4D6SA 3C7EA 1DQ1A 2JDZA 5F5CA 2V73A 4L97A 1UQXA 1WD4A 3ZXLA 2SBAA 4XBQA 1VBB1 2VQTA 3VZKA 5C33A 2VO5A 3OGJA 3GZTB 2RV9A 5C7GA 5KXDA 5FZ3A 3WDYA 4TLGA 3PUSA 1OF4A 1PVC1 3LFIA 1S0EA 2XJPA 5FMBA 1PIV3 4RA0A 4DINB 1K12A 1RMU2 2JG9C 3EJKA 1VRH2 1JH5A 1GQGA 1NUKA 3D8CA 3PLQA 1EUUA 4UFMA 3ROUA 3T0BA 1DGRN 5HCHA 1Z7S2 1QGLA 4LMFA 1A8DA 3BB6A 1JYXA 1W99A 1AJOA 2HYXA 3AXDA 3H8OA 1URXA 4C1XA 1O59A 4LBOA 4QPWA 5A6YA 3CJXA 2ZAAA 4LHSA 2YC0A 1JTZX 3CF6E 2PHWA 4AR2A 2FCUA 1W6NB 4ZU4A 3FMGA 1R091 4N53C 5KXCA 3A4UA 3OF1A 3VBOB 1LEMA 4GH4C 4FP2A 3E6CC 3LB9A 5A7OA 4XDOA 2GC3A 2PQSA 1VR3A 4YGCA 2DURA 4QGLA 2DWRA 2DCTA 4QXBA 4YVWA 4A41A 2VBBA 1VBA1 2VMCA 4WBBA 4UFIA 4DZGA 2Z2SB 1LGBA 4SBVA 2PA7A 4UBGA 1UWWA 1WW5A 2I74A 1NCRA 3VDCA 1PM7A 5CAZA 1UY0A 2WO7A 2D97A 4QXKA 3WQBA 4YG6A 5FYHA 4Q4Y2 3ZN6A 3VKFC 4CXWA 4R4XA 2NN8A 1K5MA 4OHYA 2G4IA 1R081 5E1RA 1SFYA 5BNOC 3O1OA 1MZ5A 4IV1B 4XFGA 3LDKA 3WHUA 2R071 2ERFA 4HK9A 3GZAA 4HXCA 4QX2A 4AVTA 5T5JA 4AVBA 5BXXA 5CFDB 4N8MA 3HQRA 2ZGUA 4AHYA 4H2AA 3N9LA 1R092 3AJZA 4P5YA 3ZIWA 1W8TA 3K77A 4AI3A 4E2SA 2XHKA 1ULCA 1W6OB 4PI2A 5JOYA 1D7PM 2ZGQA 3TOJA 1LU1A 2FDKA 2XGXA 3I3QA 3B9IA 5IFTA 4CXYA 3WP6A 1MVEA 1V00A 3AP6A 4BQ5A 5ISLA 2D40A 1VBA2 3ZM8A 1RUOA 3WP5A 5JMCA 2GNTA 2A75A 2MHFA 4LUKA 4NR1A 3HNBM 3SLIA 5FPUA 1NXMA 1W8ZA 1WUVA 1ZBA1 2IC1A 2HEWF 3HNMA 5JR7B 1GZWB 3JD72 2AC1A 1O5UA 2ZGSA 4JZRA 1RXFA 4MUVA 1AZDA 1SLTA 5FY5A 3CJIC 1YLLA 3U4XA 1PO11 1R082 1RL3A 2UYBA 2YZ4A 4GIQA 4IESA 4PQQA 3PIJA 4KG0A 1HJFA 4KH9A 4UT5A 1IG0A 1R1A3 2XL7A 3AP9A 4QB1A 4ISQA 4BQWA 1WCDJ 2VH9A 2XH6A 4WVVA 4M3CE 3POIA 1OQEA 4JX0A 3WCRA 2E33A 3O1SA 3NQHA 5F2SA 4N43A 1AR73 2HEVF 4XABA 2L9LA 1QU0A 1AR63 4LKFA 3V0AB 4YRDA 5C71A 1D4M1 1D0HA 1RUG2 4UAPA 2DTWA 2A70A 5FBJA 3SEPA 4Q0VA 4CP9A 2Z79A 4C0HA 2BOIA 1TEIA 2ZGPA 4BXFA 4P14A 2Q0AA 2IXIA 1SCRA 2XKPA 4AVSA 1LB2A 2JJ6A 2QDNA 3RZJA 2WAAA 1DHKB 4DY3A 3I2OA 2BTVC 1VAVA 5T54A 4LE4A 5K4LA 4RSUA 4EN6B 2J1UA 2OQ6A 1BVP1 2JE8A 2YFUA 3HIFA 4YW4A 4K21A 2XBO3 4ES9A 1AR92 4I3PA 1UZYA 1SZBA 3C7FA 2DVGA 4FFIA 3WX5A 1BEV3 1H6XA 1YFXA 3U75A 3URFA 1CAWA 3LDBA 2QQMA 3VBUA 4FPGA 3MIDA 1UPIA 1AR81 4GKXA 4OUEA 1D4M2 1G6NA 3KCXA 3AZZA 1VB4A 5FP9A 5FPLA 1B09A 3KT4A 2E6VA 2E26A 3OPZA 4FAHA 5KHGA 3T2QA 2O1QA 4FFGA 3KF5A 4LLFA 4OHVA 4Q26A 2YU2A 1TVGA 5A1LA 4L2NA 1XC6A 2B4KA 5AC91 1AHSA 3ZFGB 5A32A 1WW7A 4ZS3A 1CGPA 1T6GC 4QPGB 2DYCA 4URTA 2YGLA 4YM1A 3UKTA 5AFBA 4COYA 1C5HA 4LXLA 2IUWA 1SPPB 4S2GA 2JDUA 1E5HA 1OURA 5IAVA 2W68A 4ET7A 5FZCA 1ULPA 3ZPYA 3APBA 4MSVA 1ZA4A 3NNMA 1G86A 2ZGLA 3R6SA 3WF2A 5I91A 2VZPA 3O12A 4FXGB 4KMQA 1YO8A 2IXJA 2VGDA 5HCAA 2Y64A 2UYAA 3M3IA 2VNGA 4Q4W3 5ABJC 4IW3A 2IXLA 4Q5OA 4YARA 3ORJA 5IK4A 2B7YA 4FFFA 4NHMA 4YG3A 4BXSV 1RVF2 1QJY1 4W4ZA 1AYM1 1S2EA 4ZZ5A 1O3TA 3L2HA 3U11A 2ZOEB 4C90A 2W0XA 4XJUA 1KQRA 5AC92 2QQJA 4ZKTB 4L99A 4FPKA 1SFNA 2Q8EA 1OA2A 3LEGA 5IJRA 2PHUA 5CFCC 1QOSA 3I3BA 2D43A 4IGQA 1QHDA 1TMF1 3AXEA 4R52A 1OPOA 5FYZA 5FZDA 2JKXA 3HBKA 4N9IA 5GLTA 4NIDA 2XG3A 2ZHKA 3THPA 1PMJX 1UD1A 4FOQA 3A7QA 4WVWA 1MS3A 2HJIA 3BGAA 2JE7A 4IEOA 4LUMA 4TXWA 3FE5A 1COV1 3V64A 1NKGA 5FZ7A 2XQRA 2CDPA 1OPMA 1RUI1 1H4HA 5A7WB 3MHZA 4BISA 2JG8C 2FDGA 3WNKA 2VMEA 2WFF2 2ZCWA 2Y8KA 3ZN5A 1QJY2 3CNAA 4Q1PA 1HV1A 1UYPA 2BNOA 4RS5C 1S4CA 4YWAA 4EN9B 3KLSA 2FDHA 2QDRA 2VBDA 1IQDC 5FUNA 3ON7A 1GQHA 1W05A 2F4LA 3BU7A 4F7ZA 2RS33 5FREA 5FWEA 3KV6A 4IERA 3O1MA 4XJ8A 4D94A 2BOJA 3C7HA 4BQ4A 3DYPA 4OLLA 2B45X 5FR3A 1DZQA 2WLQA 4CUGA 2LUWA 2PHLA 1MEC2 4Q4V3 1O5LA 4UFHA 3RFRA 2ORXA 3I7DA 1BK0A 4QKBA 4QQHA 1XNDA 2HH9A 3DECA 5DABA 5FZEA 3WXPA 5T5PA 3AKQA 5A3PA 2R16A 2WABA 1OD3A 2ADEA 3C2UA 4IEZA 2C6SA 5L7OB 3AP5A 3HPNA 1U5IA 2XVLA 1COV2 2WN3A 1FOD1 4XF1A 3OB8A 5KC6A 5CKMA 1W28A 4LR4A 2AACA 1QWRA 1F9KA 1W3VA 2EXJA 1SHWB 3MLLA 1H4GA 4W8JA 4YG0A 1NLSA 3EB7A 2QBXA 1BMV1 2RS52 2D6PA 1G9DA 2RS12 5C4WA 4Y20B 4E4ZA 1WLWA 2VOTA 2W87A 3DPRA 2VW1A 4EROA 4Q4Y3 3VBSC 2B46X 2VZTA 2JX9A 2JB4A 1XYOA 2VZUA 3AZYA 3ZYIB 2R061 3ZR5A 4UFKA 5HI0A 2K0GA 3H3LA 3VBFA 1NCQB 4HANA 2VMHA 4FAGA 5CFCA 2G9GA 1LGNA 3KSCA 3JU9A 4RR3C 3PMEA 1UX7A 5HCFA 2CAUA 1LESA 4H7MA 1LOFC 1CAXB 4PLMA 4OQ8A 1OC1A 2A71A 2XDVA 1JYNA 4NAMA 2WS91 3H42B 1W6PB 1YXWA 2NM1A 4LTAA 5BNNA 2JICA 5F5QA 1VBA3 1PZ8A 1IKPA 3LIGA 2C26A 3S7IA 3RVHA 1NQJA 4O7XA 2WNUC 1RUF1 3D0JA 4Y22B 3SNMA 4YSFA 2Y38A 2G1MA 5IK7A 4AEJA 3CBNA 3JD73 4QKFA 3OGRA 1PX4A 5EFUA 1GP6A 2F4PA 3O14A 2OT7A 1OT5A 3POSA 4IE6A 5FYTA 3MPBA 4Z2WA 2HEYF 1GNHA 1DGRA 4BMEA 1RUD1 5DZFA 4DOUA 4EWDA 1PM4A 2R062 4LHKA 5IVJA 4LO7A 2W3JA 1LEDA 1IGOA 1YEWA 3LQCA 5JSRA 2R30A 1ASJ1 5A3NA 1ZZCA 2H6CA 2FDFA 1SLLA 1XXNA 2FDJA 3OGGA 1POV0 1Y4WA 3FZ3A 3UKNA 2G9FA 4LIUA 1IPSA 1ONAA 2VECA 1DU3D 3ZKUA 2C5DA 2VCAA 5LATA 4CEYC 1G7YA 5C8CB 3AYAA 4CP0A 2C9KA 1H0BA 2WS92 1C4RA 1CAUB 3EQEA 4WM7B 4MXWA 5LBCA 3DUIA 1RUG3 4NHYA 1BBT2 3KM5A 2JE9A 4NE9A 2FMDA 5CKQA 2AH2A 4FTSA 4NVPA 5F5AA 5GZDA 5J7MA 3LA7A 2UU8A 4K6BA 1MS9A 4IV3C 1US2A 3GM8A 1SACA 3ACIA 1V70A 4NPRA 1OKOA 3WDWA 5J48A 5JZGC 4QMAA 3PTRB 4XETA 4PIXA 3ZYHA 3WNLA 3WNMA 1DQ4A 1RUD2 1J1TA 2W39A 4DXTA 1VALA 4W65A 4BIFA 3PUIA 4YW2A 3POJA 3BALA 4BDVB 3VUOA 5EJ3A 3R05A 1PIV1 4OI0A 5JVVA 4AAPA 1OVSA 2GSYA 2Y6GA 2ZKLA 1AR93 2Y0OA 2DV9A 4JDMA 1XE8A 3LCPA 4OI2A 5T50A 3WY6A 4YVSB 5FPAA 3O1RA 3H8RA 3WW3A 4CZSA 2AEZA 5DAXA 3FUQA 1UO9A 3LGRA 1QDOA 1D4M3 4XC9A 5JI9A 2WO3A 1L3JA 3PVEA 5FP4A 1KEXA 2Z5WA 5TSWA 4KWUA 5M0TA 3NMBA 4XIKA 4A7YA 1O3RA 2J1AA 4NRMA 3THDA 1EAH2 1O91A 1N47A 1W3XA 4CCLA 4PT6A 5LBEA 4FFHA 1IKQA 2FZ1A 4DUWA 2Q4SA 2WAOA 1ND2C 2JENA 5DUWA 1HLCA 4GWMA 3D5OA 3NKGA 1FATA 2DTYA 2E31A 2Q8CA 1AF9A 2XWBB 1HV0A 3AKTA 3S0MA 3N35A 2CHHA 4I09A 5FZ1A 4BLIA 3MLJA 5FK7A 1ZX5A 3PU3A 1Q8OA 2WJSA 2PELA 4FOYA 4QT6A 3UGFA 2JG9B 2ZEYA 1SDDB 5HCBA 4NRQA 2OUHA 1LHNA 1A3KA 5FZOB 3I4IA 1RVF3 2P3KA 3AFKA 5H9QA 3RS6A 3VZOA 2XKOA 3AKPA 3LSDA 3JCIA 4HG6B 1K3IA 3ITQA 4AZZA 2CWSA 2WQ8A 3WW2A 1PMIA 3WQ0A 3VHNA 1EPZA 3AMPA 5AC93 1H8TB 3AK0A 4QWNA 1YIFA 1CONA 3OCPA 1QNWA 1OBNA 1X8EA 5JZGA 3MIFA 1VBD1 3U4SA 2WZPP 1MACA 3Q8FA 3IDBB 4N53B 3V0AA 3AJYA 4CUCA 2D93A 1W8HA 3H7JA 4GH4B 1D2QA 2XOMA 3LSEA 3B9CA 4GWIA 3VDDB 2UY9A 1CPMA 1NA1C 1QDCA 3FL7A 2VL4A 4CDWA 3H9AA 2P34A 1X7NA 5IUQA 3BN6A 2PN5A 1NOVA 3OPTA 4MGYE 4Y5TA 4A6SA 1WWYA 3OGSA 2OS2A 4R4ZA 4V2VA 1I6XA 2GH2A 4IGPA 5A7PA 2WFF3 4JGZB 3ZN4A 1MQTB 2GMMA 1QJY3 1FNZA 1S2BA 2QQIA 4XJAA 1R1A1 3HEIA 3UK9A 2FHRA 4LK7A 1MZEA 2DFCA 1U0AA 3D3AA 2A6XA 3NAPC 1JOBA 5FZLA 1HX6A 2RR12 4CCMA 3VHRA 3K3NA 1OUSA 2XJTA 3WDXA 2DUPA 2ZX1A 3MF6A 4NWVA 1AR71 4RL7A 2QVSB 1VBD2 2A3YA 5BPXA 2RMU2 1AR61 2VOXA 4GJZA 5FQ0B 2BBVA 1MEC3 4XHXA 5IAXA 1H2NA 2BJSA 2QE3A 3SKVA 5KHIA 4CUAA 2R6QA 2VG9A 2Y6FA 3TEXA 3PVOA 1KJRA 1MS0A 4HT1T 4K9SA 5BV6A 3MO4A 3AZXA 1COV3 1DP0A 4AQ2A 4HKLA 4HZFA 4XJ9A 4MADA 1HQWA 3IT8A 4RFT0 3T30A 5FYYA 1TZOA 4OMDA 1PK6C 1SPPA 1WW6A 4LBKA 2QCSB 5FMOS 2ARCA 1CESA 4JRAA 2EALA 2TEPA 1XNTA 3N9PA 3SH4A 5IT6A 2RS53 2RS13 2XBO1 3WG2A 4CEWB 4F3JA 3WG4A 2W91A 3JB8A 3WZ1A 1JBCA 4ONUA 2WT0A 1BEV1 2YY1A 4H7LA 4CCJA 2PHTA 2ZEXA 5IWFA 3WG3A 2LALA 2D3SA 4XOGA 1XB9A 2FDIA 1RUC2 3W5NA 3HJRA 4H14A 1HQLA 5D1IA 5GLUA 5IVVA 2GZWA 3AFGA 2Q1MA 1HRV2 4QPIB 4N7IA 5C3RA 1UOFA 1N1VA 3GCWA 5FJHA 4P9LA 3PJYA 5FYCA 2R0FA 4XFIA 1H1IA 4C8DA 5BNPA 1ND3C 1QJU3 2GC1A 4CSWA 4XFHA 2WFPA 1L7LA 3AMHA 3C7OA 5A3MA 3AB0A 3BI3A 2P6HA 2X5IA 2YHJA 4OVEA 3VL9A 1NLRA 3I2HA 5F3IA 1UKGA 2FQPA 1WCSA 2J1SA 3N9QA 5F32A 3WP4A 1UY3A 4E4SA 2WSVA 4Q4W1 4G9SB 3ETQA 2LROA 5B4NA 1SMVA 1DQ6A 4PCRA 1OOPA 1SLCA 4TTGA 1MS8A 5JWPA 1UOJA 1MVQA 1W8WA 5FLJA 3TN92 1ZZ7A 4FXKB 2Z4FA 4PJYA 4Q4X2 1VB2A 5GLZA 4ZHNA 2D6MA 5FXXA 4LHNA 1DBNA 3EO6A 3MBWA 2D6NA 1NYWA 1LOEA 1UOBA 2HLEA 5JR2A 3U78A 3FLRA 1GOFA 2UWCA 1X8MA 1QIQA 2C9AA 4JCKA 4LOTA 5JOWA 3I2FA 1C28A 1WKYA 4PDWA 2VULA 2WS93 4OYUA 1JZ2A 1UW8A 3QACA 4EWAA 3K4AA 2EA7A 3W21A 4AYUA 1BBT3 4JV4A 5C9AA 4S2HA 1UIKA 1VBC2 3K4ZA 4PLOA 4OHXA 2AYHA 5KBFA 1M06G 5EQUA 3A0KA 4YVWC 5L7OA 5HXVA 4CCCA 1IOAA 3Q8BA 3KQ4B 4Q4W2 4UBHA 4YW3A 4HPKB 3VHPA 1Q8SA 2EAAA 1APNA 3KF3A 1P8JA 4TSVA 1YFWA 3M4FA 4ITCA 1NCRC 1IQAA 4KGGA 4N90A 3WW4A 2VUJA 1IS4A 1S0IA 3ASIA 1ZYBA 2VNOA 5F1RA 5F3CA 1ODMA 1NY72 1FV3A 1F31A 2RS31 4UF0A 1XRUA 5BUVA 2FCVA 1GZCA 1K5MC 4C1WA 3VBHA 1HN1A 5CB7A 3MLKA 3WG1A 4MG2A 2JEMA 2VZ1A 2R7EB 4AG4A 3GF6A 3CL1A 5DG1A 2DCKA 2CU5A 3GBGA 4Q4V1 4DRRA 2VVFA 2CAVA 2D5FA 3UJQA 5JI7A 2YMZA 1EAH3 1QXJA 1OI6A 1RUE3 2EAKA 1W8UA 1CAVB 1VLNA 3QBQA 1Q5OA 4EE2A 2YPJA 4EWEA 3M3EA 2Y6JA 2ADDA 3QH6A 3WF1A 3CU7A 3T2OA 3BTXA 4Y22A 4H55A 2DU1A 3BTAA 5FTTC 2ARBA 2CYFA 2RS32 2JG8B 1O3SA 2PFWA 1ZZ8A 2BGPA 3RWKX 4LORA 4Q4Y1 4RS5B 4HMZA 1GQPA 5EPAA 4CU9A 5EYYA 2R1DA 4GWNA 4A42A 3USUA 2XJVA 3VL8A 4PF5A 1WCQA 3WF0A 5DAWA 1FPN1 2DVAA 3MW4A 4Q4V2 4JVAA 5JSOA 1GBGA 4DUXA 2RM23 5I8SA 4WM8B 1UYZA 4JKLA 5FZ0A 2OKXA 3SC7X 3VBRB 4I0BA 2P3IA 5JUVA 2BERA 2W46A 4XUPA 2PYTA 4N43C 5LBFA 4Q27A 1YJKA 3ZFFB 2VTXA 3UYJA 3IB3A 3H0OA 4U2AA 1W03A 1BVVA 3NNFA 2AREA 2GNMA 2YBKA 4HKWA 1X9PA 5FYSA 1C1FA 4W6XA 5J96B 2ZPXA 1GSLA 2ZEZA 3FHQA 4UFJA 5IVYA 1MS4A 2WZR2 1UXXX 4IEVA 1EYBA 4XBNA 3LAGA 3UGHA 5C3SA 4META 1W2TA 3JD71 5FY8A 5J98B 4MX3A 3AYEA 3R4UA 5K7PA 1W9SA 2RVAA 3ZSLA 1W6MB 2D5HA 3AVRA 3JXSA 1BMV2 4H3WA 4IE7A 3TRSB 1QOOA 2FZ2A 1X33A 1FPN2 4JGYC 2XPJA 1YRZA 3J26N 4BH9A 1G9FA 3VBSB 2WA4A 5L19A 1O3QA 1RHI1 4A3ZA 2GDFA 2GALA 2K46A 2WNVC 3J7MA 1JHNA 3VD7A 2RR13 1BQPA 3SH3A 4ES8A 1H1AA 3VBUC 3KMHA 4AEDC 4CDQC 1RITA 2BQPA 3CO2A 2OPKA 4KWKA 4D7YA 5JOXA 1V6IA 1VBD3 2RMU3 4RR3B 2MNGA 2ZGNA 1D0GA 1GICA 1GOHA 1I5ZA 4AFMA 1BK1A 1RUG1 2DBIA 2Q1ZB 2W1QA 4B1LA 4FTEA 3K4DA 4L11A 5FXWA 5LA2A 2A6WA 2VOVA 3I49A 1DQ2A 3M1HA 1N1YA 3E1F1 3SITA 1ZZ6A 2ZTNA 1LHWA 3OBZA 5H9RA 4CDXB 2CGNA 3ZXAC 2DVDA 1WMFA 5G04L 4B29A 2WNUB 5FV3A 5A33A 3WT3A 1U5XA 4NO4A 4D3WA 2VE1A 4COUA 1YYNA 1ZBE2 2X8KA 1C5IA 2AGSA 2RDNA 1L7RA 4RN5A 5FYIA 3GHNA 4LO6B 1PNGA 2YFZA 3IDCB 4JHZA 2XONA 3EBRA 3T1MA 5IATA 1RHI2 3TNPB 2VXRA 5IK8A 4XDPA 1AR91 2W5FA 3DL3A 5A3OA 3SCFA 3M8LA 5FAXA 3HD8B 3LPGA 4YNIA 3OUIA 1LOCA 3DN7A 1UU5A 2HWC3 4X6QB 1RUC3 1W9WA 3I3DA 3I54A 4K3UA 5FY4A 5LRSA 4C91A 4HOOA 2BYVE 1U12A 1W39A 5A6XA 1JZ4A 3NV4A 2ZX2A 3I8TA 1HRV3 1GLHA 1LHUA 3ATGA 3AYCA 4BPZA 1BLZA 1KFUL 1XNKA 3OY8B 2HBTA 3ALQA 4P9IA 1W9TA 2A7AA 5KWRA 4YYOA 3OD0A 1W0PA 2X09A 3FUOA 1WA4A 1Y7BA 2WQ4A 1UMIA 2JD4A 1S55A 1Y9MA 4IV3B 4M00A 3B93A 4Q0QA 3LOIA 1AXZA 4EV0A 2P2KA 4GMP3 1VMHA 2IWGB 2CV6A 2IXCA 4XYXA 3SCGA 4X8PA 3WINE 2MEV3 1CQ9A 4JGYA 1AX1A 5GALA 3B3QE 4GZ9A 4NPLA 4LBMA 3GXUA 2D98A 4FQZA 3FJSA 2WNVA 2VM9A 3BOWA 3NKTA 4MZUA 1OHFA 4L9BA 2Q5TA 2JDKA 3RWNA 4AEDA 4CDQA 4YM2A 5B4XA 3NW4A 2SLIA 4AI2A 3W58A 1H6YA 3TN93 1DFQA 1F15A 4JGZA 1MQTA 1RVF1 3ENRA 3KD4A 4JQRA 4Q4X3 5FZGA 3O1UA 4ATEA 4CDUC 3BTYA 3U07A 3H50A 3M3CA 1U5ZA 2VU9A 2E32A 4XHBA 1Q3EA 3ZLIA 4AFBA 1XU1A 3FBYA 1NG0A 1JU3A 4RD7A 3RZGA 5FMOL 3AZVA 3F2ZA 4BZ4A 3OBTA 4FI9A 4RGGA 3O1TA 2NP0A 1RGSA 4Y1ZA 3OSDA 3OYWB 5FQ0A 2AENA 1YHFA 2BFUS 2Y60A 4M4PA 4MYEA 4G3YC 4R9AA 4LITA 3WQ1A 2BGCA 1VBC3 3J8F2 4FOVA 4XW3A 4I0WB 4D7TA 1SBFA 4EN8B 3LA2A 1GZTA 3I59B 1CR7A 1MR5A 4CCOA 2ZKNA 3ACGA 5CG8A 1YC61 2WO2A 2B42B 3NNLA 5DZGA 2QQUA 4LOSA 4EQVA 3Q8CA 4K1YA 3K46A 2ENRA 2ZMLA 5CADA 3CMGA 2W1SA 2WYFA 4QU2A 2EXIA 2HWB1 1QH6A 2WFF1 4QXCA 5C4WC 3J7HA 3ZYRA 3DPRC 1K42A 1GWKA 1W6QB 4LBQB 1LOBA 1STMA 5E89A 2CWMA 1HXS1 1I5PA 1UN1A 4JC1A 2TNFA 1VMFA 5D8AC 3RSJA 1OH3A 3AL5A 3VBFC 5LRRA 2P3JA 5F39A 5ACA2 2VMDA 1A6CA 4TZDA 4HONA 1MEC1 4Y1UA 4XJWA 4HSJA 2QJVA 3HAGA 3THTA 3N3HA 1UY4A 2JECA 4RQPA 4NIIA 1CX1A 2D44A 3ZYPA 4E4HA 3OEAA 4IL7A 3NNGA 4WZCA 1QKQA 5ANNA 3WEZA 4M3CA 2D3RA 4YZ5A 5BNNC 2XLFA 3KCYA 1W90A 5LCWL 1Y9GA 1UYYA 3JZVA 5LA0A 3S5AA 4OZOA 3ZR6A 1OF3A 4L8QA 4R9DA 1A8MA 1W06A 3HOBA 1OA3A 1XNBA 1PGW2 2HWB2 5H9PA 4PHZA 5C3QA 3KWVA 3MUZ1 4INDA 1AX0A 5JXGA 2RS51 1EUTA 2RS11 1ZRFA 3SCHA 4CDUA 3UNPA 1HXS2 4QPYA 4KL1A 4BCUA 5K0UB 2F17A 3IKWA 3T1LA 1QJX2 1VIWB 1K5JA 1HRI3 2WIIB 3UESA 3NAPB 3ZFEA 2R1BA 4EZ4A 5EYXA 3NJVA 2VCMA 5LEKA 1LKNA 3IPVA 3RI9A 4GULA 1JUHA 2VPVA 4J1XA 2W08A 2GH8A 4JTOA 4KBZA 1GZ9A 5ERLA 1J3PA 1REEA 4JTNA 4XF3A 3V0BB 1AUYA 2W2IA 1RUH2 3OPWA 1KD7A 1MZFA 3BVCA 4LIVA 4XBLA 2FCTA 2N7GA 2BDRA 3ZXFA 4QX5A 1QJU1 4YFZA 2WT2A 3BODA 1EP0A 3UT0A 4DNYA 4JKKA 4O65A 2WZR3 3QLQA 4PBPA 4RGKA 1W2UA 2K9ZA 5E6HA 2A1XA 4LULA 4JRLA 3RDIA 3U0ZA 1PK6B 5FY0A 3IMNA 3PUHA 3DXTA 3BKZA 4CU6A 5CISA 4UWDA 1L7QA 4D0QA 2WR9A 5D8AA 1REFA 1S0GA 4D69A 4WVMB 3FWEA 4BWOA 1FPN3 1H2MA 2JKBA 4CP1A 1GWLA 1YFYA 3VD4A 3VKMA 4P08A 4QDRA 4QKNA 1U5YA 2EXKA 2VMFA 3GYDA 1GU3A 5T5LA 3NL1A 2BWCA 2XMLA 4MH0E 2IZWA 4MLOA 5DUXA 3B7MA 1WBLA 1E5SA 4BE3A 5LZ6A 4QPIC 3TB0A 1J3RA 2E7AA 1V6KA 1QJU2 1B35A 1VAKA 3EHKA 3ZYFA 3W5MA 1DYPA 1BBT1 1EPWA 4XILA 1SFPA 2BNMA 5FP8A 1SLAA 2YV8A 4AW7A 2CNAA 3T3YA 1ND3B 3THCA 4I3GA 2ZAHA 3B01A 2VR4A 5EP9A 2W47A 1POQA 5CEHA 1DLCA 1ZBE3 3AL6A 3WVJA 4ATFA 5IVEA 2WWJA 3OEBA 1YQCA 3DYMA 3VD9A 4I01A 1RHI3 3J7LA 3ZKYA 2RJKA 3B00A 5A7NA 1LAJA 1N3QA 4TWTA 1YI9A 2RJLA 2LTNA 2YGMA 4HETA 1WLTA 4QX0A 4A7ZA 5CBLA 1JYWA 3RJ2X 3EXUA 1BJQA 4V2WA 3E6BA 2YU1A 3N9NA 4LHLA 1NAEA 3VN4A 2YXSA 5HBAA 4HVQA 2HWD3 5KR7A 1LECA 2Y6LA 3GGLA 1W6NA 1ENQA 2WQZC 4AQTA 3J4UH 3RZHA 2DVBA 4AE2A 4HN1A 1EAH1 2R0HA 2MPFA 4LBLA 4P9YA 1RUE1 3BCWA 1F2NA 3VBOA 1EV12 1XQNA 5F7UA 4FO9A 2QTWB 3IIIA 3ZFFA 2XLGA 3OBAA 4R8HA 2ZEWA 5E16A 1N1TA 5GZCA 4AVVA 2UURA 2P5BA 4CPBD 5L36A 2Z42A 4OHZA 4M0NA 4MGQA 4QX8A 2WO1A 4YVWB 3PNAA 4B1MA 4CDWC 2DCZA 1JW6A 5FY9A 3OG2A 3RQ0A 1S1AA 2XWJB 1OVPA 2D6LX 3I2JA 5FZ8A 4XPVA 5F37A 4HVRA 5FP7A 5DN2A 4BU2A 3KHBA 1PX3A 4LE3A 2ZGOA 4LQRA 4AQSA 4ORFA 1NCRB 1O6UA 4DEQA 4AF9A 4KNCA 1V6JA 4FPFA 3FHIB 1N3OA 4PIZA 4BQ2A 5FWJA 3RRDA 4XAAA 3ZN6B 4IV1A 4BQYA 1C57A 1K5MB 2VUDA 5FPVA 5LA9A 1UF2C 3IDAA 2RM21 5CFDA 1I1EA 4CP2A 1JODA 2QFEA 3WSOA 1RUE2 4HVOA 2NZ9A 1W6OA 4Y3OA 5FO9B 2D6KA 3D0SA 3LEMA 4URAA 1UZZA 4MHUA 4V1PA 4NROA 3VKOA 4LNVA 4BQ3A 2JDMA 1JS9A 2O0OA 2ZX3A 1GNYA 4COVA 2W94A 3RI8A 2JIJA 1ULEA 3LA3A 3H1YA 1F4HA 3BPZA 1Q8PA 3U14A 3WR0A 1RJ7A 3HQUA 1GZWA 1J83A 3J8F3 4HN0A 3ZFGC 4AFDA 5A1FA 5JDBA 1YI7A 4QPGC 2WRAA 4LJHA 2OA2A 2D6OX 2BU9A 4U36A 5FMCA 3ZSEA 4XFAA 1QY4A 5T3NA 4BMBA 4XFBA 2OIIA 4CCKA 3ABZA 4XUOA 2P37A 5C5TA 4XQDA 3L9JT 1V6NA 2WKKA 3AP4A 1O7FA 4LT5A 1PZ7A 2RM22 1LJ7A 2VAUA 3R0RA 4K7JA 1UAIA 4MGKE 1LTEA 2NYYA 4LKDA 3UGGA 1QNYA 3TEWA 1PGSA 3AM2A 4OQ9A 2PAEA 4B7KA 2RR11 4HSLA 4COWA 1Q8QA 2K2SA 2ZZJA 4PLNA 5D21A 3N4MA 2B9UA 2DCJA 4QHBA 3GZUC 2NQYA 2CDOA 5F3EA 2VNVA 1XYPA 2RMU1 3MW2A 3CIHA 5ACA3 4N43B 5FPXA 4W50A 1XNAA 2R49A 1R1ZA 2DFBA 2QQVA 2R043 2V09A 2WA3A 1JU4A 5FK8A 4B8EA 1SCSA 1RC6A 2TBVA 4CP9B 2EIBA 4BOWA 2Y0IA 4DFSA 3RGBA 4EZHA 5ANQA 5BNPC 2AZ5A 1JI6A 1O4ZA 2ZA9A 4YVSC 1H1MA 3NJYA 2QKDA 2A5ZA 2HWB3 4KWLA 2X5IC 3B69A 4NHLA 1JOJA 2RDRA 1V9U2 4QM9A 4XCAA 4A6OA 3IZOA 5IFPA 3NJZA 5JXJA 4R9BA 2QZ3A 5BNOB 3ETPA 1ULOA 1JHJA 2VMIA 2DUOA 1HXS3 2VOWA 2XJUA 4LA3A 2PHXA 2BFUL 1OOPC 3LEIA 5EXOA 1VBE2 3P1IA 5DQ0A 1V6OA 4KU8A 1QJX3 2J1VA 2HWC1 1RJ8A 2R32A 3NO8A 5FZIA 1RUC1 3UV9A 2ARXA 4UW4A 1CAWB 1E5RA 4NPMA 3TWIA 4HFSA 1LENA 3VBUB 2P4EA 5LW9A 3WNOA 1T2XA 1LCLA 1FX5A 1HRV1 1W04A 4BM8A 2AUYA 1VP6A 4XDQA 4LEJA 4PDWC 3VHOA 1YIPA 1NT0A 5BYNA 3HR9A 2JDAA 3ME2A 1AXKA 4K8RB 1LGCA 1RUH3 3ZFGA 4MHRA 2D7FA 1QJZA 1OD5A 2VVDA 4QPGA 1ODNA 4XZPA 4OCTA 4EN0A 1HIXA 5A32B 1AL22 4ZXKA 3VDBA 1ULFA 2HKXA 4IUGA 5C9AC 2BP6A 1ZVFA 2B9VA 4LLOA 3ZO0B 2IXKA 1S0JA 3IN9A 3CJIB 4GMP1 2VZRA 2EIDA 4LKEA 1SEFA 4RHV2 5C6CA 2GC0A 1CJPA 2MEV1 4A4AA 3RZKA 5L7OC 1GYKA 4OUSA 3M2MA 2WZ8A 3CEWA 2XR4A 2VQAA 4ASMB 5DAQA 2YROA 4J1WA 3RZZA 3WV6A 2P17A 1RUJ2 5I0UA 4AOCA 4E2GA 5JIUA 2HWC2 1GR3A 1IHMA 3O7OA 4QGNA 5I93A 2BGOA 2W52A 1CZVA 2ZMKA 3N9MA 3TN91 1IPJA 4Q4X1 3U37A 1ZA7A 2YC4A 1JYCA 3ILRA 2HWF1 3ECQA 2XVGA 2VUAA 4XUTA 4Y1VA 3W59A 4NIHA 2ZGKA 3VBHC 4QD2A 2VZVA 2PMWB 2YB7A 4Q0PA 4CUBA 3MFCA 4IEXA 1UY1A 1KS4A 3P6BA 5EZWA 3O1VA 5F9TA 1RUNA 1W8OA 1NCQC 3P5BA 4CCEA 1DGLA 3NJXA 3V56A 4PIYA 1MPXA 1TG7A 1WLDA 1BZWA 2B39A 2HWE2 4AK3A 3CDZB 5LASA 3WNNA 2MEV2 5I8TA 1VBC1 2I2SA 1DGWX 4E9KA 3ZYJB 2PLV1 4I0AA 5LEJA 1F8VA 1LHVA 1G9CA 2LRPA 4M4RA 1Z78A 3VZLA 1VPHA 1OUXA 5A7WA 4TLFA 5DG2A 2ZX4A 4EN7B 5JLVA 3PUAA 4K8FA 2GC2A 3VGIA 1XPWA 1LNSA 3CZJA 2HWF2 4BHPA 1TME2 3LZZA 2VMGA 2W1WA 4IE4A 1NY71 1REDA 1CZTA 2JDYA 5A3TA 1NZIA 2DUQA 4FPEA 5K0UA 2WINB 4P9XA 2WWUA 5CKNA 3WDUA 1SQ4A 3KS7A 4LBJA 1XYNA 5SV5A 4DB5A 3O1PA 1FAYA 4L92A 3H8XA 3NNJA 1PO21 3PJQA 3KT7A 5FZMA 3N7KA 3MV11 5F6LB 1NQDA 1OKQA 1OXCA 4RFRB 2QUOA 2PLV2 1UZWA 2O8OA 4BA6A 4Q8LA 1EV13 3ZSJA 5HV0A 5KHJA 1SBEA 2G19A 1MZ6A 1AX2A 1V6MA 4OHWA 4DO0A 1JYTA 3I2GA 1K45A 2OQ7A 4ASKA 1E5IA 2JDNA 4NRPA 4PQ9A 4B3NA 1WLCA 1UXZA 4XUNA 3RZMA 4K20A 4XURA 3MIBA 1YJLA 5ABJB 3V65A 2ZS6B 1QQP2 2X53S 4NN0A 4QU1A 4QX7A 1PVXA 4MGSA 4MVTA 4Y20A 4P5HA 3WHTA 5IK5A 4AHZA 2X10A 5C4WB 2ZACA 5KXEA 4Q0UA 2VUCA 4CU7A 1KITA 3DPRB 5DAPA 3QCWA 1HRI1 4I02A 2YBPA 1QXPA 4FT8A 1WGPA 1PO22 1NCQA 3KB5A 4UYBA 3MPPG 3RNSA 1IZ3A 2OZ6A 2V5YA 4HBNA 1SG3A 3ACFA 1YUDA 3VBFB 4BIOA 4FCAA 3C8XA 1J84A 2DCYA 5CFCB 2FD8A 1X36A 3BUCA 3ZXGA 3T2PA 1CAXA 4XTPA 1FMD2 5DXDA 3W9AA 2ZHNA 2A73B 4BK5A 1W6PA 4FP3A 3VLBB 3WP3A 4Y24A 4XIOA 3DCQA 3TEYA 2CTVA 1O4TA 1IG3A 5AVPA 1IPKA 2RHPA 1VRBA 3RG0A 2WZR1 5F2WA 4MOAA 3DV8A 4OULA 4E8DA 5CA6A 4CVUA 4FSJA 4B4RA 3ZYBA 4A44A 1GFF2 4F83A 3POYA 2VCCA 3IIAA 2W95A 2ZJCA 4IEYA 3KCCA 1KDKA 4AI0A 3A0NA 3ST7A 4J6GA 1HRI2 3ZDSA 2OUJA 2V72A 3LF7A 4XXAA 3MYXA 4IE5A 2NLRA 1G8WA 2JWPA 5I0SA 2X29A 5A6QA 2YC2A 3MDPA 1IS6A 2XUMA 3M3QA 3F95A 3RPQA 4CRQA 1H9PA 3N9OA 3SEEA 3PTYA 4P9JA 1UZ0A 3LWCA 4XQ4A 3MIGA 4A2UA 5C8CA 5LBBA 3RMYA 5IVBA 5C3PA 3MI8A 2ZX0A 1OA4A 4IEQA 5F8PA 3WF4A 1CAUA 1HKDA 4WM7A 5EV7A 3I3MA 4GXLA 4DXRA 4ZU5A 3HVDA 4AEKA 1GWMA 4MXWB 5JXIA 1Q43A 2V5DA 5A80A 1H8TC 4DXZA 2QQNA 4MGTA 4XMAA 1SDWA 2BZDA 4LBNA 3DGTA 1HB3A 1Y9QA 3NRUA 1YQ5A 4LBQD 5CZKA 3WNPA 5DPNA 2J1TA 4X8NA 4F8AA 1ZBE1 1VBB2 3VDDC 4KI5M 1V9U3 5LY1A 4CA9A 3KV4A 3POBA 3LE0A 4I2OA 4FPHA 3ZOIA 1PVC2 5GLVA 2QQKA 4DY5A 1BXHA 5JMOA 2B8MA 4HK8A 4YVSA 3T09A 4YGEA 4ZU7A 4FPCA 1VBE3 3FHAA 1QMJA 3HN1A
chains in the Genus database with same CATH topology
4GMP0 4JGZC 2UWAA 1MQTC 4Y4YA 1CD3G 1PHMA 4S2FA 2HWD1 3IM0A 1LODA 2OW4A 1FT9A 4DS0A 1GANA 4AHWA 1UMZA 3SMHA 3GBFA 3LOBA 3ZMNA 4Z07A 3UJOA 3ZIXA 1WW4A 1RIRA 3U10A 1AL23 1J58A 4BQ1A 1XU2A 3NVCA 3ACLA 1DQ0A 1OSGA 3OTFA 3JBG1 4PBOA 2ET7A 2JXAA 4AGGA 4RHV3 4I30A 2Y26A 4YW1A 3ZXJA 5LK5A 4AGVA 4EJRA 5FOJB 3INAA 3FFQA 1RUJ3 3WQ7A 4W6YA 3KZ4C 1OFSA 2JG9A 4AEMA 2XVKA 2E7QA 3I2DA 2PHRA 2RE9A 4Y5Z0 5DZEA 4Q2FA 3POWA 2HWD2 4G4FA 5CVRA 5CIRA 5FFOC 4P9GA 1BYHA 4CEYB 4CEWC 1AYN3 4BYYA 5GZGA 1C3HA 1C8M3 2R072 1ENXA 1S0DA 3MFAA 3GNEA 4FTBA 3WDTA 1O4YA 3JUUA 3X29B 1H8TA 4AFAA 1PZ9A 1I3HA 2E7TA 4FPJA 3M70A 4QQLA 3ZSMA 4N53A 1ENRA 4KGQA 4RQPC 3DKWA 4ASLA 1I9RA 4GH4A 5JZGB 3E6CC 4QPIC 3ZYJB 1YWKA 1ALYA 2HWE3 3JBG2 4M3CF 2BUKA 1MS1A 2BNNA 2O8QA 4O9GA 3VDDA 3NV1A 3RJRA 2BPA2 3J8F1 5A3LA 4FPLA 4XF4A 1ZBA2 4CDWB 1SBDA 1J1LA 1IS3A 4N7UA 3ES4A 1JYIA 1POV1 2GAUA 4AI8A 2XL9A 4DMIA 3E5UA 3JQXA 1PO12 2E9QA 5DDJ3 3B02A 2HWF3 1E57A 1TME3 1ZRDA 4CTEA 1HDKA 5BNOA 1GNZA 2A6YA 4TYSA 2Q30A 3WCSA 2AR6A 2BW8A 1G9BA 4B4QA 3ZFEC 3ZMOA 1Q8VA 1FXZA 3R4DB 4YZ4A 5ACA1 5JPNB 1FI2A 1QOTA 5J36A 3ILFA 4RGAA 2B5HA 2R041 3TBDA 4DPNA 4UW6A 1XNCA 3FFZA 1AVBA 4HKOA 2PLV3 3HWJA 3JB4C 1DF0A 4QQPA 3J9SA 1ND2B 1LULA 1H9WA 5FO8B 1DZTA 1OLRA 2YDEA 1A78A 1CX4A 1PGW1 3CJIA 3D4KA 4Q1RA 3HBZA 2F6BA 1QQP3 4CEWA 2FMYA 1UCXA 2GN7A 2HYKA 2VOKA 2C1FA 4DQAA 2ZBJA 1QJX1 2XB6C 3H8UA 3M3OA 1DDLA 5GLWA 5T55A 1OFNA 1PO23 3AKRA 1AR82 1H2LA 1KJLA 2R042 1JN2P 4QPIA 3O0XA 4GQ7A 2GNBA 3MGUA 1LOGA 2VVEA 1RUH1 1FMD3 5J09A 5JIAA 1NA1B 1B35C 3E6DA 4XFFA 5GZFA 2QZ2A 3N7JA 1N3PA 1ZRRA 5BNPB 4IEWA 2WLPA 4YZ1A 1ZZ9A 4YM0A 5C8WA 1WBFA 4M0HA 2DVFA 3K48A 2X5IB 2ZGTA 1DYKA 5I0TA 4S2DA 4AGRA 3UKVA 4YLZA 2KM2A 1Y3TA 2ZHMA 3PMSA 1OOPB 3S7EA 1KDMA 3BIWE 4IETA 3MF9A 3H7YA 4XF0A 3HT1A 3H1WA 2CL2A 1AYM2 1OLQA 1YNAA 4QGMA 1RMU3 5FPZA 2PQQA 1VRH3 1Z7S3 2E51A 4PDWB 4KU7A 2VW0A 4WM8C 4XFCA 3ZYGA 4XXPA 3VBRC 1G9AA 4UW5A 4AVAA 2YYOA 3VBOC 3ZFFC 1ZREA 5C9AB 2H0VA 1TMF2 3RYRA 1JUIA 3H3UA 4QQOA 4GA9A 4NHKA 3E5QA 4FQ4A 1S0FA 1KRIA 4UW3A 4HPKA 4Q0SA 2NPIA 3S6PA 4AXOA 5I8YA 1VBB3 3ZSKA 1UL9A 5JPMB 3ZXDA 2EXHA 1AL0G 1TQ5A 2QQPA 1RUI2 3ILNA 1PVC3 5ABJA 5HCFA 1S0CA 1RINA 1JXNA 1BCXA 2ZGMA 3AYDA 4LA2A 4XQWA 1C8NA 3SHRA 4IV1C 1VJ2A 2BVBA 1UU6A 5I0RA 4MV2A 3VBHB 5CFDC 3NWKA 5DUVA 2IFWA 4XMIA 3VKLA 3KGLA 4GB31 4AFCA 3VZMA 1FV2A 3T2TA 3K51A 1IS5A 1EV11 2WSUA 3D82A 1CAVA 2XJQA 3KT1A 1R093 4LO4B 5KHKA 1RB8G 4WZFA 4K1ZA 3GALA 3FBMA 2CGPA 5DUUA 1XE7A 1FOD2 3O0VA 3GHMA 2EVXA 3KGZA 4CDXC 1QH7A 4E27A 3S30A 2JG8A 2NMNA 2E53A 1BMV2 3NSTA 3WNXA 3MICA 3QOPA 4RS5A 3NV2A 3SXWA 3AMQA 1ULGA 4IEPA 2EIGA 2A6VA 3IBMA 2LM3A 2KXLA 5FLIA 2XJSA 2A3XA 4Z8BA 1R083 3USUB 1F5JA 2ES3A 3IWZA 4WM8A 4B7EA 1DLLA 1M4WA 2H6BA 2R073 1ZZBA 2PHFA 4GB32 4GKYA 3USSA 3VBRA 4JDNA 3WD5A 5CADA 2CY6A 5GZEA 5E8AA 2ETEA 3WUDA 2PAKA 3ZXEA 4KQ7A 3MEPA 3WOGA 1RTVA 1UIJA 3O5SA 4YZ2A 3E97A 3JBG3 4HLTA 4XE9A 4WV8A 1RUF2 4N9HA 5L73A 4BLJA 1PGL1 1H2KA 1ZBA3 4FVVA 3P3NA 4OUMA 4AWDA 1AJKA 5FCCA 1DGWA 1W6MA 5KXBA 2Q8OA 1Q56A 4FOWA 1DQ5A 1PO13 4Z1VA 3VBSA 1C1LA 1BKZA 3FLTA 3IDEA 4YW5A 1ASJ2 4YFWA 3C3VA 5T52A 4QM8A 1ULDA 4XJZA 1V6LA 4OZXA 2WWSA 4RR3A 2ZMNA 4Q29A 3L2YA 5LK7B 3OD4A 1LOFA 1UX6A 2D3PA 5BY5A 2GNDA 1CVNA 1Z0HA 2VNRA 2NMOA 3H3ZA 1PGL2 4CDXA 1LOAA 3E5XA 3AMNA 1NE6A 2WNUA 3VKNA 2IXHA 5KHHA 3HT2A 1POV3 1GV9A 3PVNA 4B4PA 4C0BA 5A33B 3O0WA 3P3PA 4Z92B 2WC2A 3G7DA 1V9U1 2A3WA 2BEOA 1KS5A 2WT1A 1TE1B 1H8VA 4P9WA 1KXGA 4IXLA 4AVCA 1VAMA 1PIV2 3VZJA 3WUCA 2DF7A 5B2GB 1WCKA 1LHOA 4OI1A 1VBE1 5FO7B 3MW3A 3TNQA 3B5LB 4YM3A 2ET1A 2DU0A 1J59A 1UKRA 4CEYA 1AR83 3PHMA 3ELNA 2WNEA 1F5FA 2C0ZA 4E4DX 3OY8A 4AQ6A 5F6KA 5T5OA 3AP7A 1S2KA 1AL21 4IV3A 2ZZQA 3CLPA 5KC5A 2VY0A 2GMPA 3H1MA 4LO8A 3FC0A 5SV8A 4RHV1 5FDBA 1UU4A 4NOTA 4Y26A 2PHDA 4SLIA 4JGYB 4DRVA 1RUJ1 4MGIE 1PNFA 2WNVB 4KBBA 1UPSA 2PAMA 1TNRA 5GM0A 4AEDB 4CDQB 2ZHLA 4E2QA 1D2SA 1AYN1 1J3QA 2E63A 1C8M1 3Q9OA 3RMXA 5CU1A 3VV1A 5K0UC 4UXAA 1AYM3 1N1SA 3M7AA 2UY8A 3AKSA 4KWJA 2OVUA 4OFGA 3ZX7A 3OYWA 1HW5A 1ZNPA 5E88A 1YFUA 3SISA 2HWE1 4KG8A 2H0BA 1LU2A 2BWAA 3TYJA 4M01A 2VW2A 4Y1XA 4YGBA 4YZ3A 5EWSA 5GJ6A 3I59A 1TMF3 2YUEA 2XLAA 1ND2A 5H9SA 5JSPA 2A6ZA 4MXVA 1ZM1A 4XF9A 1CN1A 1HQNA 4FPYA 3VZNA 2GN3A 4X6RB 1RUI3 5DDJ1 5AVAA 1ZRCA 1AYN2 1TME1 3MIHA 4D7SA 1W6QA 1C8M2 4LBQA 3N7LA 3N7MA 4Z82A 5JCTA 4AI1A 5JOZA 1GKBA 1R1A2 2CGOA 2KA3A 4CYDA 1YCIA 3G6JB 2ZGRA 3ES1A 1ENSA 3PVBB 1LRHA 4GALA 4YGDA 3N36A 4W6WA 3QD6A 3JQWA 1AR72 1CJDA 1D4VB 1AR62 1DG6A 3WLUA 3FX3A 1OQ1A 2GMEA 3NV3A 3RYKA 3FLPA 3R4SA 4RQPB 4JDOA 4LO5B 1S0BA 4M3CB 3MIEA 5FOBB 2OYZA 4AHXA 5JAXA 1NA1A 2QNKA 5J37A 5K9YA 1NZCA 3TAYA 3DF0A 4Q8KA 1DIWA 1FOD3 1QF3A 3D6EA 3HQXA 5DDJ2 3RYPA 4HL0A 4JAAA 2PTMA 1NXD1 1X82A 3HMYA 4IEUA 1QQP1 2BVVA 2I07B 2XBO2 5FBZA 1SLBA 2WL1A 2GU9A 4CDUB 1WMEA 4NWWA 1BEV2 4WVZA 3NAPA 2ZABA 1W0OA 1CIWA 2I45A 2R063 3ZFEB 5BNQA 1OMIA 4GB33 5C8CC 3IPVB 1H30A 3V0BA 1LR5A 1AXYA 4A7KA 1EY2A 4WM7C 1FMD1 5CNAA 3OBRA 1X50A 2VQ0A 2XJRA 1WD3A 2ILMA 3AX4A 3GBWA 2FBEA 1NE4A 3UL2A 1WMDA 4COZA 3WDVA 1SLIA 1RUF3 1PK6A 3ZVXA 1TNFA 3KQRA 3B94A 3LKJA 5GKAC 4O9EA 1Y43B 5FRAA 1MS5A 4K40A 2TUNA 4WVMA 1RUD3 5J3UA 5D8AB 3WW1A 4OI4A 1OQDA 2ATFA 1QXRA 4IQPA 1ASJ3 3AMMA 1KFXL 2OZJA 3BOPA 3AZWA 3QH7A 4YVSC 3MZHA 2EF6A 1CPNA 2UWBA 1RMU1 5CG9A 1FYUA 1DZRA 4QQ2A 1VRH1 2Z69A 4Y1YA 4A3XA 5FLHA 3SH5A 4R9CA 1Z7S1 4FBFA 3OJBA 4XTMA 5BNNB 5K8SA 4XEZA 1FNYA 2IFRA 1B35B 4FPOB 4ISRA 1ND3A 3ZXKA 4MGZE 1DQ1A 2JDZA 2V73A 4L97A 1WD4A 3ZXLA 2SBAA 4XBQA 1VBB1 3VZKA 5C33A 3OGJA 3GZTB 5KXDA 3WDYA 1PVC1 1S0EA 2XJPA 1PIV3 4RA0A 4DINB 1RMU2 2JG9C 3EJKA 1VRH2 1JH5A 1GQGA 3D8CA 3PLQA 3ROUA 1DGRN 1Z7S2 1QGLA 1A8DA 3BB6A 1AJOA 3AXDA 1URXA 4C1XA 4LBOA 3CJXA 2ZAAA 2YC0A 1JTZX 3CF6E 2PHWA 1W6NB 4ZU4A 3FMGA 1R091 4N53C 5KXCA 3A4UA 3OF1A 3VBOB 1LEMA 4GH4C 4FP2A 3LB9A 2GC3A 4YGCA 1VR3A 2DURA 4QGLA 2DWRA 2DCTA 4YVWA 1VBA1 4WBBA 4DZGA 2Z2SB 1LGBA 4SBVA 2PA7A 4UBGA 1WW5A 2I74A 1NCRA 1PM7A 5CAZA 4QXKA 2D97A 4YG6A 4Q4Y2 3ZN6A 3VKFC 4R4XA 2NN8A 1K5MA 4OHYA 2G4IA 1R081 5E1RA 1SFYA 5BNOC 1MZ5A 4IV1B 4XFGA 3WHUA 2R071 2ERFA 4HK9A 3GZAA 4AVTA 5T5JA 4AVBA 5BXXA 5CFDB 2ZGUA 4AHYA 5LEJA 3ZIWA 1R092 3AJZA 4AI3A 4E2SA 2XHKA 1ULCA 1W6OB 5JOYA 2ZGQA 3TOJA 1LU1A 2XGXA 3B9IA 3WP6A 1MVEA 1V00A 3AP6A 2D40A 1VBA2 1RUOA 3WP5A 5JMCA 2GNTA 2A75A 2MHFA 4LUKA 4NR1A 3SLIA 1NXMA 1WUVA 2IC1A 1ZBA1 5JR7B 2HEWF 1GZWB 3JD72 1O5UA 2ZGSA 4MUVA 1AZDA 1SLTA 3CJIC 1YLLA 3U4XA 1PO11 1R082 1RL3A 2UYBA 2YZ4A 4GIQA 4IESA 4KG0A 4KH9A 1R1A3 2XL7A 3AP9A 4ISQA 1WCDJ 2VH9A 2XH6A 4WVVA 4M3CE 1OQEA 3WCRA 4N43A 1AR73 2HEVF 1QU0A 1AR63 3V0AB 4YRDA 1D4M1 1D0HA 1RUG2 2DTWA 2A70A 4Q0VA 2Z79A 4C0HA 1TEIA 2ZGPA 4P14A 2Q0AA 2IXIA 1SCRA 2XKPA 4AVSA 1LB2A 2JJ6A 2QDNA 1DHKB 4DY3A 2BTVC 1VAVA 5T54A 4LE4A 4RSUA 4EN6B 1BVP1 3HIFA 4YW4A 4K21A 2XBO3 4ES9A 1AR92 4I3PA 1UZYA 2DVGA 3WX5A 1BEV3 3URFA 1YFXA 1CAWA 3VBUA 4FPGA 3MIDA 1UPIA 1AR81 4GKXA 1D4M2 1G6NA 3KCXA 3AZZA 1VB4A 1B09A 3KT4A 2E6VA 3OPZA 4FAHA 5KHGA 2O1QA 4OHVA 4LLFA 4Q26A 4L2NA 5AC91 1AHSA 3ZFGB 5A32A 1WW7A 1CGPA 1T6GC 4QPGB 2DYCA 4URTA 2YGLA 4YM1A 3UKTA 5AFBA 4COYA 1C5HA 4S2GA 2W68A 3ZPYA 3APBA 4MSVA 1ZA4A 3R6SA 1G86A 2ZGLA 5I91A 3O12A 4FXGB 1YO8A 2IXJA 2VGDA 5HCAA 2UYAA 3M3IA 2VNGA 4Q4W3 5ABJC 2IXLA 4YARA 5IK4A 2B7YA 4NHMA 4YG3A 1RVF2 1QJY1 1AYM1 1O3TA 3L2HA 3U11A 2ZOEB 4C90A 2W0XA 4XJUA 1KQRA 5AC92 4ZKTB 4L99A 4FPKA 1SFNA 1OA2A 2PHUA 5CFCC 1QOSA 2D43A 1QHDA 1TMF1 3AXEA 4R52A 1OPOA 5GLTA 4N9IA 2XG3A 2ZHKA 3THPA 1UD1A 4FOQA 4WVWA 1MS3A 2HJIA 4IEOA 2JE7A 4LUMA 3FE5A 1COV1 3V64A 1OPMA 1RUI1 1H4HA 2JG8C 2WFF2 2ZCWA 3ZN5A 1QJY2 3CNAA 4Q1PA 1HV1A 2BNOA 4RS5C 4EN9B 3KLSA 2QDRA 1GQHA 3BU7A 4F7ZA 2RS33 5FREA