1N3QA

Pterocarpus angolensis lectin complexed with turanose
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
241
structure length
241
Chain Sequence
b'QDSLSFGFPTFPSDQKNLIFQGDAQIKNNAVQLTKTDSNGNPVASTVGRILFSAQVHLWEKSSSRVANFQSQFSFSLKSPLSNGADGIAFFIAPPDTTIPSGSGGGLLGLFAPGTAQNTSANQVIAVEFDTFYAQDSNTWDPNYPHIGIDVNSIRSVKTVKWDRRDGQSLNVLVTFNPSTRNLDVVATYSDGTRYEVSYEVDVRSVLPEWVRVGFSAASGEQYQTHTLESWSFTSTLLYTA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords lectin PAL
publication title Crystal structure of Pterocarpus angolensis lectin in complex with glucose, sucrose, and turanose
pubmed doi rcsb
molecule tags Sugar binding protein
total genus 51
structure length 241
sequence length 241
chains with identical sequence B
ec nomenclature
pdb deposition date 2002-10-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00139 Lectin_legB Legume lectin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1n3qA00
3AZZA 3IM0A 3SH4A 1WD4A 3DGTA 4K1YA 3FLTA 4P9WA 3RRDA 3USUB 5KXDA 2DTWA 5F9TA 2GNDA 1YI7A 1DZQA 1JBCA 2FMDA 1EPWA 1VLNA 1S0EA 1CJPA 4YW1A 4WVVA 4XXPA 3RSJA 1RITA 1W6OB 4HL0A 3TB0A 3WDYA 5GZCA 2C9AA 4LBKA 4RA0A 1C1LA 1AVBA 4R9DA 3B3QE 2E53A 1IS4A 4R9BA 3POWA 1G9DA 1QU0A 1MS0A 3AP4A 5DZGA 2A6ZA 2Z42A 1AJKA 3AJZA 3QLQA 2ZMKA 4XJAA 2AUYA 3HN1A 3N7KA 1JN2P 2NP0A 4XJZA 1QDCA 3ZSKA 1W6NA 4PBOA 4R9AA 4AVVA 4Q1PA 1KJLA 1JOJA 3SH5A 5KXEA 2AGSA 1UL9A 1YIFA 4GWMA 1GICA 3N36A 2JE7A 1LULA 4Z8BA 1OFSA 1LOFC 1DQ6A 2E6VA 1SLTA 2V5YA 1CVNA 1HQLA 4BMEA 3NWKA 4YGCA 5GZDA 4XIOA 3OBRA 1IS5A 1ULCA 1LHWA 2XB6C 4Q8KA 1WCSA 1DIWA 1GZWB 1FYUA 4Y24A 3NV2A 5EYYA 5T54A 3T2TA 1CQ9A 2ZACA 1ULFA 2DVDA 1S0FA 1B09A 3R4SA 1QOTA 5GJ6A 3AFKA 4AGRA 2CL2A 5JMCA 3AP7A 4D69A 3V0BA 4YG0A 4ASMB 1MZ6A 1F5FA 2A71A 1IS3A 2VW0A 1WW6A 3APBA 4XBNA 4AWDA 1X50A 3MW2A 3N35A 4BM8A 1WBFA 4P9YA 5GLTA 4LBQB 1SBDA 1Z0HA 5DUUA 4Y1XA 4XHBA 1AXYA 4BLIA 1QOSA 2UWCA 5DG1A 1G9FA 4GA9A 2A3YA 5HCFA 4FQ4A 1DQ0A 4TYSA 4DFSA 3SITA 4XBQA 1WW4A 4M3CB 3AZWA 1FATA 2YROA 2ZMNA 5DUVA 1SLCA 1LGBA 4DRVA 4FVVA 1GV9A 2DUQA 2DVAA 4GKYA 4XJ8A 2D44A 1V6KA 2ARXA 1FV2A 2SLIA 2ZBJA 4F83A 2VXRA 1LECA 3GALA 1Q8VA 5KXCA 1W6QB 3HMYA 2E51A 3OY8B 3H0OA 1CR7A 1N3QA 4PF5A 1W6NB 1ZA4A 2ZHLA 3FLRA 4FOYA 3ASIA 4YGDA 3PVNA 3RG0A 1S0IA 4BPZA 1N1TA 5HCAA 4Q1RA 2LTNA 2ZGTA 1DYPA 1O4ZA 4RL7A 1KDKA 5JOZA 2A6WA 2A75A 3BIWE 2UWAA 3WV6A 1C4RA 2W68A 1VIWB 2A6XA 1LEMA 2R0FA 4XZPA 3WOGA 1CIWA 1S0CA 3BOPA 4TZDA 1LODA 2I2SA 1V6MA 3M3OA 1SLIA 1WBLA 1ENSA 1R1ZA 4IQPA 1VALA 2DVGA 4YM3A 1WUVA 4JCKA 1KQRA 3NV1A 1H9PA 1IKQA 1YO8A 3FBYA 4P14A 1U0AA 1W6PB 4FP2A 3O0VA 2GNTA 3MW4A 2P2KA 3N7JA 3PVOA 4YW5A 3V0BB 1H9WA 3VKFC 1D0HA 1DQ2A 1SLLA 1AXZA 3JU9A 1SCRA 2A6YA 2H0BA 4UW3A 3L2YA 1AJOA 1TEIA 4YZ5A 3ILRA 1A3KA 1LOAA 2CY6A 1A8DA 5L73A 1V6OA 4KBBA 4XOGA 3BODA 2WKKA 1Q8PA 1VAMA 2G4IA 3UJQA 1QKQA 3I4IA 4ZKTB 1CPNA 3BTAA 3V0AB 4LBMA 2ZHNA 3O5SA 4FPCA 5CB7A 1D2SA 1DQ4A 3D6EA 1IOAA 2ZGPA 1DGLA 1ENRA 1Q8OA 3RS6A 1JHNA 1W0OA 1Z78A 2ZAAA 4P9XA 4YM2A 3ZSMA 5T55A 2C5DA 2RHPA 3W59A 3AYDA 2VU9A 3C2UA 1QOOA 1S0GA 4LBJA 4ISRA 4LBNA 2D6LX 4ITCA 1W6MA 4FPLA 3VKNA 4YZ4A 1G86A 3DUIA 5CA6A 1LOEA 4FPJA 2GMPA 2P3KA 2WLQA 3WCRA 1SACA 1JUIA 1LHOA 1LU1A 5GZGA 4DRRA 1JYCA 2ERFA 5JOXA 4YFZA 1A78A 3O0XA 2A70A 1DQ5A 2EALA 3AP9A 3AP6A 2D6MA 4XHXA 1O4YA 3NV4A 4WVWA 4DS0A 2D3SA 3WDTA 4ATEA 1UZYA 3RMYA 5IK4A 2D7FA 2AREA 3CNAA 5T50A 2JJ6A 2DV9A 3B69A 1PZ8A 1I3HA 1Y7BA 5EXOA 2D3RA 4FOVA 2P34A 3VKLA 4AVTA 1AF9A 1LTEA 1DHKB 3ZSJA 5IK7A 3N7MA 3WLUA 4Y22B 4XBLA 3IPVA 5CAZA 1LENA 3OYWA 3WDWA 2W39A 1JW6A 3UK9A 1Q56A 1QF3A 4FQZA 2AENA 1MACA 1LOGA 3UL2A 4HANA 2EF6A 3MPPG 1V6NA 2ARBA 1GZ9A 4FPGA 2ZZJA 3AP5A 4NO4A 2EIGA 3ATGA 1GBGA 2TEPA 2D6KA 2VUAA 4YGEA 2V73A 2D3PA 2A3XA 3I8TA 4WZFA 1HQWA 2E7TA 3PJQA 3VV1A 4ATFA 1AX1A 1WW5A 2ZGOA 3VKMA 1F9KA 3SLIA 2ZGNA 3B9CA 1C57A 4Q27A 3WG2A 2YZ4A 3ILNA 2EXHA 3OJBA 2ZGSA 1S0JA 2VH9A 3FUOA 2GDFA 1H30A 2PHXA 5DUWA 4YGBA 4U36A 4U2AA 2YMZA 4XXAA 2PHFA 1RIRA 3M3EA 4FPEA 3T1MA 1UX6A 1ULEA 4Y20A 3QCWA 1V6LA 3IN9A 5DZFA 2GMEA 3GNEA 4XILA 1IS6A 4UW6A 3AYCA 1DBNA 2A5ZA 2W08A 4XDQA 2ZABA 4FPFA 3LSEA 2DWRA 5GLZA 2SBAA 2GN7A 1KDMA 1S1AA 2WQZC 3JUUA 1LESA 1PZ9A 3B00A 5CBLA 4CZSA 1ZM1A 5GLVA 1NLSA 1W0PA 3AZYA 5H9QA 2YXSA 4BOWA 2PHUA 3ZXJA 2B7YA 5T5JA 3ZPYA 4Q8LA 2NM1A 2NZ9A 3O0WA 2ZGMA 2CTVA 1G9AA 1GNZA 1UZZA 2JDZA 2VW1A 5HCBA 4UW5A 1BKZA 1MR5A 1AX0A 4PBPA 4XMAA 1QNWA 1MS3A 4WV8A 1W6OA 2DURA 2EAKA 4Y1YA 4AGVA 2KM2A 1APNA 3KQRA 1SBFA 1BQPA 3IPVB 3RMXA 3U4XA 3D4KA 1HKDA 1S0BA 2EXIA 4Y1ZA 2Q5TA 1WLDA 2NMNA 3AZVA 5GZEA 2ZA9A 2ZHKA 2D43A 1LGNA 4K1ZA 3LSDA 5T52A 1CN1A 3PMEA 3AXDA 4I30A 1GANA 3AXEA 4XTPA 4LBLA 5CNAA 5DZEA 4YZ2A 1BYHA 1LOFA 3UJOA 5BYNA 5FRAA 1G9BA 4UW4A 4C1WA 4PQ9A 4XJWA 4CTEA 2WSVA 1I1EA 3WHTA 4AVSA 1DFQA 1UN1A 2DUOA 1LJ7A 4YLZA 2W52A 2OVUA 1G9CA 2JD4A 5EYXA 3PVEA 3M2MA 1ENQA 1N3OA 1GZWA 1UKGA 1UMZA 4H55A 2PHTA 1PZ7A 3ILFA 3SNMA 3SISA 3WG4A 3ZVXA 1KJRA 4FPKA 5GLUA 4XYXA 1GZCA 3AJYA 2CWSA 3R05A 4PCRA 4YZ1A 4NOTA 3N7LA 1ULDA 2P37A 1HDKA 2R0HA 4Y1UA 1ULGA 4Q2FA 4Q26A 3W58A 3VKOA 2ENRA 3POYA 2FHRA 2JECA 4LBQA 4BMBA 1MZ5A 1MS1A 5DG2A 5AVAA 1LGCA 3WCSA 2DYCA 1DLLA 3FUQA 4YW3A 3A4UA 4XE9A 3WNXA 5GALA 2DUPA 1LOCA 5F5QA 1BJQA 2OW4A 1MS9A 4CRQA 1V00A 3AZXA 4FPYA 2P3JA 4M3CA 3VUOA 1LHVA 4XIKA 1FAYA 1MS8A 4M3CE 5KXBA 3INAA 3OGGA 1RINA 3WUCA 2A3WA 2DU1A 3ZYPA 5JVVA 2OUHA 4M3CF 4XMIA 1QNYA 1AZDA 1KITA 4Y1VA 3OBTA 5FREA 1W6QA 5IK8A 4YM0A 4M00A 1GYKA 1MS5A 2VW2A 2WT1A 3M1HA 2DTYA 3OY8A 5H9PA 5T5LA 3ZXKA 1IKPA 5T5OA 4OZXA 5T5PA 2EXKA 1V6IA 2E7QA 1WW7A 3WVJA 1LU2A 2A6VA 2R1BA 5E88A 3IKWA 2D6PA 1GKBA 2HYKA 2JKBA 2ZGRA 5LK5A 5H9SA 1OQ1A 3FFZA 4AYUA 4XJUA 2ES3A 4YZ3A 3ENRA 5GM0A 5H9RA 3O12A 2OUJA 3MEPA 4FPOB 4YG6A 2WNEA 1QDOA 2R49A 5IT6A 5JLVA 5IK5A 3TAYA 1SLBA 2AYHA 1MVQA 1W6MB 2AR6A 1YRZA 1BZWA 1SFYA 2GMMA 3T1LA 1YYNA 2EXJA 1JYIA 1W6PA 2ZKNA 4L8QA 5JOYA 1GLHA 2A7AA 3V65A 1SCSA 2D6NA 2YY1A 3AX4A 4YFWA 1GNHA 1UAIA 3NV3A 3WHUA 2GN3A 1URXA 4SLIA 4LBOA 1UPSA 1WLWA 2DVBA 1QGLA 3HR9A 1N1SA 4XTMA 1SBEA 3WZ1A 1AX2A 3POSA 3AK0A 3V0AA 3A0NA 2WT0A 3M3CA 2ZGKA 3M3QA 1OKQA 2WT2A 4R9CA 1DYKA 1G7YA 1BXHA 3IMNA 1ONAA 1CONA 1GSLA 2UURA 3B01A 5E89A 4FPHA 5IUQA 1JXNA 2JE9A 2BQPA 1V6JA 2NN8A 3R4UA 1YXWA 1MS4A 1XQNA 3USUA 4JC1A 2DU0A 5E8AA 4DPNA 2ZGUA 1LEDA 4GALA 2ZGLA 1F31A 1AXKA 1N1VA 1WLCA 4YG3A 2D6OX 4YM1A 2YV8A 4K21A 3WG1A 2P3IA 3KM5A 3ZYRA 2R1DA 2CYFA 1LHUA 2NMOA 4K20A 1FX5A 4FP3A 1VAVA 4GXLA 4AGGA 1N1YA 4JRAA 5DUXA 3ZXEA 3OYWB 1LHNA 1Q8SA 2WSUA 2XG3A 2ZGQA 3MW3A 1LCLA 4FOWA 1DQ1A 2VY0A 3FLPA 3RQ0A 2NYYA 1N3PA 2PHWA 5GZFA 3WUDA 3LCPA 4YW2A 4DQAA 5JDBA 1WD3A 1FNYA 3WDUA 1KRIA 4MYEA 2GNBA 3AYEA 1Q8QA 2WJSA 3WG3A 3V64A 3AYAA 1NXD1 1QMJA 4GKXA 1SLAA 4C1XA 3ZSLA 2PELA 1J1TA 4ISQA 5DXDA 3ZXFA 2UU8A 2CNAA 3N3HA 3Q9OA 1FNZA 3SH3A 1MVEA 2CWMA 2UWBA 4Y26A 4M01A 2ZMLA 4YW4A 1FV3A 1G8WA 3OPZA 1C1FA 2GNMA 2PHRA 2ZHMA 4Y22A 4Y20B 2DVFA 5JOWA 1N47A 1CPMA 1HLCA 3A0KA 3WDXA 1S0DA 3D5OA 1CESA 4ZXKA 4BQ1A 5GLWA 4XJ9A 3WDVA 4GWNA 3ZXLA 4FOQA 2R16A 2GALA 2LALA 1LOBA 4BLJA 4W65A 2AH2A 5SV8A 4LBQD 5EWSA
chains in the Genus database with same CATH superfamily
3AZZA 3IM0A 4CCLA 4K1YA 2JIGA 5FZ7A 2C1FA 2DTWA 4WM7A 3J7LA 1YI7A 1HB4A 1VBB3 2WNVB 1EPWA 1VLNA 1S0EA 1RJ7A 4YW1A 4M0NA 1OA3A 2PN5A 4XXPA 3RSJA 3SCHA 3W58A 3TB0A 5GZCA 3KF3A 5BPXA 4LO5B 1O59A 2Y6GA 1ZZCA 3MIBA 2WNVC 4RA0A 1RUG1 2QDNA 1P8JA 2AC1A 4B8EA 5L19A 3FZ3A 3POWA 1RUG2 2NLRA 3AP4A 5DZGA 1AYM3 1AJKA 4XZUG 3S6PA 2AUYA 5IYYA 4EN9B 2NP0A 1AR83 3J26N 1BK0A 4P08A 4XJZA 3THPA 4BIFA 4EWEA 5ACA1 3ZSKA 1W6NA 2Q8EA 3KZ4C 3U1XA 5C3OA 4LO7A 4QX8A 3SH5A 4D8MA 5ACA2 4NAMA 4HK8A 5KXEA 1QH6A 3MLJA 1CZVA 1GICA 5FYHA 4AK3A 2JE7A 1F5JA 1W2TA 5DQ0A 4QPIC 4E4SA 4QPGA 4COZA 1XE0A 2QTWB 3C7OA 1VPHA 1HV1A 4XABA 3RWNA 4YGCA 5FYIA 1WMDA 1IPJA 1BHGA 2QZ2A 1DP0A 4MV2A 4OCTA 4QDSA 5FYUA 1PO23 2X29A 3E6CC 1GZWB 2BFUS 1A8MA 1ZBA1 2E7AA 2OXBA 3ALQA 3PUAA 3L9JT 4FFGA 4HPKB 1R081 3IDBB 4I3PA 1REDA 1S0FA 1DLCA 4DUVA 5JMCA 3MIEA 4XF3A 3VBOC 3WP3A 3VN4A 2P1BA 4XBNA 1WW6A 4AWDA 5FZ6A 4OI0A 5LA0A 4JZRA 4A7YA 1ACCA 1BEV3 1Z0HA 3M3IA 3H8OA 2J42A 2VO5A 2VBDA 4BLIA 3UKNA 1O3QA 4DY5A 1CAVB 4HFSA 4MXWA 4NRQA 4GA9A 1FMD3 4XQ4A 4JQRA 1AL21 5BUVA 5KHIA 2VCMA 3I54A 3RZGA 2E32A 2VZVA 1OC1A 1HQNA 5KHJA 5FOJB 1PX3A 1AHSA 1SLCA 2X5IB 4KU8A 2DUQA 2VZ3A 4Y4YA 2ARXA 4BYYA 5FZHA 4NIHA 3WY6A 2WZR1 1DCSA 1LECA 3GALA 1Q8VA 1B35A 1W6QB 4N43B 5T3NA 1RUH2 3HMYA 1TME2 1RUH3 2WZR2 3KT7A 1TME3 1O8SA 5L9BA 1OBNA 3HT2A 3MV11 4OYUA 1O5LA 3BN6A 3QBQA 4MZUA 2XVLA 4Q4X1 4IV3A 4I0BA 3JQWA 5FBZA 2WFF2 1KDKA 4Q4X2 4A2UA 2A75A 2WFF3 2VC9A 3NRUA 3LB9A 3G7DA 3WOGA 1UW8A 3BOPA 4NMIA 3VZJA 2LRPA 1LODA 2G1MA 4IEWA 1UPIA 2VAUA 5FPZA 4TZDA 5IATA 1TMF1 1H9PA 3H50A 1TMF2 1IKQA 1U0AA 2WC2A 5K0UA 3O0VA 2PHDA 3N7JA 3SHRA 1E5SA 3KCYA 3PVOA 2DFBA 4XETA 2VVDA 1H9WA 1PMIA 3VKFC 5APAA 2VOXA 2VZRA 2VCBA 2Q8OA 3S0MA 2O0OA 1W05A 2Y6KA 1LNSA 1ZRIA 4AQ6A 1IHMA 3OGRA 4D7SA 3VDDB 4PIZA 1TEIA 1W8FA 3OBAA 5A32B 3C3VA 1YQ5A 3ILRA 1A3KA 1REFA 1NCQA 1RUC1 4KBBA 4O65A 3WQ1A 2XWBB 4QQOA 4XOGA 5D2AA 3UETA 5FZEA 1K5JA 2VZTA 1RUC2 3ETPA 5K7PA 2Z2SB 4G4FA 2V72A 4FPCA 2P4EA 3NAPC 5LA1A 2CSGA 3DCQA 2XLGA 4BQ3A 4OQ8A 1E5RA 1ENRA 1COV3 3ZMNA 4DXTA 2Q4SA 2C5DA 1HXS3 2VU9A 1UY0A 1VBA1 2Q1ZB 3JD71 4LBJA 3ZFEA 3ZYFA 5CKNA 3H7YA 4LBNA 4P9LA 2WYSA 1W6MA 3JD72 2D5HA 1UXXX 2VOVA 2HWB2 1UQXA 2HWB3 2Y34A 3ACIA 3WW2A 1ZBE1 2G19A 1HN0A 2VBPA 3GHNA 1UY1A 2VQAA 4YWAA 1ZBE2 3I2JA 1IQAA 3POJA 4UBGA 4PIYA 4MGQA 2P6CA 1LU1A 3A22A 1JYCA 2V4AA 5FZ1A 4YFZA 1VB4A 1TG7A 2UYBA 3VHNA 1AR61 4R52A 1ASJ1 1IZ3A 1YFYA 3AP9A 4BWOA 3VHRA 1O4YA 2GAUA 1MQTB 2JDMA 3CBNA 3NV4A 4WM8A 2Q8CA 1AR62 2ATFA 1UZYA 2XKOA 5C3QA 2D7FA 2AREA 2VMFA 5T50A 4J1WA 4AEMA 3LA2A 5C4WC 1L3JA 1H6YA 2GZWA 1A6CA 4JGYA 5LATA 3LPGA 3KLSA 5K4LA 5LA9A 3SMHA 5FKCA 1QJFA 4FOVA 3J7MA 5C3RA 2D40A 5JCTA 1SDDB 3AKQA 3GZEA 3POFA 1RTVA 3ZSJA 4AVAA 1GP4A 4AXOA 2XWJB 4QDRA 3OYWA 2VTXA 3NNFA 3ZN4A 3UK9A 5GKAC 2Z5WA 1UY2A 3HBKA 2AENA 5FFOC 3ACLA 3OF1A 4NIDA 4FPGA 1QJY2 4NO4A 1QJY3 4YVWC 4QKDA 1UOGA 3DYOA 4R4ZA 5LCWL 1PMHX 5DMYA 4KG0A 3TN93 3Q8BA 1NA1C 4WZFA 4QGLA 1HQWA 1UO9A 1W39A 3O7OA 4JTOA 3VKMA 3I3DA 5A3MA 2FDHA 1C57A 3HWJA 1UX7A 3OGJA 4OI2A 5DDJ3 2DFCA 5IAVA 2ZGSA 4I2OA 2VH9A 4WM7C 3KD4A 4AVBA 2QQMA 1W9FA 1TZOA 4RHV2 4U2AA 2YMZA 1XE8A 4K40A 1QH7A 2OQ6A 4MH0E 3MO4A 4RHV3 4R8HA 1E5HA 3T1MA 4AI1A 4CUCA 1UX6A 1OFNA 3IN9A 4IEXA 4MXVA 4XILA 4UW6A 5JZGA 4S2HA 1PVC1 4CE8A 4FPFA 3RZZA 1CWPA 1KDMA 2QNKA 4HVQA 2RS53 1PVC2 1YWKA 1BLZA 3KGZA 4LJHA 5A80A 4MHRA 1BVP1 3AZYA 3HEIA 3PUQA 2YXSA 4LHKA 5H9QA 4JAAA 3RVHA 3SEEA 4QPGB 4ZU7A 2B7YA 3ACGA 4AI2A 3WT3A 3ZPYA 5CEHA 1TNFA 5IVBA 4XQWA 2G9GA 2HWD3 5F2SA 5F5IA 1HJFA 4QMAA 5HCBA 2RS31 1KD7A 2FDIA 1DZRA 3IDEA 3HT1A 1W6OA 4WV8A 3ZXGA 1E5IA 2ZEYA 5IVCA 3PDQA 2HWC3 3N9MA 2DCZA 5C33A 3IPVB 2WAOA 4OHXA 2F4PA 1X8EA 1HKDA 3MGUA 1XNKA 4URTA 3ZMOA 4CU6A 2Q5TA 3UGHA 2NMNA 3CO2A 3WXPA 2FQPA 4JX0A 4K1ZA 2ZCWA 5T52A 1R1A3 3PMEA 2GH8A 3AXDA 5CNAA 1GANA 3PUHA 4LBLA 3GCXA 1BYHA 2ORXA 3S57A 4KQ7A 1GP6A 4QM9A 2OPKA 4CUGA 4MXWB 4IEUA 1OD5A 1FPN3 4YARA 4CTEA 1DFQA 2DUOA 2PQSA 3OD0A 4YLZA 5FV3A 1WCQA 2OVUA 5IVJA 4MGYE 4NRPA 1GQHA 4Q0PA 4XC9A 3ZLIA 5FAXA 2WLPA 3PVEA 3O1RA 1ENQA 1QJEA 1XYOA 4H55A 4CXYA 3Q8AA 1QJU1 2PHTA 4XPVA 1I5ZA 4YYOA 4IEVA 1B35B 4XFIA 1QJU2 3VL9A 3BB6A 3VZMA 2X10A 3AJYA 5LB6A 1J83A 1YQ6A 4NOTA 4QKBA 3I2KA 1ULGA 4Q2FA 4Y1UA 3UKTA 1RVF3 3POBA 2ENRA 3POYA 4IV3B 3LZZA 4UFJA 5C5TA 5FO9B 3KHCA 1V70A 3AFGA 1RUJ1 5IFTA 2IXCA 3PUIA 1CIYA 4HZFA 4MG2A 4UT5A 4MGZE 4YW3A 5I0TA 3A4UA 5IVVA 5CFDC 1GZTA 2Z69A 2GP5A 4AHZA 2OW4A 3RYPA 1YJKA 4A41A 4PT6A 4FI9A 1MS8A 3MICA 1VBD3 5K0UB 2W91A 3J8F3 2W87A 3M4FA 4LQRA 5A7WA 2QE3A 5G04L 1JZ4A 2Y33A 2PFWA 2WQ8A 2VZ1A 4XCAA 4Y1VA 1GP5A 3P5BA 5ANQA 4M00A 1HB3A 2WT1A 3KB5A 4K7JA 5K0UC 3OY8A 3MLKA 5H9PA 1YC61 1IKPA 1NCQB 2Y6HA 3G6JB 4GQ7A 3I2FA 5JSOA 5F8PA 2A6VA 4AEDA 4LKDA 3VD7A 4AHWA 2Q30A 4DEVA 1GKBA 4BH9A 3C7HA 4AFDA 2GC1A 3VBRA 1VP6A 2XLAA 4YPJA 4E2QA 3LPFA 2OUJA 5FPUA 3NW4A 2ZZQA 4FPOB 5ERLA 2R49A 3CHXA 3ZFEB 5IK5A 4IV1A 1H2MA 4LK6A 2WO3A 2AYHA 1XU2A 3T0BA 1W6MB 3EB7A 4PQQA 1BZWA 1NUKA 2EXJA 5A3LA 4FO9A 2K46A 3J7NA 3ZFEC 2VM9A 3TEZA 5FPLA 3NV3A 3RPQA 5FJHA 3EXUA 5CKQA 1JZ3A 4ARXA 2YYOA 4CP1A 5JAXA 1FI2A 1UPSA 2DVBA 2RM22 5FDBA 1N1SA 2RM23 2VQ0A 4PF1A 1EY2A 3WZ1A 2YDEA 3AK0A 1Y3TA 3NJZA 5FK8A 1BCXA 5FZ0A 3VBFA 2G9ZA 2YBPA 4IEQA 2WT2A 4R9CA 1G7YA 4LO8A 1CONA 5M0TA 3B01A 4WM8B 5E89A 1I6XA 3DECA 3KT1A 4BXSV 1V6JA 3ZN5A 5FWJA 1MS4A 3H7JA 4QHZA 4DINB 5E8AA 2XJSA 2WINB 1W2OA 2ZX1A 2PAMA 3AB0A 2ZGLA 3K4ZA 4JGYB 4Q5OA 1WLCA 5FYVA 4Q4W1 1UOFA 2XDVA 4YW6A 4O9GA 3SQOA 3WG1A 2EICA 1O3TA 1C8NA 1RC6A 3ZYRA 4AQSA 1RUF2 1LHUA 4K20A 3EQEA 4C0BA 4CEYA 1RUF3 1VAVA 2OT7A 4CPBD 4AI3A 2QBXA 2HJIA 4JRAA 5CU1A 4YRDA 2JB8A 3OYWB 1Q8SA 2VUDA 2V09A 2WSUA 1OUXA 2EA7A 2XH6A 4FFFA 1LCLA 3MV01 1DQ1A 5F6LB 1N3PA 5GZFA 3PTRB 1ZRCA 2WN3A 1AYN1 2KR2A 3D0JA 3NJVA 4LK7A 5FZ9A 3RZLA 5J48A 2HH9A 1POV1 4NN0A 4KI5M 4LKSA 2WZPP 1NXD1 1QMJA 2J1RA 2ET7A 2ZEXA 4W4ZA 5FBJA 1CZTA 1JU3A 3ZSLA 2BNNA 5KHGA 1J1TA 3C7EA 1OI6A 4MLOA 3ZFFA 1QWRA 5AC91 4AAXA 1HRV3 2UWBA 4LNVA 4XUPA 4IL7A 5AC92 5CYYA 1FV3A 4TXWA 4AI8A 2PHRA 4CCCA 2DVFA 4URAA 1RUI1 1N47A 1HLCA 2DBNA 4LULA 4GZ9A 1VRBA 3ZX7A 5CFCA 4J25A 1CESA 3OPWA 2JDHA 4BQ1A 1RUI2 5GLWA 4XJ9A 3WNOA 3N4MA 4GWNA 3ZKYA 1ND3A 4FOQA 5EFUA 1H2KA 2BYVE 2GALA 4C0HA 5JXJA 1CX4A 2W92A 1W8NA 5DAPA 5SV8A 2DCJA 4DZGA 2OA2A 5JZGC 4TN7A 3SH4A 5DAVA 2ZX2A 5FY5A 5FXZA 3LFIA 3ZFGA 2P3YA 3THTA 1LKNA 3MFCA 3RRDA 3K48A 4BCUA 4BQ4A 5C3PA 2GNDA 2QDRA 4P9JA 1JBCA 1C28A 1S2EA 1OOPC 1X9TA 4OHZA 3WF3A 1QHDA 3ZDVA 1W6OB 3ZYGA 1HRI1 1YNAA 1H6XA 2C9AA 3PUSA 4B7KA 5C7GA 1C1LA 1AVBA 1HRI2 2QFEA 4R9DA 4E8CA 3WINE 5A3TA 4MUVA 5J37A 1QIQA 4MO3M 3PURA 4COVA 2WYFA 1GMMA 1MS0A 1D2QA 4QQHA 5FP4A 4F7ZA 2ZMKA 2RG4A 3I2DA 3E6BA 1RMU1 3DEMA 4XURA 5FYSA 5HI0A 3N7KA 2HKXA 2IXLA 2OQ7A 1HIXA 4HKWA 2DCTA 1QDCA 5BNOA 2JEMA 3JZVA 4Q1PA 4HVRA 4AVVA 2PHLA 1SFNA 4KL1A 5I0DA 4I0AA 2AGSA 1YIFA 4BJ0A 4FFIA 5JI9A 1LULA 4PI0A 4Z8BA 2R6QA 4IE5A 2F6BA 1S2BA 1CVNA 1W3XA 3NVCA 3NWKA 5GZDA 1LR5A 1IS5A 3OBRA 1LHWA 4Q8KA 1WCSA 2W1UA 3EJKA 3VHOA 1YQCA 5B4XA 4BK5A 2ADDA 3B7MA 1GQGA 5EYYA 5T54A 1KFXL 2RMU1 3LOIA 1CQ9A 4K6BA 4TSVA 3R4SA 4CUAA 1XYNA 2YPJA 5EHDA 1QOTA 1UU5A 4QKNA 2RMU2 3AFKA 2CL2A 3AC0A 4D69A 4AR2A 4YG0A 5FZDA 4RR3A 1MZ6A 2VW0A 3VD9A 2EIEA 1X50A 4KGQA 5CISA 3VDDA 2BRTA 1PX4A 1C8M3 4P9YA 4E4ZA 2Y6FA 4CU9A 3H8UA 1SBDA 1UU6A 5DUUA 3S5AA 4Y1XA 3TWIA 1O3SA 4XHBA 4NRMA 3H9AA 4QX7A 1H4GA 2UWCA 4ASLA 2VZSA 1H0BA 3L2HA 4RGKA 2CDPA 3J9SA 1UIJA 1MEC1 5EJZB 4Z1VA 2QKDA 1W9SA 4XBQA 4JKLA 1MEC2 2YGLA 3TNQA 1WZXA 1MEC3 1W2NA 2UY8A 4DRVA 5F6KA 2DVAA 3M70A 5DAXA 2D44A 5A7WB 2ZBJA 3QD6A 2P5BA 3F95A 4B7EA 2VZPA 4RS5C 3WR0A 5FMOS 3ELNA 2E51A 3OY8B 1OVPA 4QU2A 3UGGA 4Y5TA 2ZHLA 3FLRA 1D4VB 1PK6A 3ASIA 1H1MA 1RXGA 2YPDA 2WS93 4JDMA 4YGDA 3RG0A 2R32A 4BPZA 1N1TA 2BV4A 2ZGTA 4Q1RA 1XC6A 3H3ZA 5EZWA 3K3OA 1H8TA 4CCEA 2UWAA 4BXFA 5C9AC 1C4RA 5AFBA 2QQLA 5FPBA 3IDAA 1S0CA 3VBRB 4AEDC 5FUPA 3VZOA 2I2SA 2WZEA 4QHBA 4LTAA 4AFCA 1WBLA 3PJYA 1W8TA 4IV1B 2R043 1ZREA 3VBRC 1KQRA 4CU7A 1RHI2 3CMGA 4CYDA 2MNGA 1RHI3 1D4M3 3BU0A 3BUCA 1YO8A 3VB9A 4FP2A 3MW4A 2EAAA 2P2KA 3V0BB 4IV1C 4JHTA 1I5PA 1CJDA 2OIIA 1EAH1 2H0BA 2AZ5A 2RDSA 1AJOA 2Q8DA 4LR4A 4E2SA 4CCJA 2XBO1 4YZ5A 4QHOA 1F4AA 5HPOA 4JDNA 2OYZA 1LOAA 2CY6A 4LIUA 1KS4A 5E6HA 1H4HA 2C0ZA 2G4IA 5FO8B 5ISLA 1NZCA 3I4IA 1PIV1 5BNPA 3O5SA 4N7IA 4ONUA 3VBFB 2BGPA 5CB7A 1DQ4A 3D6EA 2XHKA 4NHLA 5B4NA 1IOAA 2XKPA 4SBVA 2BOJA 4AZZA 1Z78A 2DDUA 3IMMA 4LLOA 3MIGA 3ZM8A 3GBFA 4RSUA 5T55A 4ARYA 3CJXA 2RHPA 4HMZA 3AYDA 3LEMA 1S0GA 4LO4B 4ISRA 1KFUL 3ZDSA 5CADA 2VOTA 2VBBA 2QQWA 2KA3A 3VKNA 5A6YA 5FMBA 4CEYB 4PLOA 4L11A 4UXAA 5A7OA 2B39A 2QQKA 4B29A 5ABJA 2BERA 3OTFA 3E5UA 4KG8A 4FPJA 2GMPA 2P3KA 2R061 2WLQA 3MIFA 1SACA 1JUIA 1U5XA 1RUG3 1X36A 3MUY1 2IXHA 5FMOL 2FDJA 2R062 2ERFA 4B1LA 2H6CA 2JXAA 1NQDA 5F3CA 2XONA 5LY2A 5FR3A 2ZAHA 3O1UA 3O0XA 1A34A 3DL3A 3KQ4B 4K8FA 5A3UA 5JXIA 3AP6A 2D6MA 2W0XA 4XHXA 5ACA3 3VD4A 1XNAA 2Y64A 3T3YA 4FTSA 2B4KA 4RFRB 2D3SA 3WDTA 4DS0A 5HXVA 4OHYA 1ENXA 4CP2A 3Q8CA 3I3BA 1ULPA 2VUCA 4RGAA 3CNAA 1XNBA 5A33A 1CAUA 3S7IA 1JZ7A 4NR1A 1O5UA 1PZ8A 3BPZA 3TYJA 2WWJA 3ZFFB 1O8PA 5EXOA 1K5MA 4JTNA 2FBEA 3VKLA 1LTEA 1YUDA 3AM2A 4NUBA 5JR7B 1KS5A 4BQ5A 2WNOA 1ZBA2 2W94A 3IPVA 5CAZA 5CFCB 5K9YA 1ZBA3 1R082 3WDWA 1R083 2HEVF 4KWUA 1K42A 2BWCA 1ND3B 3VBSA 3MPPG 2W1SA 1SEFA 5FKBA 2XJVA 2ZZJA 1TE1B 3AP5A 3LQCA 3DXTA 3FHQA 4I0WB 2VMCA 1GBGA 3ATGA 2D6KA 1OA4A 5I0RA 3ZFGB 4AE2A 1OF4A 2V73A 2D3PA 3FBMA 4FAGA 4ATFA 3LKJA 4EZHA 1LRHA 1F9KA 5CG8A 3S30A 4QB6A 4W6WA 2CGNA 3RI9A 1OMIA 2LUWA 1Y9QA 2VOWA 3OJBA 5IVEA 3U4SA 4CCKA 4CCOA 1AL22 2GC0A 1S0JA 3FUOA 3BI3A 1LAJA 1AL23 1RUNA 3IAQA 2I74A 3U10A 2JIJA 4XW3A 2PHFA 1RIRA 2AEZA 3M3EA 3ZSEA 4FPEA 4HLTA 2MEV1 4JGZA 4XF9A 2BTVC 1ULEA 5DZFA 3PL0A 2X5IC 4GJYA 4CP0A 5FLJA 1ZX5A 2RE9A 2WZR3 3AYCA 4XDQA 3BTXA 5BNOB 3I97A 2GN7A 1VR3A 4JVAA 4N43C 4AAPA 2JICA 3AMQA 1DU3D 3UGFA 5FZFA 4L9BA 4CZSA 4X8PA 2W1WA 5DABA 5BNOC 4L92A 4Q4X3 1SHWB 4PDWA 2NZ9A 3CU7A 4KU7A 3TEXA 3RZHA 2CTVA 4MVTA 1JMUB 3HNYM 1W0NA 1UZZA 4CCMA 2VW1A 5LBEA 1CGPA 1WWYA 4OUEA 4CDQA 1MR5A 3OB8A 4PBPA 4XMAA 4Y1YA 1W03A 3KV9A 2D97A 2KM2A 3BGAA 4GB31 3VLBB 5A7PA 1VMJA 1BQPA 1TMF3 3E5QA 4GB32 2FCUA 2WO1A 4GMP1 1VAKA 4RR3B 5FY7A 3CKHA 3AZVA 2BFUL 3C7FA 2ZA9A 4NHMA 1ZYBA 1WMFA 3KV6A 1LGNA 3LSDA 4LORA 4LOTA 1VRH1 4QX0A 3HIFA 1OH3A 2V4VA 3AXEA 3CLPA 4YZ2A 5DZEA 2VNVA 2X8KA 2VZQA 4UF0A 1Z7S1 1LOFA 3S7EA 5FYYA 1YFUA 1Z7S2 4UW4A 1OHFA 2HWF1 5J1XA 3VDDC 1RUC3 4XJWA 4MADA 5BY5A 1SQ4A 3PIJA 3MIDA 1I1EA 2D5FA 2HWF2 2FCVA 1UN1A 2RS11 4UFMA 2JG9B 3K4DA 3I2OA 1K3IA 1OLMA 3ITQA 2RS12 3D0SA 2VQUA 4CP9A 3I59B 1UWWA 1JS9A 3WNPA 2RJKA 2CDOA 3GF6A 1UKGA 4OUSA 2IFWA 3EBRA 2XHNA 1VBA2 3SNMA 3HQUA 1VBA3 3JD73 1W9WA 1KJRA 4FPKA 5IHRA 4YVSA 2PAKA 5JXGA 1YHFA 5L7OA 5D8AA 2BWAA 4YW7A 3CEWA 4YZ1A 1ULDA 1PK6B 2P37A 2BNOA 4OFGA 4Q26A 3LWCA 1ZBE3 4CUBA 3CQOA 4ZZ5A 5KC6A 2FHRA 2JECA 1E57A 2A73B 1U5YA 3DKWA 4LBQA 1ZVFA 4QXBA 1MS1A 1H8TB 5I93A 5AVAA 1PK6C 3WCSA 3BOWA 2BOIA 2J1SA 3FUQA 5FP3A 5K8SA 2JB4A 1L7LA 4XE9A 3VDCA 3W9AA 1UMIA 2CV6A 2J7MA 2D93A 1ZRRA 4JQTA 3AZXA 4D6QA 2P3JA 3THCA 1ASJ2 3C8XA 1AR63 1X82A 3H3UA 1ASJ3 4M3CA 4XIKA 5KXBA 5FP9A 3OGGA 1NXMA 3ZYPA 1JYWA 1MQTC 5IWFA 2BVVA 4M3CF 2HWE1 4FTBA 1WA4A 5FREA 4DNYA 4AI0A 4A7ZA 1PO11 2HWE2 4H2AA 4E9KA 1GYKA 3M1HA 2IXIA 5LK7B 5T5LA 3ZXKA 5KHHA 5BNNA 1C5IA 3PLQA 2EXKA 1V6IA 2E7QA 2Y60A 2PXJA 3WVJA 4A45A 2R1BA 1M06G 3JXSA 2YG0A 3KS7A 1ZZ7A 1QXRA 3IKWA 5E88A 5BNPB 2D6PA 4G3YC 5JSRA 4CXWA 2HYKA 2EVXA 4OZOA 1OQ1A 5F32A 4BA6A 3N9OA 5A1FA 3BCWA 3MLLA 3ENRA 5GM0A 5H9RA 4RD7A 4H7MA 1O6UA 2BZDA 3K75B 4B4QA 5BNPC 1QDOA 5JLVA 5IT6A 3TAYA 2ARAA 5EJ3A 2ZS6B 2VMGA 4MX3A 4CSWA 3LE0A 3GDBA 1W6PA 2RDQA 3FL7A 1IPKA 1GLHA 2D6NA 3E5XA 5JUVA 1KEXA 1RL3A 2YY1A 2WDBA 5ABJB 1GNHA 4PJYA 4RN5A 2QQJA 1GUIA 1ST8A 3PU3A 4QQPA 4IEOA 4XFCA 4LBOA 1HW5A 1H1AA 2DCYA 2W95A 4P9GA 5ABJC 3WP4A 2ZX3A 1SBEA 3V56A 3POSA 4Q0VA 4IW3A 1O4TA 4EQVA 3M3QA 4CEWA 1PVC3 1DYKA 2HBUA 1X33A 2EIBA 2K2SA 3H1WA 2W1QA 1GSLA 1V9U1 3IMNA 3UNPA 5IUQA 1ZRFA 4LT5A 2RDRA 1W99A 3ZYJB 1WMEA 2XJRA 1V9U2 1XQNA 4PLMA 5A33B 1CAUB 3B5LB 1PGL1 2DBIA 1J3RA 4XEZA 1LEDA 4E4HA 4YG3A 3WW1A 2VMHA 5J3UA 2BPA2 2VVEA 4OI4A 1K5MB 2FDKA 4QPGC 2RS32 2JD9A 2RS33 4XF1A 4N9HA 4HXCA 1W8OA 4AGGA 4AOCA 2VXJA 5DUXA 5A6ZA 4JHZA 2WN2A 1LHNA 4XFHA 2XG3A 3IWZA 3NKGA 4FXGB 4I3GA 2WO7A 3VBSB 2PA7A 4KNCA 3FLPA 1YCIA 4OUMA 3ME2A 1QJZA 2PHWA 3A21A 1JTZX 4UYBA 4YW2A 1BK1A 4XDOA 4QDQA 5F1RA 1NCRB 2GNBA 4Q4Y1 4DIQA 5CVRA 4QD2A 4LXLA 2UYAA 5JXHA 4C1XA 3FHIB 2BGCA 4ISQA 3TBDA 2WUHA 2FDGA 3N3HA 1FNZA 1G6NA 3SH3A 1MVEA 2CWMA 3RJ2X 4M01A 4BIOA 3S5QA 1C1FA 1EPZA 4XFBA 4JGZB 4NHXA 2ZHMA 4RQPA 4Y22A 2K9ZA 2VCCA 2XR4A 5FIXA 2PTMA 3A0KA 2TBVA 2ZTNA 1QJU3 1S0DA 4EN8B 3D5OA 2WL1A 1VE0A 4BQXA 4P00B 4K3UA 4HN0A 3T4VA 3WDVA 3SKVA 5C3SA 1Y9GA 2VECA 2LALA 4BLJA 1B35C 2ILMA 2AH2A 4LKFA 5L9RA 3T2QA 2QVSB 5FXWA 1WD4A 3VZNA 4NROA 4PDWB 1RUJ2 3FLTA 3USUB 5FZIA 1RUJ3 4IV3C 5JIUA 3AL5A 1DG6A 1DZQA 1CJPA 4CDQB 4WVVA 1YFWA 1RITA 1EYBA 1ZNPA 3DPRA 5FTTC 1DGWX 2XVGA 4PDWC 3KT4A 3WDYA 3CF6E 2B5HA 1PNFA 2Y6JA 4LBKA 4ZHNA 4IGOA 1VBE1 2KD7A 3B3QE 2E53A 4JRLA 5IFPA 5HV0A 2Q0AA 3U07A 1QU0A 2Z42A 3OEAA 3QLQA 1S55A 1DDLA 2IFRA 1LB2A 1JN2P 5LBCA 5FCCA 2XJQA 4UF0B 3U11A 3H8XA 4R9AA 3H8RA 2J1VA 3ON7A 1D0GA 1KJLA 3OUHA 1UL9A 4GWMA 4RGGA 3IIAA 4TLGA 3HN3A 4CDXA 3ZKUA 2VNOA 4IE6A 1JODA 1LOFC 1GWKA 1DQ6A 1NCQC 2E6VA 3EO6A 1SLTA 4WBBA 4QGNA 5FPVA 3TOJA 3GGLA 4BMEA 3N9PA 2Y0OA 4XFFA 4XIOA 2R7EB 1ULCA 1NZIA 4CP9B 4N90A 1DIWA 4JKMA 3FMGA 4Q0UA 1YQ8A 3NV2A 2JENA 2EIDA 4HETA 2ZACA 5F5AA 5GJ6A 1DGRN 3AP7A 4YVSB 4AEJA 3V0BA 4ASMB 3B93A 4V2VA 3PMSA 2Q1MA 3LD8A 1IS3A 2VMEA 3APBA 5D8AB 4EE2A 5L7OB 3N35A 2C26A 3T30A 1ALYA 4RFT0 1UKRA 4HN1A 1GOHA 1WBFA 5GLTA 5I8SA 5EV7A 1YLLA 4LBQB 5LEJA 4K8RB 5L7OC 1AXYA 4C8DA 1SZBA 1JZ5A 4QXCA 1IG3A 5DG1A 4D7YA 4DB5A 1G9FA 1F35A 4FQ4A 1DZTA 1OH4A 3LOBA 1OSGA 2LW8A 3GYDA 3FE5A 3WP6A 1WW4A 4M3CB 2YROA 5DUVA 2XL9A 5D1IA 1LGBA 3BTZA 4GKYA 1UYZA 4I02A 1V6KA 2SLIA 4XACA 5A70A 4WM8C 4F83A 3RYRA 5C8CB 3I2GA 1OXCA 4D0QA 5FOBB 1OPOA 4Y5SA 4Q4W2 1WKYA 2W46A 2YC2A 4Q4W3 4JGYC 1CR7A 1N3QA 4PF5A 1ZA4A 4FOYA 5BNNB 5FLIA 3PVNA 4OMDA 1CAWA 4LHLA 4BDVB 3KV5A 5HCAA 1PM7A 3RGBA 1O4ZA 4QPWA 1POQA 3ACFA 2A6WA 5BNNC 2PLV1 1O91A 3WV6A 2W68A 2QQIA 1VIWB 3U37A 1LEMA 3LEKA 3NSTA 5JPMB 3LA7A 2J1UA 4HBNA 4E4DX 1V6MA 3THDA 3TEYA 1JOBA 1ENSA 1AYN2 1R1ZA 1SLIA 4IQPA 1AYN3 4J1XA 5IAXA 4JCKA 3NV1A 5EQUA 3Q8EA 1YQ2A 1W8HA 2BW8A 1POV3 4COUA 1QJX1 1W6PB 2J1AA 2XVKA 2GNTA 1JYXA 4ZZ8A 1EUTA 1X8MA 2WIIB 3VZKA 4ES8A 1DQ2A 3VD5A 3JU9A 1SCRA 4C91A 2IWGB 4UW3A 2VTXJ 3L2YA 3ST7A 5FZBA 5AC93 5DPNA 2MPFA 4QPIA 2XUEA 1A8DA 2AEYA 3H1YA 5L73A 2ID4A 4AHYA 2VD7A 2WKKA 3BODA 2VMIA 3GZUC 2PMWB 4ZKTB 3SCGA 1RUI3 3AKPA 3LIHA 5KHKA 5IJRA 3O1SA 3D3AA 4O9EA 4CEWB 2ZGPA 1DGLA 2E33A 3HJRA 3VBHB 3RS6A 1JHNA 1S2KA 2C6SA 2ZAAA 3MYXA 4P9XA 4XF0A 4V2WA 4UOJA 4YM2A 5FYCA 3WF1A 1FOD1 3SEPA 5LY1A 3VBOA 2BUKA 1QOOA 2CAUA 2JKXA 1FOD2 1T6BX 2D6LX 2RV9A 3D82A 4ITCA 5SV5A 4HONA 4FPLA 3K46A 3T08A 3ORJA 1QQP1 4IEYA 4YZ4A 3UV9A 3SC7X 1G86A 2AACA 4BQ2A 3DUIA 1QQP2 2DCKA 1MPXA 5CA6A 1HRI3 1ZRDA 3WCRA 1C3HA 3O1PA 5L36A 1BBT1 5FY4A 4ES9A 2BBVA 5A1AA 1HX6A 2WWUA 2WBKA 2D98A 4HKOA 1BBT2 4DRRA 5JOXA 3PU8A 3JBG1 3B94A 3OBZA 1RMU2 4A7KA 2QQUA 1RMU3 3JBG2 3CL1A 2IZWA 5EJ1B 1W06A 3RYKA 3EMRA 4D6RA 1DQ5A 2EALA 4IE7A 2GH2A 2JDUA 3T2OA 4WVWA 4DXZA 2JDAA 1CZSA 4ATEA 3IAPA 4KH9A 5FXXA 3RMYA 3GZTB 1XXNA 1OLRA 4P5YA 3SCFA 3B69A 4EJRA 4FXKB 4B1MA 4YSFA 2ARCA 2V5DA 4UI9L 4M4RA 1GR3A 1YJLA 4HVOA 3NNMA 4BHPA 4MSVA 1US3A 3WW3A 5FZAA 5C70A 2X09A 4UBHA 5IK7A 3N7MA 3WLUA 4RQPB 4Y22B 4XBLA 1UY3A 4P9IA 5A3OA 3KMHA 4IE0A 1Y43B 1RYYA 2H6BA 1C5HA 2PQQA 4I09A 4ET7A 2W39A 3JB8A 2RMU3 4EWDA 1OA2A 1JW6A 4QM8A 1QF3A 3ZN6A 1MACA 1NYWA 4IGPA 3A23A 4P5HA 1FT9A 4EZ4A 1V6NA 2Y6LA 5C8WA 5LA2A 4YGEA 4MGTA 3R4DB 2YFUA 2R071 2VOKA 1J3QA 3I8TA 3OUIA 3VV1A 2E7TA 3PJQA 1AX1A 1WW5A 4XQDA 1W9TA 2ZGNA 1REEA 3P3PA 2YZ4A 3DPRB 3ILNA 4PLNA 2EXHA 2DF7A 2JG9A 2ZEWA 2CGPA 1OD3A 4IEZA 2YC4A 5FP8A 1H30A 1GFF2 1XSRA 3I59A 1XNCA 3I3EA 4MHUA 4U36A 4WVZA 4YGBA 5DUWA 4AVCA 4A6SA 2W3JA 5CIRA 3VZLA 3J4UH 2VZUA 2YU1A 1J58A 5HXMA 4OVEA 3U0ZA 5DAQA 3GNEA 3WQ7A 1IS6A 2BVBA 2QQVA 1J3PA 1DBNA 2A5ZA 2W08A 2ZABA 1Q5OA 2B9UA 5GLZA 5E16A 2SBAA 5FZCA 5F37A 1S1AA 3HAGA 2O8OA 1LESA 3B00A 3WF0A 3T09A 1AR91 4CDXB 1ZM1A 5GLVA 1W0PA 1RUE1 2OX0A 3AMPA 4OULA 4Z07A 1JYVA 2PHUA 1AR92 3ZYHA 1XBFA 3GXUA 3DYPA 4HK9A 3CJIA 3MDPA 2NM1A 1RUD1 1RUE2 2ZGMA 3O0WA 4Q8LA 3VBUA 5LRSA 4QQLA 1UXZA 2GC2A 3B02A 3ZXAC 4CDXC 2JDZA 1G9AA 1RUD2 1BKZA 3J7HA 4Q0SA 1QXPA 1MS3A 4UWDA 2DURA 2EAKA 1F15A 1YFXA 1RXFA 1I9RA 1GQPA 2YBKA 4CA9A 3AMMA 3KQRA 2G9FA 1SBFA 1VBC1 2H0VA 3RMXA 3U4XA 1S0BA 3RNSA 5F39A 1VBC2 3ZYIB 2YUEA 1WLDA 2HEYF 1TQ5A 2ZHKA 4GJZA 2D43A 2XJPA 1YEWA 3HNBM 3FFQA 4I30A 4KWLA 4XTPA 4DUWA 1EAH2 2HEWF 2JDKA 3ZPOA 1EAH3 4UFLA 2IVIB 2XBO2 3BVCA 5EIYB 2VGDA 2XBO3 4H7LA 2Y0IA 4CDUA 4PQ9A 3IZOA 2F17A 3OG2A 3U14A 2WSVA 3T0DA 5FZMA 4ZPIA 2RR11 1UY4A 1PIV2 2WAAA 1PIV3 3KF5A 3FJSA 1KXGA 2JDYA 1SPPB 4AI9A 2ORZA 1G9CA 3WP5A 3VBFC 2L9LA 1UF2C 3M2MA 3P3NA 5DAWA 1NX9A 1UMZA 2B9VA 4W50A 4GH4A 3K51A 5CZKA 3N9QA 3SISA 1VJ2A 2WR9A 1JZ8A 5FJKA 4AEKA 2XQRA 1GZCA 4YVWA 1WCDJ 3D8CA 1W8WA 4PCRA 4TWTA 3FWEA 4BB3A 2QQNA 3HPNA 1HDKA 1JOPA 1W90A 2R0HA 1CAWB 3IB3A 3VKOA 1NA1A 5FZLA 4QX2A 4LPLA 4CEYC 1XNDA 1MZ5A 2R063 4XUTA 1VBB1 5DG2A 3EYPA 1LGCA 3C7GA 2FD8A 2HLEA 1GU3A 1XNTA 1XU1A 1VBB2 2YB7A 3WNXA 4QXKA 2DUPA 1LOCA 3M7AA 2O1QA 1UMHA 5F5QA 5GALA 3RJRA 4FCAA 3SXWA 4Q0QA 2CAVA 1MS9A 2CU5A 1HB1A 1V00A 4FPYA 4DUXA 4AF9A 3VUOA 2E63A 4LO6B 5LRRA 3O1MA 3INAA 1AYM1 3NMBA 5A3WA 3WUCA 2A3WA 2LM3A 5A7SA 4OLLA 4UFHA 3OSDA 1AR81 1AYM2 2YC0A 4GD4A 2K0GA 1AZDA 1KITA 4LHSA 3OBTA 4NE9A 5I0UA 2NQYA 5FZ8A 2JG8A 1AR82 3KCCA 4KBZA 3ZIXA 3T0AA 5BXXA 3AMNA 4QPIB 3ZFFC 2RDNA 2ZJCA 3PTYA 4OZXA 5FYTA 5T5OA 5T5PA 3FHAA 4CCDA 1WW7A 3FC0A 1LU2A 4GWIA 4LIVA 4UFKA 3IDCB 4XDPA 5LWBA 1RJ8A 2KXLA 4C90A 5CFCC 4QT6A 2JKBA 2ZGRA 5LK5A 5H9SA 1NLRA 2FZ2A 1ZZBA 3NNJA 1PO21 3WQBA 4AG4A 2ES3A 4YZ3A 5JR2A 5FMCA 3BKZA 3ZOIA 1ND3C 3O12A 3O1OA 1PO22 3KSCA 3MEPA 4QPYA 4XAAA 2WNEA 5FY9A 1NCRA 1MZEA 3VBOB 1PM4A 2FCTA 3OOXA 1EP0A 1MVQA 4OI1A 4NIGA 3ZFGC 2GMMA 1SFYA 3UESA 5CG9A 5FY0A 3TRSB 2BGOA 2ZKNA 4L8QA 2JE8A 4Z2WA 5IVFA 5LW9A 1SCSA 4YFWA 1BEV1 1UAIA 4Q4V1 3WHUA 3NL1A 1BEV2 1URXA 2P6HA 4DO0A 4A4AA 4Q4V2 1POV0 1WLWA 4Q4V3 5IVYA 1JYTA 3HR9A 3AKSA 1FMD1 2MEV2 2YGMA 1AX2A 2MEV3 3DKQA 3GCWA 1FMD2 1WGPA 2C24A 3A0NA 1SMVA 4B4RA 3V0AA 4XUOA 1UYPA 1OKQA 3ZXDA 3ES1A 5FY1A 1ONAA 2C4XA 2Y38A 4FPHA 2OPWA 1JXNA 2JE9A 3OGVA 4A6OA 2NN8A 3GBWA 3UYJA 4ZS2A 3USUA 4JC1A 2DU0A 2RJLA 4DPNA 2OKXA 4PIXA 1VMFA 1CD3G 1F31A 3DV8A 1N1VA 1U5IA 1RUH1 1TME1 2XXZA 4YM1A 2Y26A 3NNLA 4K21A 1ODMA 3QOPA 1NE6A 2P3IA 3KM5A 4V1PA 2CYFA 2NMOA 2VNRA 3LDBA 1FX5A 2A1XA 4FP3A 2ET1A 4XUQA 1N1YA 3WD5A 5FY8A 4GB33 2WWSA 4OQ9A 2WFF1 2WABA 3MW3A 1W04A 1JU4A 5CFDA 1ZZ6A 3ZN6B 4RYDA 3NQHA 2VY0A 1ZA7A 4GMP3 4W6YA 5JDBA 4RR3C 1PMJX 1VRH2 1WD3A 1FNYA 1VRH3 4CVUA 1CAXA 2ZXQA 3RDIA 4EN7B 1Z7S3 1H8VA 4NHYA 3IIIA 1Q8QA 4N8MA 2WJSA 2YU2A 2YFZA 1OVSA 3V64A 3WG3A 1O3RA 3HNMA 4GKXA 1HN1A 5CKMA 2HWF3 4AQ2A 1SLAA 2PELA 5DXDA 3ZXFA 2E31A 2CNAA 2RS13 3Q9OA 5JMOA 5I8TA 1PNGA 2P17A 3NKTA 5FXVA 4B3NA 2ZMLA 2JG9C 1UYYA 3OPZA 1W28A 2PYTA 2XLFA 4HSJA 4FT8A 4M0HA 3WSOA 5JOWA 3DN7A 3NAPB 2UY9A 3WDXA 1IG0A 5F5CA 4EV0A 5KBFA 2BDRA 3I49A 1STMA 1Q43A 1O7FA 3MBWA 3BPSA 3ZXLA 1COV1 3RZJA 5FO7B 3AVRA 1DGRA 1W2AX 4CXXA 4LBQD 1COV2 1PHMA 3CZUA 1HXS1 2QJVA 3ZR5A 4Z92B 4GAZA 5KC5A 3DGTA 1HXS2 3CJIB 4P9WA 1XRUA 5KXDA 1R64A 4LUMA 5F9TA 3VBUB 2FMDA 1Y4WA 1UZVA 2CGOA 2HWB1 5AFEA 3MZHA 5FZKA 1H8TC 4Y5Z0 2VMDA 4KMQA 4DMIA 4HL0A 3CJIC 4JDOA 3VBUC 2ZEZA 3PNAA 5DN2A 2J22A 4NPLA 2VZOA 1WCUA 2ADEA 1U5ZA 3E6DA 5B2GB 1AUYA 4CDWA 1IS4A 3LEGA 4R9BA 3B9IA 1G9DA 4Q29A 4E27A 4IDZA 2A6ZA 5C8CA 3AJZA 3I3MA 4XJAA 2VULA 3HQRA 4AFMA 3HN1A 3OUJA 2HWE3 2VTFA 4NJ4A 2XMLA 4B4PA 3JCIA 2XOMA 1PO12 3K77A 4PBOA 1X7NA 1PO13 3GBGA 5KR7A 1W8ZA 3K3NA 2QQOA 1JOJA 1M4WA 5C4WB 1W2UA 4CDUB 1WCKA 3N36A 1UOBA 1OFSA 2VQTA 3GJBA 4N7UA 4IETA 3R0RA 1TNRA 2V5YA 1HQLA 5G05L 3K2OA 4CDUC 4A42A 4LOSA 4Z82A 3MHZA 2XB6C 4INDA 1JH5A 4EYUA 3USSA 4K9SA 1FYUA 5LEKA 4Y24A 3T2TA 2QCSB 4GH4B 3I3QA 3LAGA 3LFMA 5A1LA 1BVVA 3PVBB 1ULFA 2DVDA 1B09A 5F3IA 4E2GA 4META 4YVWB 1OPMA 5FUIA 1F5FA 2A71A 3CDZB 4GH4C 1QJY1 3H42B 4AW7A 1U12A 1XE7A 3MW2A 4R4XA 4A3XA 1DYOA 4OMCA 4S2DA 1NA1B 4NPMA 4IGQA 5FZOA 3WNMA 2MHFA 4X6QB 1ULOA 3KVAA 1GNYA 3TN91 3ZIWA 5C71A 5A3NA 1L7RA 1QOSA 3KWVA 4QB2A 3TN92 1UZWA 3VD3A 4AHXA 1GWMA 3H3LA 4I01A 4WM7B 5DDJ1 2A3YA 5HCFA 1DQ0A 1JZ6A 2XJTA 5DDJ2 4MGIE 3W20A 4TYSA 3WNNA 4DFSA 4RHV1 3VBHA 3OCPA 3SITA 4D3WA 1GOGA 3BYWA 2QZ3A 1UOJA 1FATA 2ZMNA 3AZWA 4DOUA 1GWLA 4P02B 1V9U3 1GV9A 4FVVA 4XJ8A 5HCHA 1FV2A 2VUJA 1WLTA 1PGL2 2VXRA 5KXCA 4O61A 1JHJA 2JG8B 2QQPA 1K12A 2RS51 2WFPA 2WQ4A 3H0OA 4GIQA 5J96B 1W9YA 3VL8A 5BV6A 1W6NB 2X05A 2RS52 4D6SA 1K5MC 2FMYA 1S0IA 2Q1FA 3ECQA 2JG8C 3U75A 2LTNA 3HBZA 1DYPA 4RL7A 4FAHA 4FBFA 1OOPA 3LIGA 5JOZA 3BIWE 2HWD1 2YHJA 4BE3A 3RZMA 2A6XA 2R0FA 4QX1A 4XZPA 1J1LA 1CIWA 2HWD2 3I2IA 4XCBA 3QH7A 2YBSA 3ZYBA 3VBSC 2WRAA 1AR71 3M3OA 3RFRA 3RI8A 3I7DA 5J7MA 2HWC1 4EWAA 1VALA 2DVGA 1AR72 1WUVA 4YM3A 3VDBA 1AR73 3LDRA 2HWC2 4Q4Y2 2W47A 4QX3A 4Q4Y3 4QAWA 3T4HB 4P14A 3FBYA 2E26A 3GHMA 1RUOA 2BEOA 1IGOA 1NCRC 2ZX4A 1R1A1 4HT1T 4YW5A 3TEWA 4UAPA 1OURA 1VMHA 1D0HA 3RWKX 3IBMA 1SLLA 1AXZA 1R1A2 2A6YA 2ZKLA 4ZS3A 3VGIA 4TLFA 1SFPA 4NHKA 5FLHA 5J98B 4IXLA 1XB9A 1V6OA 3NNGA 1FPN1 3OPTA 3WF4A 1Q8PA 1VAMA 2OZJA 2IXKA 5IW0A 3UJQA 1QKQA 1CPNA 1D7PM 1FPN2 3BTAA 3V0AB 4LBMA 4JGZC 2ZHNA 3WF2A 1D2SA 5FYMA 4GWJA 2Z79A 4LLFA 2O8QA 1Q8OA 1W0OA 4WVMA 1RGSA 2B45X 3ZSMA 2BP6A 5EP9A 3W59A 1W3VA 3KGLA 3VDAA 3C2UA 2HBTA 2F4LA 2WA4A 4CU8A 4DEQA 1K45A 3DF0A 3FX3A 5LASA 5JI7A 5J09A 1OKOA 3H1MA 1NG0A 4EROA 1RVF1 4MGKE 4CDQC 4J6GA 1RVF2 1LOEA 3LA3A 2J1TA 2LROA 1VBE2 3NO8A 5CFDB 4D7TA 1VBE3 1ZZ8A 1F8VA 1EV11 1LHOA 5GZGA 1AL0G 3HOBA 4XUNA 2WA3A 3AVSA 3LEIA 1EV12 1A78A 3POGA 1OT5A 1US2A 1EV13 1HB2A 2E9QA 1UU4A 1UZ0A 3AKTA 2A70A 1CAXB 4O7XA 1H2LA 2WNUA 1CX1A 1NAEA 3QH6A 1VB2A 1VBD1 1PGW1 1UCXA 3J8F1 4RS5A 2FZ1A 3FN9A 1VBD2 3ABZA 1PGW2 5IK4A 5E1RA 2JJ6A 2DV9A 3J8F2 3VHPA 4N53A 1I3HA 1Y7BA 1XOYA 2D3RA 3HD8B 2P34A 3WQ0A 4AVTA 1AF9A 1DHKB 4XF4A 2C9KA 3A7QA 5C9AA 3ETQA 4F3JA 1LENA 4JKKA 1Q56A 1ND2A 4FQZA 4LMFA 1LOGA 3UL2A 2OZ6A 2EF6A 4HANA 4LA3A 2ARBA 1GZ9A 2GU9A 3P1IA 2EIGA 4YVSC 2X53S 2TEPA 2VUAA 5FMDA 5D8AC 2Y8KA 3X29B 3N9NA 4BK4A 2ZX0A 4GULA 1DGWA 2A3XA 4XAEA 2ZGOA 4AGRA 3SLIA 4GMP0 3B9CA 1NT0A 3MUZ1 4IERA 3ES4A 1J84A 4Q27A 3WG2A 5FQ0A 4PI2A 5LBFA 1KGYA 3HVDA 2RJ2A 1SPPA 3NJXA 2GDFA 2PHXA 5JIAA 4A3ZA 4XXAA 4X6RB 2B46X 2R30A 4CDWB 4E8DA 2RM21 1OQEA 4H3WA 3E97A 4Y20A 3AMHA 3QCWA 1V6LA 1JZ2A 3OGSA 3P6BA 2GMEA 4NVPA 1NOVA 4CDWC 4COYA 2BBAA 4LHNA 3JB4C 1L7QA 4HOOA 3LSEA 2DWRA 3URFA 5C8CC 3JUUA 2WQZC 3ACHA 5HV4A 4L97A 1PZ9A 5A6QA 5CBLA 2I45A 1UIKA 1NLSA 4BOWA 4BQYA 4D94A 2BJSA 3ZXJA 5T5JA 5FUNA 5A3PA 4LUKA 2PLV2 4ZY9A 1GNZA 1R091 2WNVA 2PLV3 2J1EA 3QACA 4Y4RA 3GZAA 4UW5A 1AX0A 2VJXA 4LE4A 1QNWA 1R092 1RUF1 4ZU5A 1T2XA 1R093 4AGVA 5ANNA 1SDWA 1NY71 5F2WA 1APNA 2JWPA 4HKLA 2GP3A 4CPBA 5LZ6A 1NY72 2JX9A 2VPVA 3D4KA 3DXUA 1YI9A 2EXIA 3CZJA 4UFIA 3BTYA 4Y1ZA 1QJX2 1JUHA 1V0AA 5TSWA 1Y9MA 5GZEA 1QJX3 5C6CA 4JV4A 5JSPA 3Q8FA 3HQXA 4FTEA 3OEBA 4DXRA 2TUNA 5C5UA 3U78A 1CN1A 5FZOB 2XUMA 3OD4A 4A44A 1IPSA 5FK7A 3PHMA 3UJOA 3ROUA 5BYNA 2VG9A 5FRAA 3W21A 5F7UA 1G9BA 4C1WA 5EPAA 4Y3OA 3POIA 4KWKA 1NLQA 2ZPXA 3WHTA 4LITA 4IESA 2TNFA 3AL6A 4AVSA 4BM8A 3UT0A 1HRV1 3W5MA 1LJ7A 2W52A 1QXJA 1TVGA 2LS6A 1OLME 3LF7A 4ASKA 3KVBA 1HRV2 2JD4A 5EYXA 3TNPB 3O1VA 3JQXA 1BMV2 1N3OA 4CEWC 1GZWA 4Y33A 1H1IA 5D21A 1J59A 4BQWA 4HPKA 4BU2A 3VBHC 4L0PA 4QKFA 1PZ7A 3ILFA 1FOD3 5AVPA 3WG4A 1PVXA 3ZVXA 5GLUA 4FFHA 4XYXA 3WEZA 1UD1A 5JZGB 1T6GC 2CWSA 3R05A 5I0SA 2VL4A 3N7LA 1MZFA 1QQP3 2XGXA 4QGMA 5I91A 5L9VA 4L2NA 1OLQA 3K4AA 4BMBA 1OOPB 1H2NA 5LBBA 4ZU4A 4QX5A 1BBT3 1XJAA 2DYCA 1DLLA 4COWA 1CAVA 1XYPA 3GM8A 5A7QA 3JBG3 1BJQA 3IT8A 2FDFA 1F2NA 4MGSA 4CRQA 1ODNA 1LHVA 1QEXA 1FAYA 4M3CE 2X5IA 2IUWA 1RINA 4ZXEA 2DU1A 5JVVA 1NKGA 5JPNB 1JYNA 1OUSA 2OUHA 4XMIA 1QNYA 5J36A 3O14A 1W6QA 3EHKA 4N43A 4EN6B 4YM0A 1OF3A 5FZGA 1MS5A 2VW2A 3PIGA 2DTYA 4XVHA 3UKVA 2O14A 4LKEA 3ZR6A 4QU1A 1X9PA 2W5FA 3WNKA 5FPAA 4RQPC 2VE1A 3DYMA 4HG6B 4ORFA 2GC3A 2ETEA 1FXZA 3BALA 4OHWA 3FFZA 4AYUA 4XJUA 1S4CA 4WVMB 1IQDC 3WW4A 1Q3EA 4YG6A 3MI8A 1SLBA 2R072 2W2IA 4AQTA 3WNLA 2R073 4AFBA 2W9XA 2JDPA 2AR6A 5JWPA 1YRZA 2HYXA 3T1LA 3AKRA 1YYNA 1JYIA 1PGSA 5JOYA 4M4PA 2A7AA 3V65A 4CCNA 3BU7A 1W8UA 2B8MA 3AX4A 3WX5A 3RZKA 1C8M1 2BNMA 4BISA 3DPRC 2VR4A 4ZONA 2IC1A 1C8M2 2GN3A 3LGRA 3BIEA 5A32A 4SLIA 4NPRA 4NWVA 3NAPA 1QGLA 4XTMA 5FYZA 3NJYA 4QQ2A 4N9IA 4QXHA 3I2HA 2WT0A 2PAEA 3M3CA 3R6SA 3LDKA 2WNUB 2ZGKA 2ZOEB 4LEJA 4QWNA 2XQXA 1NE4A 4IE4A 4FSJA 1SG3A 1BXHA 2UURA 1RB8G 1EUUA 4RS5B 5F3GA 5FZ4A 2BQPA 3POEA 3R4UA 1AR93 1YXWA 3CIHA 3F2ZA 3KHBA 2WNUC 4EN0A 2JDNA 2CHHA 1RUE3 2ZGUA 4N53B 2RVAA 4GALA 1AXKA 4BZ4A 1WA6X 2D6OX 3E1F1 5I8YA 1RUD3 3M8LA 2IXJA 1XPWA 2BU9A 2YV8A 5A7NA 2WS91 2WZ8A 3MPBA 4N53C 2R1DA 3MFAA 3MIHA 4GXLA 3O1TA 3SKJE 2OS2A 4WZCA 2XL7A 5C9AB 2XPJA 2WS92 4W6XA 3ZXEA 5FZ3A 5HBAA 1XSQA 4AL9A 2ZGQA 4AEDB 2VNGA 1ND2B 1VBC3 2XJUA 2Z4FA 4QB1A 4XFAA 4DXSA 4DY3A 4FOWA 1QY4A 3GJAA 1JI6A 4LA2A 3RQ0A 2NYYA 3T2PA 1OQDA 3KCXA 3WUDA 5FP7A 1GOFA 3LCPA 4S2FA 4DQAA 4AFAA 1BMV1 5KWRA 1ND2C 4NIAA 3WDUA 2R041 4OHVA 1NQJA 1KRIA 2VCAA 4MYEA 5C4WA 5FPXA 1WMXA 1F4HA 2VVFA 4XFGA 4NWWA 1RHI1 1D4M1 4TTGA 1MQTA 2R042 3AYEA 4PHZA 3W5NA 2WO2A 4HSLA 1HJGA 3AYAA 1D4M2 5FQ0B 4S2GA 1ZZ9A 1YIPA 2I07B 4NAOA 2IVJA 2N7GA 5FYBA 5FWEA 4F8AA 2RR12 2GSYA 4G9SB 2RR13 2UU8A 3ZO0B 3MF6A 4Y26A 3KV4A 4L99A 4LE3A 4MOAA 4YW4A 1G8WA 2NPIA 3MF9A 2GNMA 3N9LA 4KGGA 4NIIA 4Y20B 1DF0A 1CPMA 1UNBA 4X8NA 4YNIA 4IUGA 2B42B 4IEPA 4W8JA 4ZXKA 5F3EA 1HV0A 1UYXA 5A6XA 2R16A 1LOBA 4H14A 4Z2AA 4W65A 2QUOA 4KWJA 5IK8A 5EWSA 5BNQA
chains in the Genus database with same CATH topology
3AZZA 3IM0A 4K1YA 2C1FA 2DTWA 4WM7A 1YI7A 1VBB3 2WNVB 1EPWA 1VLNA 1S0EA 1RJ7A 4YW1A 4M0NA 1OA3A 2PN5A 4XXPA 3RSJA 3SCHA 3TB0A 5GZCA 5BPXA 4LO5B 3MIBA 1ZZCA 2WNVC 4RA0A 1RUG1 2QDNA 4B8EA 5L19A 3FZ3A 3POWA 1RUG2 2NLRA 3AP4A 5DZGA 1AYM3 1AJKA 3S6PA 2AUYA 4EN9B 2NP0A 1AR83 3J26N 3THPA 4XJZA 4BIFA 4EWEA 5ACA1 3ZSKA 1W6NA 3KZ4C 4LO7A 3SH5A 5ACA2 5KXEA 4HK8A 1QH6A 3MLJA 1GICA 4AK3A 2JE7A 1F5JA 4QPIC 4E4SA 4QPGA 4COZA 1HV1A 3RWNA 4YGCA 1WMDA 1IPJA 4MV2A 2QZ2A 1PO23 2X29A 3E6CC 1GZWB 2BFUS 1A8MA 1ZBA1 2E7AA 3ALQA 4HPKB 5I91A 3L9JT 3LOBA 1R081 3IDBB 4I3PA 1REDA 1S0FA 5JMCA 3MIEA 4XF3A 3VBOC 3WP3A 3VN4A 4XBNA 1WW6A 4AWDA 4OI0A 4A7YA 1BEV3 1Z0HA 3M3IA 4BLIA 3UKNA 1O3QA 4DY5A 1CAVB 4HFSA 4MXWA 4GA9A 1FMD3 4XQ4A 4JQRA 1AL21 5BUVA 5KHIA 3I54A 1HQNA 5KHJA 5FOJB 1AHSA 1SLCA 2X5IB 4KU8A 2DUQA 4Y4YA 2ARXA 4BYYA 3WY6A 2WZR1 1LECA 3GALA 1Q8VA 1B35A 1W6QB 4N43B 5T3NA 1RUH2 3HMYA 1TME2 1RUH3 2WZR2 3KT7A 1TME3 3HT2A 1O5LA 3QBQA 4MZUA 2XVLA 4Q4X1 4IV3A 4I0BA 3JQWA 5FBZA 2WFF2 1KDKA 4Q4X2 4A2UA 2A75A 2WFF3 3LB9A 3G7DA 3WOGA 1UW8A 3BOPA 3VZJA 4TZDA 1LODA 4IEWA 1UPIA 5FPZA 1TMF1 1H9PA 3H50A 1TMF2 1IKQA 1U0AA 2WC2A 5K0UA 3O0VA 2PHDA 3N7JA 3SHRA 3KCYA 3PVOA 2DFBA 4XETA 2VVDA 1H9WA 1PMIA 3VKFC 2VOXA 2Q8OA 3S0MA 2O0OA 4AQ6A 4D7SA 1IHMA 4E27A 3VDDB 4PIZA 1TEIA 5A32B 3C3VA 3ILRA 1A3KA 1REFA 1NCQA 1RUC1 4KBBA 3WQ1A 2XWBB 4QQOA 4XOGA 1RUC2 5K7PA 2Z2SB 4G4FA 4FPCA 3NAPC 2XLGA 1ENRA 1COV3 3ZMNA 2Q4SA 2C5DA 1HXS3 2VU9A 1VBA1 2Q1ZB 3JD71 4LBJA 3ZFEA 3H7YA 4LBNA 4P9LA 1W6MA 3JD72 2D5HA 2VOVA 2HWB2 2HWB3 3WW2A 1ZBE1 3GHNA 2VQAA 1ZBE2 1IQAA 4UBGA 4PIYA 1LU1A 1JYCA 4YFZA 1VB4A 2UYBA 3VHNA 1AR61 4R52A 1ASJ1 1IZ3A 1YFYA 3AP9A 4BWOA 3VHRA 1O4YA 2GAUA 1MQTB 3NV4A 4WM8A 1AR62 2ATFA 1UZYA 2XKOA 2D7FA 2AREA 5T50A 4J1WA 4AEMA 3LA2A 5C4WC 1L3JA 2GZWA 4JGYA 1A6CA 3KLSA 3SMHA 4FOVA 2D40A 5JCTA 3AKQA 3ZSJA 1RTVA 4AVAA 4AXOA 2XWJB 3OYWA 3ZN4A 3UK9A 5GKAC 2Z5WA 2AENA 5FFOC 3ACLA 3OF1A 4FPGA 1QJY2 4NO4A 1QJY3 4YVWC 4R4ZA 4KG0A 3TN93 1NA1C 4WZFA 4QGLA 1HQWA 1W39A 3O7OA 4JTOA 3VKMA 5A3MA 1C57A 3HWJA 3OGJA 4OI2A 5DDJ3 2DFCA 2ZGSA 4I2OA 2VH9A 4WM7C 3KD4A 4AVBA 4RHV2 4U2AA 2YMZA 1XE8A 4K40A 1QH7A 4RHV3 4MH0E 4R8HA 3T1MA 4AI1A 1UX6A 1OFNA 3IN9A 4IEXA 4MXVA 4XILA 4UW6A 5JZGA 4S2HA 1PVC1 4FPFA 3RZZA 1KDMA 2QNKA 4HVQA 2RS53 1PVC2 1YWKA 3KGZA 5H9QA 1BVP1 3AZYA 2YXSA 4LHKA 4JAAA 4ZU7A 4QPGB 2B7YA 4AI2A 3WT3A 3ZPYA 1TNFA 4XQWA 2G9GA 2HWD3 4QMAA 5HCBA 2RS31 1KD7A 1DZRA 3IDEA 3HT1A 1W6OA 4WV8A 3ZXGA 2HWC3 5C33A 2DCZA 3IPVB 4OHXA 2F4PA 1X8EA 1HKDA 3MGUA 1XNKA 4URTA 3ZMOA 2Q5TA 2NMNA 3CO2A 3WXPA 2FQPA 4K1ZA 2ZCWA 5T52A 1R1A3 3PMEA 2GH8A 3AXDA 5CNAA 1GANA 4LBLA 1BYHA 4KQ7A 4QM9A 2OPKA 4MXWB 4IEUA 1OD5A 1FPN3 4YARA 4CTEA 1DFQA 2DUOA 3OD0A 4YLZA 2OVUA 4MGYE 1GQHA 4Q0PA 5FAXA 2WLPA 3PVEA 1ENQA 1XYOA 4H55A 1QJU1 2PHTA 4XPVA 1I5ZA 4YYOA 4IEVA 1B35B 4XFIA 1QJU2 3VL9A 3BB6A 3VZMA 3AJYA 4NOTA 4Y1UA 1ULGA 4Q2FA 3UKTA 3W58A 1RVF3 5LEJA 2ENRA 3POYA 4IV3B 3LZZA 5FO9B 1V70A 3AFGA 1RUJ1 2IXCA 4HZFA 4MGZE 4YW3A 5I0TA 3A4UA 5CFDC 2Z69A 4AHZA 2OW4A 3RYPA 1YJKA 1MS8A 3MICA 1VBD3 5K0UB 3J8F3 3M4FA 2QE3A 2PFWA 4Y1VA 4M00A 2WT1A 3KB5A 4K7JA 5K0UC 3OY8A 3MLKA 5H9PA 1IKPA 1NCQB 3G6JB 4GQ7A 5JSOA 4AEDA 2A6VA 4AHWA 2Q30A 1GKBA 4BH9A 4AFDA 2GC1A 3VBRA 1VP6A 2XLAA 4E2QA 2OUJA 3NW4A 2ZZQA 4FPOB 2R49A 5IK5A 3ZFEB 4IV1A 1H2MA 2AYHA 1XU2A 1W6MB 1BZWA 2EXJA 5A3LA 4FO9A 3ZFEC 3NV3A 3RPQA 3EXUA 2YYOA 4CP1A 5JAXA 2RM22 1FI2A 1UPSA 2DVBA 5FDBA 1N1SA 2RM23 2VQ0A 1EY2A 3WZ1A 2YDEA 3AK0A 1Y3TA 3NJZA 1BCXA 3VBFA 4IEQA 2WT2A 4R9CA 1G7YA 4LO8A 1CONA 3B01A 4WM8B 5E89A 1I6XA 3KT1A 1V6JA 3ZN5A 1MS4A 3H7JA 4DINB 5E8AA 2XJSA 2WINB 2ZX1A 3AB0A 2PAMA 4JGYB 2ZGLA 1WLCA 4Q4W1 4O9GA 3WG1A 1O3TA 1C8NA 1RC6A 3ZYRA 4AQSA 1RUF2 1LHUA 4K20A 3EQEA 4C0BA 4CEYA 1RUF3 1VAVA 4AI3A 5CU1A 2HJIA 4JRAA 4YRDA 3OYWB 1Q8SA 2V09A 2WSUA 2EA7A 2XH6A 1LCLA 5F6LB 1DQ1A 1N3PA 5GZFA 1ZRCA 1AYN1 3D0JA 5J48A 1POV1 4NN0A 2WZPP 1NXD1 1QMJA 2ET7A 3ZSLA 2BNNA 5KHGA 1J1TA 1OI6A 4MLOA 3ZFFA 1QWRA 5AC91 1HRV3 2UWBA 4LNVA 4IL7A 5AC92 1FV3A 4AI8A 2PHRA 2DVFA 1RUI1 1N47A 1HLCA 3ZX7A 4LULA 5CFCA 1CESA 4BQ1A 3N4MA 1RUI2 5GLWA 4XJ9A 4GWNA 1ND3A 4FOQA 5EFUA 1H2KA 2BYVE 2GALA 4C0HA 1CX4A 5SV8A 2DCJA 4DZGA 2OA2A 5JZGC 3SH4A 2ZX2A 3ZFGA 3THTA 1LKNA 3MFCA 3RRDA 3K48A 4BCUA 2GNDA 2QDRA 4P9JA 1JBCA 1C28A 1OOPC 4OHZA 1QHDA 1W6OB 3ZYGA 1HRI1 1YNAA 2C9AA 4B7KA 1C1LA 1AVBA 1HRI2 2QFEA 4R9DA 3WINE 4MUVA 5J37A 4COVA 1MS0A 1D2QA 4QQHA 4F7ZA 2ZMKA 3I2DA 5HI0A 3E6BA 1RMU1 3N7KA 2HKXA 2IXLA 1HIXA 4HKWA 2DCTA 1QDCA 5BNOA 2JEMA 3JZVA 4Q1PA 4HVRA 4AVVA 2PHLA 1SFNA 4KL1A 4I0AA 2AGSA 1YIFA 5JI9A 1LULA 4Z8BA 2R6QA 2F6BA 1S2BA 1CVNA 3NVCA 3NWKA 5GZDA 1LR5A 1IS5A 3OBRA 1LHWA 4Q8KA 1WCSA 3EJKA 3VHOA 3B7MA 5T54A 1GQGA 5EYYA 1KFXL 2RMU1 3LOIA 1CQ9A 4K6BA 4TSVA 3R4SA 1XYNA 2YPJA 1QOTA 1UU5A 2RMU2 3AFKA 2CL2A 4D69A 4YG0A 4RR3A 1MZ6A 2VW0A 1X50A 4KGQA 3VDDA 4P9YA 1C8M3 4E4ZA 3H8UA 1SBDA 1UU6A 5DUUA 1O3SA 4Y1XA 3TWIA 4XHBA 3H9AA 1H4GA 2UWCA 4ASLA 1H0BA 3L2HA 3J9SA 1UIJA 1MEC1 4Z1VA 2QKDA 4XBQA 1MEC2 2YGLA 3TNQA 1MEC3 4DRVA 2UY8A 5F6KA 2DVAA 3M70A 2D44A 2ZBJA 3QD6A 4B7EA 4RS5C 3WR0A 5FMOS 3ELNA 2E51A 3OY8B 4QU2A 2ZHLA 3FLRA 1D4VB 1PK6A 3ASIA 1H1MA 4YGDA 3RG0A 2WS93 4JDMA 4BPZA 2R32A 1N1TA 4Q1RA 2ZGTA 3H3ZA 5EZWA 5C9AC 1H8TA 2UWAA 1C4RA 5AFBA 1S0CA 3VBRB 4AEDC 3VZOA 2I2SA 4QHBA 4LTAA 4AFCA 1WBLA 3PJYA 4IV1B 2R043 1ZREA 3VBRC 1KQRA 1RHI2 4CYDA 2MNGA 1RHI3 1D4M3 1YO8A 4FP2A 3MW4A 2EAAA 2P2KA 3V0BB 4IV1C 1CJDA 2OIIA 1EAH1 2H0BA 2AZ5A 4E2SA 1AJOA 4LR4A 2XBO1 4YZ5A 4JDNA 2OYZA 1LOAA 2CY6A 1KS4A 1H4HA 2C0ZA 2G4IA 5FO8B 1NZCA 3I4IA 1PIV1 5BNPA 3O5SA 4N7IA 4ONUA 3VBFB 5CB7A 1DQ4A 3D6EA 2XHKA 4NHLA 1IOAA 2XKPA 4SBVA 1Z78A 4LLOA 3MIGA 3GBFA 4RSUA 5T55A 3CJXA 2RHPA 4HMZA 3AYDA 1S0GA 4LO4B 4ISRA 1KFUL 3ZDSA 5CADA 2KA3A 3VKNA 4CEYB 4PLOA 4L11A 4UXAA 2B39A 4B29A 5ABJA 3OTFA 3E5UA 4KG8A 4FPJA 2GMPA 2P3KA 2R061 2WLQA 3MIFA 1SACA 1JUIA 1U5XA 1RUG3 1X36A 5FMOL 2IXHA 2R062 2ERFA 2H6CA 2JXAA 1NQDA 2ZAHA 3O0XA 3DL3A 4K8FA 3AP6A 2D6MA 2W0XA 4XHXA 5ACA3 4FTSA 4DS0A 2D3SA 3WDTA 5HXVA 4OHYA 1ENXA 4CP2A 4RGAA 3CNAA 1XNBA 5A33A 1CAUA 3S7IA 4NR1A 1O5UA 1PZ8A 3BPZA 3TYJA 3ZFFB 5EXOA 1K5MA 4JTNA 2FBEA 3VKLA 1LTEA 1YUDA 3AM2A 5JR7B 1KS5A 1ZBA2 5K9YA 3IPVA 5CAZA 5CFCB 1ZBA3 1R082 3WDWA 1R083 2HEVF 2BWCA 1ND3B 3VBSA 3MPPG 1SEFA 2XJVA 2ZZJA 1TE1B 3AP5A 4I0WB 3ATGA 1GBGA 2D6KA 1OA4A 5I0RA 3ZFGB 4AE2A 2V73A 2D3PA 3FBMA 4FAGA 4ATFA 3LKJA 1LRHA 1F9KA 5CG8A 3S30A 4W6WA 2CGNA 3RI9A 1OMIA 2LUWA 1Y9QA 2VOWA 3OJBA 1AL22 2GC0A 1S0JA 3FUOA 1RUNA 1AL23 2I74A 3U10A 4XW3A 2PHFA 1RIRA 3M3EA 3ZSEA 4FPEA 4HLTA 2MEV1 4JGZA 4XF9A 2BTVC 1ULEA 5DZFA 2X5IC 4CP0A 5FLJA 1ZX5A 2RE9A 2WZR3 3AYCA 4XDQA 5BNOB 2GN7A 1VR3A 4JVAA 4N43C 2JICA 3AMQA 1DU3D 4L9BA 4CZSA 4X8PA 5BNOC 4L92A 4Q4X3 4PDWA 2NZ9A 3CU7A 4KU7A 2CTVA 4MVTA 1UZZA 2VW1A 1CGPA 4CDQA 1MR5A 4PBPA 4XMAA 4Y1YA 2D97A 2KM2A 4GB31 3VLBB 1BQPA 1TMF3 3E5QA 4GB32 4GMP1 1VAKA 4RR3B 3AZVA 2BFUL 2ZA9A 4NHMA 1ZYBA 1WMFA 1LGNA 3LSDA 1VRH1 3HIFA 4YZ2A 3AXEA 3CLPA 5DZEA 2X8KA 3S7EA 1Z7S1 1LOFA 1YFUA 1Z7S2 4UW4A 1OHFA 2HWF1 3VDDC 1RUC3 4XJWA 5BY5A 1SQ4A 1I1EA 3MIDA 2D5FA 2HWF2 1UN1A 2RS11 2JG9B 2RS12 3D0SA 3I59B 2RJKA 3GF6A 1UKGA 4OUSA 2IFWA 3EBRA 1VBA2 3SNMA 1VBA3 3JD73 1KJRA 4FPKA 4YVSA 2PAKA 1YHFA 5L7OA 5D8AA 2BWAA 4YZ1A 3CEWA 1ULDA 1PK6B 2P37A 2BNOA 4OFGA 4Q26A 3LWCA 1ZBE3 5KC6A 2FHRA 2JECA 1E57A 2A73B 1U5YA 3DKWA 4LBQA 1ZVFA 1MS1A 1H8TB 5I93A 5AVAA 1PK6C 3WCSA 3BOWA 3FUQA 5K8SA 4XE9A 3W9AA 2CV6A 2D93A 1ZRRA 3AZXA 2P3JA 1ASJ2 1AR63 1X82A 3H3UA 1ASJ3 4M3CA 4XIKA 5KXBA 3OGGA 1NXMA 3ZYPA 1MQTC 2BVVA 4M3CF 2HWE1 4FTBA 1WA4A 5FREA 4DNYA 4AI0A 4A7ZA 1PO11 2HWE2 4E9KA 1GYKA 3M1HA 2IXIA 5LK7B 5T5L<