1N3YA

Crystal structure of the alpha-x beta2 integrin i domain
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
189
structure length
189
Chain Sequence
b'QEQDIVFLIDGSGSISSRNFATMMNFVRAVISQFQRPSTQFSLMQFSNKFQTHFTFEEFRRSSNPLSLLASVHQLQGFTYTATAIQNVVHRLFHASYGARRDAAKILIVITDGKKEGDSLDYKDVIPMADAAGIIRYAIGVGLAFQNRNSWKELNDIASKPSQEHIFKVEDFDALKDIQNQLKEKIFAI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Integrin alpha-X
publication title Structure and allosteric regulation of the alpha X beta 2 integrin I domain.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell adhesion
total genus 69
structure length 189
sequence length 189
ec nomenclature
pdb deposition date 2002-10-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00092 VWA von Willebrand factor type A domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.410 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold von Willebrand factor, type A domain 1n3yA00
4C29A 1ATZA 1YVRA 3N2NA 5E6RB 2XGGA 4Z7NB 1U8CB 3M6FA 4G1MB 4NENB 1IJKA 5KYNA 2VDRB 1T0PA 4C2BA 3RAGA 3ZE2B 1FE8A 3EGDB 3VI4B 2NUTB 5KYXA 3EOAI 1XUOA 4CNBA 1M2VB 2WW8A 3Q3GE 1AOXA 4HQOA 1JV2B 1MJNA 1RTKA 1IJBA 2I91A 3EOBI 1OAKA 3EGXA 4F1KA 1PT6A 4WJKB 3ZDXB 3ZE1B 4UM9B 3HXOA 3BN3A 3PPVA 1IDOA 3PPXA 4PN7A 5KYWB 2VDNB 2B2XA 3V4PB 4JDUA 1RD4A 3NIFB 5KYYA 2NUPB 3EGXB 3FCUB 3GXBA 4O02B 4F1JA 3PPYA 3K6SA 2XWBF 1JEYB 3V4VB 2IUEA 1DZIA 3EFOA 3PPWA 4A0QA 3VI3B 1M1XB 3EG9B 2I6SA 4FX5A 2VDOB 4IGIA 1FNSA 1QC5A 3BQMB 3ZDYB 1U0OC 4MMYB 5HDBB 4CN9A 2ADFA 3NIDB 4MMXB 4BJ3A 3K6SB 1N9ZA 1JLMA 1TYEB 4DMUB 1M2OA 2VDMB 3EFOB 3TVYA 3ZE0B 2WINI 1T6BY 5KYXB 2O7NA 3HI6A 1RS0A 1UEXC 1RRKA 4UM9D 1MQ9A 1SQ0A 4G1EB 1CK4A 1JEQA 2QTVA 1NA5A 2VC2B 3K71B 1MQAA 2VDKB 3BQNB 2ODQA 1AO3A 5E6SA 1BHQ1 3IBSA 2X5NA 1L5GB 2I6QA 4WK4B 2M32A 3E2MA 1LFAA 3K72B 1AUQA 1SHUX 4HQFA 4XW2A 1MHPA 1PD0A 5E6RA 2ICAA 5KYYB 3TCXB 3T3MB 4WK0B 1XDGA 4CN8A 1CQPA 2ODPA 1ZOOA 2NUTA 3QA3E 1M2VA 5ES4B 3F74A 5E6UA 5HGJA 5HJ2A 1BHO1 2VDQB 3NIGB 2XWJI 3TXAA 1Q0PA 1M10A 1M1UA 1PD1A 4C2AA 1MQ8B 1YVPA 1QC5B 3T3PB 2NVOA 4HQNA 4IHKA 3ZQKA 1QCYA 3ZDZB 1N3YA 5KYUA 5KYWA 3HXQA 4MMZB 1MF7A 1U0NA 1XDDA 5BV8A 4M76B 3FCSB 3F78A 4NEHB 5E6UB 4UM8B 4Z7QB 2NUPA 1ZONA 2VDPB 4HQLA 4WK2B 1JEYA 1JEQB 1DGQA 4IXDA 4NENA 5LN1A 1IDN1 1PCXA 3IJEB 4Z7OB 3EH2A 5KYUB 1V7PC 3EGDA 3EG9A 4WFQA 3EH1A 3TW0A 5E6SB 2VDLB 4HQKA 1SHTX 1ZOPA
chains in the Genus database with same CATH superfamily
4YLEA 4DCTA 4MYSA 2C3YA 1NW7A 1P2VA 5EINA 2HZBA 4BQQA 4W5WA 5E3IA 4EG0A 5FI1B 2O4CA 1PL6A 2OBLA 2A0XA 3DGEC 2OTCA 4R2MA 3BILA 2UZ4A 3U5ZB 5BYAA 4JBGA 5DOVA 1EAYA 2VA8A 4I6EA 5FO1A 2NUTB 1OXMA 1RCTE 3WICA 3AEQA 3CWZA 1EX6A 4LECA 5EIFA 1P7VA 1JQ5A 5AIAA 2JD2A 3DR3A 1TK2A 4U6QA 4DCPA 1GGNA 4KQ2A 2JS7A 2QPAA 3NEAA 1GTVA 2Z4TA 2XOKA 3CN7A 3LPMA 4O5OA 3ZDDA 1V2GA 2CFIA 3BUSA 3DB1A 3A9CA 3HSSA 3U7JA 2XKKA 4MZXA 2MR5A 1C8VB 4Q5IA 1QB7A 1LVHA 4QDTA 4WZZA 1JWAB 2DUNA 1WVMA 1JZSA 2CLIB 2UUOA 3ABQB 3K32A 5HKKA 4AXXA 3PXUA 3U4GA 3TFQA 3RAJA 4DLWA 2OHIA 4ECEA 4F3KA 2NYAA 3A14A 2Z4RA 4RX1A 1Z5UA 1P0CA 3N28A 2VJNA 2CZQA 1NATA 1QH0A 1Z17A 2RGEA 2DPMA 3QWBA 4FJ2A 3KJZA 1RU3A 1FK8A 5EZYA 3OF3A 5C0OE 3RFUA 4ZYLA 5CVTA 2WWFA 1P73A 1TF2A 1JNXX 4WXMA 1ZRHA 4OXNA 4QICA 2GASA 4AULA 2FUEA 2VL7A 2ZZMA 3K2BA 4TXNA 2RIRA 2IW1A 4MRRA 4OHXA 3SIRA 3ZXSA 2WJYA 3NBAA 2PHZA 4L6AA 6REQA 2V0GA 4K9LA 1PT9A 4M0CA 4D9EA 4C1BA 1CRQA 1RI3A 1Y6RA 2E4YA 3N5CA 4H7HA 2WFMA 5CURA 3SLRA 4KKXB 4W99A 1ODFA 3I58A 4CKXA 2BBTA 2PUWA 3EPJA 4X41A 1BMDA 2CVZA 2D1SA 3MHTA 3V5NA 1KY4A 4V38A 4Q18A 4CF4A 1CZUA 1EBFA 1UKVY 1VJGA 2X2PA 3ROGA 1N36B 2E6UX 1RKVA 4RACA 3H0EA 1DEKA 4A2CA 1LDMA 4YMWA 1U98A 2H2AA 1SA0A 4ZGGA 4C0BA 1RKQA 3C8UA 1C3OB 2QBYA 3GRCA 2CT8A 1QIMA 1COWA 1RXIA 3ZHYA 4AP5A 4IINA 4PHCA 4F04A 3TD6A 4EZIA 4HQFA 2PNJA 1GR1A 1E1CA 3UENA 5H70A 4FQ8A 4OUKX 5DHPA 4G8CA 4F45A 4O3FA 3K9LA 1FTQA 3OZGA 1P81A 3REFA 4WWHA 4KQJA 4I9FA 4L9SA 2VCYA 4NEQA 1USVA 3DGFC 3M9WA 3ZK7A 5AVVA 3T95A 4PIPA 1R4NA 3HH8A 1CV2A 2IL1A 2Q3MA 4MB6A 3VDRA 4M9SA 1RE1A 1KF0A 4ZJYA 1D0VA 3KJHA 2RB5A 4CRWB 1L7PA 2VHXA 2WF5A 4NV0A 2IPAB 4BAUA 4M0EA 1DG1G 1N0VC 1TQ4A 5DRYA 3LLCA 2QMQA 3R3UA 5DNEA 4E88A 4FILA 4EG6A 5EXTA 3DLHA 2R1ZA 3JD0A 3BKWA 3HJBA 1IPEA 3KDPA 5A4DA 2OWEA 1HRDA 4CIBA 4HPXB 1WW3A 1R8YA 2P9CA 3I01A 1N6PA 5E6UB 4N3GA 4AG6A 4BNKA 1ZVKA 1C3JA 4EHJA 2XIJA 4UMFA 2QPOA 4JNKA 5BN3B 3A6ZA 3OOYA 2QNBA 1T8TA 3K09C 2A0YA 5BQOA 1FDSA 2PEZA 1V96A 4RYLA 1FSPA 4M83A 1VSBA 4HC4A 2UYCA 3ZVNA 1PEDA 2C00A 5F52A 2RJOA 1O8BA 3B1ZA 1Z0ZA 2O2JA 4ND8B 3VFDA 4YX9A 4Y9UA 2OCGA 4WMLA 3SHVA 3OOSA 4QKQA 5CA1B 2B6NA 5HSGA 5FJJA 2H9YA 2AD1A 4EG1A 1NXPA 2IXAA 1LQTA 2I4RA 2ZTMA 2YQ5A 4K81B 3ZWXA 5BW4A 3UGTA 4P3OA 5JCZA 3ZGNA 5C8DA 1JR4A 3WAGA 1N2SA 1QK5A 2RGWA 4JR0A 3L8DA 3R7WA 4TOIA 5IANA 2Q6TA 2WV7A 3EWSA 1ACLA 3SQOA 4P3KA 3VX4A 3OY7A 2ZT7A 4EIWA 2OBNA 5BSWA 4MQEA 4F46A 3TRHA 1B6SA 3RSHA 4PAQA 2FI1A 5DU2A 2Z8YM 4JX9A 3NG1A 2Y2VA 2AN1A 4S35A 5DI3B 2QV7A 2YMQA 3CF4A 1XQ1A 2VHEA 1MJFA 3ILYA 4MV4A 5DRTA 3IXMA 3VC1A 3WLEA 4B0OA 2Q28A 4ZOLF 1ZLXA 4PZLA 3K0EA 4YJGA 3VBEA 3BTUA 1DFIA 1NE7A 1LNSA 3IAAA 4UAGA 3P4XA 1OLXB 5AI8A 4J3NA 2OORA 1M67A 2GHRA 4B6GA 3ECSA 2W8BB 4NF2A 5EWLB 1YAJA 5FUWA 3KU4A 5IBRA 5L3RA 1RZ3A 3T52A 2OBYA 2C4TA 2JARA 1GSHA 1N5LA 4BVFA 1IMJA 3V7UA 1BJRE 3EW9A 5IJXA 2NO1A 2ZRDA 3P0JA 4ZO8A 1Y8RA 1YZYA 1Z33A 2CF6A 3EQZA 3KCQA 2I2BA 3EFOB 4REMA 3I30X 3EUEA 3QVWA 4QWMA 3IEXA 1PO7A 4RGBA 4EKEA 5JNWA 1AHPA 4C7OA 4TQAA 1QIDA 2OK8A 4AICA 4YJKA 1I36A 1XDBA 1UMBB 3R5HA 2EW2A 1OZHA 2FR1A 2VYFA 4GU5A 4QEDA 3ZZNA 1JHQA 3R3ZA 4OB7A 2AC7A 1UJ5A 3A1CA 4XCVA 4YY3B 1R9JA 3VR2A 3RU2A 4YUAA 3TJZA 3E2MA 4TZKA 3ZVRA 5JWRA 5BWBA 2OM6A 4RSRA 3QGMA 3URMA 4PG8A 1Q7RA 3P5BA 3EMVA 4WBXC 4QUAA 3EGIA 3MWYW 4MQ6A 2ZM5A 1M72A 4MVJP 5TC4A 5FTMA 1DQRA 3DCYA 3LC2O 3SHFA 5IDVA 2BHTA 4JGGA 5T3UA 2W2KB 4LISA 5EUMA 2QRVA 1FMTA 4I4IA 4F6CA 2VDUE 1PQUA 4ND2A 3QNUA 4BNUA 3BK7A 2H0RA 2J3IA 2QM0A 1WF6A 4HRVA 1HV8A 3TQTA 4W1SA 2HFJA 3NRBA 4B75A 2FWNA 2GAFA 3MT0A 3C70A 1FU7A 2JRLA 1I3CA 2W2VA 4PLGA 5DTIA 3A9RA 2IKQA 1P2UA 4OY3A 4RJKA 4X60A 3RIEA 5IJZA 2EFGA 4FE7A 1T9ZA 2B25A 3KKNA 1PLKA 1XVTA 5FRDA 5J1SB 1N5JA 4H60A 1ZK1A 1XKLA 5CPBA 3IRUA 5AVWA 3HU5A 1T10A 1BCSB 4BKUA 5JRJA 1GDTA 4KQCA 1YZQA 1JKFA 2C2KA 2ZJ3A 1HKHA 2X1LA 4Q3EA 3O73A 5FOWA 4ZD6A 1ETHA 1VLVA 2WSYB 3AP2A 3K1JA 2OFPA 4KK4A 3K9NA 3O8QA 4FJ1A 4BVJA 3PGJA 2YRFA 4D92A 3UANA 3IMCA 4C14A 5JROA 2PGNA 5EIBD 1Z6TA 5BP7A 4NFYA 2MU1A 5E4YA 3ODGA 2SICE 1XP5A 2YVLA 3WHKA 3A10A 4RFLA 4LNUA 1O5TA 3GJYA 5J5AA 4F3NA 1IHDA 4P83A 4EFLA 1RZRD 3ZBPA 2ECQA 2C03A 3URKA 5BN4A 3WLMA 5JSZA 3ZD8A 3P9NA 4CL0A 3KFVA 4DBLC 5SYNA 5BR7A 3EZ6A 3PNOA 4ZVTA 4YECA 3A6JA 3F7TA 5DGDA 4ON9A 4G5FA 1G2QA 4IOKA 4W6ZA 2X0JA 1Q19A 3K8YA 1SZDA 2AXPA 3RIXA 3WC4A 1PJSA 2PRJA 4NNJA 2J3KA 5ALYA 1OJLA 1YL5A 4G85A 4KAAA 5HF5A 3FMGA 2JVIA 2IS4A 1FC0A 1R5BA 3TIIA 1A98A 1L5YA 1GUAA 3DZJA 1JHZA 4JQYA 2WOJA 3LSTA 3C6XA 1EK0A 1TB4A 2REQB 2CHUA 2CYCA 2YVAA 1SBYA 1P39A 4FFRA 5LQDA 2HIGA 2W22A 3Q7SA 2DFLA 2WU3A 3OX2A 4G26A 3AI7A 4O1HA 4WOPA 2VXOA 3NM4A 1IH8A 3D8TA 1OLSA 2RGBA 3S7ZA 1K8ZB 3LBYA 4N7RA 4N47A 3ICCA 4HWRA 1UC5B 2RHDA 2IOFA 1JLMA 3IYLW 4IIBA 1OTYA 4B09A 3GLIB 1RWNA 3F7MA 1LTHR 1DAPA 1NQOA 3LUBA 1K88A 3L0ZA 3DEFA 4CKBA 1RQLA 3MMXA 3WSVA 4AX8A 5C7LO 1XTKA 2OO3A 3AW8A 3DAYA 1C0PA 1PJLA 2WT9A 4RD2A 3LO5A 5U1PA 3ND8A 2R8ZA 2ZDHA 4BFZA 3NR2A 4IG4A 4H27A 2WD7B 5D3MB 2X3FA 4AUKA 4ATNA 1TO2E 1FP7A 3IAM1 3LC0A 5DE3A 4LRSB 2OOKA 1NASA 3NNDA 1LCIA 2D2EA 2G1KA 4B6SA 4DARA 1G9XA 3O2NA 4L7VA 4M9RA 3EC7A 1ZK3A 4X8MA 1EUDA 2Z9BA 1D2RA 4P53A 3WL6A 1DO2A 2EEZA 1JI3A 3GLRA 3I2JA 3WYGA 2PUEA 1M1YB 4QX6A 1CIVA 4ZALA 3N0WA 3TGWA 3ZNQA 1IHUA 4DGQA 3LS2A 4XI9A 4S12A 1YASA 1DC8A 3DAFA 2GUGA 3L07A 1VRCA 3E6AA 2H57A 2QPLA 1D03A 1QAOA 3T0GA 5K6AA 1MQ8B 1U0JA 4IMIB 4O33A 4OI1A 2DM6A 2V6GA 1UJ6A 3VU3A 1IBMB 2O2CA 3FVRA 2D7CA 2W6ZA 4RMNA 4RLFA 2RC6A 1ZINA 3HXTA 5CNKA 2J46A 2CVFA 4I7EA 3TXXA 1E2DA 4BMSA 2R8YA 1LVGA 1QO0D 3C6ZA 4JVOA 2HRZA 1K0FA 3B3JA 1NHWA 2UVDA 4REOA 3T1YB 1ZD8A 2UYOA 3B1VA 2OXIA 4GOKA 4KKVA 2XVZA 2P3OA 3IVGA 3PT9A 4MYHA 1OV6A 2NUAB 4MYTA 3TM4A 2EQAA 5BW5A 4B4DA 4E09A 1QE3A 2FW1A 2NV2B 4CDMA 2QTLA 2GX6A 3AOEC 1BHJA 1GXSB 4FGKA 4TV9B 2C83A 2G7MC 3VTKA 3N2NA 1RZVA 2CVHA 3CTMA 4WUTA 4YJHB 1U9IA 3IEKA 4PNEA 5EKDA 5H3HA 2BZGA 5CB8A 4JITA 2H1OA 2C94A 1Z3IX 3Q3GE 3B7WA 1GPKA 3I9V1 4KJXA 4XUCA 5REQB 1TRKA 1P1KA 4GUDA 3WLHA 1QVAA 3AY6A 3ZDXB 1QSGA 4F4HA 5F51A 2OZLA 1O58A 3P9RA 3L04A 2BTOA 2D3WA 2RBEA 5JYCA 1VE3A 3MCZA 1GILA 3QBVA 4OBBA 4PGGA 3BE5A 4TS3A 1C0LA 1R5JA 4LRYA 4DSUA 1KFBB 3GL9A 2JDID 2EX1A 2IZ0A 4JDUA 4DIBA 1ZXLA 4E7OA 4M1OA 5AOBA 1M2JA 1BJKA 4PW0A 2RHRA 4P93A 4F9EA 4EUNA 5JC8A 1E2HA 3GH3A 4TSKA 1EHCA 2WPDD 1SKBA 3FTFA 4M0KA 3LT4A 1NNEA 4R40A 1GFWA 4FEEA 3LXXA 1PS9A 1YE8A 4M8IA 2ATXA 4L4SA 5HWSA 4ZCQA 1UFKA 4QULA 3E3NA 4M21A 1DKOA 5GMOA 5K3AA 1A0OA 2Q2OA 4K8OA 2Q4TA 5LBUA 3ZJ5A 2Y99A 4CMIB 1MG0A 4OUDA 1MGPA 4IGIA 1VA5A 2G8LA 5EY5B 2REOA 2EFDB 5A71A 2B1QA 3MWDB 4GI7A 1RYBA 4F84A 3KPYA 1YA6A 3VKVA 2R751 3ABOB 4HGOA 1KK0A 1T3ZA 1XTVA 2R00C 1YB4A 1E3MA 1W4RA 2YKGA 3D0KA 3MPUA 3CYFA 4KQGA 2RBGA 5ITSA 2WD8A 3PUWA 4BU0A 1VLMA 1QHNA 3U16A 4TXHA 3U7FB 3RJZA 1EH5A 2CBXA 3WO0A 3PNBA 1C8KA 3DZDA 4OSPA 1OZ0A 4E51A 4DLAA 1XRMA 3BREA 4LJSA 3EVNA 2OGTA 5FP0A 3OPYB 5GGYA 4LQ4A 2PXAA 2ODBA 3UJ7A 1YJCA 1TM3E 3HU3A 2XA9A 2J3MA 4IRMA 1M3SA 3BMCB 3M6VA 3NBQA 5L3ZA 5TS2A 2NUBA 2DGDA 2A1UA 2JBAB 2ZBDA 1FXWF 1XXHB 1QVWA 3KWLA 4EP1A 1E6CA 2ENUA 3A05A 3NJ4A 5HRAA 5HYVA 3P0FA 3ETEA 2RE8A 3ETCA 1W49A 1EGAA 2QMYA 5G2OA 2FFBA 5HNKA 3TS1A 5C3MA 2EW1A 1S2DA 4BNLA 3ZVMA 1KAQA 3Q2OA 4FFDA 4KXWA 4W1RA 2HSZA 2JVJA 2XWJI 1N5RA 4M0PA 5HS4A 2WABA 4M7RA 3MLAA 1WU8A 4RPGA 5IKPA 4DMFA 2JLCA 1VYUA 2AUMA 2CCKA 2ALJA 3HDHA 2QM3A 1UJMA 3ITDA 1ZC4A 2GSWA 3GARA 3RVPA 1QORA 1RSZA 2UZ0A 1A9OA 2WKSA 4HVAA 4PCLA 4H18A 2ZYRA 4Q15A 1RLTA 4BNDA 3GRYA 2W2LD 4WFKA 1IJFA 1KR2A 4FZJA 3H1BA 4W9RA 2LDXA 1G9TA 2ZJ2A 1TA9A 4ARBA 4DY6A 1CJKC 4IIDA 4KVGA 3EGWA 1BRMA 3L43A 1C80A 1UJ4A 5T5QA 1IY2A 1UQTA 5HX7A 1OZAA 2OT3B 4FDUA 1KZGB 2PUVA 3TD9A 3TFOA 3TW0A 1SB8A 4B8WA 2FRVA 2BM1A 4MR7B 5G4KB 5J2UB 2A0KA 3VOBA 3A6EA 3WWCA 2F3UA 3WLLA 3WKDA 2M9MA 2K6GA 3VVLA 2J5BA 4F06A 1K0UA 3I6BA 3KZNA 4N9WA 1Z2EA 2CCJA 4C6SA 4UTRA 2XCSB 3HWX1 1F7UA 3D7LA 4I50A 3CZCA 3WIVA 3T3IA 4D3ZA 3EPRA 4FP9A 2XKAA 1K89A 4MQFB 2R7MA 1V3TA 2C1XA 3B1JA 2BMJA 3PGVA 4DLVA 4ARZB 1NWCA 1H6DA 1UBGA 3CB2A 3QUTA 3GLHE 1KGDA 1E69A 3KQSA 4U7PB 1G64A 5LUBA 4BEWA 1Q0QA 2OYSA 3TL6A 1KC3A 2F62A 3MWKA 4CV2A 5B55A 4RA6B 4HNSA 1A71A 1RD4A 4EYOA 1UT8A 1BOOA 2XB8A 5IVIA 3WGOA 3KD3A 2YTZA 4PLVA 2WYHA 5DN9A 3R7FA 5KEIA 5B7NA 1YCHA 3MWJA 4Q0MA 1D2EA 5CYOA 4DIKA 3S1AB 1D1SA 1AKNA 2FZKA 2OHFA 3HG7A 3HP1A 5EG5A 3RIHA 3TB4A 3F67A 3CNNA 4JP2A 5AT1A 1IEVA 4ABTA 4TYQA 1GLNA 1IBLB 3MCUA 2ZAGA 4N7MA 4N76A 5KKNB 3E2PA 1S96A 3AGQA 1U7XA 1OTXA 1NWHA 3PUVA 3UMYA 1QNLA 4Q3CA 3VR3A 4BO4A 3DFKA 2VP0A 1ZM9A 4MMXB 4CU2A 1A9XA 2NYUA 1TYEB 3EFHA 3HGQA 1NBWB 2GLTA 1RM0A 4DLZA 4M37A 3WYDA 2FRXA 3QEBZ 2BFWA 4PAOA 1LW7A 4ZAXA 1Q7BA 1K7YA 2G36A 3AHGA 4DN6A 3S5JA 4WECA 1KSFX 1MA0A 2QSUA 5A3RA 2OPBA 2H85A 4ZREA 4W5JA 2PGJA 4L4UA 4EY4A 1DBQA 4FOOA 5CDFE 4D8XA 3NUZA 2XUIA 1D8TA 3GT4A 3MOGA 2NOAA 2D1TA 1QBGA 4PAMA 2P6UA 2BONA 2YMMA 1HC7A 1UBEA 2A9JA 2OCBA 1O9HA 1X9IA 3MPOA 4RAOA 4XOIA 4D9KA 4KN9S 1UPUA 2ZB7A 2C99A 3PCRB 1A9QA 5F5XA 2G9NA 4M55A 4M1QA 2PBFA 2GF2A 1D4ZA 4A6DA 3GJRA 1RE0A 2HHJA 3QJ5A 3ZV7A 5LWHA 3QU4A 4L95C 3I0NA 6AT1A 4FZ3A 5C53B 1HXHA 3NIGB 3MTGA 1RKBA 1Q1NA 3NWBA 3OTQA 1X1CA 2M1ZA 2RKWA 4D9NA 2G1UA 1ESDA 1IMOA 2JGKA 2V9ZA 4QARA 4AJLA 2XGJA 2WJHA 4K8RB 3J81A 4GPEA 4HTFB 3AHHA 2IX3A 1Q3KA 4J0DA 5CX1A 2ZJ8A 3MINB 3C4QA 1DXQA 4C0XA 5EUBA 2NPOA 1KI6B 2WBLC 4JOSA 3TQOA 5K20A 3IA7A 3I12A 3D2CA 3N2IA 1QG2A 3C5VA 3CNLA 3P9PA 4MV9A 4BFUA 1NDUA 5D5PA 2MYPA 4FYMA 2OYRA 1JG7A 2VR1A 1VHDA 5CLIA 1O57A 3RVQA 4BX8A 4A0GA 1T5BA 2G76A 1DIBA 3T94A 2G5GX 4TLEA 3WSWA 1J99A 3HCPA 3KEQA 1VL0A 5AVZA 3T34A 3H11B 3OT4A 5KCMA 3GUVA 3IO5A 4DHWA 4IKPA 2XLCA 4JMPA 2PZKA 5E6RB 1L4UA 2X0NA 3EY9A 5LBTA 3ZJYA 2AN4A 3ZHTA 1PZEA 3AM5A 3BXHA 3HY6A 2G5TA 4XARA 3IESA 2DULA 3NYRA 4A7PA 1XEAA 2PSDA 3QE2A 3T6KA 3HADA 2IC5A 4Q7EA 4WOCA 1XZHA 1QGZA 3DQZA 3K0FB 1EVQA 1Y3FE 4C76A 1AMNA 1LPSA 1TEXA 1CVLA 4KWEA 3EPHA 1G55A 2IOHA 3PHHA 3MGKA 3QFHA 4LK2A 5TPZD 3M6XA 3HY4A 4Z1OA 1I4LD 1O4WA 1QBKC 1QGOA 2PGXA 3H6KA 3HLYA 4JQOA 4LTMA 4UBIA 5I7WA 4NIMA 1P2TA 4O4LB 1B74A 3U81A 7YASA 1R0WA 5EHIA 1LA2A 3U49A 2ZT5A 4EELA 2WUVA 1ZM2A 2DQZA 1EPUA 3Q3HA 2MMGA 1URPA 2NZVG 2ZB4A 4DL9A 3LXRA 3PU6A 2UXBB 4GW3A 4R8VA 2OPHA 4MVJG 1SURA 1Z83A 4HMQA 4RCYA 3S2YA 5ICEA 4OLAA 2ZBGA 4DS3A 3RKRA 4P3NA 421PA 1Q3HA 4YJFA 2FHSA 3A4YA 4XM2A 4QGBA 4INOA 1UOEA 5FLYA 1P29A 4GBED 4EK9A 1NG9A 3LAWA 4TQUS 4E5NA 1T1GA 2HADA 3BCRA 1WB4A 2W2XA 2JF0A 3P1JA 4M8LA 4BLPA 4KTVE 3UHFA 2PUCA 1FDTA 1A5AB 1WMBA 2UUBB 3UG6A 1K5GA 1NMEA 3ADDA 3I0ZA 3BJIC 3NS7A 3QTBA 5J59A 3UJNA 1JDBB 4I46A 2R7AA 4D9CA 3VYSB 4L6IA 1DV1A 1NJ2A 4RZHA 2Y66A 4DIDA 3QVXA 5TGTA 4YV1A 4L78A 2PRZA 2XKJE 3LUGA 1DRWA 5AOAA 2PRIA 4TMZA 4WACA 1JS1X 1YQWA 1KJQA 1L8AA 5CT9A 3FOCA 4WBNF 3BT7A 1CUIA 2CL5A 4PSVA 4PWZA 1D2MA 1WF3A 2J6HA 3FOWA 3WLNA 4E6PA 5JVDA 3N7TA 1AS2A 3FPSA 3ZQJA 3CF4G 5ES4B 2DRIA 2OO5A 3HZZA 5KIAA 1N92A 2B8NA 4TPKA 5HJ2A 3LH5A 3QBTA 3L7YA 5CEJA 2C1ZA 4TYPA 1G66A 3PCXA 4H6XA 4KXQA 2BKEA 4XTCS 2XA1A 1U8EA 1XNGA 3AVXA 3VU9A 3WQBA 4YUZA 1V4BA 1L5LA 1HLPA 3FWKA 3CLVA 2Y1DA 3O4FA 4LEIA 3THXA 2EV9A 2FEAA 1ZD5A 3MYYA 4GZMA 3TSCA 4EQ6B 5L6LB 1MOPA 2FPWA 3AL2A 1W96A 2OM2A 4OOFA 1OHHA 1A77A 1O87A 2V5AA 3EXHA 1W75A 3SQMA 4Q3LA 3AYXB 4D44A 2PGAA 2R6JA 1YS6A 4EJ2A 2JLRA 3ADBA 1Y8CA 3TQFA 5H16A 4HNRA 4BLTA 4KFCA 3QVLA 3IP5A 4LDRA 3G2HA 2XV1A 5LMUB 4Q39A 1ZSNA 3VR0A 1V8OA 1L7MA 1Q17A 3EH1A 3OFNA 3H9BA 4RABA 2PU5A 4V0NA 3A2KA 4I4TF 4BNGA 4EGCB 1CPYA 3OA2A 2QX8A 1Z6GA 3IP9A 1GAQA 4MHSA 1JQBA 2QIOA 4DQ0A 1QGUB 1EJ0A 1MH1A 1NUSA 2VJLA 4LXUA 3QLVC 1ZN8A 2H5IA 4OPMA 3GA0A 4R1TA 1QP8A 1KZ6A 3DOEA 4D0GA 2Z6QA 2FMFA 1Y6GA 4QU5A 4H1WA 2B69A 3EOAI 3Q7EA 2QYOA 5KYGA 1RKUA 3L6OO 3SFVA 3HFRA 1YACA 2HEIA 1Y7TA 2WAXA 2P8JA 3F5QA 2CB0A 3LY5A 4TSRA 2FHPA 1JFRA 3W7AA 1JU3A 2O8EA 2XR1A 2W8ZA 4TROA 1U65A 4OJKA 4V0ME 1VL2A 3HKCB 3ISJA 4HAUA 4XVQA 4AZ3A 1H2WA 2J45A 4CQMD 4DIUA 1HR0B 1T6XA 3IP6A 2QLTA 4MR8B 4JJ4A 2WIBA 3DV0B 3K0CA 4V2IA 3O95A 4BNWA 5BN5A 4B7XA 3ZJVA 4US1R 1OA0A 5IEJA 5CFNA 5MDHA 1JX6A 1T5TA 2Q3DA 1BA2A 4RHXA 2B9VA 1BW9A 2WSMA 5LL6P 1WKBA 1W52X 1RRPA 1TNDA 3CO5A 2I2CA 4D4IA 1YB7A 3NAMA 1WLYA 5JNVA 4Y6SA 2NM0A 1N75A 4YJ3B 5G3ZA 5FULA 4C7XA 4ODIA 2GMWA 1DIRA 2JH8A 2OKCA 2VYND 2ZCUA 1X7GA 3SCZA 3WWYA 2HLDD 3BXOA 1GFZA 3HV2A 2BMDA 1DI0A 1O6ZA 1C9YA 4F71A 4R3NA 5B36A 4I19A 2C78A 2AW5A 2B4RO 4PINA 2WUWE 1NNLA 2QG4A 3SVTA 3WQSB 3KR0A 3B52X 5LA6A 1A2KC 3OZVA 4KO1S 3ZHXA 5ALDA 5K1ZA 1EZZA 4DTIA 2SHKA 3TR0A 4KHPB 1O6FA 4I36A 4UHCA 3JQQA 3IQDB 1ISRA 5HW0A 5ILOA 4RK0A 4KQWA 4CV0A 1AZSC 1PJAA 2QMUA 4GAEA 1ADCA 1XN1A 4G65A 3GLUA 5TQ0A 3WAKA 4LOAA 2NU6A 1MO4A 1P62B 5JDCC 6CHYA 1OWMA 2I1WA 2OXRA 3SX2A 1X1AA 2IHTA 4BJ6A 3BZWA 4D0NA 2VJPA 4ZJPA 4MA5A 5B12A 4LF7B 2AFIE 4EMUA 3SYTA 3WZ2A 2JIZD 2IXDA 4QRDA 1QZXA 1M76A 1RJDA 1KEWA 4DV1B 1E60A 1FDRA 2RIPA 2VDQB 3KTOA 4K6OA 2X2OA 4J8PA 1N1EA 4KWHA 3SQLA 4KWTA 2CK3A 1XBTA 2FPIB 4C89A 3QSYA 3CUWA 5FD8A 4LOIA 4ZRMA 5F33A 1GEGA 4MUEA 1N3LA 1ZW6A 4HH1A 4EAQA 1J90A 1IG0A 1XJWA 3RSZA 4EY3A 3KYJB 4U39A 4MPPA 4OI0A 4EPTA 2WJ4A 1OV4A 1XZJA 4CQJA 5EQDA 2O7VA 3ZJ4A 5A4KA 1DGQA 1T9GS 1W4AA 4ZQEA 5AUPB 4OQEA 1B0PA 1WCWA 3GFQA 3L1UA 5DB4A 4PXAA 1GL3A 1A1VA 4YGXB 3VMMA 4IKOA 2GM3A 4G1UC 3VPSA 5BN1A 1V0JA 5JTTA 3AESA 4F4DA 5BMOA 1BWRA 1R66A 4FPXA 1XMQB 1VHJA 2ISQA 3UF0A 1RP1A 2BFPA 5AJWA 4ER7A 1PNRA 3DA8A 1VHQA 1E5VA 3GZTB 4PZAA 3KU1A 2BGUA 1AQLA 2JGFA 2X86A 3BZBA 3SLGA 3FZNA 2GCOB 4QFCA 4ND3A 4ZODA 4JY7A 4KYUA 5DZSA 4KSYA 4OQYA 3S4YA 1A8UA 2RD2A 4EEKA 4R0MA 2IJGX 3M7IA 3ZCQA 3EOBI 2R68A 2VPPA 4E94A 2AJBA 3TIGA 1K08A 3BWCA 1BVRA 2HCJB 1X8XA 2J9GA 1RBYA 1PEAA 3FYUC 1WX1A 3H2GA 2RKBA 6PFKA 2E21A 5KB3A 3SVLA 2QLJA 5T4EA 3P0EA 2JCBA 3IJPA 5EE1A 4Z9FA 4HSGA 3ZUGA 2WWYA 4YXWD 2RI0A 4UZSA 1FDOA 3ICWA 2WAOA 5FPKA 3OZTA 1DJLA 1XWWA 3MJTA 2ZP1A 1N4AA 1T15A 3LHFA 3L1KA 4X7BA 1BEEA 2XGOA 4Y2RA 1U3WA 2G3YA 2QQGA 3MMZA 4LBVA 5FWYA 5H83A 2I6SA 5DP2A 2F3RA 1I1OA 4KLZA 1DNPA 4U63A 5G0WA 3UGKA 4CTJA 2AOTB 1L5SA 2BKUA 1J2YA 3SPXA 3CKLA 4LW8A 3ZLTA 1A76A 4N12A 4OHYA 1SBZA 1YWGO 2HFKA 2NV6A 4AZWA 1JR3A 4M49A 2PV0A 2XF2A 1ZD2P 3FAZA 4BB9A 5FTLA 1NDQA 5CT5A 4X90A 2J41A 3LLMA 1N5IA 4L0QA 3BH0A 5CLLA 4TYNA 2B0JA 3JU3A 2O0MA 1SBHA 5JFOA 2H1IA 2IEAA 1WNTA 1SD1A 3W8RA 1YGYA 1KOJA 2HCRA 4JEHA 3V80A 4UM5A 5BV7A 2WVAA 3G0OA 4XFDA 2KLHA 4TRJA 1C9MA 2JI7A 5HFAA 3HRHA 4WJZA 3UXMA 4JKOA 3AM1A 1S2MA 1PD0A 3JQAB 3C5WP 4CQLB 4YFYA 3V8EA 3SZMA 5CNMA 4MWGA 1RM5A 2UVQA 1E1DA 3PRJA 5COAA 1CR4A 4HKTA 4IHJB 1N1DA 2E5LB 4ETWA 1Q5PA 5K0ZA 4O2AF 1IOWA 1SIOA 4ZV7A 3NQ41 4PFJA 5E4TA 4FDLA 3JYQA 4Q7JB 2GYWA 1BHO1 1ZM3A 1KS2A 3S2GA 4Z2AA 1LU9A 3D7KA 5FO0A 1IRIA 2IW3A 1NVFA 3RSLA 1OLOA 1N3YA 4A8PA 5KYUA 1SH7A 1ECBA 4EZEA 1V5IA 3LA8A 2CNLA 2BFDB 5C9ZA 5IJ9A 2LGJA 4YALA 1OAOA 3AK4A 5LOVB 2ZULA 2E6KA 1IM8A 4JB0A 1TFRA 1L7RA 3DL4A 4LC1A 3P9XA 2JJYA 3C5HA 4J4HA 3VSAA 1Z0DA 2QB5A 4LVUA 2J48A 2VDJA 3DDCA 3MFQA 4P86A 2HQSA 3L93A 1RRGA 3QU5A 5HIAA 3N70A 3OZAA 1IXSB 4R54A 5FBVB 2BJWA 1QO9A 1E66A 4FUQA 2CJPA 1MAUA 4EB3A 1RWBA 2UYQA 1NBMD 3TPCA 2WICA 4LV5B 4L2IB 1FUEA 2ZRBA 3LOUA 2WVGA 2XVXA 3SYMA 3WYEA 5IC4A 4C3ZA 2JKVA 2R8RA 1C7IA 1V47A 3WTCA 4BO8A 1U9YA 4Z7NB 3NCTA 5CEFA 3IX7A 5AKEA 1IXRC 4CI0B 4QXAA 3B53X 4QU9A 3ZDQA 3UKOA 4JIMA 4F3TA 3QU7A 3QU2A 1A3CA 2GILA 4JH0A 4BKOA 4LN1A 4RKYA 4CIXA 1JHAA 2CXSA 1SVUA 1FYWA 3CR8A 3DSRA 4NU6A 1N9GA 3LUFA 3WLIA 4UNQA 1G8GA 4U7GA 3OG9A 3S2FA 4RS4A 1Y9AA 1OXSC 4HI0E 4NYMR 3L9XA 5FUMA 4OVKA 4DNOA 4WKOA 5T41A 2P79A 2YBEA 4N0EA 1KL7A 5C8ZA 3CX6A 1UANA 3UPTA 1KH2A 1DBWA 3WNVA 4RD0A 1J9ZA 4ZOEA 3PNYA 1Z2AA 3QNWA 3AVWA 1USWA 3I01M 1EVLA 1FYEA 1HY3A 3IMGA 3KM0A 4TXJA 3DE0X 3IO3A 3QPVA 5EESA 4JKIA 2V8OA 3TR6A 3W5BA 4ZQCB 4B31A 4L5BA 3TSAA 2A9OA 1KEPA 2QSJA 3C3EA 3PTAA 3ORQA 1KMMA 4MVJM 2VK8A 3V00A 1WE2A 2JHCA 4LY3A 1FNSA 1QC5A 4JMLA 2F3QA 2QTCA 1RKXA 4J6FA 4URYR 1QP7A 1SXJA 4JB8A 4I08A 1XVLA 2H2GA 4R8KA 5K3BA 4ZI7B 2XF8A 1QCDA 3QBDA 4K3VA 1DC3A 1JPJA 1XKQA 4P5DA 1WMSA 4EYQA 3FFXA 1M2OA 2Q4DA 5HKBA 1Z47A 5JU6A 3ZH9B 1FLAA 2BM0A 2Q8PA 2PH3A 2HK6A 3DYIA 2O3UA 1J6UA 4NFSA 1MJGM 3SBDA 3ZCXA 4FB5A 5B1EA 3CLHA 8ADHA 1EFVA 4A0RA 2VUSA 4UNSA 3OM8A 1S7CA 4KBFA 1F3LA 4Q1EA 1FUUA 1Q1BA 3EK2A 3WQQA 2I65A 2VJMA 3OMLA 5AXBA 1OLUA 3PNLA 4IH9A 2HPVA 6YASA 5AI0A 1ORRA 2L2QA 2ERYA 3OTIA 7ABPA 4DY4A 3HN2A 4RLQA 3VAZA 3DC7A 5AK6A 3ZU2A 3LKDA 5JH7A 1Y81A 1GNTA 1Z4MA 1CQJA 2G4CA 3I8SA 4LMRA 3T3MB 4MVJD 1PYOA 3VSDA 2B34A 1B42A 2NU8A 5ESDA 2PJZA 4DTCA 2AWNA 7ADHA 2C95A 5L95A 4NOLA 1NF2A 1Z4JA 2J08A 1MRSA 4E03A 4E4RA 1APBA 2FQ1A 2I6GA 5M04A 4RY0A 2VJCA 3HM9A 2ONKA 1EVYA 1MRZA 1OKKA 1P1JA 4JLOA 3RVKA 4RGYA 5B2ZA 3X1JA 2HYIC 4IJUA 3CN9A 3DD1A 1TJNA 3BOSA 5HMMA 4CM4B 1KRXA 2PS0A 3DBLB 3CF0A 3HNOA 3PSHA 4CLOB 3TG8A 4MIEA 4KXXA 4CL3A 1KMHB 1J00A 2BL4A 2FKAA 3GBSA 1EDBA 3LU1A 5BYBA 3NKVA 4Y9SA 4UU7A 1BE6A 2FSFA 1E89A 4MW9A 3SP1A 3VYWA 2OORC 4TS1A 4JENA 4ZEXA 5IHPA 1QLHA 2Q3LA 2BUBA 1ZN2A 2P4SA 4W9NA 1O7JA 4M46A 5EP4A 1WQ3A 3LDFA 1GAWA 3G82C 3PFGA 4BMCA 5LP6B 1EJBA 2NWQA 1DG9A 1I2DA 3DP7A 4LXYA 4XQ0A 1KKUA 1MDBA 1IONA 3FIJA 3IT3A 4UZEA 2VVTA 3SEQA 4CG0A 5CA1F 4BP1A 2JCSA 1ZOPA 2PO5A 3DJYA 5DN6D 2DJIA 2X13A 4MDEA 2P41A 2AMVA 2DSTA 3GJ5A 3T0IA 2R1TA 1CQZA 2FPGA 3CSUA 4PS0A 1PFKA 3CRZA 4D3DA 3ND7A 3EPKA 4WLOA 3NWJA 1JDTA 3LO8A 3W7BA 4BBPA 2CGEA 4K03A 3G17A 2QZSA 1IQ0A 5IBPA 2C0QA 3BWMA 3HL4A 1JT9A 2NQ8A 1N7JA 1HKUA 4RU1A 5BSEA 3BDAA 3OVMA 4V1CA 3HI4A 3PNPA 1F8GA 4N8EA 4LDQA 4EJSB 3Q88A 3QI2A 1H2HA 2HUNA 1Y9EA 4PFSA 4FUTA 4JYCA 1PVVA 2V7BA 2ZXUA 1VCMA 4PG6A 1IDOA 2PKXA 5BQPA 4NBRA 3I4CA 1GTRA 2BFEA 3KK0A 1E7MA 4KIJA 4L7QA 2VUHB 3KYDB 4MQBA 1YQXA 4MUIA 3BFXA 3UAXA 2Q7XA 3RK0A 1RI5A 2FXVA 2HC9A 2R8BA 4B71A 3VUEA 4G5OA 4DJFC 1QP0A 2R6AA 2AJCA 4ME6A 5A03A 4KE9A 3ZE7A 3G2LA 2RGDA 5EOVA 4M0UA 2Z08A 1J8FA 1X92A 1Q7CA 2O7RA 5EL0A 4U4AA 4CR6A 5JNLA 3N39C 3VOSA 5B3AA 1WCIB 5G02A 4CKCB 4WV3A 5KZMB 3E4DA 1ZUWA 2NX2A 2H4HA 5SYAA 2QQFA 4LJ9A 3D7RA 3UOGA 4Q1BA 1S8OA 2EGGA 1PK7A 4G1BA 4MUBA 3AUYA 4J1NA 2WTXA 3EYAA 4BNMA 1W5FA 4LHVA 2A5DA 3DO6A 4HWGA 1KY2A 5KVAA 2JCGA 2QAGA 4Y2VA 5HFNA 2YXNA 3VOAA 1JEQA 1KSHA 3UV7A 5HZKA 1EJ2A 5KTRA 4G0UA 1QYIA 1WHSA 1YA4A 2EYQA 1MEJA 2LCQA 1BA3A 5GONF 4BGUA 2JL1A 4JI2B 4IIYA 2FQQA 3H05A 4JJAA 3FNIA 1LS1A 5I48A 1ZOIA 2F9LA 1XCLA 4NCKA 4H4DA 3UZUA 1BYIA 4Y9TA 1QGED 5H68A 5TQ2B 3VPDA 4DM7A 3DOHA 4PZEA 2OHJA 2QUHA 4Y0VA 4E31A 1ZD1A 2O57A 5DX1A 4TKLA 1AT1A 1WV1A 3WX0A 3A36A 1AGRA 4X8OA 2ZXFA 1UFOA 3AHJA 4UULA 2E4AA 3LVBA 1O89A 4NP6A 2BW0A 4RWZA 1JSLA 3TMYA 1YMVA 4OKSA 2M1XA 3OIDA 4OBWA 1NZDA 4QUBA 3BPSA 3H4TA 4ALLA 1TZKA 1YO6A 3ETHA 4J1TA 2WEKA 1T3TA 4AP9A 4P5PA 4XWKA 4AJ4A 2P4EA 4TKZA 2Z2JA 4LRTB 2ZIXA 1LZLA 4HLUA 2O8FA 2IWRA 3Q41A 3I5UA 5TSDA 2O1XA 4JWKA 2GM5A 2BFCB 1UM9A 4JUBA 1BX1A 1MXFA 3K0AB 3WNZA 4H16A 3HGMA 3QOYA 5I5EA 1SHKA 2DBRA 2EARA 4HNAA 3UPDA 1VE6A 4BAZA 2VK4A 4ECAA 1JDSA 5B4UA 3ZGVA 4LIPD 1IEXA 1PJQA 4EI2A 4CMBA 4F3CA 2JGLA 2O0KA 3RSCA 2XWSA 3RG2A 2QJWA 5KX5A 3F3MA 2H4FA 1QUEA 5I8PA 1JSZA 5AVRA 2GBGA 5I7EA 3TRIA 2GAJA 2IUFA 2L17A 3R6TA 1EIWA 3OTWA 1LBEA 3L49A 3CUSA 2JVKA 5B2FA 2GK4A 3V55A 2JGEA 1H69A 3L7IA 4HPJB 4LK3A 3DUFA 3R77A 1FFDA 3THYA 5DKFA 4A16A 4B3GA 2ZSAA 5I51A 4Y2TA 2I87A 2SCUA 3KKLA 5ALFA 3MXOA 3IUSA 4XASA 3HCAA 3VNBA 3GJ7A 3L92A 4LE1A 4F4IA 2D5IA 5LJLA 3TNYA 4AWBA 4AKTA 2HXYA 4IEIA 1T8SA 2PA0A 4HDAA 4MPJA 4TMXA 5FL7D 3KKKA 1B2LA 1Z2NX 2BR3A 4N40A 4BY9E 4Y2XA 1JFTA 1SN7A 2CL0X 3RAPR 4XVCA 3EGXB 1JB1A 1F2UB 1ZVJA 2ATCA 3TI9A 4Z1MD 2IYZA 3TQRA 1EFTA 2Q3FA 4QD3A 4NDZA 1CP3A 1K68A 2MWMA 5C4GB 5LSAA 2IUEA 1Z2CA 5K6AC 1YZVA 1PZFA 5HK9A 5K03A 1G5RA 3WL7A 2HQ1A 3AETB 3AI2A 4GX0A 4DUPA 4UPEA 4OGLA 4Y30A 3M81A 2HBZA 2IXGA 5C1OA 3I1YA 1ZHOA 4B3HA 2V7UA 4DOMA 2X2FA 3EVBA 2D1RA 3Q8LA 5G3YA 3AINA 1U0OC 1E6MA 2FRDA 5L6MB 1NU8A 1N9ZA 4IIXA 1C1YA 4JNCA 1UH5A 5MHTA 1GZ3A 4EKGA 4EUEA 5BVGB 4LJ5A 4RFSB 4OF4A 1C3LA 4NFLA 1I24A 2O7NA 3R24A 3RFFA 1WY7A 2E82A 3WLQA 4DAOA 1YUNA 2F8LA 2YWEA 1NL3A 1AUPA 4O4JA 4Y0AA 5KI6A 1MEEA 3BSWA 1E1YA 3BCHA 2H3EA 2A4MA 1RYNA 3BRQA 1BD3A 1P4AA 3HXKA 3L8GA 5IC5A 3ZNNA 1R6BX 3C3CA 4MGEA 4P84A 5DFAA 4KR3A 4YHBA 1U9IC 3AY0A 3WA7A 2HF8A 4DQVA 2R5FA 4XW2A 5J2TF 3HY3A 3PRKE 1E7SA 4QBFA 5JFGA 1NQWA 5F98A 1E18A 2Q4OA 4GGOA 3HKDB 2F4VB 4V0SA 1PKXA 1MFZA 2IE0A 2WF8A 1DAGA 1F20A 4JD5A 4QOJA 2NUTA 2D5LA 3RANA 3RFCA 4KYVA 1XMVA 5IAKA 3S55A 4QECA 1W5BA 4X45A 1MPXA 1GCGA 4PX5A 5DASA 4QXOA 1JH8A 1B8VA 1PIWA 1WXWA 2Q0XA 3OM1A 4FJ0A 3F0TA 3D4LA 1MT3A 1TQHA 2ZQ5A 2NPIA 3FTQA 4OU4A 5LR6A 3OECA 3B20A 2R4TA 4ZJZA 2HLHA 2Q29A 2ZQZA 2VUIB 1SXIA 4DNXA 1V41E 2L69A 4WZAA 2HMTA 2WSIA 4WIAA 3OQMA 4TTAA 3EA0A 4A4DA 1T2NA 4HN4B 1G41A 2QJOA 5T6BA 3T5MA 3VR4D 4A8TA 5KSWB 3U7HB 3RS0A 2D3TA 3T7IA 3N74A 5F7ZA 3SGLA 2AXEA 5FEUA 2BEVA 4L8LA 3BRWD 2VHUA 4TTIA 4TV9F 4AJ2A 1A96A 1IWPB 3LHKA 5GM2A 3L8EA 5JZ9A 1JRLA 3QXCA 3O1LA 1SG0A 3SEFA 5B53A 3LSYA 3S44A 1EX9A 1NMYA 2IIPA 4NYJQ 2JLZA 1K7XB 4JUCA 2A0WA 5KHLB 1ZU5A 2J4CA 3QM1A 4QBIA 4DM4A 3LQYA 1JILA 4AT1A 1EXDA 3IELA 1BE8A 4OCZA 1LLCA 1IN4A 1SOMA 1G59A 3AUUA 3M4NA 2GJ4A 3VO1A 2FX2A 4GP7A 1Z07A 4OJQA 2N1BA 2B1RA 3UXEA 3WGVA 1G3QA 4N1AA 2ZIWB 4QYSA 2VIIA 2Z9DA 3QUSA 4YT8A 4GWLA 3QELA 2HKIA 4UNNA 2OCIA 5DDIP 1C1XA 2G0TA 1G42A 2VXBA 4YO7A 1YNOA 2HA7A 4GKAA 2XT0A 2FW0A 1C3OA 1L4FA 1LSOA 4TL9A 3DS8A 5K8IA 3AY3A 1MNAA 4RFVA 3VZQA 3TZHA 4BBAA 3U4AA 3SD7A 5DWDA 5JHHB 1QAQA 2ZSFA 3AT1A 3X44A 3HVUA 3BRCA 2IYEA 3HB0A 3MD0A 4A3SA 2V7WA 4F8YA 4H1UA 1AA9A 1C30A 3L02A 2Q8QA 4YJDA 5LFAA 2A9QA 2PO7A 4KO3S 5A5GA 3KWMA 4KVZA 5DHRA 2QXYA 3NC4A 2ONZA 2QSYA 4YMIA 1IFXA 3CU5A 4F2HA 3LGAA 4OHFA 3EUWA 1M8FA 4EJMA 1TGYA 4JBLA 1AKWA 3R9IA 5JRDS 3RUFA 1NMSA 4DCJA 3FHCB 1WDWB 4BJ3A 4LSZA 4Y2QA 3OI7A 1VPWA 3RVBA 4B45A 2C4WA 2YC2C 3DZIA 3K2EA 2YRWA 1MC8A 1GZ6A 1KY5A 4NMXB 2PMBA 5AOVA 3LJKA 1Q12A 3VHQA 3ZG6A 4BZZA 2ON6A 3QFFA 5K7SA 1NVAA 2SKEA 1QHFA 4XZ3A 3WWEA 4ISCA 1PJ3A 4PLCA 3SHOA 3CPSA 1GG8A 3GA7A 5I9LA 1U4NA 2OHOA 621PA 1O9GA 1RWVA 4UBJA 1GUFA 2D6FA 3NVAA 5ARDA 3V9PA 4AJNA 2YWDA 4KFRA 3MS7A 5KTYA 1JA0A 1AXGA 3NBUA 3IOYA 4RD4A 1K9VF 3RHSA 4DSAA 2WD9A 2PX5A 2PX6A 3PDIB 2RCNA 2ZI4A 3HDJA 2HWYA 3UWSA 2QTWB 1HYGA 5LNK6 1L5NA 2MSEB 1RRMA 2IDKA 4XYBA 4EG4A 4ZZIA 2CHGA 4I6JA 2HL6A 4PYKA 5AO9A 3KXKA 4AJKA 4TMFA 3MQ2A 4F9TA 721PA 3JAWB 3T7SA 4B6EA 4GNRA 1PX0A 1SWWA 2EL9A 3QP9A 4KQFA 4M8KA 5ALWA 5EQTA 3SMQA 4NNPA 2Z6UA 1SEPA 3U40A 3TBKA 1BU5A 4MULA 1L7VC 3SOPA 2IYLD 5T64A 4GMXA 1K3FA 1DIGA 4M99A 4NEHB 4Q66C 5DXFA 4BPRA 2DHCA 3EBLA 1UXGA 4XEUA 1YF3A 2AJTA 3R0IA 1E0SA 1GG2A 1ULBA 2ZB8A 4G0YA 4R8SA 1XDUA 4ZQFA 3VH3A 3VNRA 3W3ZB 4DWVA 1NPTO 1X9GA 1XLTA 2I2AA 2VNHA 4Y1EA 5BOSA 5J2UF 1LTKA 2VBIA 3PHLA 3GGPA 4U6SA 2IV7A 1JFFB 4MKRA 1W87A 2W8BA 1ECJA 4KN6A 4XGKA 1CSEE 5IW8A 3WJAA 2FMUA 2R1VB 2NO5A 5AXCA 5HK8A 4IY1A 4YV0A 1W4CA 2IK8A 4IVNA 5KQLA 5AIBA 1ISGA 1YH3A 3DLPX 3QKSB 3SE0A 1PEKE 1B8OA 1PW5A 2Z09A 4HDNA 1C0IA 3WRYA 1J20A 4ND6A 4X7RA 3X1DA 2GPBA 3FSGA 3MJDA 3P2YA 5A5VA 4A0FA 3A2NA 1A1SA 1BDBA 2OCKA 1UMBA 3AUJB 3CSDA 2XNJA 2ZYTX 3NYIA 3CX3A 3QEKA 3DQQA 5DTJA 4ZZ2A 3ZR4B 4ENVA 3GN1A 3M34A 3CNHA 3NTLA 2LV8A 4CFSA 1Z5WA 4WINA 4XYLA 3V4RA 2ZB3A 4ND1A 2FU5C 2R2AA 2F00A 3JWEA 2NZWA 2PIAA 3MCVA 3MJRA 1ZUNB 1RYZA 1KJZA 4ZCLA 6GPBA 3CRNA 2C9ZA 3OZUA 1USGA 3AR2A 1AKEA 1HETA 3DBHB 4OYLA 1Z8FA 1ZOLA 2CUTA 1ADJA 1J22A 4DV4B 1M1XB 1FXSA 5AMXA 2F8SA 4XWGA 1IZYA 3RS2A 1NV9A 3CR3C 4A82A 1XK7A 1G5IA 4ZMBA 4E5PA 4LQLA 1ISHA 3HHEA 3QF4A 1N77A 2GZRA 4KJZA 2O8NA 1VE9A 3HFGA 2PJDA 1CIPA 5B58T 1XLUA 1B26A 1FDVA 1ODSA 3CNQS 4M0MA 5EERA 3MMSA 2GM9A 2WINI 3ZBQA 2I4OA 2HA3A 2VP2A 4R2KA 4S24A 1TJPB 4Y3UA 3CISA 4C87A 3RC2A 2HZ7A 4MB2A 5B7QA 2R85A 1EU1A 4PYRA 2NNWB 3QIAA 5DNVA 1ZISA 2OXTA 3UFXB 5E6SB 2G1JA 3VPXA 4BFLA 1CULC 2CE2X 1RAGA 4MW6A 5KSYA 1ZQ9A 1TQ8A 3DR5A 1X1TA 1TJ4A 3PUJA 4RETA 5SY6A 1NQTA 2M6LA 3ZKWB 1L5RA 3HDYA 1WAMA 2B61A 3O1IC 4ILEA 1JJFA 1Z7GA 3SQXA 1OGJA 4O4HF 2R60A 1BDMA 1KYXA 4Y1GA 3ZCVA 4UU8A 1G20A 2JLQA 5ESWA 5CIYA 3E7PA 2BEUB 1XTSA 2COEA 1XI2A 3PEFA 1D2NA 1JHXA 1M5RA 1SVSA 1THZA 2FTKE 2C4HA 3RSOA 5CA0F 3TAHA 4ER3A 3VC3A 4HWOA 3TBHA 3A6DA 1HT2E 1EM8B 2JNWA 2V6MA 3F8TA 4GOMD 1ZOSA 2I71A 5HCNA 3A3OA 1QE5A 3AYZB 3HP7A 4R2WA 4K6CA 2X0DA 1TW3A 1RXWA 1TKBA 4TQ9A 1X80B 3HB9A 5DHFA 4G2TA 1BYUA 4IBOA 4DFDA 2BHSA 3N2LA 2LD4A 2EOAA 4TXMA 4J7UA 5JALA 1GCAA 1MIOB 3PTZA 4CKZA 3B9RA 3O91A 4I1PA 2ZK7A 4ENRA 3K70D 4YCMA 1ZEJA 1PEYA 1VXOA 2NMVA 1K8QA 4YO8A 4TV8F 4BNIA 3NB0A 2FN9A 2BM8A 4HL6A 3BCUA 1Z4IA 2REQA 1QIIA 4LJ8A 4P5EA 3DO8A 4P2GA 4RMJA 4X1KA 2BT4A 3TLYA 5LN1A 3GMTA 4KLAA 2HSDA 2VLIA 3OCWA 2AG1A 1J25A 3WIEA 4AY5A 1C14A 3ASZA 4BLUA 1JYEA 1J7KA 4K26A 4LHZA 4LOHA 3FX2A 4N01A 1I30A 3W3AA 2I76A 1ECLA 1QWSA 4BKRA 5KTKA 1KE2A 2IP1A 4MEAA 5E7JA 2PKQO 1IJKA 4X20B 5E9JA 2WYUA 4ZWNA 1Q0UA 1YS4A 4IS3A 1Z74A 2IVFA 4K6FA 3WB0A 3GZNB 3ER9A 3K4HA 3NANA 4JBNA 5K4AA 1U02A 2CLLB 4E5DA 2QD1A 2MOKA 3LWZA 1CEEA 3EQ9A 1YVDA 3HUUA 1X7HA 3HWSA 3ZE9A 4LYHA 2QHXA 1DLJA 3EXAA 4DVJA 5D3MA 1Y37A 2WD7A 2ZRLA 3MCTA 1T0HB 3MRXA 4W5TA 1T2UA 3D8RA 4O4LF 3RWMB 1K8YB 4BEJA 2OV6A 5FFMA 1AGXA 2ZWOA 3F6PA 4F60A 3NVKI 2EFEB 3G2NA 1C7JA 4QU8A 4D5EA 3PHJA 4QU0A 4TKVA 5KC8A 3RIYA 3BTOA 1GTMA 2TS1A 2F1KA 2X2EA 1DBRA 1EFDN 2MJLA 3CH5A 1M1YA 4M1ZA 5HZMA 3EAQA 4KQIA 4G84A 4YEDA 4WERA 4AMYA 2O3QA 3OZDA 4G5QA 2HK7A 3H16A 3NTRA 3WV4A 4F72A 3GXOA 1PX2A 2VBCA 5IYZA 2QWXA 2GVDC 4DGSA 2X6TA 3U3KA 3KQHA 2SECE 1NU6A 4FU0A 3RF6A 4LJYA 2YOHA 3D1LA 2IOQA 1CE8A 2HMWA 2GCEA 2V55B 1ZNWA 3BD6A 4XDZA 1MO3A 1NMQA 2DB3A 4LC0A 1VCHA 1YR8A 2F3SA 3ERCA 1X70A 1OYYA 3QVOA 3EXIB 4A26A 1ZUD1 4QM6A 1TMYA 2EATA 1C8LA 2F9FA 2HQOA 1NFRA 3EEFA 2NUAA 1ORVA 1T36B 2JI6A 4N8SA 5ALKA 3NIWA 3PC4A 5ULLA 1H2FA 4YJ2B 5KOHB 1WMDA 4CT0A 3ZGYA 1EGHA 1FP1D 1IBCA 3H17A 5CHEA 3RBAA 1GXSA 4Z4IA 4D4KA 4KL8S 4X54A 1MABA 4F2DA 5FNVA 5AQ1A 3PGKA 3MWEB 1SHZA 3DF9A 3JZIA 4YJHA 4HX9A 4RW0A 1LWNA 2HMYB 3TFWA 3ANMA 1RBZA 3HVKA 4N0DA 5REQA 1W85B 5DSTA 5CXQA 2XNDD 1KAEA 4MV0A 2ODNA 2QM8A 1ZUIA 2QD2A 3QX9A 2AKAB 4B40A 4C7BA 2J5RA 3D4IA 5EE9A 4R1SA 1EXNA 4AF8A 1TPYA 3KOMA 2A8YA 1MN6A 3G0IA 4LZPA 4PQYA 5JLAA 3FPEA 4N3CA 3OFVA 1ZDMA 3S68A 4PPQA 1UKAA 2BEWB 1PR2A 3DTTA 3ADPA 1AN9A 3K0CC 2G1AA 1L8LA 2FDRA 3F78A 3WK4A 2OFXA 5CXXA 3MS4A 3U17A 1BFDA 1NYLA 2HXGA 4PN3A 3CS3A 2ODWA 1LPMA 4OLJA 1ULAA 2O7SA 4CW7A 7REQB 4IXDA 3PE6A 4K6KA 1W4BA 1LRJA 3DC2A 4MPRA 1PGPA 4WLVA 4CMIA 1ODKA 5LPNA 2FLWA 1ZI8A 1KU6A 2XBLA 1G7CA 2OP0A 1M8GA 1ATZA 3GFBA 1T8PA 1CR0A 2HRRA 2Q4BA 4BNFA 2W00A 2GEFA 1QHEA 3MMNA 4KO8A 1C9DB 3KZCA 1K92A 2Q62A 3ZDBA 4OYHA 3PXDA 4MVCA 5E38A 3LDUA 3TZEA 5H59A 1OF1A 3PXCX 2BF4A 3GW8A 3QTTA 5FBWB 4CLHA 4F3YA 5B5SA 1JYFA 1L5QA 3JWJA 4DADA 5LDDC 2X8WA 4B43A 1HFKA 1P5FA 3MCAA 1XVAA 3Q6NA 3R8CA 2YFHA 3CO0S 2RHMA 3H5LA 5JS6A 2H00A 2AUTA 2BGKA 3BMCA 3I4FA 3MQFA 4GMKA 5G40A 4EHAA 2JBAA 3JQDA 3KVOA 4PWYA 1XXHA 2JEYA 2QRPA 1T2VA 2EEPA 4RF3A 3HWWA 1MAHA 4OX9B 2WDZA 4YONB 4GM0A 3ADCA 4CFYA 5HE9A 5C37A 3BIXA 4MRPA 4KO4S 1DEOA 1OQAA 4XD7D 2FWJA 4ZVKA 1WEHA 5DTEA 4UM7A 3IS3A 1QPGA 4CL2A 5IAEA 3RRMA 1YJXA 2YJ4A 4JC4A 1PVOA 3VI3B 3X2FA 3R7NA 3HSYA 2R44A 2GHIA 1E2FA 3L4JA 1I3OA 2QMEA 3AJAA 3ML1A 4XTRA 4YJ3F 3BEOA 4FYWA 5G4LA 4F9FA 1YUBA 3ETNA 3L4BA 4HEJA 4MS1B 3KVVA 1LNZA 2QNIA 2YNMC 1KYWA 1IOVA 1EM6A 4FGJA 1E6UA 1V16A 4PEVA 4K28A 2BVNA 2GT1A 5EJFA 4JXJA 3OPXA 4R68A 1GPH1 3OCZA 4TWJA 3ZWDA 4B4UA 3JR3A 4F11A 3CW2A 5A3QA 1AGNA 1K6EA 5JHGB 2JJ8A 5JAPA 3GGSA 2JPDA 4YCJA 3NHRA 4Y6OA 3RLIA 4OP3A 1IQPA 1H2XA 4MRMA 1IIRA 1CF9A 5GZ1A 2I2FA 2UXDB 3IHKA 4L0CA 2A57A 1UK6A 2GXQA 9LDBA 4MR7A 4RHCA 2YNMD 5IT0A 1R15A 2WFLB 2WMYA 4B73A 5ADVA 2C2XA 4GDMA 4Z4HA 3NBFA 3JSAA 2ZKLA 4Q9AA 3BD8A 4D57A 5F3RA 1JFSA 3P9KA 5IN5A 4H2DA 3VYUB 2AN3A 1KSGA 3W90A 3PC3A 5GOTA 2XE7A 3A31A 3R20A 3X3HA 4ZOCA 3JX9A 2FMXA 4IDHA 1Y1SA 4LA4A 1JFLA 1QFMA 2QLNA 2BKXA 4CR8A 1EG7A 2IT1A 4CEHB 2Y1FA 2W2TA 1KVQA 2QM7A 3DL2A 3MT7A 2IH4A 3AF1A 4RA6A 3WGNA 1YCGA 3I39X 3PKZA 4JYMA 4YT4A 1KERA 3GO4A 4Y6GB 2JEZA 1ZRNA 3ER8A 1XQXA 4GLJA 1GPLA 1RHUA 2VDPB 4UNPA 4W7SA 1ENOA 4YRDA 1Y3IA 3CNEA 5JS1A 4I14A 3S1AA 4QTZA 4WK2B 4IIHA 3RDPA 5CXUA 2B98A 3S8MA 2ZE6A 4NENA 4DR6B 3H5AA 4RJ2A 2HWXA 4X6XA 4E70A 1E1RA 2IS6A 1HWYA 2EJVA 1Y5LA 2PPLA 4MHOA 2YMLA 2Q5JA 4FDAA 1ONSA 2WKWA 3AJRA 4K2AA 2GD6A 3RAFC 4Z4EA 2ZRIA 2W6MA 4U9HS 4IRUB 4LWQA 1JSXA 4WN9B 1SU7A 1G9SA 1VGRA 5JCPA 3UHJA 4RTQA 3E8SA 2FOXA 1KYYA 1L6IA 1V1RA 5DLDA 4LJRA 4LRUA 3T9DA 4A8JB 1N5KA 3JQ6A 1IJBA 2BFBB 1S89A 2BY4A 3OY2A 5EHQA 3BFKA 4FGZA 4AWXA 1U8YA 5G0SA 3E15A 1RPNA 2V3VA 5F35A 1GPAA 2ZPAA 4K9SA 1ACJA 1JR3D 1NJFA 1VZ3A 3W8FA 2GJ9A 4NJEB 2HRQA 1Z3CA 3ZIAD 3PEVA 5HJEA 3RC8A 3JVDA 4ZPXA 5FT9A 1AZLA 3VSCA 2P35A 3S28A 2QN2A 1UFRA 4PONA 2H7XA 2ZYAA 3O1JC 2F3TA 3LYLA 1R12A 4O02B 4XWYA 1E7YA 3TIVA 2DUJA 3FMPB 5FPPA 3GDGA 1A9ZA 5FUQA 1W9HA 4OFBA 3C3PA 5KNBD 3EX7C 4Y9DA 3O6VA 1OSNA 1KETA 4BATA 4D56A 3OQVA 4MQ5A 4AF7A 5ELMA 4TMVA 1B0UA 2GPWA 2QY6A 1OAOC 2NSJA 4TUYF 4DC0A 5JW6A 2VSFA 2OQRA 2YW2A 2CMDA 4J1SA 4MWBA 2MSNA 3GWZA 1RMQA 1YI0A 2P0AA 2RH5A 5D51S 3GLFB 4KPYA 2NGRA 2P9FA 3ET5A 3TKAA 4C3VA 5IP5A 1YBVA 1YR6A 2F43A 1GTJ1 2G67A 1Z4PX 4A5SA 5DLYA 1UBHS 3H4MA 4LWPA 1T1EA 3KEOA 3MINA 1U8FO 1RIFA 5KYXB 1AMUA 3KT0A 1N5MA 2FMKA 1BROA 1JVBA 2DUWA 3CBGA 3FI9A 4O0LA 3NHSA 4PO9A 4WDQA 4X71A 5P8WA 4E2WA 2DERA 3K2IA 4IH1A 3D1VA 1RAIA 3A0UA 4HYQA 4N03A 2IYTA 1K4KA 3L7NA 1AO3A 1IM2A 1DC6A 2WZBA 1DX4A 3PWTA 1CKEA 4N5IX 6ADHA 3K8ZA 1OY1A 2POCA 2Y77A 4NATA 3NHWA 1A7UA 1Z8DA 1YB5A 3NXSA 4QQRA 4IHJF 1NSFA 4PICA 2YVQA 2Y27A 1RIIA 3H11A 3SR0A 5E6RA 2Y9PB 5I7HA 4Z8YA 3IP1A 2YHAA 3MUFA 4G4JA 1N3BA 1XDGA 5CJJA 4UBMA 3WYFA 1NF9A 1SO8A 4XJTA 2NYVA 3WDKA 3WLFA 2WOOA 1VC2A 4KXYA 3QJGA 4QSHA 4AG3A 2CLFB 4ZFNA 3K0FA 2PSFA 4IJQA 1N2JA 4ALKA 3RVRA 5HUJA 3I37X 1BKDR 3B6KA 4DLNA 1JIVA 4ARAA 1QCYA 2Z5GA 4JBXA 5JZVA 1ZY2A 4RF5A 4BP3A 4FMDB 3ZGXA 2HBRA 4DSNA 5IMSA 3BQ9A 1M2FA 4BBZA 5KDDA 2GS9A 1RXCA 1FLNA 3G68A 1R2QA 2X0RA 3K0BA 4U2FA 2PUBA 1O54A 5KNDD 5BNIA 4HQLA 3VU8A 3A6PC 4B35A 4G09A 3NHMA 1NW9B 2BTQA 3OD5A 4UFNA 4IJMA 3LNCA 2O50A 2EKQA 1NBHA 3KUDA 1XJ5A 2IFTA 3SC4A 3KQWA 1D4FA 5MFPA 1LNQA 1NY5A 1PNVA 1SXJC 2QU7A 2RGUA 2YY5A 1Y7PA 2UAGA 3FPKA 1MBZA 2Z9CA 1GZ7A 5LWQA 1KJNA 5AXDA 1AZTA 4PQFA 3IQFA 4E46A 1PQ4A 3BXFA 3E9DA 1GP2A 1VSQA 1XZQA 4OH7A 3A6KA 3BSYA 1W0JD 3U4DA 2EFJA 1U1FA 4MWTA 4QGAA 4WCFB 5FPHA 2YBDA 4G9GA 4C3OB 2E0IA 2XZDA 3A4TA 4LPKA 4DSZA 4YUXA 3AR8A 1RTKA 2GPAA 3DTVA 5EKTA 1E1QD 1E3IA 1BWSA 2FFAA 3LC1O 3OO1A 5CCXA 1FRFS 3MWGA 2HNBA 2QMHA 4PC1A 1X7XB 4RZIA 1EQUA 5HIJA 3WRXA 3PE4A 4KR9A 5A3JA 3QTLA 3DVRX 1LB1B 3AEQB 4B7UA 2G5CA 2V7TA 2YOGA 3RIMA 4EG3A 3ZQ6A 4MDFA 1S2OA 1YR2A 1H1DA 1NOIA 1CS0B 1FW8A 3A6LA 3BL5A 4GX5A 2NPFA 5H5JA 3WISA 2C8JA 3PDUA 5JADA 3GFSA 2YXPX 2H9IA 1CYEA 4BE4A 1EFAA 3RBXA 5E7IA 4DM3A 4R71A 1QHGA 4JLNA 3R23A 4CM8B 3LUHA 1A69A 4QJ4A 4EARA 3SNHA 1W44A 3NDRA 2C07A 4ZI7F 1EMDA 2HD4A 3EIFA 2O2EA 1X7ZA 1XHFA 4BVBA 2B3DA 4KV9A 1TW2A 3K0KA 3CVUA 4B9EA 4ENTA 1BS1A 3D1JA 3RROA 1E7QA 2OK7A 3NASA 4KDEA 4DMUB 4EQ6A 1VE5A 2P9TA 3LQQA 4LTDA 1G2IA 1PR9A 4BV9A 3BWEA 4W9NC 3UM9A 1T6BY 5EZYB 4EI8A 3R6LA 5L51A 4HATA 4IUCS 4G8DA 5JT1A 1T5DX 2ZRQA 4QGGA 3UIEA 4EFMA 1YBMA 3WB2A 2P77A 1EVJA 1HT0A 4Y18A 5TR9A 5A9SB 3GDHA 6REQB 3RYCA 3CUTA 4NX2A 2HREA 4IDOA 4I5GA 1XZBA 2GKSA 4HB4A 2QYTA 3AFGA 1EA7A 3LG2A 3KOWA 1K3TA 1W2HA 1XA0A 3TLGA 1MB4A 3D6AA 5H9WA 1P0MA 1ZYUA 2B4TO 4P38A 5K3CA 1QGUA 1DE0A 1VKNA 1X3LA 3GN2A 3ECAA 3PUIA 4AQ7A 3EGVA 5H81A 1QH8B 3V8NA 1JB9A 4GYYA 2P9QA 4GZ6A 1VCOA 4R81A 2DY1A 1YKGA 3A2MA 3LPNA 1SA0B 3BJMA 4GRDA 2ZBPA 1RQ2A 2I8CA 1ORDA 3Q3VA 1E62A 4GEGA 5KSOA 4Q3DA 2I9KA 3VTZA 5ITWA 3ZDRA 3MTBA 3VV3A 5HJ7A 5K9ZA 1M2NA 5JJKA 1E1CB 1OAAA 3T3PB 1L7DA 4TT3A 2CV0A 4XKJA 4D8TA 1Q50A 3NTXA 4GOND 3IDOA 3HA5A 4JASB 4K1LA 3SHQA 4DLBA 3HKCA 3CZMA 3ROTA 4M7WA 1XE3A 3KJNA 4YP0A 1R4NB 1U7UA 2B8JA 1FA9A 1VRWA 3OCXA 4V03A 1M2KA 5LP6F 4PZ0A 1Q11A 1PJCA 1FP2A 1OI2A 1Z7EA 4M98A 5H1YA 4F0JA 3Q6MA 2JRCA 2R1UA 2WJJA 3KE8A 1JBQA 1E96A 3KELA 3BG5A 4OQDA 3T41A 2OHGA 4NYIR 1Q1GA 2CKDA 4L9AA 2F2TA 2PSHA 3ETJA 3FFTA 3H8WA 3ZD9A 4FFLA 4AROA 1JDVA 1OVMA 1N9KA 5EE0A 2VQFB 2PUFA 1F1JA 4HQ6A 2LKDA 3KAQA 4OAQA 4ZIRB 3PWSA 3VA7A 4LXHA 4IX9A 1WD7A 3M1YA 3RTGA 3FNEA 3M6MD 2AX3A 4UQOA 2QAGC 3ESZA 1EWYA 2H08A 2P1DA 2GD1O 3N2YA 5CBPB 3BHJA 3CIFA 3DBVO 4UDYX 3SIXA 1WXGA 4DRZA 9LDTA 1HL3A 2OD9A 5JXHA 3CRW1 5ANRB 1GV1A 2OFWA 4INZA 3ILVA 1KEKA 1EDEA 2JJ1A 3LCMA 1T91A 4X93A 5DM0A 5EXDA 2ZYVX 1Z4KA 3EE6A 4IS2A 2P75A 1GPJA 1XZ8A 3DHNA 3SS8A 4U00A 1KJ9A 2AMFA 4YAGA 1VIVA 5KYWB 2R4UA 3JXEA 4P3XA 1P5ZB 1P6XA 2DHRA 5CNIA 1QGDA 1RHMA 2CBGA 1U0GA 3H65A 4ZAVA 4YV7A 3SM3A 2P9YA 1E6EA 3GEDA 2IHJA 1Y5RA 3EVFA 4CCAA 2OXEA 4D80A 1GVNB 4OHZA 2WMDA 4II3A 1NURA 2EWMA 5EJMA 4MCJA 3R7WB 5E4FA 1ETUA 1N5OX 1CRZA 1UM8A 4Q03A 5FL3A 3E5NA 3Q0IA 4KQ9A 4J1TC 1NIPA 4PLWA 5IFKA 3GDWA 3PNVA 5JSUA 2B5WA 2NZ8A 3KOZA 1PFQA 4UAVA 2X1MA 4AJ1A 3T61A 4YR7A 1Y7HA 2H18A 2H4JA 3DAHA 4HLUC 4LRWA 4X64B 4A9AA 2FPIA 2QRHA 4K6GA 3AVUA 2OCDA 1TUEA 3LT1A 1FJXA 2H0QA 1X6VA 4EHNA 3R7DA 2FPOA 2O19A 2IU6A 3R74A 8AT1A 3GEEA 1O0BA 1UDCA 4CIDA 4PM4A 5JSQA 3LMKA 3PL1A 4OAPA 1E4EB 3RRYA 1NLZA 3MSXA 3PIIA 2EZTA 3N0RA 1CK4A 3GK3A 5LD2C 2JI8A 3I05A 3PLAE 2PBLA 3M5PA 1NP3A 2P9ZA 2PL1A 3IUEA 5EMMA 1PGNA 4RADA 3S81A 2RHGB 5FLEX 3U62A 3FNFA 4RM2A 3SJAA 2P9JA 3ZK9A 3CKMA 1VLHA 1XPOA 4EA8A 1SMKA 2FWAA 2GNOA 2QQ5A 2RGNA 3TX2A 3PXEA 2XY4A 4MEJA 3QYPA 2YJGA 3W78A 3PWKA 4CM1A 3FRJA 1DXOA 5C5IA 4HVTA 3GDOA 2AQHA 1B6TA 1MRNA 4UVIA 1U7OA 4WX2B 1BMFA 4N0QA 3JVVA 1VMEA 1X7WB 2GCOA 4CIAA 4WESB 4IDBA 4CM5A 4BVAA 1CB0A 1WD5A 4DKJA 1I6MA 1TKCA 4BLSA 2EHJA 3AJEA 3A26A 1HYQA 2OA0A 3LT5A 4RPIA 3O0TA 3V9AA 5GIPE 2GBCA 1UBFA 2ZWIA 3F5SA 3IBCA 5K0LA 2Z5VA 5KKAA 1Y4ZA 3BGIA 5ICSA 2W42A 1O95C 1PWYE 1WPRA 2FKNA 4U3JA 4FHFA 4XWTA 2WWHA 3C3YA 2QRVB 5LDHA 1AKTA 1CP2A 4CF7A 1TYBE 1DAEA 3N2KB 3WBFA 2FB9A 4LOLA 4TSFD 1PWEA 5DJ5A 1W5EA 4TWRA 5FR2A 4B6OA 1FTWA 2BGNA 1FVHA 4LF9B 3O9MA 4G4SO 2XKBA 4NECA 5HE8A 3RK4A 2FRDC 3TTVA 4YNBA 4C20A 1IE3A 2O5VA 2AOTA 2OV2A 3R5JA 1I4DD 1FSFA 5FUYA 5LU8A 3M8KA 2I3AA 1O95D 1M5UA 2JZCA 3DZFA 5IJAA 4RKQA 3RW9A 2QN9A 1RHRA 1Y3BE 1H23A 3PUYA 4Q47A 3BEDA 1ZJ5A 5KJEA 5HTOA 3VPFA 2PZAA 4FD2A 2DR2A 2WUGA 3ZNPA 1L3IA 1CRLA 1W34A 3FDXA 3K0SA 4ZCTA 4OKIA 2G9RA 1UOPA 2EDAA 2G71A 1KA9H 5JCOC 3GCWA 4MIOA 4E4YA 5CJ2A 2WSLA 2OVBA 4XXHA 3F6RA 3EA5A 5H0IA 4WCVA 3JQ7A 1QANA 2QZJA 1K63A 1ZVMA 4LFAB 2H92A 3KAKA 3TZKA 4RDIA 3TEFA 1H6BA 2RGAA 3WKBA 3K3PA 5HR5A 4RVNA 3U2QA 3OX3A 4B80A 4OB6A 3RJ9A 3OPQA 4DA6A 4XLTA 4R3WA 2JCYA 2MINA 5CVCA 4CQLA 1IAVA 5JSZB 3P19A 4ARCA 4YRIA 4WQMA 4NMLA 2PL5A 4DQXA 3HPRA 2V7PA 3OLYA 1TMKA 4Q6WA 3RREA 3ZQUA 5HGXA 1SOWA 4TLMB 2RSLA 2VTVA 1JEYB 3ZDCA 3L8YA 2IELA 2XGSA 4TS4A 5HKAA 3I62A 2QVYX 3D6FA 1PN3A 3UMJA 3GUZA 3H3FA 1KVRA 1WXXA 3OE5A 4GOLD 2ZRAA 3CVJA 4M1EA 1QYVA 4Q4JA 1F8FA 2IIVA 3UWPA 1USUA 4OU5A 5FOXA 4KPEC 1CW2B 1IK6A 3BGVA 4FWBA 1QOZA 3L5OA 2APJA 3WLTA 5LOVA 2C4KA 3P2MA 2Y76A 4FSDA 1PLJA 4HAXA 3IDAA 1C4XA 2FEPA 3ON5A 2JFWA 4KPGA 3IKMB 4V3BA 2YWFA 3OT5A 2CLHB 2CWDA 3QHPA 4J4TA 4MIYA 4HVLA 2DR0A 5AW1A 4UOQA 1UAGA 4NZMA 1G17A 1NA5A 1ZI9A 2JKYA 2VJDA 4G0OA 4Q12A 4UUQA 4WGGA 4CLEA 4EEZA 5AUNB 4W5OA 4XVHA 4MI3A 4HNUA 4CCWA 1XHLA 5CDGA 3FB4A 3RHZA 1YOVB 1JI0A 2GTHA 1YOBA 4MUMA 1CUUA 4MOWA 2O1WA 4GPAA 3SLKA 4CKBB 1GQQA 4COKA 1B3RA 4NS4A 2ACEA 2GZSA 2Y4NA 3KYCB 1W47A 3W9BA 3LOPA 1AF4A 5HXAA 1LC3A 2PCJA 3GVCA 1QS0A 3Q3IA 5A6VA 4RL4A 1P2BA 2W2PA 3PD1A 1H2YA 4GXTA 4INJA 1U2DA 3ECCA 1JSCA 1LBIA 1YTLA 3FRIA 4Q02A 4QDKA 4PSAA 5TIIA 2FDCA 2WTMA 2NTEA 2W2OA 3QVSA 3OUZA 1F9AA 4PO3X 1WW2A 4NYIQ 1DP4A 1KI9A 1VCIA 4LHXA 3JARB 3O3CA 4J7AA 4MAFA 1TTQB 5D3QA 4K0RA 3G2JA 5FOUA 5LKAA 2FP4A 2CMKA 3Q7TA 4NESA 5CH5A 1W46A 1ZA1A 1R0LA 3DDHA 3OE4A 5JYBA 2V7QA 4B6JA 4P7FA 2GYYA 2XUGA 4KMSA 1AXRA 1ZIOA 2XITA 2ZBQA 4UM8B 4R5MA 3ZIDA 5FFFA 3SS7X 1CEYA 4BL5A 1SBCA 3O75A 4BRZA 1TF5A 4I4NA 4XX1A 5BURA 1DAKA 1V2HE 4U2BA 1DBVO 2JJ2A 3L9WA 4FFPA 3UMCA 3V4LA 4B6PA 4V39A 4YBRA 3WSTA 5AW3A 5IG2A 4LF5B 5EUQB 4ICIA 5DYYA 4RLHA 1OFVA 5C81A 1KAGA 4G97A 1GL6A 1E2JA 4XJSA 1BFKA 2IS2A 2H1HA 1E3QA 3FWPA 1XXLA 4IVRA 3AVTA 1XK6A 4GNKA 3WXBA 2GI4A 3NDJA 3NEPX 2WRZA 4Q6BA 4YUYA 1WB5A 1G4AE 4OH1A 2ZVDA 2NACA 5CX4A 3B2EA 1S3GA 1BWPA 3FLAA 4YRTA 3SZOA 2WIAA 2QRMA 3AUSA 4DBLE 4JI4B 1B7GO 1QZUA 1HG0A 1AKRA 2A9FA 2OR3A 2PGIA 3FI0A 1RAAA 1Q20A 3G59A 2XUKA 5E7QA 4BHTA 3OJLA 3PQ2A 1U7ZA 5ED4A 4LRQA 4HEQA 4MW2A 3PXAA 2WI8A 3B1YA 1U6JA 3M1IA 4C88A 1H8EA 5EE5B 3ZHRA 3C7CB 5ELLA 4FXPA 4W9MC 4L8WB 3LZCA 5AVYA 1KI7A 5DHSA 2XIQA 5AW7A 1MCZA 4J0HA 5EKUA 4G89A 1EVEA 4XVUA 4FGLA 5AHXA 4F8JA 1PKEA 3JQPA 4CIVA 4LUCA 2A9RA 2OZVA 2PKYX 4P4UA 3V42A 1TM7E 4MKZA 2B2NA 3EWNA 4QXRA 2NU9A 3NV7A 1JF8A 3RRNA 4Y7DA 3NPAA 2YFQA 3C3WA 5LQUA 4X62B 2OZLB 4WEOA 1VB5A 1JHVA 2PAFA 2EJWA 2RK6A 3GR6A 2A5LA 4FX5A 3W2FA 1L3CA 4E1AA 3PE3A 4GO1A 1VKRA 5EXPA 3ONEA 1PZHA 3DMGA 5KS2A 4DBVO 1U5CA 3WDSA 4M1TA 3D2BA 2AZDA 1NG1A 3GCDA 1YRWA 4HTAA 3RNLA 3ZV3A 2I78A 3WG9A 2AVNA 3O7MA 5C1DA 3UW1A 3FGOA 3M2PA 1YBAA 3RYFB 4BC0A 1ZGAA 1BX3A 1VBKA 3T9EA 3FCCA 1L4HA 4FS8A 3DLCA 2AE1A 2ZRCA 4OUDB 3SIPA 1H1LA 4MI1A 2HV8A 2XCUA 3FNGA 4M54A 4M0LA 3SDZA 1SU4A 3LYHA 3SXJA 1NGSA 4BNHA 4L8GA 1C9JA 1U1CA 4B6QA 2WE7A 3HVIA 3HKBA 5ETJA 4JLJA 1CUZA 4BRUA 1P77A 2FZLA 2QPTA 3R0ZA 5A7FA 4DLUA 2VAPA 1E79A 1LUAA 3LZ6A 5B4TA 2ZI3A 4Z9BA 3EF0A 2MMCA 2ZCJA 4J07A 4CQNA 1N2CE 1VL8A 3A4VA 2XUDA 2ZBEA 4V0OA 3ELYA 4KIFA 5CK4A 3ZEAA 4D3FA 3WRYC 4YPVA 1HEUA 1EQAA 2YHBA 3R4VA 3U39A 4PYJA 2HSEA 4WZBE 4J0QA 4RVOA 2V96A 4ZO6A 4ZYZA 3LBNA 5KHAA 1BS2A 2Y0PA 4DUGA 1UAYA 1J8QA 5CDTA 2IU3A 1AB6A 2OUKA 2PLRA 2VP5A 1SM4A 3R7SA 4Y2GA 4EJSA 3AR3A 4B9AA 4OXRA 4UTNA 5DBIA 4DUZB 3HXMA 1UFVA 2V58A 5TPWA 1OIVA 2GK6A 3VDNB 2IF2A 4EG8A 1I9GA 2BCEA 2YUIA 4KRGA 1OPRA 3SSAA 3HXQA 2BKLA 4FT4A 1A7KA 1PFYA 2BRUA 3H18A 5D2CA 5AW6A 2H2IA 5E7MA 1E0AA 2FX3A 4PZUA 4LNHA 3DMPA 3K9FC 1A50B 1TTTA 3ZEIA 2Y0DA 4N48A 4AECA 1XAIA 1IB0A 1IY8A 4ZYVA 2OSVA 1FMCA 4XIIA 4ZZ0A 2MHCA 4LGYA 2PTGA 4GOXA 2IODA 3IH5A 1XYYA 1YGPA 4WT7A 4HZGA 3FGPA 3GMSA 3QY0A 5DTQA 3WRWA 5IUNC 1K5DA 4CKCA 3GYBA 1J0CA 3NGLA 4UBKA 2VAXA 3BWYA 3VR6H 1SVOA 2XTJA 2CVOA 3PGLA 5FOVA 1CT9A 4X61A 2IIQA 1YL7A 2J7PA 3O4HA 2DT5A 3FN4A 4L4ZA 1E8MA 1V6AA 4OJMX 5ITVA 3ZZUA 4NFHA 4D9BA 1P9OA 3KHUA 1ZAYA 4QNMA 3VDQA 3RRZA 2VRCD 2IWHA 3LXUX 1EUZA 4PSUA 3AVPA 1WBDA 2IH2A 4EGFA 4V3CA 4JLSA 3CA8A 1P0QA 1EK2A 2R97A 3DMRA 3G5MA 2PMWB 2IPOA 3JRXA 4IOJA 4URWR 2QUJA 1A9YA 3QFTA 3L8MA 1IWOA 1X87A 4MUNA 4TMKA 4YAJA 1RPZA 2H0AA 3HU2A 4LYYA 4Y6PA 2BZ1A 3CB4A 3FYSA 1T3GA 4YACA 4CHGA 2V03A 2A58A 4OQZA 1FYXA 4L4YA 5JJBA