1N44A

Crystal structure of annexin v r23e mutant
Total Genus 115
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
115
sequence length
318
structure length
318
Chain Sequence
ALRGTVTDFSGFDGRADAEVLEKAMKGLGTDEDSILNLLTARSNAQRQQIAEEFKTLFGRDLVNDMKSELTGKFEKLIVALMKPSRLYDAYELKHALKGAGTDEKVLTEIIASRTPEELRAIKQAYEEEYGSNLEDDVVGDTSGYYQRMLVVLLQANRDPDTAIDDAQVELDAQALFQAGELKWGTDEEKFITILGTRSVSHLRRVFDKYMTISGFQIEETIDRETSGNLENLLLAVVKSIRSIPAYLAETLYYAMKGAGTDDHTLIRVIVSRSEIDLFNIRKEFRKNFATSLYSMIKGDTSGDYKKALLLLCGGEDD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Annexin V
publication title Interfacial basic cluster in anexin V couples phospholipid binding and trimer formation on membrane surfaces
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Lipid binding protein
total genus 115
structure length 318
sequence length 318
ec nomenclature
pdb deposition date 2002-10-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00191 Annexin Annexin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.220.10 Mainly Alpha Orthogonal Bundle Annexin V; domain 1 Annexin 1n44A02
1.10.220.10 Mainly Alpha Orthogonal Bundle Annexin V; domain 1 Annexin 1n44A04
1.10.220.10 Mainly Alpha Orthogonal Bundle Annexin V; domain 1 Annexin 1n44A01
1.10.220.10 Mainly Alpha Orthogonal Bundle Annexin V; domain 1 Annexin 1n44A03
1YJ0A 2H0LA 1A8AA 2Q4CA 1HAKA 2HYUA 2IE7A 1W45A 1W3WA 1AEIA 2IICA 2XO3A 1AXNA 4MDUA 1AOWA 4X9PA 1YCNA 1HVGA 1ANWA 1BCWA 1ANXA 2XO2A 2H0KA 1AIIA 1BO9A 1MCXA 2ZHJA 1HVFA 1AVRA 2ZOCA 4EVHA 1BC1A 1W7BA 2H0MA 1ANNA 1A8BA 1XJLA 1BCZA 1I4AA 1N00A 2RANA 2IE6A 1SAVA 2ZHIA 1DM5A 1N41A 1ALAA 4MDVA 1BC3A 1BCYA 1AVHA 1BC0A 1HVEA 1HVDA 1G5NA 2II2A 3BRXA 1HM6A 1M9IA 2HYVA 2HYWA 1AVCA 4EVFA 1N42A 1YIIA 4HREA 1N44A 1DK5A
chains in the Genus database with same CATH superfamily
1R4AE 4OIYA 3USYA 1R8QE 1QC7A 4X9PA 1YCNA 1BCWA 1ANXA 2H0KA 2R0DA 2ZOCA 4EVHA 1BC1A 1W7BA 1A8BA 1XJLA 1S9DE 1ALAA 1BC3A 1BCYA 4FQ0C 4JWLA 1AVHA 2II2A 1YGMA 4KN7X 4JXHA 1C1KA 1YIIA 2VXGA 3ABOA 1YJ0A 2H0LA 4D7QA 3SWVA 3ANYA 4D7RA 1ANWA 3USWA 1AIIA 3ABSA 4C7PA 2ZHJA 1BO9A 1ANNA 3L8NA 1I4AA 2RANA 1XT0B 2IE6A 1Q8DA 2ZHIA 1DM5A 4Q2SA 4C0AA 1R8ME 1M9IA 4JMOA 1RE0B 3AO0A 1XSZA 2OY9A 2Q4CA 1A8AA 2IE7A 2XO3A 1AEIA 2HSNA 2IICA 4Z21A 1AXNA 4JK1X 4MDUA 1AOWA 3AJCA 1HVGA 2XO2A 4A4PA 2R09A 1MCXA 1HVFA 2H0MA 1N00A 2K6XA 1SAVA 1HVEA 1BC9A 1HM6A 1PBVA 2HYVA 4FHRB 1AVCA 4KMUX 4HREA 4MDVA 1N44A 4L5MA 1DK5A 1KU1A 1HAKA 2HYUA 1W45A 1R8SE 1W3WA 2QEZA 1UPTB 1AVRA 4JMIA 1BCZA 3HJLA 1LKVX 1N41A 3LTLA 1BC0A 1HVDA 1G5NA 3BRXA 4EVFA 3SOHB 2HYWA 1N42A 3ABRA 3ABQA 3TW5A 4KN4X
chains in the Genus database with same CATH topology
1YJ0A 2H0LA 1A8AA 2Q4CA 1HAKA 2HYUA 2IE7A 1W45A 1W3WA 1AEIA 2IICA 2XO3A 1AXNA 4MDUA 1AOWA 4X9PA 1YCNA 1HVGA 1ANWA 1BCWA 1ANXA 2XO2A 2H0KA 1AIIA 1BO9A 1MCXA 2ZHJA 1HVFA 1AVRA 2ZOCA 4EVHA 1BC1A 1W7BA 2H0MA 1ANNA 1A8BA 1XJLA 1BCZA 1I4AA 1N00A 2RANA 2IE6A 1SAVA 2ZHIA 1DM5A 1N41A 1ALAA 4MDVA 1BC3A 1BCYA 1AVHA 1BC0A 1HVEA 1HVDA 1G5NA 2II2A 3BRXA 1HM6A 1M9IA 2HYVA 2HYWA 1AVCA 4EVFA 1N42A 1YIIA 4HREA 1N44A 1DK5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1YJ0 A;  2H0L A;  1A8A A;  2Q4C A;  1HAK A;  2HYU A;  2IE7 A;  1W45 A;  1W3W A;  1AEI A;  2IIC A;  2XO3 A;  1AXN A;  4MDU A;  1AOW A;  4X9P A;  1YCN A;  1HVG A;  1ANW A;  1BCW A;  1ANX A;  2XO2 A;  2H0K A;  1AII A;  1BO9 A;  1MCX A;  2ZHJ A;  1HVF A;  1AVR A;  2ZOC A;  4EVH A;  1BC1 A;  1W7B A;  2H0M A;  1ANN A;  1A8B A;  1XJL A;  1BCZ A;  1I4A A;  1N00 A;  2RAN A;  2IE6 A;  1SAV A;  2ZHI A;  1DM5 A;  1N41 A;  1ALA A;  4MDV A;  1BC3 A;  1BCY A;  1AVH A;  1BC0 A;  1HVE A;  1HVD A;  1G5N A;  2II2 A;  3BRX A;  1HM6 A;  1M9I A;  2HYV A;  2HYW A;  1AVC A;  4EVF A;  1N42 A;  1YII A;  4HRE A;  1N44 A;  1DK5 A; 
#chains in the Genus database with same CATH topology
 1R4A E;  4OIY A;  3USY A;  1R8Q E;  1QC7 A;  4X9P A;  1YCN A;  1BCW A;  1ANX A;  2H0K A;  2R0D A;  2ZOC A;  4EVH A;  1BC1 A;  1W7B A;  1A8B A;  1XJL A;  1S9D E;  1ALA A;  1BC3 A;  1BCY A;  4FQ0 C;  4JWL A;  1AVH A;  2II2 A;  1YGM A;  4KN7 X;  4JXH A;  1C1K A;  1YII A;  2VXG A;  3ABO A;  1YJ0 A;  2H0L A;  4D7Q A;  3SWV A;  3ANY A;  4D7R A;  1ANW A;  3USW A;  1AII A;  3ABS A;  4C7P A;  2ZHJ A;  1BO9 A;  1ANN A;  3L8N A;  1I4A A;  2RAN A;  1XT0 B;  2IE6 A;  1Q8D A;  2ZHI A;  1DM5 A;  4Q2S A;  4C0A A;  1R8M E;  1M9I A;  4JMO A;  1RE0 B;  3AO0 A;  1XSZ A;  2OY9 A;  2Q4C A;  1A8A A;  2IE7 A;  2XO3 A;  1AEI A;  2HSN A;  2IIC A;  4Z21 A;  1AXN A;  4JK1 X;  4MDU A;  1AOW A;  3AJC A;  1HVG A;  2XO2 A;  4A4P A;  2R09 A;  1MCX A;  1HVF A;  2H0M A;  1N00 A;  2K6X A;  1SAV A;  1HVE A;  1BC9 A;  1HM6 A;  1PBV A;  2HYV A;  4FHR B;  1AVC A;  4KMU X;  4HRE A;  4MDV A;  1N44 A;  4L5M A;  1DK5 A;  1KU1 A;  1HAK A;  2HYU A;  1W45 A;  1R8S E;  1W3W A;  2QEZ A;  1UPT B;  1AVR A;  4JMI A;  1BCZ A;  3HJL A;  1LKV X;  1N41 A;  3LTL A;  1BC0 A;  1HVD A;  1G5N A;  3BRX A;  4EVF A;  3SOH B;  2HYW A;  1N42 A;  3ABR A;  3ABQ A;  3TW5 A;  4KN4 X; 
#chains in the Genus database with same CATH homology
 1YJ0 A;  2H0L A;  1A8A A;  2Q4C A;  1HAK A;  2HYU A;  2IE7 A;  1W45 A;  1W3W A;  1AEI A;  2IIC A;  2XO3 A;  1AXN A;  4MDU A;  1AOW A;  4X9P A;  1YCN A;  1HVG A;  1ANW A;  1BCW A;  1ANX A;  2XO2 A;  2H0K A;  1AII A;  1BO9 A;  1MCX A;  2ZHJ A;  1HVF A;  1AVR A;  2ZOC A;  4EVH A;  1BC1 A;  1W7B A;  2H0M A;  1ANN A;  1A8B A;  1XJL A;  1BCZ A;  1I4A A;  1N00 A;  2RAN A;  2IE6 A;  1SAV A;  2ZHI A;  1DM5 A;  1N41 A;  1ALA A;  4MDV A;  1BC3 A;  1BCY A;  1AVH A;  1BC0 A;  1HVE A;  1HVD A;  1G5N A;  2II2 A;  3BRX A;  1HM6 A;  1M9I A;  2HYV A;  2HYW A;  1AVC A;  4EVF A;  1N42 A;  1YII A;  4HRE A;  1N44 A;  1DK5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...