1N41A

Crystal structure of annexin v k27e mutant
Total Genus 126
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
126
sequence length
318
structure length
318
Chain Sequence
ALRGTVTDFSGFDGRADAEVLRKAMEGLGTDEDSILNLLTARSNAQRQQIAEEFKTLFGRDLVNDMKSELTGKFEKLIVALMKPSRLYDAYELKHALKGAGTDEKVLTEIIASRTPEELRAIKQAYEEEYGSNLEDDVVGDTSGYYQRMLVVLLQANRDPDTAIDDAQVELDAQALFQAGELKWGTDEEKFITILGTRSVSHLRRVFDKYMTISGFQIEETIDRETSGNLENLLLAVVKSIRSIPAYLAETLYYAMKGAGTDDHTLIRVIVSRSEIDLFNIRKEFRKNFATSLYSMIKGDTSGDYKKALLLLCGGEDD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords annexin V
publication title Interfacial basic cluster in annexin V couples phospholipid binding and trimer formation on membrane surfaces
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Lipid binding protein
total genus 126
structure length 318
sequence length 318
ec nomenclature
pdb deposition date 2002-10-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00191 Annexin Annexin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.220.10 Mainly Alpha Orthogonal Bundle Annexin V; domain 1 Annexin 1n41A02
1.10.220.10 Mainly Alpha Orthogonal Bundle Annexin V; domain 1 Annexin 1n41A04
1.10.220.10 Mainly Alpha Orthogonal Bundle Annexin V; domain 1 Annexin 1n41A01
1.10.220.10 Mainly Alpha Orthogonal Bundle Annexin V; domain 1 Annexin 1n41A03
1ANXA 1BC3A 1N42A 2IE6A 2ZHJA 4EVFA 1W3WA 2Q4CA 1W7BA 1AVHA 1XJLA 1A8BA 1G5NA 1W45A 1YIIA 2HYVA 2HYUA 1AVRA 2ZOCA 4HREA 1BCYA 1I4AA 4X9PA 2H0MA 2II2A 2H0KA 1BCZA 1MCXA 4EVHA 1HAKA 1HVGA 1AVCA 1ANWA 2XO3A 1BO9A 1N44A 1YJ0A 1HVFA 1YCNA 1AIIA 2IE7A 4MDVA 1DM5A 2H0LA 1SAVA 1HVEA 1N00A 1N41A 2ZHIA 1ALAA 1AXNA 2RANA 4MDUA 1ANNA 1BCWA 1A8AA 1BC0A 2XO2A 1HM6A 2HYWA 1AEIA 1M9IA 1HVDA 1DK5A 1AOWA 3BRXA 2IICA 1BC1A
chains in the Genus database with same CATH superfamily
1R8SE 2IE6A 2ZHJA 4EVFA 1W3WA 4L5MA 1G5NA 4Q2SA 2R0DA 2ZOCA 4JMOA 1I4AA 4X9PA 2HSNA 2II2A 2H0KA 1BCZA 3ABRA 3AO0A 4JXHA 1N44A 1BO9A 1YJ0A 4A4PA 4JWLA 1SAVA 1R4AE 1Q8DA 3AJCA 1BC0A 1RE0B 3USYA 1KU1A 1AEIA 1HVDA 1QC7A 1BC3A 1S9DE 3ABSA 1A8BA 4FHRB 1AVRA 3SOHB 1MCXA 4EVHA 1HVGA 2XO3A 1YCNA 1AIIA 2IE7A 2K6XA 1DM5A 1HVEA 1N00A 4OIYA 1ALAA 4MDUA 2RANA 1BCWA 1BC9A 4C0AA 1XT0B 1PBVA 2OY9A 2HYWA 3SWVA 2R09A 1BC1A 1ANXA 4KN7X 1W7BA 1W45A 4HREA 2HYUA 4D7RA 1R8ME 1HAKA 1R8QE 4D7QA 1HVFA 2H0LA 3ABQA 2ZHIA 4KN4X 1AXNA 2XO2A 3L8NA 4C7PA 1UPTB 3ABOA 1DK5A 3LTLA 3BRXA 4KMUX 1XJLA 1N42A 4FQ0C 2Q4CA 1YGMA 1AVHA 2QEZA 3USWA 1YIIA 2HYVA 3HJLA 1BCYA 2H0MA 1AVCA 3TW5A 1ANWA 4MDVA 4JMIA 4Z21A 1N41A 1ANNA 1A8AA 2VXGA 1XSZA 1HM6A 4JK1X 1LKVX 1M9IA 1C1KA 1AOWA 3ANYA 2IICA
chains in the Genus database with same CATH topology
1ANXA 1BC3A 1N42A 2IE6A 2ZHJA 4EVFA 1W3WA 2Q4CA 1W7BA 1AVHA 1XJLA 1A8BA 1G5NA 1W45A 1YIIA 2HYVA 2HYUA 1AVRA 2ZOCA 4HREA 1BCYA 1I4AA 4X9PA 2H0MA 2II2A 2H0KA 1BCZA 1MCXA 4EVHA 1HAKA 1HVGA 1AVCA 1ANWA 2XO3A 1BO9A 1N44A 1YJ0A 1HVFA 1YCNA 1AIIA 2IE7A 4MDVA 1DM5A 2H0LA 1SAVA 1HVEA 1N00A 1N41A 2ZHIA 1ALAA 1AXNA 2RANA 4MDUA 1ANNA 1BCWA 1A8AA 1BC0A 2XO2A 1HM6A 2HYWA 1AEIA 1M9IA 1HVDA 1DK5A 1AOWA 3BRXA 2IICA 1BC1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ANX A;  1BC3 A;  1N42 A;  2IE6 A;  2ZHJ A;  4EVF A;  1W3W A;  2Q4C A;  1W7B A;  1AVH A;  1XJL A;  1A8B A;  1G5N A;  1W45 A;  1YII A;  2HYV A;  2HYU A;  1AVR A;  2ZOC A;  4HRE A;  1BCY A;  1I4A A;  4X9P A;  2H0M A;  2II2 A;  2H0K A;  1BCZ A;  1MCX A;  4EVH A;  1HAK A;  1HVG A;  1AVC A;  1ANW A;  2XO3 A;  1BO9 A;  1N44 A;  1YJ0 A;  1HVF A;  1YCN A;  1AII A;  2IE7 A;  4MDV A;  1DM5 A;  2H0L A;  1SAV A;  1HVE A;  1N00 A;  1N41 A;  2ZHI A;  1ALA A;  1AXN A;  2RAN A;  4MDU A;  1ANN A;  1BCW A;  1A8A A;  1BC0 A;  2XO2 A;  1HM6 A;  2HYW A;  1AEI A;  1M9I A;  1HVD A;  1DK5 A;  1AOW A;  3BRX A;  2IIC A;  1BC1 A; 
#chains in the Genus database with same CATH topology
 1R8S E;  2IE6 A;  2ZHJ A;  4EVF A;  1W3W A;  4L5M A;  1G5N A;  4Q2S A;  2R0D A;  2ZOC A;  4JMO A;  1I4A A;  4X9P A;  2HSN A;  2II2 A;  2H0K A;  1BCZ A;  3ABR A;  3AO0 A;  4JXH A;  1N44 A;  1BO9 A;  1YJ0 A;  4A4P A;  4JWL A;  1SAV A;  1R4A E;  1Q8D A;  3AJC A;  1BC0 A;  1RE0 B;  3USY A;  1KU1 A;  1AEI A;  1HVD A;  1QC7 A;  1BC3 A;  1S9D E;  3ABS A;  1A8B A;  4FHR B;  1AVR A;  3SOH B;  1MCX A;  4EVH A;  1HVG A;  2XO3 A;  1YCN A;  1AII A;  2IE7 A;  2K6X A;  1DM5 A;  1HVE A;  1N00 A;  4OIY A;  1ALA A;  4MDU A;  2RAN A;  1BCW A;  1BC9 A;  4C0A A;  1XT0 B;  1PBV A;  2OY9 A;  2HYW A;  3SWV A;  2R09 A;  1BC1 A;  1ANX A;  4KN7 X;  1W7B A;  1W45 A;  4HRE A;  2HYU A;  4D7R A;  1R8M E;  1HAK A;  1R8Q E;  4D7Q A;  1HVF A;  2H0L A;  3ABQ A;  2ZHI A;  4KN4 X;  1AXN A;  2XO2 A;  3L8N A;  4C7P A;  1UPT B;  3ABO A;  1DK5 A;  3LTL A;  3BRX A;  4KMU X;  1XJL A;  1N42 A;  4FQ0 C;  2Q4C A;  1YGM A;  1AVH A;  2QEZ A;  3USW A;  1YII A;  2HYV A;  3HJL A;  1BCY A;  2H0M A;  1AVC A;  3TW5 A;  1ANW A;  4MDV A;  4JMI A;  4Z21 A;  1N41 A;  1ANN A;  1A8A A;  2VXG A;  1XSZ A;  1HM6 A;  4JK1 X;  1LKV X;  1M9I A;  1C1K A;  1AOW A;  3ANY A;  2IIC A; 
#chains in the Genus database with same CATH homology
 1ANX A;  1BC3 A;  1N42 A;  2IE6 A;  2ZHJ A;  4EVF A;  1W3W A;  2Q4C A;  1W7B A;  1AVH A;  1XJL A;  1A8B A;  1G5N A;  1W45 A;  1YII A;  2HYV A;  2HYU A;  1AVR A;  2ZOC A;  4HRE A;  1BCY A;  1I4A A;  4X9P A;  2H0M A;  2II2 A;  2H0K A;  1BCZ A;  1MCX A;  4EVH A;  1HAK A;  1HVG A;  1AVC A;  1ANW A;  2XO3 A;  1BO9 A;  1N44 A;  1YJ0 A;  1HVF A;  1YCN A;  1AII A;  2IE7 A;  4MDV A;  1DM5 A;  2H0L A;  1SAV A;  1HVE A;  1N00 A;  1N41 A;  2ZHI A;  1ALA A;  1AXN A;  2RAN A;  4MDU A;  1ANN A;  1BCW A;  1A8A A;  1BC0 A;  2XO2 A;  1HM6 A;  2HYW A;  1AEI A;  1M9I A;  1HVD A;  1DK5 A;  1AOW A;  3BRX A;  2IIC A;  1BC1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...