1N4DA

The ligand-free structure of e coli btuf, the periplasmic binding protein for vitamin b12
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
244
structure length
244
Chain Sequence
APRVITLSPANTELAFAAGITPVGVSSYSDYPPQAQKIEQVSTWQGMNLERIVALKPDLVIAWRGGNAERQVDQLASLGIKVMWVDATSIEQIANALRQLAPWSPQPDKAEQAAQSLLDQYAQLKAQYADKPKKRVFLQFGINPPFTSGKESIQNQVLEVCGGENIFKDSRVPWPQVSREQVLARSPQAIVITGGPDQIPKIKQYWGEQLKIPVIPLTSDWFERASPRIILAAQQLCNALSQVD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Vitamin B12 transport protein btuF
publication title Crystal Structures of the BtuF Periplasmic-binding Protein for Vitamin B12 Suggest a Functionally Important Reduction in Protein Mobility upon Ligand Binding
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transport protein
total genus 67
structure length 244
sequence length 244
chains with identical sequence B
ec nomenclature
pdb deposition date 2002-10-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01497 Peripla_BP_2 Periplasmic binding protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1980 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Nitrogenase molybdenum iron protein domain 1n4dA01
3.40.50.1980 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Nitrogenase molybdenum iron protein domain 1n4dA02
5CX1B 3AERB 5GGXA 2Q8PA 2YNMC 2XDQB 4HMPA 1K75A 3MWFA 4DBLE 4GICA 4BBPA 1KAEA 4MLZA 5KOJB 2ETVA 5KOJA 2XQVA 1G21B 4M7OA 2PHZA 4UTPA 3LI2A 2YNMD 1G21A 2XH8A 5HX7A 1N2CB 4PM4A 4TKVA 5JJ5A 5I4KA 3ZTTA 4N01A 2PS9A 4H0FA 1N2CA 4LJSA 4MDYA 4NNOA 4INOA 3NU1A 4OVKA 5M34A 4MX8A 4WZAB 3AEKB 2WI8A 1KAHA 3MFQA 1QGUB 1K2VN 4H59A 3AEKA 4WZAA 1QGUA 2AFHB 2Q8QA 4FNAA 5KHLB 4WZBB 4WESA 2AFHA 4INPA 2MINB 4ND8A 4WZBA 4IRMA 3ZK9A 2MINA 1XVLA 1PQ4A 5JPDA 2WHYA 4G09A 3CX3A 5GGYA 3MD9A 5B58T 1N4DA 1TOAA 1MIOB 1M34B 2O1EA 1M1NB 4HMQA 5KOHA 1MIOA 1M34A 3U7QA 1N2ZA 4TKVB 1M1NA 2R7AA 4WNAB 4XPIB 2OGWA 5JOQA 4K3VA 2RG7A 3PDIB 4WNAA 4XPIA 3AEQB 3AESB 3PDIA 4NNPA 3AEQA 1QH8B 3HJTA 4TKUB 4B8YA 1KARA 3AESA 3AEUB 1K0FA 1QH8A 4TKUA 1H1LB 4FILA 4LS3A 4OXQA 3AEUA 1G20B 3G9QA 4WESB 1H1LA 4OXRA 4UDNA 1G20A 4ND8B 3MWGA 2OV1A 1QH1B 3PSAA 3ZK8A 3TEFA 4UTOA 1QH1A 2XV1A 2XY4A 5CR9A 5KOHB 3U7QB 2PS3A 3ZK7A 5FLYA 3EIXA 3MINB 4CL2A 3HH8A 3MINA 4MO9A 1L5HA 1EFDN 3GI1A 2AFIB 5CX1A 2X4LA 3AERA 2AFIA 3PSHA 2R79A 4UDOA 2XDQA 2M6LA 5BVGB 1FP4B 5JG7A 5M29A 1N4AA 1PSZA 3TLKA 5BVGA 1FP4A 5BVHB 3R5SA 4WN9A 2OSVA 2PRSA 4G07A 1K7SN 5BVHA 4HMOA 2OV3A 3UJPA 1ESZA 5M3BA 3R5TA 2M6KA 3BE6A 5M2QA 3TNYA 4PAGA 3K1AB 5HDQA 3AETB 3EIWA 3HXPA 3LHSA 2XUZA 1M1YB 3K1AA 3AETA 4HN9A 2QI9F 4WN9B 5AFSA 4FI3F 1M1YA 2PS0A 1L5HB 3BE5A 4FKMA 3ZKAA
chains in the Genus database with same CATH superfamily
3BA1A 3V4FA 2KW5A 4RANA 1TEXA 1AGPA 3BGWA 1UKZA 4JBHA 4UBLA 1UJ2A 4OG2A 1GILA 2NG1A 2WU1A 5CH3A 2P91A 1G2IA 1BQEA 4HF7A 2VP6A 3OF3A 1Q6ZA 1YMQA 3T4XA 1GTJ1 5CFPA 2IBTA 4MIOA 3WZ2A 4BLOA 5ADVA 1NZFA 3AUJB 1X7DA 4PHTA 4Q66C 4TGLA 1RR6A 5HILA 4D98A 3IR5A 3CUTA 5J2UB 1COWD 1MPXA 4BO4A 2CBXA 1D2AA 5BW6B 2AYXA 2FFJA 1NQWA 2NSLA 1SVIA 4TVOA 5H1YA 1GU7A 2WMYA 4WXRA 5C5CA 3FCXA 1DE0A 1Y7IA 2WABA 3BULA 3AHFA 2GHQA 4DGSA 2JKVA 4IFTA 3O84A 2A4MA 3S8YA 2D1RA 2W2PA 3LQRA 1BXRB 1POWA 1EFRA 2PR2A 1SCQA 2YASA 3ESXA 4PGAA 4PCLA 2FRDA 5GMOA 5TQVA 4Q9LA 1V2HE 4RMNA 3RFUA 4ZK2A 1KO5A 4C4SA 1L6RA 2RCNA 4OHWA 2RI0A 3EG9B 3KQUA 3WDMA 3HKBA 2IXBA 3FJ1A 5DKFA 2LGJA 5EXSA 4OHMA 4TSKA 3RC2A 4KXUA 4OQDA 4KRGA 3A6GA 1NJGA 1SCNE 4QGBA 3TPZA 1Y0BA 2CXPA 4OUDB 2ZI9A 2QVZX 2XMSA 1ZEMA 2V3VA 1DWOA 1M73E 1PV2A 4BFUA 1U5AA 4YR7A 2AZXA 3SC2A 4N39A 4B85A 3NCTA 4KUHA 3JRWA 1UFKA 2G7MC 2A4KA 2OV8A 3MS2A 3NTLA 2IHBA 4FZ3A 2NV6A 1SXJE 2IT1A 3OPYA 5E6SA 5IVKA 2FW8A 3KT8A 2F3TA 3N2GA 3W8FA 4C06A 1NXXA 1RS0A 5IMSA 4AM8A 2IVFA 2O2ZA 3QW4B 4UDNA 2ZWIA 4DCTA 4HZUB 3NC4A 4JD5A 1EX9A 3ZK8A 4WEQA 4Z0HO 4XX1A 3A4YA 1DKQA 1N0VC 3L7MA 3DFIA 9MHTA 2DFPA 2NM0A 3S99A 1T8RA 1R8JA 1DAIA 4P3KA 4CNQA 2AJBA 3MWDA 2IC5A 3CVJA 3HKCA 3LLUA 1TJYA 2XZDA 2H17A 4E5SA 1NJ1A 2G28A 3UHJA 5LU8A 2BHSA 4H4EA 3MRXA 3FTEA 2FRVA 1DJQA 5A7GA 4CCWA 1T6BY 1SK9A 1IU9A 1HI9A 4JI3B 1YB5A 5I9LA 2XKJE 3ND6A 3L77A 1T36A 3S27A 4TRJA 4PFSA 5BVGB 1XZJA 2J48A 3JQAD 1W9HA 4HKTA 5BW4A 1H2AS 1QOZA 1VRCA 4MV1A 1JR6A 2XT6A 3QVUA 4F4DA 1GZHB 3VZDA 3TOZA 2YYYA 3EJWA 3W06A 3F6RA 5JWOA 4J76A 4B3CA 4RDHA 3NC0C 3R6TA 2REQB 4JY7A 4KXVA 2VYND 3OTWA 1JDPA 2D8MA 4NWIA 1OILA 3VHQA 2IIVA 5FNVF 2BH2A 2FMHA 1SD2A 5BQ5A 1A3CA 4JXJA 4O3MA 2R44A 1BZYA 1ODFA 3CRNA 3CSSA 4JOCA 2BHRA 5AICA 1JX6A 2XUDA 5IAGA 2ZE7A 1HNXB 5DULA 1PGJA 5TQ0A 5JZOA 3E5RA 3FWKA 2XUJA 3UMGA 2G88A 2XIJA 2SKCA 3HSYA 4QHTA 3OCCA 2HMSA 3EOAI 4MEJA 1QIJA 2BN4A 5DPMA 3G68A 1E94E 4FFNA 4F2GA 2HWUA 5FAKA 1CULC 1Q0RA 3VXKA 2LUOA 2RD2A 1G20E 1KZ4A 3UAXA 3EQ6A 5KPDA 4WFKA 3OIVA 4UHEA 2Q4OA 4MR8A 1BS9A 5JISA 3TZQA 1NVTA 3ZOZA 3UO8B 3RS0A 5CEFA 2FPWA 2WI8A 1QGUB 1L7NA 4U2EA 4ANFA 5EUBA 2OBXA 2V45A 4FNAA 3F6CA 2FFAA 1WF6A 1UBLS 3KQMA 4XYGA 1T6ZA 1YI0A 2M2IA 1RE1A 3TGWA 3QF4A 1ORWA 3QJGA 4DXAA 1KMNA 4X62B 3JWHA 1XTQA 3ONFA 4JLBA 4P3YA 4Y6PA 1L7DA 4INZA 4PG4A 4JQYA 1NMXA 1OFUX 1QGDA 3CX3A 1HE4A 2PZGA 1Q0SA 5HKOA 1M74A 3KYCA 2O1EA 2QLNA 3GJ4A 4M0KA 5AKKA 2JLRA 1FFYA 2AMJA 3JAKA 1J25A 1YC2A 4I9HA 4CR8A 9ABPA 3DL7A 2A5FA 4MPRA 2C8JA 1OB5A 4ZO7A 2A58A 4AC9A 4J6FA 3ESAA 1REQB 1USUA 2QEQA 5JNUA 4WLUA 1RWPA 1RM5A 3DE2X 3MRVA 4CR7A 4YCBA 5DYTA 1E3WB 1J97A 4RL6A 1X9GA 4MI1A 1V1RB 3V3TA 4TSFD 1ZGJA 1O0CA 1CR1A 3KB2A 1VLQA 2B3DA 3DDZX 4FOPA 4BBJA 2ADFA 3QUBA 3BTUA 4LCEA 3U1TA 3GFOA 5LYJF 3Q1KA 4BQOA 3KZMA 1F2TA 3DFFA 4JR2A 4CWAA 2J0VA 2I6XA 1MJ5A 3L7BA 3AVPA 2I6UA 5IDXA 1E32A 2GN2A 2OFPA 2PX3A 4G1FA 4YMLA 2E5FA 3SHQA 2ZIFA 2RHJA 4HDCA 4JP1A 3OE1A 4QU9A 4YCSA 5D01A 5KPJA 3GJ7A 3SKYA 3QVTA 2TMYA 1CWUA 4KBFA 4MEBA 1SEPA 4WFQA 3ADBA 1QRAA 3STHA 2FETA 1RXWA 3WAJA 2X5OA 3OTGA 3BQMB 2LE0A 3C3CA 2LKCA 3GRCA 5HK8A 3SM3A 4BJ6A 2EYUA 5FHQA 4BC1A 1AZWA 3RUCA 4F0JA 3F3YA 3X1JA 4D8XA 1DUSA 3KS9A 3ZX4A 1E5TA 3L8EA 1BCSA 2PL3A 1Z2OX 4P3XA 5BN4A 5KQMA 4G07A 3WMEA 1YFKA 1LZLA 1CUGA 3SICE 1IY1A 3CLTC 4QFBA 3WHIA 1DKOA 5DHAA 1BH2A 5DV9A 1TVEA 3K0AB 2G83A 2GGSA 4BGUA 2PYDA 3AY0A 4A6EA 3D4IA 1STOA 3HXPA 4Y2XA 4EJSC 2PAFA 3E5HA 4ZALA 1OGIA 5IJ0B 4FR2A 4UAUA 2FRDC 4PYKA 1HLDA 1L5HB 3MT9A 2IPAB 3RJ5A 1W52X 5JAUA 3RVKA 4LDZA 2FWNA 1F48A 2I4OA 1URPA 4FKZA 1OWNA 1U7OA 1I3CA 1P1HA 3H11A 3TKLA 1D7AA 4KKVA 5KX5B 4Z9YA 2O1WA 3LQ2A 4QXRA 3X1DA 2F1HA 3LUBA 2BFBA 4MYHA 5CLLA 1QHHB 2AJLI 3ETNA 1JQ3A 3S28A 2GCNA 1S3GA 4EGJA 1H6AA 1SCJA 3KQQA 4KLNA 3U4GA 1CPYA 3AY7A 2ETVA 1YASA 3PKIA 4EO9A 4BAZA 4YUWA 5CDTA 4F3TA 3ER9A 3B5JA 2X2FA 2CLSA 2R7NA 4N8EA 4IX1A 1FNNA 3LDAA 5TS3A 3PHLA 4O4IA 3OQPA 2ZYTX 4CQMB 2DUNA 5IEJA 3ZIUA 5C8XA 5JRDS 3M6XA 1MV8A 1OASA 1KRXA 2NTVA 4BNWA 4X24A 2B37A 1E2BA 4MLDA 2C5EA 2XODA 3BS4A 2FPIB 4MVJI 4NC9A 5EP3A 3RSQA 3SX2A 2IS6A 1QUFA 1KEEB 3S0JA 2G25A 3EW9A 2F3RA 2P41A 4KSBA 1AXRA 3IYLW 2C9BA 1MV5A 1W1WA 4KFUA 4M22A 2ET6A 5DSXA 1UQUA 3RUAA 3FVVA 3T3GA 3GMIA 2O54A 3NVKI 4GOJA 4K3UA 1EUZA 4MVYA 3ZBUA 2VAXA 4N9QA 1II8B 3R6GA 3JQ9A 3TRFA 4CIXA 1M2OB 1HC7A 4UHJA 4BTVA 4YRRA 5AKHA 4EWLA 121PA 3WMWA 1JJAA 1JU4A 2QRKA 3UJHA 1Z8NA 1N78A 1ZL0A 1L4FA 2QRMA 3L04A 2YXPX 3L18A 2JKYA 3OU7A 2OCYC 4JUDX 3CXRA 4MVJP 4RD2A 3V1TC 3HEAA 3LOUA 1W5FA 2VH1A 3JVIA 4JX9A 1EM6A 3U40A 2VNSA 3UV3A 4OJNA 1FSGA 1YULA 2DT5A 2CKMA 2ISQA 3HLTA 1BS1A 3ACCA 3PHCA 4NDNE 4O29A 3QUSA 4M9ZA 3C48A 3ENKA 4JLDA 2OPBA 3ROFA 4XASA 2E0IA 5ALLA 1SUBA 4ENTA 4EYSA 2XDWA 1DIAA 3PPXA 2FQQA 1EG7A 3VKVA 2C2WA 3NOQA 4C76A 1D1QA 1D2EA 2NZVG 4EABA 1Q7GA 4IJWA 4XB6B 1RLOA 3UAGA 4ZU3A 2DFDA 3QE4A 1TU4A 5FRDA 1T9GR 2E1PA 1IFXA 2Y9PB 4RKWA 1JEOA 3DL2A 4EF5A 5KSZA 2UXCB 1SCDA 2QJTA 2XECA 4K0RA 3JWGA 5FT9A 3L8ZA 1DAMA 4HRYA 4FDUA 4TWRA 4HX9A 3AJ8A 1BA2A 3AOGA 1ISSA 3PT5A 4ZIRB 4LVUA 1XZDA 4IMRA 5CBKA 4WGGA 1JNYA 2QDXA 5IKEA 2HUNA 2WUDA 3ICCA 3DBLB 3R7LA 2QIOA 2XKKA 3MEQA 4S1PA 1P2SA 3HWX1 3BGSA 2ODNA 1Y48E 3EB9A 1D6NA 4KO1S 2JVJA 2JL1A 2R1ZA 5A4KA 2G80A 1F3OA 2G82A 4UUNA 3HA7A 4AXBA 5H4GA 1KMQA 1XQYA 3AM4A 2O3QA 4MJLA 2XWJI 1AT1A 1Z4OA 3EVAA 1XVTA 2E37A 2ECKA 3K8QA 2FN7A 3QVKA 4AY2A 4EATA 1UZLA 1ESDA 1GYRA 1I2ZA 1U8CB 1KYVA 3UWDA 2VNIA 3EGXA 2G9VA 3CE6A 4BXOB 3FI9A 1T4GA 1SJ9A 2P3OA 2WR8A 1ZU5A 2ZSDA 4UU0A 2P4EA 2VK4A 3LLMA 2J1LA 4R2XA 4YAEA 2I1WA 1GNPA 3O8NA 4EAAA 1KERA 2IYRA 2HPHA 1XCLA 4JLAA 4RBNA 5HQ3A 4Z99A 1Q95A 1I9CA 1H1DA 1WNTA 1YZUA 2R1TB 4NBVA 5KNBD 1R5JA 2OUIA 4KBYA 4OYYA 1Q0ZA 5F1OA 3WL4A 4ZYLA 4DLUA 1XZMA 3TUIC 2ZCJA 2AGVA 3IVAA 4PTZA 5CVEA 3OQIB 5FUVA 1XHEA 4CIWA 5DIFA 3OQBA 4F7DA 3QU5A 4C5CA 1ZWLA 4TVSA 2O2HA 2PL5A 3KQSA 2D2FA 4MYTA 4OKIA 4NXMB 3QVSA 2COEA 5L3QB 1QIHA 1A82A 4OHBA 5B3JC 3LWZA 2YIDA 1RZVA 3W1VA 3LDGA 3NRCA 1Y34E 1VKZA 1X7GA 3E5MA 3RIYA 1MC5A 4IILA 2FPMA 3D2BA 4RM2A 4K9MA 2PMCA 3ORFA 2Z8XA 4DZTA 3R7WA 1RYMA 1O08A 3A9CA 1ZHOA 3I0MA 3ENWA 1QB7A 1QGED 2IHNA 2CL7X 2ZT8A 2GRUA 2RHGB 2WW8A 3JD4A 2BGKA 2PD4A 3RG8A 3WKEA 4RELA 4IHKA 1CQXA 2HJHA 3OOYA 4WEOA 2E5LB 4N0PA 2PFSA 5AXBA 1ML4A 1G7SA 3HACA 5SYNA 3LA6A 3ABRB 1OLUA 3CLKA 1C41A 3ZZ0A 3S55A 2I7TA 1RYFA 3AOEC 4KOEC 3WLSA 2VH2A 2BBTA 4DLVA 1ZKDA 2XQGA 3MLBA 4HOYA 1I80A 5KTTA 2JGIA 5G1NA 4G5QA 1Z0SA 3BWXA 4CM8A 1ACMA 1ENPA 1UR5A 1RT9A 2YYAA 4K6OA 4UUMA 4GP7A 3VJLA 1A7KA 3MMZA 3PD7A 3LUJA 1ZSVA 2CJPA 4LS3A 1QYRA 1TU3A 1NF3A 3RWMB 3WZMA 3ZCPA 3NP7A 2ZIAA 3T61A 2WV7A 2YVKA 1CETA 4JP2A 3C3EA 2Q6KA 3CZMA 4YACA 4JB0A 4ZJZA 1VBNA 4UUAA 2HK6A 4LPSA 2YV1A 3QU2A 1O96A 3H5WA 3CPHA 3TZCA 4K28A 3Q8LA 1T2NA 1Z5GA 2JAXA 1IPFA 5BW8A 5K0BA 3L4BC 2QN6A 4LTMA 3SQXA 2HTEA 5KOHB 2XBLA 3UZUA 2VDRB 3G5LA 2NACA 4EFMA 1CKEA 3BXOA 3DXFA 2Y0EA 2YJTD 1QV9A 3UA3A 1XHLA 3S7ZA 5KVCA 3LUFA 1GV0A 4EY3A 5A4AA 3GCDA 1AZSC 4RSRA 1UKBA 4QD3A 3EDCA 2Q3EA 2P9FA 2QLMA 2VYVD 4XJVA 3L0OA 3EAGA 1RTTA 5C53B 4QBGB 2WYIA 4YJ2F 3ZVRA 1CJCA 1ZJ6A 2VJKA 2WTAA 2X4LA 3F6YA 3IHKA 3OLQA 1V7QA 2OMKA 2Z0MA 3D8SA 4NK5A 3ABOB 4NQRA 1NX9A 3R41A 3HKEB 4IIFA 4TS1A 4WN3A 1KI6B 5ITSA 3LZDA 2ZIGA 3RS2A 4L8WB 2XUFA 2P2CA 1RMYA 2VZEA 1BEUB 2JVKA 4HH3C 2JRCA 5EIOA 1RI3A 3TVYA 3KCQA 4MKGA 4OBWA 1QRUA 1RMTA 1AOXA 5GONB 4O63O 4B46A 4DAEA 4Y30A 5KTPA 4K8OA 2IZ7A 3TNYA 4E15A 1BDJA 2Q3BA 4GX0A 3EXG2 3AUSA 2GXUA 2I87A 1GUYA 1C8LA 2QJOA 2VAVA 1W8IA 2VEOA 2WYWA 3D4PA 2UUCB 1UDRA 1NXQA 5ITVA 2AJDA 4AS3A 1R27A 2GSDA 4LJ5A 2P27A 3ABQB 3FMOB 4GSYA 3ZY5A 1J70A 1LPPA 1U0NA 1YQTA 4V0KA 2HWKA 2ZUWA 1JE0A 4O59O 4DJTA 1YI8A 5E4FA 5AJVB 2CV1A 5F23A 2QZSA 5FFMA 4U2DA 1P5ZB 3F9CA 2PKQP 4KN9S 1R4NB 1IBMB 3ZUPA 1KU0A 3VNRA 2I9KA 1P91A 3WNCA 2D3TA 1N3LA 1YCGA 2YVQA 4HVAA 4NCKA 4LYGA 3H9JA 1HY3A 2PUVA 1FFXB 4A2QA 4CI0B 5JFTA 2Y1XA 3TIVA 3T7SA 1CQJB 1ZP6A 2JDID 3HGTA 5TGZA 3LI2A 4A82A 3ZCSA 3PCTA 1KXJA 1G3RA 3BMCB 5CVDA 1HETA 2R7MA 3H5LA 3HUDA 3L6EA 3NIFB 4OQZA 4D9NA 1AA9A 2TMDA 3NBKA 3V80A 3ZU5A 1D2NA 3MJVA 1OYOA 1YVDA 2QN8A 3L40A 4FT2A 2AZTA 4WXEA 3M1IA 4CXMA 3EXIB 2EJCA 3O3CA 3ZWBA 4EI9A 3ZY6A 3KYJB 5HIJA 1BMQA 1NNSA 2FFQA 1RKVA 2AKAB 4DSNA 4LWPA 4UZEA 1JG6A 2R1VB 1CDDA 1I6KA 2AF3C 4J2TA 4D6PA 2C94A 3O8QA 4EVQA 3VTZA 4L4SA 1MB3A 2PA0A 4Y1RB 2X1LA 3PEEA 3S81A 1CS4C 4KR6A 2CNDA 2ORVA 2CJWA 4NH0A 7REQB 1FIUA 1ZITA 2Q2VA 4QC2A 2W70A 3VR6D 5BUCA 3AP2A 4KMRA 1JBEA 3PUKA 3KR9A 3AFOA 4RXTA 3SYNA 1R5OA 3A3YA 5DM2A 5K3BA 4ZN6A 3IRUA 5HJ7A 2FF7A 1NW6A 2D7CA 1BEZA 2GD2A 3IBTA 2BBWA 4EHJA 6LDHA 5J1SB 4MHSA 2QHXA 4CMGA 1CY8A 2XDYA 3I04A 2ENUA 3CX4A 2VHUA 4HS4A 1YE5A 1B16A 3KDAA 4FFBB 4MB6A 3B1WA 6REQA 3BDVA 2VC2B 1YOVA 1AGXA 5JFGA 3L0CA 3C8MA 5A4IS 3FPHA 2X1HA 2FUKA 2GD1O 2EJUA 2YRWA 3BTSA 4H7KA 4PCAA 5FBKA 5SICE 1M1YE 4R98A 3QEJA 1MLDA 3QYPA 1JFTA 1E1RD 1VIVA 1FNSA 1ZZGA 2D0PB 3CRQA 2PJRA 3TI7A 3O95A 5KQSA 3K96A 4EI8A 4ZI3A 2HYIC 4BEJA 1VBFA 4MV7A 5DYYA 4Y98A 5BNZA 5CURA 1SR8A 5EIWA 2ZYWX 1WXHA 1IOWA 1TKCA 1DHTA 1I4LD 4X00A 4ZP1A 4H7PA 2H63A 2QD3A 1IK4A 3FFWA 5IWCA 2WFLA 1ZQ1A 3SX4A 4YX9A 4ARUA 4P98A 4HBGA 3GCZA 4CMEC 2PWZA 4BKPA 2QR5A 2XCSB 1UBJS 2FUNB 1UWVA 5EJ2A 3WWOA 2P9HA 3V4SA 1FOEB 4C4OA 3NTUA 1X6VA 4GWKA 4HP8A 1YRYE 5ER9A 2OCGA 4B6SA 5FA8A 2BFEA 3A9WA 5F7OA 3HI6A 1P1FA 3G8BA 3OJXA 3R9XA 3RBXA 1F20A 1P7VA 4N7RA 1Y6QA 1Y6GA 1Z8FA 1ZGCA 3EFHA 4YJ3A 3SMQA 1QXSA 5CB4A 2AFHE 2FJUA 1E6KA 1ZK0A 3T7DA 4G0PA 4QM6A 2GPNA 1R6AA 3DW1X 3T1VA 2O8VA 1L1RA 1AUVA 3LP5A 3OIDA 4M49A 3HLYA 3FLBA 2GCEA 1KKLA 4UZSA 2IFTA 5ADWA 1ZAYA 4HN4B 3MCZA 1DRKA 3WWCA 4AUNA 1EXNA 4AY3A 4JA0A 4J4BA 5EMJA 1EBUA 2WJHA 5ALGA 4UFPA 5JCXA 1M8KA 1IZYA 1XRPA 4QUHA 5DRTA 4EGFA 2O5EA 3V00A 1V11A 1ULHA 5IJ9B 4EDHA 1JAZA 1QGOA 3CX6A 4CG3A 2RHBA 3CF0A 4M7OA 4NJOA 5D3MA 3ZU4A 2OECA 1EZ4A 2XA9A 4O4LB 5IT4A 3RARA 4BWGA 4PZZA 4MUAA 5HX7A 3U1BA 3G7NA 4HXYA 2CNNA 5KNLA 4LZWA 2G67A 4ENVA 1GGNA 2W4QA 5F1KA 2AN1A 3RKSA 2UUAB 2JLSA 1OLXA 3WV4A 5KVVA 5AIAA 3ELDA 3AVOA 1ZGGA 3IP5A 5KYWB 1EDBA 3AB8A 1ZOLA 2P5TB 4XCQA 1E2UA 3I9OA 3OVMA 4YQEA 1JWLA 1AKRA 4Y2QA 2O2GA 3GEIA 4QFCA 2BTQA 4B2LA 2Z5VA 4PVDA 3EQZA 2PGOA 3IE2A 1AQUA 4URYR 2VHXA 3BRWA 3NHUA 3C3AA 4MV3A 3RYTC 3W1WA 1ICEA 2EF0A 1WVIA 3ZJVA 1A5ZA 2BOVA 1BRTA 3PC4A 5TS2A 3EBOA 4I46A 4B0PA 5LQNA 3FG9A 4BLTA 5I7RA 5TPZD 4U5XA 3PDIA 4NU5A 1NI3A 2O7RA 1GCOA 1GHTA 3AUTA 4U7WA 2NVUB 4PSKA 1KP2A 2D5BA 1KK2A 4XUEA 2DLDA 2AG0A 3H9GA 3DMFA 2ZBDA 4BRZA 5LUAA 2Y1KA 5T3UA 4E7PA 4ND8B 1GRNA 3G9TA 4IIBA 2XCOA 4JUFA 3M3DA 2G0NA 1NG9A 3EOBI 2W2LD 3KKKA 3K15A 5LQKA 3N59A 4ZXFA 1NGSA 5IXYA 1PT7A 3IV6A 3CBGA 2IVZA 4BWFB 1J49A 2XNDA 5AD1A 4BAUA 2HI0A 1OFVA 3JTMA 5IKPA 4N0EA 5P8WA 1PJ4A 3K0FB 4Q7KA 3MQ4A 4RF2A 3UQYS 3H99A 1KIFA 1Z4MA 3AR2A 3UQZA 4D0RA 4YR9A 4AZVA 2CL6X 3NHAA 3I1IA 1X80A 1LSOA 1P9NA 1X1QA 3GT0A 3QPBA 3L8FA 4FNMA 2O9JA 5AHXA 3AGQA 5ALWA 3X43A 4D0GA 3NKVA 5UKDA 1L5QA 4ED9A 3VH2A 4Q16A 4D4LA 4F3KA 2VCHA 2IHYA 3CWZA 1ACJA 4E5MA 2BY4A 1T43A 4ZOCA 3VUFA 2C4WA 2W7TA 1CUZA 3O82A 2JAQA 4G89A 4ZKDA 1QHFA 3DM9B 2X9QA 2QLJA 1YNOA 5BMOA 3JVEA 5AW6A 1IXZA 1E79A 4LVOA 3U3KA 4F1JA 2O8FA 4PPGA 2HX1A 2HSZA 3WKCA 5JRJA 1IZZA 2WKRA 4BNUA 5I7EA 4X3PA 3VYWA 2D7DA 2OVBA 1PR3A 3BXGA 4P22A 4RY9A 2HYDA 1LB1B 2QI9C 4L4YA 4R40A 3T3IA 4DMHA 4F85A 2D2EA 5AVWA 4AF6A 1UK6A 1OIXA 4KFSA 2GERA 3DE6X 5HNKA 4MMXB 5EJEA 3BJRA 4C0QC 3PA8A 5JRZA 4XD7D 5JFOA 5GVSA 3W5BA 1I3NA 2DWQA 3QVGB 3CM0A 3H3FA 4R1LA 5AJYA 4J9UE 1DSSG 3R75A 3VFDA 1JJVA 1E7RA 3OMWA 3P9RA 3AONB 1XLUA 1FB5A 5B6PA 2XYHA 2QAJA 1W1IA 1J9ZA 1SPXA 5E2BA 5KTNA 3HR7A 3V8VA 1VIMA 3T38A 1K6XA 1TIPA 2AXQA 1Q2XA 3AEXA 3D4BA 4FFDA 4TTIA 4DYDA 3K6SB 4DUYB 4DREA 1EEHA 2C29D 2BISA 4FMDB 4EELA 4ARBA 1ZJYA 3KP1A 2GBGA 5F3DA 1NVVR 3S29A 2OZLA 1IM2A 1H85A 2WIDA 3PXDA 3UEOA 5FOWA 4AN0A 3AL0C 1AU9A 3BD7A 2J87A 2D3WA 2E82A 3P9KA 2AR0A 5D6OA 2GKOA 4YAUA 1N5LA 3PFBA 4GI2A 3T3EA 1Y1RA 1GGEA 2V98A 3HDYA 4LA4A 5CA1B 5ERXA 1APBA 3AY3A 3HDQA 3CPEA 2P62A 4Q48A 5FFNA 4AQ7A 1LX7A 1I36A 1P18A 1W5EA 1C7ZA 3PK0A 3EXFA 4X44A 5AUPB 3CNLA 3W5AA 1BDIA 1U1EA 3FHCB 5CA0B 3D02A 3G6WA 1VXRA 2RONA 4QPJC 2RDMA 1SCKA 5HFAA 3RR2A 3L92A 4D3SA 2QOEA 3ZR4B 4FHGA 1K4MA 3LQ1A 4FINA 1VM6A 1IM8A 4WNIA 3MD9A 4B6RA 2WWYA 3DR5A 1UF9A 3FSGD 4PNHA 3RASA 1OT5A 1H05A 4US0R 1SELA 4K2AA 5FJJA 1EYZA 1MJGM 3OKCA 3WGOA 4A8PA 2WYVA 4D7AA 4KR3A 2FZKA 1YV9A 2ZTMA 3JASB 5TMBA 3L1VA 4TYQA 4CGZA 2B2NA 2EZ8A 2HMVA 1U8FO 3AEQA 1YS7A 3IULA 5EE3A 3FOWA 2ZGVA 4XUCA 4RCZA 2WUVA 3L6DA 1Y3CE 2VXYA 3GL9A 4BX8A 3M49A 4M98A 4R2KA 5NLLA 4G4GA 5LQMA 3TM5A 1Z0DA 4Y2UA 3K32A 3A7DA 3BAFA 4HDAA 1BHSA 3NHPA 3HB4X 4Q5IA 4ZO4A 4F7WA 2ZQZA 1V25A 3QWAA 1I32A 2B8JA 4PG7A 3RVPA 1W36B 2H57A 4FDVA 1FTQA 5E1MA 1DLIA 5LQCA 3W04A 5LOVA 3PD1A 2JJ2D 2O23A 4I9UA 4R2MA 2CB0A 3W8EA 4F1WA 2ODEA 3TBHA 4H1TA 4N5IX 4YDQA 4RCYA 1ZI9A 1PN3A 4K40A 4NOKA 5B58C 1U3UA 2FN8A 2JFWA 4I50F 5AW3A 4P0QB 1FMFA 1G8FA 5DXJA 5JCJD 4DR7B 1AUOA 3TXAA 1RAAA 4C29A 3VR5A 5ADUS 3W5VA 1IG3A 2GFHA 2H2FA 2VJMB 3L9XA 1K63A 3NTXA 4NULA 4G65A 1GOTA 2APJA 2NTYC 4ZMRA 3R6WA 1RLIA 2IY8A 3II6X 4L75A 1FQJA 2O3RA 1N0HA 1H3FA 2NV0A 3VVBA 4B9AA 1Z33A 2ZROA 4DB2A 1N77A 1PK9A 1JHOA 3WMFA 2I2BA 4MR9A 4OLAA 3GEBA 4LQ4A 1UK8A 2NYAA 3OF5A 4BEBA 4GGMX 4PY2A 2IP1A 1V95A 2VNHA 3E18A 5KCMA 3VSCA 2FQYA 3TLJA 3A25A 3PUZA 4QXQA 1R6TA 3E7PA 3SHFA 1JYSA 2WF9A 3C4JA 2WIGA 3O73A 1V35A 2WA2A 3CZPA 1SC9A 2QU7A 4FGSA 1NDHA 3H4MA 3UMSA 3K0CC 2FR1A 5JH7F 1E2LA 3PQ5A 2GEVA 2HAEA 1J1UA 1ULAA 4B6QA 1ISMA 5CM2Z 4ZGGA 4R3WA 1J33A 3WY9A 4E07A 1LJLA 2RG1A 1L5SA 3CUEF 2V4UA 4R68A 3O4IA 2NZWA 3SFTA 1J2EA 5E9AA 5DVZA 2XNKA 1C30A 2VP0A 3FDFA 1XD2B 3NCHA 1DDOA 2VTEA 4PWYA 2Q3DA 5CPFA 1VL0A 4QBTA 2Y92A 2BHTA 3LYUA 4QYTA 1XYGA 3FOBA 1Y7TA 4N65A 4U4AA 9LDTA 1HYQA 2XWBF 3IOYA 2UV8A 3Q0TA 3NGMA 2HA7A 1R9JA 3P0IA 4Q9KA 3WRWA 2ZU0C 2BV3A 1AG9A 4RJTA 4UNRA 3K9BA 2HWWA 1SZDA 3TRDA 3ZLVA 1KI9A 4DV0B 4HJXA 3GCWA 4TRMA 1M2VB 3ZU3A 5BP7A 1QYIA 4YP6A 2GFQA 4QL3A 1TB4A 2FSVC 4DQXA 5EHXA 3TVTA 3LDUA 5KC9A 1Y8QB 2B92A 1IOZA 4IDFA 2EFCB 1HNWB 1DI0A 2PBZA 3ITEA 1G8YA 1RAHA 2H08A 2MSNA 3Q7PA 5BT8A 1C7QA 2PRZA 4CLHA 1XPOA 4O0MA 5FL3A 1M10A 3PE4A 1T2CA 1GR0A 1X7XB 1CDZA 1ZXXA 4BE9A 2BE7A 2O05A 1JKMA 2RG7A 3GA7A 4B7ZA 1LV8A 3ZWYA 1TE2A 5BNTA 4ARAA 2Y66A 1U28C 3Q3VA 4KLCA 4RPIA 4F3YA 4HGNA 3MAGA 1AH2A 1NVVQ 3HM9A 1M0SA 4CM9D 4U7PB 2LCFA 3AEUA 1NVWQ 4Q3BA 5K01A 2ZWVA 4LQCA 2OFFA 5B7QA 3M89A 1K7XB 2P8SA 2ZBVA 3KAPA 4E2FA 2WHPA 4COOA 4OHZA 1C9MA 1ZIPA 2XBUA 2WSSA 3C8ZA 2JAOA 1MAVA 3D1LA 3H86A 3GUUA 2FSFA 4KQHA 5EQFA 5FKJA 3VR5H 3ZWWA 3DOIA 1R4MB 3HJRA 1QV7A 2RGNA 3G8AA 3UN1A 3JY6A 4ERXA 1ZH6A 4RJ2A 5JDCA 3ID6C 3NWJA 3LL7A 5BSEA 3IGFA 1BWRA 1KC1A 2B78A 3RLFA 3WLIA 4ALNA 2RC6A 2IPLA 1L4KA 3W2EA 3ZK7A 3G89A 4RY0A 4QBHA 3SLKA 3IAAA 4I8IA 3C5HA 4DJ5X 4UOEA 5JI2E 4V24A 1V8FA 3LBHA 2ZT5A 3CH7A 3GJSA 1J8QA 3CUYA 4IIHA 1E5LA 4ES6A 3B1VA 4LJ4A 4DLWA 2P3LA 4G1EB 3NC1C 1N8KA 4RGBA 1G7RA 1TD9A 1DADA 2G9UA 4IIUA 5D5HA 5HTKA 3W3AA 1UXJA 4GPEA 1OBOA 3O91A 1SXJB 2UZIR 2Z1MA 1KFEB 2YIVX 2HO4A 1ZR2A 1V5FA 5CCDA 1AKWA 3C5EA 4WXPA 5DI3A 2WD7B 4R16A 4BMSA 1S2GA 3EUFA 5KZMB 2NMVA 1B93A 3IODA 1JA1A 1OA1A 4P3OA 4PYOA 3SI7A 1E89A 1L7XA 2K2QB 4OQNA 4Q3EA 2K7FA 2YWCA 2XGJA 2ATCA 1RHJA 3FW1A 5KYUA 1SVSA 4D4JA 4PSUA 2QRUA 2PBRA 4S1TA 1I4WA 4G56A 1PEKE 4IOMA 2RE8A 1GPBA 1NUUA 3OBIA 4H15A 4KXMA 4P4TA 1FDRA 3HCNA 5LFAA 4ZTZB 3PGKA 2RH5A 2WWXA 4YCJA 2HLHA 1P1JA 1C4KA 2HLDA 2AC7A 5C3MA 4HAUA 2JIOA 5GPBA 5C7LO 4N5MA 1FXWF 1JH8A 1L5ZA 2QGFA 3UK7A 2EIXA 1JJBA 1NUAA 4YQZA 1V2GA 2C0QA 1R1DA 2H2GA 2I3AA 2J41A 4HDQB 2OO5A 3O8CA 1X94A 4NBWA 4PYNA 4R0VA 3WJ7A 3MCWA 4B3FX 4PR3A 4C3VA 2MDTA 4C4ZA 1HX7A 4CDGA 2F00A 3GZNB 4YLEA 1XTUA 1UC8A 3HSSA 4FW9A 5TDHA 3JYPA 5D00A 4L4RA 1N1GA 1W49A 5F5XA 4OHUA 3U56A 3IO5A 4X7PA 5M34A 4NFYA 1NMQA 2H4YA 2R4QA 4J43A 1WZIA 4J16C 1BX0A 2VNJA 2Z6VA 1UAYA 1MOPA 3H75A 5JWHA 3G2LA 3EGVA 1GY8A 4A8JA 3MHPA 3IBCA 2O3SA 3G23A 4FGUA 4TZ6A 3H0KA 2B1RA 3NFYA 4JBLA 3SQDA 4HLCA 1YDEA 4QJBA 2EWVA 1CRZA 3V7NA 2EX0A 3X44A 5AUNB 3PFGA 3QEKA 4HMQA 4EQZA 3D5QA 2GK3A 3AL3A 2OKGA 2HHHB 3MTQA 2A2ZA 1ESEA 5JXGA 1F8YA 3PQCA 1QHEA 1D6MA 2AKYA 2JJ1D 1VQ1A 3VOBA 1DC3A 2A0XA 4NBUA 4P7BA 4HNUA 3DMHA 2YYSA 4OYHA 3L43A 3RYFA 1G20B 2O7QA 2VBFA 1G1AA 2X0IA 5J1TB 2G4LA 5DP2A 4QG3A 4N49A 3GG9A 3IDAA 3AHGA 4XWWA 3O8RA 4MS1B 3RB8A 4EG1A 1LBTA 4TL7A 3BK1A 2CZQA 3DJFA 2QTNA 3W3AH 1TT5A 2PT7A 5AK3A 1KK0A 3KYCB 3HY3A 4UVIA 1CK4A 1AHPA 4JWTA 5GY7A 2XOKD 1DFHA 1XUOA 1YRWA 3DBRA 1OFIA 3PHJA 4JBWA 3T3HA 2RI1A 4D1YA 4YRZA 3T5MA 1LPAB 1PF7E 2YMLA 3DE0X 1EMDA 3MINB 3QWIA 4M1OA 4NOMA 1EX7A 1Z39A 3JYOA 4WK6A 5BQPA 1DX6A 3PLAE 1DX4A 1DBRA 1E69A 1LI4A 2BBOA 3IE1A 2OFXA 1PJ8A 1CJVC 1XLTA 4FMCB 4WBNA 3ET4A 4HEQA 2RGRA 1UBFA 1Z82A 3DCNA 1DXYA 4HATA 3QVMA 1F2TB 4HDKA 3MK31 2WUWE 1YBAA 2Z2ZA 2BZ0A 1VXOA 2C77A 1CUCA 1CR6A 1DU4A 3CRZA 4IXDA 4BQPA 3OCXA 5EJ6A 1FP4A 5M29A 3RSGA 1LC3A 5I01A 2YHSA 1KI7A 4C3OB 4MKIA 2XADA 4PS1A 3H5AA 4CDMA 4KQCA 1BMDA 4KVAA 2CB9A 3AETB 1WF3A 1N2OA 3AXSA 4PHFA 4PWZA 5DN6D 4TVBA 3O9ZA 1NT2A 3ZDDA 4Q4HA 1FSZA 3JQFC 2HZ7A 3BRQA 3PNLA 4ML3A 1Q7CA 5BN3B 1P7ZA 2ILTA 2AQKA 4Q39A 1WV0A 2DE0X 2VSOA 4C20A 4X54A 3RF6A 4KQXA 4OUKX 2ZUCA 2YHUA 2AOTA 3U60B 3KEMA 3I1JA 1DQPA 3F7OA 2YN4A 2VVTA 4U7FA 3RSHA 3ZE2B 1BCSB 2NUTB 2WHXA 2ZJ4A 3IEPA 2JIQA 3KD2A 4WACA 1WEKA 1UODA 5HF5A 3VMMA 2QVBA 4HAYA 4Q9JA 5HBRA 3UTCA 3VUEA 1ZO8A 1W44A 3HU3A 3IUYA 1NKSA 1CY4A 2WG1A 4AJIA 1H66A 4YWHA 5DASA 1QFZA 2GKSA 3D7SA 4R31A 1LBIA 1ULZA 2IPXA 2VATA 3CZAA 4JIGA 4W8HA 3ZDQA 1OC4A 4DIBA 1L4EA 4C4XA 3OPMA 4B79A 1NAIA 3HN7A 4K9KA 3U19A 3FNHA 3H11B 1PGPA 4ZAYA 5J5AA 2FFRA 1ABBA 1PHRA 2OY0A 2ZJYA 5K3SA 3L49A 3GUVA 5JSYA 4AIIA 2BFBB 4QVKA 1RJWA 3OF2A 4NDZA 1XELA 1X7HA 2R48A 2WIAA 3ELWA 1C8BA 1TM2A 5MGBA 1U3VA 1W87A 1ACLA 3P1JA 2FF5A 4GUAA 4H3VA 4E4RA 4UNIA 5JW6A 3GCXA 5GM2A 3EQ7A 4YAGA 5FOUA 4I3HA 1QFYA 1ZSYA 3DWGA 2WFAA 1WCWA 2PH3A 1N34B 4JSRA 4BNDA 1ZY2A 2FY8A 3GF4A 1F17A 4IIYA 4II2A 5CYOA 2CXQA 4QM7A 3GLGA 1FYDA 4QFDA 5JOQA 2ZYRA 1DQZA 4XPIA 1R4AA 1MX1A 3GHHA 4FFVA 4ZJUA 1WVMA 1RWNA 3H8JA 4PLFA 4J0HA 1DG3A 1EZZA 3B53X 3PFWO 1ETUA 1LVGA 2FK8A 1SC1A 4V3BA 1NQOA 1G5HA 2OZPA 4ZRDA 4XLZA 1LCIA 3PNVA 3FIJA 4UXIA 1QZXA 4K9RA 4BVBA 2WKPA 4CKEA 5LXTB 4NYIR 3RJ9A 5EWMA 3K20A 1I6MA 3H17A 1NVUQ 3KVRA 4IJKA 2W8ZA 1QH1B 1PWXA 3EVEA 3THWB 3V2IA 3EGEA 3C24A 4ZVRA 3LGAA 1A2QA 3O8DA 1NNLA 1SUPA 3IA2A 1L9KA 3GLTA 1I10A 4RTNA 3R4VA 1IN4A 1FLVA 5A5DA 3DTVD 3M6WA 4IXWA 1CQWA 1KO7A 3OUZA 2IU3A 3MWKA 3A1EA 3CW8X 5J2TF 3ODPA 4KMOA 2JA1A 2GBLA 1V26A 3BMOA 2IE8A 2X2EA 1PZXA 3CNEA 3P20A 4LDJA 3C74A 1XKTA 3OQVA 5IT5A 1RBMA 1RI1A 2ZYSA 1PX0A 1Z4QA 2I1LA 1CVIA 5GJBA 4Z2YA 4B3BA 5IW8A 5C5IA 5FWYA 3O1HB 5JAHA 5JJBA 4WK0B 4XW2A 3HU5A 4MKRA 1R0RE 4L5YA 4UU8A 1XCMA 2OYSA 3AINA 5EZQA 5J5VA 2ZDQA 1UJBA 1VI2A 2NVOA 4II3A 3F7MA 5BVHB 5HIKA 1VSQA 3DNPA 3QOWA 2YTZA 2H31A 3GG2A 1ZQ9A 3FMIA 1LW6E 2WJPA 3EVGA 1ZM2A 3W5HA 2M6KA 1PYOA 2ZZNA 5CFLA 3FRHA 5J63A 1Z2PX 2Q1WA 5DYNA 4NE9A 4PHHA 1SKBA 1TQ4A 1XP5A 2C4MA 1WTAA 2V7UA 3K3PA 4BQFA 2R9VA 1J8YF 3KOWA 4BN5A 2VHTA 5HP4A 2NP7A 2J7PA 4NV0A 3NIDB 3Q7TA 3FKSA 2HTFA 4NCHA 3VAAA 2CCJA 3RK1A 1RYNA 2WYUA 3VC7A 4A03A 4DCMA 1U5BA 4RA9A 4X63A 1LZKA 1OXUA 1ZMTA 1E77A 4RQTA 3Q40A 5LWQA 1Q0TA 1EH5A 3MT7A 5IVPA 3K4PA 1JAYA 5FJIA 4E0BA 1E7MA 1NJ2A 2C4KA 2IEAA 4WNYA 5EERA 2H18A 4KDCA 4AJNA 1H8HD 1Q1BA 1Z6QA 4X8LA 1G60A 1G9XA 4FZRA 1CR2A 1H6BA 1PL6A 2VDMB 3UAVA 3GEEA 4Z4CA 4UTPA 2EKDA 4BNZA 4DCOA 5C1OA 4IHJA 2CLMB 2IU6A 2JHPA 2Z2XA 1ZXBA 2HT1A 4N1AA 4IJQA 2VQSA 1C4WA 1S2DA 3DE5X 4RMJA 4BHTA 2B4AA 2BIFA 5BR4A 1QWOA 2QL6A 2XTAA 3DTYA 4IO1A 2DYKA 1ILWA 4M9UA 4P82A 3SMVA 2QNIA 3PL1A 3AUUA 1P1IA 2J5QA 5DSTA 4EYOA 2FUEA 3LUCA 1MW8X 2VS1A 2JFHA 2V9PA 1OHHA 4U7HA 4AZ0A 4AULA 1N2HA 1P29A 1F4PA 1BIFA 1CU1A 1PVDA 1W2WB 3LPAA 1Q16A 3U3OA 4A0SA 5I5EA 2AEMA 3BDAA 5E95A 1BU8A 3ZK9A 2ZJ7A 3DZJA 4QHYA 1IN5A 5HE9A 4WW0A 1TVKA 4ZC8A 1AUQA 1YB4A 1A27A 1MZVA 2MYUA 1RXSA 1C7RA 3FRIA 3LPDA 5HYVA 1V41E 4QYSA 4GR5A 5DBGA 1GN9A 2BCEA 3LXRA 4KH0A 2JCXA 5C18A 1E96A 2BFCB 1P6XA 2OGWA 3SXUA 1J8MF 1FDIA 2SKDA 4NMXB 3ZHQA 5EVJA 2XNJA 2R8XA 2WA1A 4NZZA 4Y2VA 2WSMA 2F8LA 3C6MA 3R0JA 5IYZF 1KYXA 2VQFB 3I45A 3DV0B 2OV2A 4Q1CA 4FJ0A 3VU9B 2ZFUA 3N6VA 4OXRA 5LWHA 3WRVA 4HNGA 3KSBC 1SQSA 1YR3A 4TSRA 2B8WA 1O8CA 3UFXB 1DMRA 4AWBA 2AK2A 3D3NA 5GM1A 1ISHA 2O0JA 2HCFA 3UAOA 4ER6A 3CF6R 3Q0EA 1OFHA 3LPMA 1WBBA 1OLUB 3IUNA 4YV7A 4NBLA 2DKOA 3B6KA 2OHHA 3NALA 4NV1A 4K2HA 1JG7A 3KDSE 1UT5A 2Z57A 1T9GS 4M0EA 4CYMA 4O2AB 1VMEA 5JARA 5EPEA 3C5VA 1EKXA 1SXIA 3GFGA 3IELA 2ZZMA 3QBJA 2P7IA 4KZPA 4EQ6A 1OVMA 4YP1A 5JCOC 2NU9A 1U6KA 2HA6A 1DO2A 2VSXA 2VDOB 2ZRCA 1WPRA 2FPRA 2JGMA 2QL5A 1DKMA 2EX1A 2QL7A 3M9LA 3OWXA 3VVCA 1VL5A 4CVNA 1XTPA 3TX6A 3PTAA 1GPNA 4IH9A 4RPHA 1N8TA 4RAOA 4AW9A 3CYFA 4R8VA 2AEEA 5ICSA 4H3KB 3SJAA 2DXIA 3ETHA 1P2UA 2Y77A 3RHFA 4IDQA 5CK5A 3IDOA 1C0KA 2PKCA 4M53A 4Z4HA 1JMYA 4BECA 3ZDAA 1P2BA 1E1MA 3QOXA 4GD3Q 1Q17A 4PSAA 3UNXA 3S8EA 4NYIQ 1J90A 1XVUA 2WB2A 2P6PA 4YQYA 4DLPA 2FMKA 1QYXA 2BELA 2PT6A 2QNBA 5FBVB 5JAOA 2PE5A 1CJKC 3MTEA 4L8FA 2O0HA 2A5JA 3Q41A 1PD1A 2NN3C 3NBAA 4HPXB 2H11A 5FA5A 5TVGA 4OJKA 1J0EA 4B40A 1BN7A 3DH0A 4B45A 5JSFA 2CMKA 4NAHA 2W6NA 1JVSA 1K68A 3KNZA 4YRMA 1J0DA 4OQXA 4Y0NA 3AVWA 3MJFA 1FRVA 1T8YA 4UDXX 4XYMA 3WB0A 1MVLA 1R66A 4PYRA 4CF7A 3BZUA 1Y5IA 2AMVA 3P94A 3IDQA 3CNQS 3KQWA 3O3MB 1SUWA 4QUIA 3FMVA 1PW5A 3Q9LA 5F12A 1EGQA 1G42A 4CE6A 4XPZA 1N75A 2QZ9A 4HYTA 4EITA 1MMFB 2XMPA 4TZTA 4MUMA 1XZ8A 2PHZA 1EVZA 4Q3AA 1H2FA 5EMNA 1I2AA 3S68A 1U0BB 5E6UA 2EFEB 3B82A 3PPWA 3SM9A 5G1OA 3K0SA 2CNOA 4LF4B 2CL5A 2W42A 4CT5A 2WE8A 3IKVA 4MDYA 4RK7A 5AP9A 3GUZA 4DDVA 4OP2A 3AHEA 4DEYA 2QTAA 3I23A 3IVCA 3A6KA 2LR0A 2P30A 4MVJH 1KIMA 2CVOA 5IKMA 4QOGA 1Q15A 1ZD4A 3IAM6 4HB2A 2FXVA 4WRRA 2W9XA 1H8ED 4MYCA 1TTPB 3FTFA 2RGEA 2HL6A 1A71A 3DE1X 4B47A 4BNGA 1H42A 2O0MA 1AIPA 3FLMA 4OM8A 4UPDA 2RGXA 5A6SA 5LJLA 1TAUA 1QVVA 1ZM9A 2M32A 3QBEA 4PF1A 4E2WA 1NP7A 4BFZA 4CKZA 1XVAA 4EW1A 1XMSA 1EA7A 2X58A 3R40A 4D41A 4UTVA 3EH1A 4LN1A 4W5RA 5ALXA 1MNAA 2Q5EA 1L4GA 1ZCJA 4OFBA 3IQZA 2OQ2A 1EWVA 4XGRA 4C78A 1O97C 2P4QA 3BXHA 4JENA 4RTSA 4TV9F 1USWA 4BU1A 4HXFB 5BWOA 3COSA 5I7HA 1O57A 1JZTA 3HUUA 3P45A 1GA1A 3GEDA 1TZBA 2RGWA 2WMNB 1QYDA 3HBNA 3LVFO 4CG1A 1LEHA 2W6JD 5M04A 4Q18A 3GFVA 1ESCA 1GUDA 1R37A 2C4NA 4RVNA 2IELA 3O8QB 2MJLA 3ZC3A 1CB7A 3R44A 1VZ3A 3C7TA 1G2PA 4WLNA 3WIDA 1YTUA 2OXEA 1JLSA 3DLCA 4YUYA 2FG5A 3PUWA 1JLHA 1QIMA 2QUAA 5H82A 3IURA 4JLSA 2IGTA 2XB4A 3KTFA 3BXPA 1X1DA 1EJ2A 3AI3A 1YKSA 2B4RO 3QNMA 4FQ8A 4P53A 1ZM7A 5AT1A 3TTUA 1JHAA 5IHPA 3LD9A 1XP8A 4LJ6A 4E32A 5BORA 3DHWC 2A3RA 1NBWB 5JJLA 1W8DA 1Y63A 3Q3IA 1DEAA 5MN4A 1JVNA 1UC4B 3T8YA 5L3SB 2F3QA 5FYQA 4S2EA 2P9TA 1LUAA 2YY6A 1NUTA 3GLHE 1RAEA 2WFMA 4CG2A 3T7JA 4YP5A 1MJNA 4NZ9A 4BNJA 1PO7A 2OCLA 1VG9B 2XRYA 2X1VA 4C1BA 3MG9A 1XZHA 3DF9A 3AV3A 4RE5A 3IVRA 3HTXA 3JAMA 2XSZD 1WXQA 5LR6A 4LC1A 1ZESA 1RWWA 1UPCA 4G5GA 1WBDA 2JZNA 2QN3A 2IXEA 2PX5A 4DLBA 3M5PA 1L4UA 1M1YB 2X3YA 1RRCA 3VJMA 3MPOA 4JYAB 1XC7A 4GLOA 1MF7A 1PI3A 3RAPR 3SEQA 2A5DA 1P31A 4QNNA 3CLTD 5FA6A 5TEWA 4ZT5A 2D4AA 2WFLB 3PTZA 4XGQA 2J09A 3K16A 1VJDA 5ICCA 3HY4A 4ZDIA 2J59A 1J21A 4DY6A 5A5EA 3KSAC 3TM4A 2IPMA 4GM4A 4RZ2A 4KJXA 2PUGA 2K6GA 4F84A 5F2EA 2O8BA 1UBEA 2ESRA 3NT2A 1IJBA 1MR3F 4JXKA 4OU4A 1MABB 3GDGA 2CZCA 3K53A 3MM4A 4IL5A 4QSHA 4ALLA 5DN9A 4AX4A 3CONA 4HNAB 3ZLTA 2IPNA 3K5IA 2BJHA 1UBGA 3MILA 4YJ3B 1GDTA 1CS0A 1ZC4A 1W47A 2LIPA 4XQGA 5F7XA 4UCWA 3DFKA 2E55A 3OQMA 2O3TA 1QOQB 3SKVA 5IZ4A 4ZPXA 1DZIA 1XZIA 5DM70 4CM7A 1HE1C 2JARA 3EC7A 1NWHA 1CUUA 2VP4A 2Z95A 2QSYA 5T8KC 1JJFA 1GPLA 2AFHB 1T4MA 2GJ8A 3L0ZA 3OIFA 5DTMA 1WZNA 5THQA 2PUEA 1IWOA 3QVOA 4L02A 5WRFA 2PWYA 5HCUA 5JAQA 2Q4DA 2JI7A 2WHQA 2ZB8A 3CINA 1GAEO 4WLVA 1JR4A 1UK9A 1M0WA 1XDZA 2A5LA 1VLMA 3EF3A 3U31A 1E1KA 4ZCLA 3GVPA 1O6GA 4I55F 2ZSEA 4I4TA 2BE9A 1FE8A 1JEQA 1MJHA 2AMLA 2QSZA 1GO2A 2VBCA 3BREA 2YRFA 3C6KA 3DSRA 3EDYA 1EWYA 3Q3EA 4RY8A 4KAJA 1FUIA 4F6CA 3GMSA 4U8HA 4WNAA 5FHRA 2NAPA 3HJHA 5CBPA 1P62B 4HK4A 3SXPA 2ODQA 4EO4A 1IN1A 5CIWA 5BSVA 3GA5A 3HYRA 2GETA 1GNRA 1MB9A 2FFBA 4QTXA 4RNCA 5L4SA 4GXTA 1Y81A 2EYQA 4L9AA 2PX8A 3BIJA 3E84A 3MJHA 3U37A 2I76A 3RVSA 1H1TA 4C0WA 2O59A 1U8XX 1XAJA 1SHJA 2AEJA 2QT0A 3N0VA 2VP9A 3LRXA 3FFXA 3QENA 1DPGA 4HH0A 1G38A 2H3EA 3TAXA 1ZVQA 3ANXA 5I9NA 4DV2B 2Y1FA 7ADHA 5A3JA 3W78A 3DEIA 3WMXA 4YPFA 5DISB 2XZOA 5JADA 1UOOA 3KSUA 2PSEA 2PVPA 4G6ZA 2ACVA 2PWBA 1ND6A 1OSNA 1Y33E 4IR7A 3WQBA 2XE7A 4NESA 4D9MA 1ODTC 1OXBB 2NZ8A 2PDAA 1ZJZA 3F4KA 4O1HA 3W9SA 3KJZA 1MIHA 3OQ1A 4BVJA 1FNDA 4N5NA 2E9SA 1D07A 3R09A 5ED4A 2JGLA 3H5TA 2FPGA 3GN1A 1KFJB 3G2QA 1UAGA 3F0TA 1SN7A 2FZWA 4GBED 5BO5A 3JQ8A 4UDOA 3OKAA 4F8JA 1SXJC 4KDFA 4MCJA 1T4CA 4BNIA 2WAMA 1PSZA 2C42A 4LXQA 3WMGA 4V2IA 3QEMB 1SUAA 4ZO8A 1JEAA 1XYVA 3TQFA 1U1CA 1TLLA 3ADCA 4N48A 1KDPA 4AY4A 3JWEA 3WIOA 2E6KA 1V8DA 3PLRA 4EYKA 4K81B 3RTEA 2QI9F 4YRJA 4B4WA 3ZCUA 4CU5A 4DSAA 4WMLA 1O4VA 3ND9A 4Z54A 1CUSA 3EBPA 3ROQA 1DWPA 3V5NA 3H16A 1EESA 5FP0A 1FNBA 2ZSHA 4F4FA 1YSCA 2WF5A 3ICVA 4R2IA 3BEDA 1AV6A 1ABEA 1P7PA 4L5BA 3M0EA 2JGFA 1XNGA 3RFXA 4UBOA 4Q0MA 4N9WA 1TL7C 2JFXA 3LSTA 1DWUA 3BXFA 3HNRA 3N7TA 5IZCC 5JIBA 1PSWA 4D44A 2V7TA 1UPXA 1JLRA 3IHWA 5BXQC 1RIIA 5CDSA 4XE5A 3H1FA 1Y1PA 2HNAA 4HCJA 2FK7A 3ZQJA 5KREA 2WOOA 3HJNA 4MGYR 3ESRA 2H4HA 4FC6A 4MZDA 4PYMA 1Q7BA 1EFVA 2YV3A 4N5HX 1MD9A 4N01A 5DW0A 1Z5NA 4HAIA 4YP9A 5LIRA 1TYBE 3X2EA 1EUQA 1OVGA 3N2KA 3GARA 4G23A 3RS9A 1N5JA 2P1RA 1FDTA 4MUJA 1X0VA 1EVJA 2CHUA 3C85A 3L7CA 2QRLA 4P4SB 2E6UX 2WINI 3MGCA 2JLXA 1W9MA 3PZRA 4S05A 2O2SA 1EFAA 3JX9A 3K09A 1JAXA 2XGSA 3W79A 4XWOA 4FM9A 4YAKA 1AGNA 3IB3A 3RU2A 2VSYA 4NBRA 3KKLA 4TXNA 4MQUA 2P9YA 2YUTA 2ZTVA 3UXHA 1B0ZA 1LV7A 5HS4A 5K6RA 1M1NB 1M54A 1OR8A 2AX3A 2XYQA 4H7DA 4JL5A 1EQUA 2V55B 1NUPA 2YQ5A 3RUPA 4CL0A 4HJRA 1MENA 4JITA 4NU6A 2Q49A 2OQVA 1SXPA 2ZB3A 2Q1TA 1NQVA 1CEYA 5DM0A 5BV2P 1UJCA 1L5VA 4PHGA 5KYNA 3F6BX 4LX0A 3CISA 4BFWA 1KARA 2HPAA 3NRJA 5DBHX 1C7JA 1TO2E 3MGKA 3CTPA 3UJCA 3I5XA 3EXFB 4DW8A 4JNKA 2ICAA 3N1UA 2QG6A 2DBQA 4J0GA 2EJBA 2QJWA 3BFXA 1KYQA 5J4HA 3E22A 4QOHA 5K3OA 3M82A 2H1VA 1EHIA 2WTNA 1E2QA 4YT2A 5JDIA 2W2VA 4XEHA 4XIJA 5LQUA 1HSZA 3NDRA 4J29A 4K86A 1RU3A 5LBIA 1YQEA 4FOOA 3V1KA 3IMEA 2QAIA 2PJZA 1GU0A 4DMMA 1ID8A 1QDLB 1J8DA 2B7LA 1IMJA 3PHHA 5FPHA 1R8XA 1NP6A 4IQFA 2I2DA 2VP3A 2K2WA 3CZ4A 1NC1A 3NBMA 4FUTA 2PMKA 4EUSA 2Q3MA 3W5DA 3RU7A 4O4HA 1DS6A 3LGSA 1E1QA 1UMDA 1KY5A 3NH9A 2PJUA 1VJ0A 4YXWA 5REQB 4BTEA 1YZ3A 5LZ5A 2XCIA 1AF4A 4D3ZA 4EY8A 5ICEA 4IOLA 1E1CA 4EECA 5KYXB 1ZI8A 4N6GA 4URUR 4BNHA 1UDBA 2PV0A 3HABA 3BWVA 4ZARA 1KS2A 1M2FA 1S5PA 2PG3A 3KAQA 1RPZA 1GZ4A 1P61B 5BUSA 3R24A 4I0WB 3U3ZA 4JEHA 2DH6A 4ZEMA 1AO0A 3AIKA 4ZVVA 4TX1A 3STVA 3KEQA 4EG3A 2AJTA 1JS1X 3B2QA 3IEIA 2YN0A 3KEOA 4LRYA 3RROA 4S1WA 1CJBA 2CZGA 3GDWA 4FIDA 3D3WB 1IDOA 1HMPA 5FQOA 3V2HA 4B7UA 1VPEA 5AESA 3G2JA 4EPWA 1G1MA 3AJ9A 2WVHA 1B41A 3EEIA 1B1AA 1OWPA 1SVKA 1RFLA 2UYHA 4RVUA 1VLZA 5J23A 2YWJA 3HB7A 3IEVA 4G1BA 4F97A 1JSZA 1U9CA 4Q02A 4QPNA 4LGCA 1YS1X 3J7TA 4NHOA 2ZANA 2ZPTX 3UPUA 3BWDD 2HSGA 1OOEA 5COQA 2A67A 2YMQA 3E0XA 1RXCA 3FIUA 1BFUA 1JYEA 4MR9B 4EX6A 5ARDA 4ZD6A 1YOBA 2CNWA 3IXQA 1XROA 4Z1MA 1VIYA 3P2YA 4H0FA 4HQOA 4DJFC 1P0MA 3TYXA 4UDYX 2JEZA 3KSRA 3TQTA 3FDIA 4RD6A 3HC7A 2DKFA 4ZI7F 1F9AA 3WNQA 4J3NA 5D7NA 3ZNNA 3IUEA 1RP7A 5ESDA 4QLBA 5KHLB 3BGDA 4IWNA 3CVOA 4XCXA 1OMOA 2B4KA 5A62A 1WXGA 2PH1A 1GQOA 3DDUA 3KHSA 2I3BA 3KJNA 2HADA 1RJFA 2I6TA 2KBFA 2NADA 1L4YA 2Z58A 4YJGB 3KVYA 3FR7A 3THYB 2Z6QA 4RD1A 4TL8A 1C30B 1G4UR 2F7SA 4H3HB 2EARA 1CHDA 1UBKS 4EZIA 4G26A 1M34A 3UICA 1LBSA 1RWVA 1S2MA 3FOCA 3L0BA 3NHKA 4NFSA 4QDZA 3ZJYA 5JAMA 5LQJA 5F98A 1A7AA 4C9BA 1Z6ZA 3OZFA 3HRKA 3ZE0B 2K7ZA 1EFPB 1F2UA 4G4JA 3RRFA 4HWGA 3M5DA 2YXBA 3VR3A 1K0FA 2ERCA 1P3Y1 1L5FA 1C1DA 3USES 2DFTA 2EGHA 4FYKA 4N3NA 2AFVA 1SQ0A 1MX9A 1UBUS 3BMNA 1NTOA 4GRAA 1ZBQA 1XRRA 3QKWA 1YQ9A 4XB2A 2XHZA 5LA6A 3T6KA 3GMDA 1M5UA 2FX2A 1YDGA 2EV9A 3PPVA 1H2BA 3OJLA 4RA6A 3U80A 4IHAA 1YZFA 4BO9A 4M55A 4F4IA 2PS3A 2F9FA 4HWPA 3NWBA 4F8YA 4HS9A 4LY0A 5ERYA 3B9PA 3F97A 5F78A 4CNBA 1TJPB 2ZE5A 3IHLA 2MTBA 4CMIA 2VJQA 3HJBA 1T1IA 2ORIA 2P90A 2E1RA 2WYOA 3COPA 1L1FA 1X8KA 2FMTA 4E70A 3FYSA 1K3TA 2V74B 2Y6UA 3TZHA 1U2DA 5FUMA 1TFRA 2ZVJA 3WBKA 2IV2X 4YI3A 1JALA 2G8LA 3KPYA 5K0NA 1AQNA 2ZRNA 4MP8A 4YUAA 1PT6A 4XJXA 2CVHA 2FKNA 2P77A 3OE7D 1UMCA 5L40A 2EP8A 1EFUA 1VJCA 4I81A 5LUBA 3DO6A 1NUHA 5TNXA 3ZZMA 4O2LA 4KUGA 3GLIA 3IAM1 4BV3A 4J1NA 4M89A 3RKUA 3JU3A 3WHLA 2YFQA 2DECA 5CUQA 1G16A 1GL9B 4BO3A 2IZ0A 3K1AA 1Q0QA 1UQRA 1X86B 3LCCA 3Q7SA 1FTWA 4HUQB 4L5AA 3SIPA 5EIHA 4X84A 1PZHA 1R0XA 2BFFA 5ALPA 1RIFA 4ZVNA 2FR8C 1X7YA 4S0ZA 1CYEA 3T3MB 5F76A 4TXJA 1VCOA 4NYMR 5HZMA 1OLSA 1S2OA 2GEBA 2YL2A 4B32A 3T9AA 3GIWA 3U4QB 3BFJA 2TRSB 3UWMA 1KAEA 3R6DA 3VKWA 4M1MA 1FDWA 3TSOA 4BKMA 2A9QA 2A84A 2BUAA 2CE2X 2CXUA 1CY0A 2IXAA 2IHZA 5DI3B 1ADJA 1HYHA 2G06A 2WKWA 3I8SA 5CAEB 1KOLA 4EF4A 4P54A 3H1EA 1L5OA 3P26A 4UARA 4OBXA 2IQ5A 4HNHA 4HRVA 2O7NA 3KE9A 1A5TA 1N6NA 3QWHA 3RUDA 1LY1A 4P0TA 1LGYA 1XMQB 3WYEA 5HZHA 3A27A 1TZJA 1WKVA 1YI1A 1CRLA 4U39A 4CQJA 4Z4EA 1GFZA 4PQEA 2WAXA 3TSCA 3RM3A 4LF9B 3VJKA 4ZC1A 4EB0A 4YJKA 1QGAA 4KQEA 1AK9A 2ZUDA 1CY2A 2CVPA 2BGJA 4UW9A 4EPTA 4C43A 2QN2A 5DXAA 4R1NA 1L5RA 1U0LA 3AHHA 3ECCA 1KF0A 1NUQA 1TO1E 4MAFA 1RRGA 3WICA 3WXBA 2VTBA 2KB0A 2AR9A 2DFKB 2XF8A 1J2YA 2WZCA 1O0SA 1SKUA 1L5KA 3ELYA 4GS5A 4WADA 4XGKA 5DZSA 4ARZA 2HB6A 5JHHB 4Y7DA 3PI7A 5HUQA 3EXAA 1U9ZA 2RHWA 2Z8YA 2XUOA 3UHFA 3SJZA 1NI4A 2JI6A 2Z2KA 3F47A 4BNVA 2A8YA 4IYJA 4REMA 4BPBA 4RF3A 1GFWA 3PF8A 5KOIA 2GWHA 3H04A 2A1UB 2C1XA 2FLWA 2QGZA 3PXUA 2DUWA 4AUEA 3PTLA 2VJCA 3NXSA 3TDKA 4A8JB 2FVXA 4DBZA 4EUNA 1BE1A 1B4DA 3KJQA 3TJRA 5BWMA 2ZKLA 1UJ6A 4MUYA 4P5PA 4PBRA 5EWJB 5B3AA 1MT3A 5DTIA 3EEOA 3WIUA 2E18A 2PO5A 3BIXA 3JQ7B 2DY1A 1WDLA 4NAVA 2V58A 3ICWA 2XY4A 2E4VA 3KXLA 4Y1GA 5FTKA 3EGDA 5L4LA 3ZGZA 3O6VA 4ZOLB 3DNFA 2PKWA 1H5NA 3FPCA 4DIFA 1QPZA 1SBQA 3P4UA 5LBUA 3OT1A 4ND2A 1S8FA 1MRSA 4URHA 3T7EA 5DW3A 1GZ7A 2JH3A 2XWQA 3RYHB 1VMIA 3SWWA 1KE2A 4CT0A 1AKEA 5HJ2A 3JQAA 1C0IA 4DM7A 4O6VA 2GJSA 1Q0HA 1J1ZA 4OQ4A 2I1VB 4PYIA 3W8NA 4AP9A 1VE9A 2WP8J 2PYZA 1TZ2A 4DLAA 3ZVNA 4U9IS 5AM0A 2CCGA 3D8UA 3R3UA 1SCAA 3RH0A 1ZIOA 2OB1A 3MB8A 3B9RA 3NTOA 4LJKA 5EZYA 1K3FA 3HHEA 2GYYA 3V1YA 4C6SA 1GL3A 5AHWA 5E4YA 4A8TA 1KWKA 3MTJA 4GX5A 1UOQA 1GGFA 1Q3TA 2WSIA 3DBRB 3KRTA 1W48A 5FWDA 5GONF 3V4LA 4YAIA 3I53A 3GZJA 2V65A 1RJDA 1X8XA 5GWXA 3GLFA 4M87A 3VSAA 3VKUA 1QGZA 1D6JA 2GZ2A 4BJ1A 2ONCA 3HB9A 5EG5A 2G5CA 4RXUA 5J9FA 3X3HA 4F4JA 1Z73A 4G4SP 2GZDA 3C6QA 3FPAA 4LMBA 2HPVA 3CPJB 3DEYX 2BC9A 5CT4A 1D1TA 1T8PA 3A9TA 3G49A 3UUWA 1ZJWA 1DC7A 2G0TA 3ZG6A 2VYQA 1OAOA 4X1YA 3AVXA 1BFDA 4GI5A 4ME6A 2GCOA 4HNQA 4P2GA 1NBAA 2DZDA 3KZVA 5KOJA 3WLAA 2FSIA 1NG1A 3CEMA 1T1EA 2E89A 1B8OA 5TEVA 2WTUA 5KYVA 1R4ZA 2A9KA 2A9JA 2NUBA 1FVOA 2CWDA 3Q2KA 3T9CA 3ZWAA 4LJSA 2PGJA 2W11A 1K9SA 3ITDA 2Y1GA 1NN3A 1T1RA 2ARKA 2VPXA 3IQEA 5CVCA 4ZT2A 4RVDA 3S40A 1FUKA 3NYQA 1BS2A 3PIDA 1EXWA 2E49A 1DVRA 2ORED 3PLNA 3QPWA 4M8KA 3ZV7A 2H1OA 2VDPB 3VZSA 3ONVA 3DDCA 3ILYA 2QRHA 3KXIA 1XFDA 3GO4A 3EIFA 3KQKA 2OAEA 4MWCA 4QREA 1GG9A 4GMXA 2OC4A 4DUZB 3KOUA 4LXHA 3OX3A 1II9A 3NAMA 4X3CA 4B7XA 2ZXUA 4RK5A 1RBZA 4NYMQ 4PNZA 2YC4C 3RV4A 4CLRA 1GG2A 5KMGA 3OT5A 4TSFA 5CT6A 2GZRA 1KSJA 5C7YA 4BUJA 4NEQA 2HA2A 1S2IA 4U3JB 1A9XA 4KRFA 1FJHA 4MWOA 1NR5A 5EKXA 3G79A 2FRXA 2WJYA 4OXIA 4DWJA 5IASA 5KQLA 1LD3A 5CCBA 4WCFA 3SIWA 2WQ7A 3GXOA 4UM7A 3D7NA 3H9UA 4P58A 3TW4A 3ILVA 4DNFA 4GE3A 2GEDA 4A0RA 1SA0A 3LCJA 2KJQA 3FPGA 2IOYA 3IIEA 2ILVA 3CH6A 2A0FA 3ZDRA 6ADHA 3F6PA 5CVUA 1SVNA 3P9NA 2F3SA 4C0KA 4OFWA 1FQWA 5JTUA 4RPCA 4Y1EA 1G7TA 3NWEA 1PFKA 5ELMA 3U7JA 1IH8A 2D1QA 2ZS7A 1ZRMA 3LY7A 3MJEA 4L0QA 1O5IA 5EINA 4IS3A 5BNIA 2F1JA 4LMRA 2JAHA 1QTNA 3ESCA 3I28A 4FE7A 4U9HS 4WQMA 2JGDA 4F9EA 2AF4C 5ADHA 1GLGA 4KGXA 4X6YA 3DP9A 4TVKA 2Y4OA 1JHMA 1WZCA 2IZOA 3STXA 1EP9A 2CFIA 1Z5ZA 4OEHA 5L9AA 1TUBB 1YS9A 5DP1A 1IBLB 4W6ZA 5I8PA 2RK6A 3AYZB 3O21A 4TROA 5ECYA 3G2PA 4AZ3A 5JYBA 1FFHA 4EKGA 4UHBA 3A6ZA 2J3MA 1Z8DA 1RVV1 5DE3A 3W6ZA 2JPDA 4DR6B 1CUHA 4DA8A 2ZJ5A 1I3LA 2BSXA 3MELA 4LTDA 1LLFA 3CJQA 1C9KA 1MC1A 1A76A 2CLIB 2BHLA 3MWEA 1FW8A 1OYVA 1Q22A 1O9HA 4EEKA 4K88A 4WH0A 5YASA 4AB1A 5C35A 1QO0A 1OZGA 2WT4A 3HHPA 3MTGA 4MW7A 4D4GA 4PYJA 2ZBUA 1E9FA 1X1TA 3CWQA 1GTRA 1GVHA 3TMYA 3OEYA 4AMVA 3ROGA 3VH1A 1Z4IA 2Z98A 3VYTB 4UFOA 3ZGNA 1ITZA 1W0CA 2DHQA 1FVHA 2O8EB 4CGYA 4N7BA 4U6SA 3HN6A 4UBJA 1ILEA 1B8PA 2Q5IA 3OAAA 3V8RA 1I3MA 3DCJA 4XIYA 4TL6A 1XZCA 2Q3JA 3IT0A 4FGLA 4LOAA 1QF7A 3RPEA 4CKCB 3VDQA 4MLPA 4PAQA 4LYAA 1CUFA 3ROEA 1NFQA 3D6HA 4WKCA 1OU0A 4ZCIA 1ECFA 2QIPA 4NTZA 3RANA 1D8TA 4RV5A 3NIGB 5C34B 4P5EA 1NBOA 1WAMA 3UJ3X 2HU8A 1PJAA 2HF8A 3IIJA 4HAVA 3TFWA 1N6LA 1YJBA 3HRIA 1VRVA 2GPBA 2QW0X 5EJMA 4EIWA 3BRWD 2VQEB 4BY9E 3V1MA 4LAFA 4MCAA 1U2ZA 3ZY2A 3M1AA 2EKBA 1SUIA 5GJWC 4QYIA 1JEYA 3ZD9A 2PLNA 3C5CA 4WZAA 4CQMD 4RA9B 4EA7A 1P77A 3C98A 2MYPA 4EO7A 5JATA 2XF2A 3H0EA 4NZYA 4ZXPA 3M4NA 2DT8A 3PRHA 4KXWA 4UU1A 3TD6A 1I3OA 1IHPA 3OPXA 4JSYA 3VO1A 2Q21A 3QXCA 1UBMS 4HXGA 2I6GA 3BKWA 4G5HA 1GG5A 1ZX1A 1L8XA 1YCDA 2F8SA 5HQJA 5BUQA 1I7SB 2AFIE 3HA2A 4BMOB 2VK8A 5HRCA 2V7QD 4KXXA 1I5OA 2XNDD 4QXPA 5FD8A 1YQDA 1CSEE 2I65A 3W3ZB 3AFMA 3A7EA 3P32A 3KX2A 4NPAA 2D1YA 2PVSA 3GCGA 2QVCA 4YECA 4PLCA 2VXCA 4CLOB 3E53A 3GXBA 5BOVA 4Q00A 4MIYA 4ZTBA 3GRYA 2DR2A 2G4CA 4LF5B 1CERA 4JOQA 5LD2B 1XT6A 2AOVA 1IJFA 1CUIA 3W5JA 2YHAA 4NE2A 1NASA 3U13A 4UUOA 3CGWA 4RTPA 1NXPA 1ECGA 2R6JA 1L4HA 2I8LA 4JP3A 4Z0NA 1MZPA 1V8OA 1YACA 2B35A 3I37X 1HR0B 3GJ3A 5CXSA 2WF6A 2HF2A 2E85A 2X2OA 4QGGA 4JODA 4GLJA 3CNBA 2J3JA 4KN8A 1C29B 1YDWA 4W4TA 2OA0A 3R5XA 1SG0A 3NTVA 1TK9A 2J31A 1VE6A 3IE0A 2X4DA 2VUUA 5I9MA 2GYVA 3UIEA 1J2UA 1OD6A 5CX1A 1G21E 2IEIA 4PLVA 4B7CA 2BDUA 4C89A 5KJ1A 3WIBA 3NBUA 2VDKB 4J2OA 4RX1A 3LL4A 3KO8A 5BV0A 1RE0A 5J47A 1JQJC 1NQXA 3N8IA 3Q6NA 1T6YA 1ZNXA 2EW2A 3AIIA 3DXYA 1QC5B 3NQ41 4EPRA 4FHFA 5M3BA 2AEFA 1BGXT 1YL6A 2B9VA 1NATA 2AQIA 2JRLA 4K6KA 4WZBE 3LU1A 1VJ1A 2RHTA 1N6HA 1OJLA 5JY6A 5KNBA 4GAEA 5K45A 4J1TC 4O2BA 5E7MA 4P93A 5E6RA 2MSWA 2I1QA 4RK0A 2Y1LA 2GWRA 3BRCA 3G8DA 4KKXB 2NU8B 4FZVA 1ZZEA 2HRZA 2PZAA 2WZDA 4Q05A 3LYAA 4HDRA 4BB6A 1AKMA 5EVCA 5FOXA 1W93A 1DV1A 1L4MA 2G71A 3ACDA 5F9MA 3RVBA 4D46A 4MQBA 4W82A 1C2TA 2PZFA 3KPJA 1VGVA 4LYJA 1JQDA 4MLZA 4C0BA 2C9DA 4Y18A 4REQB 1P6QA 3TINA 5DO9A 4C0JA 4EGQA 1M8PA 1QZ3A 5ANRB 4E88A 1XTTA 4FMDF 4CZ2A 4KREA 3PJEA 4PQGA 4DN6A 2PIAA 2BP7B 4M0MA 2IIPA 9ATCA 4OL0A 1EEXB 1S89A 1T26A 3RLIA 2W4MA 1RRVA 1PYDA 4BJ5A 3DTTA 1Q1EA 4ABTA 3WLMA 1L5MA 3FF4A 2B6HA 3I73A 3A26A 3JS5A 3MT0A 4WESA 4E5KA 3EWIA 3KSDO 3MHTA 4EJ2A 2P5YA 4P86A 1KQPA 4KEAA 4URVR 4TLCA 4IMPA 2XHEA 5CA0F 2DHCA 2YWFA 4R05A 1EWKA 3M4YA 5H59A 3ICPA 4MQ6A 2B21A 4DV6B 3EMDA 2FX5A 4X91A 2ZTLA 2ATEA 4ECAA 1XN1A 3ASUA 3OFNA 1XR3A 4JP8A 4ON9A 3D7KA 3OHSX 1EUYA 4CIVA 1DJNA 1D2GA 2PL1A 5A0VA 1T9DA 1SUCA 1RZ3A 5ITWA 3F4LA 3V9AA 1LNSA 2D5CA 4ZQEA 2YW9A 1ORVA 4J94A 3IFSA 4DMRA 4WK2B 2IH4A 4ZRMA 2C54A 4KLRA 4F2DA 1ABFA 3MVEA 3KTAA 4JVSB 4IPTA 2X0JA 2P6RA 1OBHA 5JCZA 2NPFA 4AO6A 1EE9A 2XYGA 3LXXA 3DHVA 4AO7A 3R5JA 2HPZA 5A6SB 3GRFA 4HVLA 3D0OA 3GQBA 2VSFA 3AUXA 2C04A 2JIMA 3TVDA 3DVAB 3WP1B 3ZD8A 5KWJA 3R7AA 5G4LA 4X7RA 3ZS8A 2I34A 1GNVA 3WK7A 2FW9A 3ESZA 3OZCA 1VPDA 4H08A 5HIIA 3SSMA 1NRXA 3E35A 5K6AA 5J3JA 3I62A 8LDHA 3IQGX 5H3LA 3N8KA 3F6EX 1P2TA 4RTJA 1BO6A 3NM4A 1TADA 4MO9A 5KNBH 3CC8A 1LNQA 4ER0A 3V2GA 3K73O 4NQZA 1WCIA 4G1MB 2BCGY 3C4VA 5CJ2A 4DR1B 4IDAA 3UKDA 1DRVA 1RLUA 2V6GA 4GFDA 4AICA 3M4ZA 1T24A 5IU6A 2M6RA 3VSEA 5A0FA 3I12A 2P3SA 1CTQA 3KYBA 5JSZA 4KB5A 3IKMB 3DT8A 3WADA 2OD9A 4C0AC 1R8YA 3KJXA 1PG0A 3FHOA 4IQ8A 1JI3A 3ROXA 4UFNA 1HDXA 1ZR4A 3BQ9A 3D9QX 3SEAA 3IMKA 5IF9A 1D4FA 2XUZA 3HUTA 3QSGA 2Q7OE 1XQVA 5FNVA 2P9CA 3S5JA 2FSSA 2OHOA 1VMKA 3K9WA 2HSWA 3QLTA 1GAWA 1JPJA 5DCYA 1A2OA 3OQOA 3CRMA 1JFLA 2AXNA 2PXHA 3I6MA 1KEPA 3AGPA 1CNMA 1W88A 1ZD8A 2YNMC 4HMPA 4N5LA 4PFQA 4J7XA 4U7JA 1EXVA 2JDIA 2AUNA 3HFJA 5LQAA 2BM0A 4F5WA 1VP9A 1EFLA 1KRHA 1WUKS 2Q46A 4IDDA 1WXXA 3KKEA 4D82A 1RKUA 1V5GA 4MB2A 4CUKA 2CHEA 5KCZA 3U9TA 4OSEA 2JLZA 1YIDA 1SZPA 4X95A 2CLKB 5TSDA 3GLHB 1A9YA 3VISA 4KXNA 1MCZA 2VPIA 2YWRA 3GLKA 3OMLA 3K8ZA 4PC2A 4G0UA 4YAWA 2GR9A 3D5TA 4ARIA 2DCMA 4KXYA 2KSQA 3FYHA 4LXXA 2DEUA 1EP2B 3QMMA 3WOHA 5L3VA 1ZUHA 1XRSB 3ZXIA 2C1EA 2VHZA 4E33A 3ANSA 4A73A 3HDTA 1E9SA 1W2HA 5L4NA 1NJ8A 2EF1A 5GZ3A 2AN3A 4XVHA 3E4CA 2X0FA 3SF8A 3TECE 4YVFA 1SUEA 2QTRA 2O8BB 5KYYB 5HM6A 3GLSA 3VR6A 2IL1A 5JPDA 2LIVA 1OZHA 5E9JA 3BH0A 5IX8A 3L79A 5EZ6B 4I1YA 3LECA 3SVLA 4NJEA 5CIYA 3O7WA 1NVFA 1R6XA 3S2IA 1L5LA 5EZ5A 2VDVE 4G37A 1RKBA 3V8QA 2Y0CA 1Y9ZA 4MWSA 2ID4A 5DWQA 1QH8B 2NPOA 1WUHS 3OUTA 3DEAA 2CSUA 4R2HA 3G9UA 5DHFA 3U09A 1JDJA 1ELOA 3K35A 1MEOA 1U7TA 5THKA 1VHTA 4L95C 3QFRA 2AN5A 5EPOA 3G9QA 3V1UA 1CW2B 1X7WB 4YMHA 4R7ZA 4ZI2A 2IODA 4MRMB 5LLDA 2JCBA 1X1RA 3QYAA 1K2WA 3B6IA 2GX6A 3E9ZA 3JALA 2R11A 4OB7A 3EEYA 3KXDA 3TOCA 1E2HA 3DLBA 3OOJA 2YQZA 1Q7EA 1SGWA 2D1FA 3IQHX 4R8MA 1BJKA 3W3AD 1RLJA 3ZV3A 4TWAA 1Q19A 2C0CA 1KVUA 1O9BA 2V97A 3A1VA 4LYFA 4QQFA 4MYRA 2YZKA 5JO9A 4B31A 1LF5A 1N6PA 4AWXA 3W77A 5CBPB 2J33A 1RPNA 2YCLA 3UY4A 3TLXA 4MWDA 1SKYE 2O5RA 4B6FA 5IULC 5J58A 2XEDA 1AY0A 1KSGA 1NQTA 2OHIA 2W2OA 4OP3A 2BUBA 3WP0A 5MHTA 3FDZB 4Q19A 5K0FA 2C78A 2OP0A 4TQUS 2A0KA 3F73A 3FPSA 1SRRA 3CLRD 3PC8C 3WJAA 2C7BA 3CUSA 3GOQA 2VA8A 2JFYA 4KO3S 3RT1A 1HZZC 2H9AA 1JDBB 4HQLA 4R2JA 3UBTA 1Z15A 2HLDD 3WLRA 1U3GA 2FLVA 4MWZA 3AT1A 5EMHA 3WL8A 3NVDA 1C14A 1T9HA 4TS9A 3ZE1B 2GUGA 3LQKA 1ZVMA 5EMKA 1E3EA 1DJOA 1NRJB 3SSNA 1IEWA 3AWDA 4QE3A 3IVMA 3BZWA 4PNEA 3WMRA 5A3SA 2RJ3A 3OZIA 5GP1A 1RKXA 3BIWA 2BH9A 5E8RA 2E4YA 2B82A 3RGGA 5A4JA 4R5MA 1P0IA 3LVQE 1KOJA 4R8LA 4GOND 4J03A 4PXAA 1YVEI 1A8QA 1NULA 3GRKA 2ZB4A 2NU7A 4G1VA 5AM4A 4C6TB 2HM7A 3SC6A 3U2QA 4OHVA 4J0QA 1WSDA 1G4HA 4GNRA 1KBOA 1C7EA 1H2ZA 2R96A 1G2QA 1YZGA 1IWBB 3Q5DA 1OTYA 3LCRA 1ZICA 2BGIA 4AMYA 1F3LA 1LDMA 4NECA 5K0TA 2VF8A 4FYVA 1KL7A 4IXMA 4U2GA 4TV8B 2DWOA 2NSHA 1EX1A 1YE3A 4GLLA 3P2JA 5A4FS 1AF7A 1Q12A 1YZQA 2P79A 3DKPA 1HM5A 3QU7A 3TUJC 2Q99A 4TQ9A 3V1LA 1Z2AA 1ZD2P 1ZVJA 3ZI7A 3WLKX 4UATA 2NIPA 2WJIA 4CKBB 4WDQA 2BF4A 1SIUA 1KQNA 1MEEA 3S8MA 2BKAA 3HPRA 5JHGB 4DLYA 2V7XA 3FHJA 4B84A 4TWBA 1T2UA 3EPKA 1D03A 3FUWA 2P6OA 2ISCA 4LZJA 3T4UA 3ZDXB 1GGJA 4CBVA 1NFFA 1KA9H 4HQ6A 5B4UA 3HPQA 4MRNA 1P1KA 3I6IA 4NU0A