1N4DA

The ligand-free structure of e coli btuf, the periplasmic binding protein for vitamin b12
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
244
structure length
244
Chain Sequence
APRVITLSPANTELAFAAGITPVGVSSYSDYPPQAQKIEQVSTWQGMNLERIVALKPDLVIAWRGGNAERQVDQLASLGIKVMWVDATSIEQIANALRQLAPWSPQPDKAEQAAQSLLDQYAQLKAQYADKPKKRVFLQFGINPPFTSGKESIQNQVLEVCGGENIFKDSRVPWPQVSREQVLARSPQAIVITGGPDQIPKIKQYWGEQLKIPVIPLTSDWFERASPRIILAAQQLCNALSQVD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structures of the BtuF Periplasmic-binding Protein for Vitamin B12 Suggest a Functionally Important Reduction in Protein Mobility upon Ligand Binding
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transport protein
molecule keywords Vitamin B12 transport protein btuF
total genus 67
structure length 244
sequence length 244
chains with identical sequence B
ec nomenclature
pdb deposition date 2002-10-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01497 Peripla_BP_2 Periplasmic binding protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1980 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Nitrogenase molybdenum iron protein domain 1n4dA01
3.40.50.1980 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Nitrogenase molybdenum iron protein domain 1n4dA02
3MINA 4INPA 4MO9A 5KOJB 3R5TA 1H1LB 5KOHA 1TOAA 5M34A 1N4DA 3HJTA 3AEQB 3EIXA 1N4AA 1M1YA 1K0FA 3U7QB 4HMQA 5BVHB 1QGUA 3AERA 3R5SA 5M2QA 3MWGA 3NU1A 4DBLE 5M29A 1FP4A 4LJSA 3ZKAA 4TKUB 4OVKA 1KARA 1QH1B 4ND8B 2AFHB 4WZAB 3K1AB 2XUZA 4HMOA 2XH8A 5JJ5A 3ZK9A 3AERB 4WNAA 2R7AA 4M7OA 4HMPA 4OXQA 5GGYA 4WZBB 3MWFA 1N2ZA 4MDYA 4UDOA 2MINB 5CX1B 4LS3A 4WNAB 2AFIA 4WN9A 3K1AA 3HH8A 2XY4A 1G21B 1MIOA 3MINB 1QH1A 4FNAA 2Q8QA 3LHSA 1FP4B 4FKMA 1PQ4A 1G21A 4N01A 5GGXA 4NNOA 4BBPA 3TLKA 4FILA 1M1YB 1MIOB 5M3BA 2WHYA 4INOA 2RG7A 1L5HB 2R79A 2AFIB 3AEQA 4WN9B 4WZBA 5JPDA 1H1LA 3BE5A 2PS9A 4HN9A 5AFSA 2MINA 2PS0A 3G9QA 1XVLA 3AEKA 3PSAA 1L5HA 2AFHA 3AETB 4WZAA 4B8YA 3HXPA 1EFDN 2OV1A 3MD9A 2Q8PA 4H0FA 4H59A 3AESA 2XV1A 4WESB 4XPIB 3ZK7A 1QGUB 4G07A 3AEUA 4TKUA 1K2VN 3EIWA 1N2CA 1M1NB 3PSHA 2XDQA 2PS3A 4NNPA 4TKVA 5BVGA 5KHLB 2OGWA 2WI8A 2QI9F 5CX1A 1K75A 5KOHB 4K3VA 3AEKB 3CX3A 5JOQA 1G20B 1M34B 2OSVA 4PM4A 5FLYA 4G09A 3LI2A 4MLZA 1ESZA 3ZK8A 3UJPA 5I4KA 4OXRA 2M6LA 5HX7A 2PHZA 1M1NA 4ND8A 1PSZA 2X4LA 1QH8A 4WESA 1KAHA 4GICA 2PRSA 3BE6A 3MFQA 3GI1A 3AETA 3U7QA 5JG7A 2XQVA 4IRMA 2YNMC 3PDIA 2YNMD 5B58T 2M6KA 5KOJA 1G20A 1M34A 4UDNA 4UTOA 3TNYA 4PAGA 3PDIB 5HDQA 2ETVA 5CR9A 4TKVB 5BVGB 4FI3F 3ZTTA 2O1EA 1N2CB 4UTPA 4MX8A 2XDQB 1QH8B 3AESB 4XPIA 3AEUB 4CL2A 1K7SN 3TEFA 2OV3A 1KAEA 5BVHA
chains in the Genus database with same CATH superfamily
3O4GA 4Q4AB 4M38A 5FO1A 4DA4A 5DNUA 3EHDA 4EW1A 3ZBPA 4ND7A 2GVZC 3KS9A 1OH6A 5FAXA 5TPWA 3AVQA 2EYQA 3ENVA 2A9FA 1M67A 3GCZA 1G5IA 4K40A 1DFGA 3LHDA 4TTAA 3T3IA 5JNLA 4NLLA 2HHJA 2Y05A 3N9IA 5T41A 2B35A 3IEMA 4AQYB 3DBRB 3H5LA 3FHJA 5ULLA 3IKTA 4I9GA 2WIAA 2WJYA 1S7CA 1CUYA 3LVFO 4DIMA 2P65A 4EUEA 1I30A 3KUKA 4X8HA 3O21A 3RAPR 3ZXXA 3SX2A 2BFWA 2JA2A 3LY9A 4YAEA 1VLLA 3A6DA 3ADOA 4LBWA 1X2EA 3RFCA 3ZBQA 1J09A 4EYKA 2FE1A 3RYFB 3QW4B 5E95A 4EL5A 3WLKX 3PHCA 3TZEA 1CF9A 3MHTA 4M9XA 3LXRA 1A88A 2QXUA 1X1RA 4CMBA 3C97A 3K1AA 3MTEA 1BKYA 5E0OA 2C4KA 3TDMA 5JPCA 4DSOA 1NULA 1UBMS 2IU4A 4FQ8A 5ICMA 2AOVA 2V7GA 4BJ5A 1JEYB 4J4HA 2ZYAA 1Z18A 4CG1A 4Y6GB 5FJJA 4EB0A 3CSDA 2HRQA 2YW9A 4WGGA 2IH5A 1YR2A 1HQYE 1R18A 1OBHA 2Y0CA 2EZ8A 2OSBA 1P4RA 1X38A 1N8NA 2PT7A 1WB4A 1ZCBA 4WI1A 5GM2A 5CGZA 2X9NA 4PAWA 4B0PA 4EZBA 5I7FA 4E07A 4JH0A 3LCVB 5KJ6A 3AEKA 3MTQA 3FWNA 2IX3A 1K5PA 2JBAA 3CVVA 4N12A 1QYDA 3IE0A 5BQ3A 3KT8A 3OX4A 2CZQA 3JD1A 1PV1A 3N74A 3LZDA 2Q2QA 3NRCA 2HC9A 3HYNA 3IQFA 1ETHA 5T8KA 1Q1NA 2XKJE 1U5AA 4TKUA 3SIPA 2WT4A 1M6NA 4PHHA 1X7YB 1ZQ9A 1F8UA 2VWQA 3GMIA 4BO7A 3QF4B 3DNMA 3HI6A 2ACVA 4BO1A 1QK5A 3O9VA 3ZD7A 5F2NA 3N8NA 1CDDA 3MIIA 4X6XA 1KU6A 5LWQA 3FUUA 2VCYA 4URXR 1ZN8A 2WD7B 1L6IA 2H1VA 1SK8A 2ODBA 3CW2A 4C3VA 5LOVF 4DQUA 3CN7A 3OLXA 5BNZA 3FUTA 3CVUA 3T5GA 1U8UA 5E8RA 3GNTA 3PQ6A 4TTIA 1V35A 2ZJYA 1BU5A 1F1JA 3DQQA 1SXJE 3EBPA 3GFRA 4Q9DA 1QFJA 1S1MA 4I8XA 4PZ9A 4PU0A 1DRWA 3HVUA 4MVWA 1N8KA 1H8HD 1QIDA 3OQOA 3K31A 4L72A 4F2WA 4YCSA 1SPXA 4MUKA 1OWOA 1C3JA 3RSSA 4EATA 1MGPA 1XHEA 3QU4A 3PNYA 3TBHA 3ORYA 1LBHA 1WP4A 4FMBB 3PNSA 3BYZA 2IEIA 4RH3A 3T4PA 3K70B 1EWYA 3UMBA 3UFXB 1Z5ZA 4WCFB 4URWR 1PX0A 5JH7F 2IYNA 3DLPX 1K9SA 3UT0A 2RH8A 3A9WA 5ALNA 2I7XA 1EWQA 3ZR4B 4CL2A 1WY7A 3K71B 3ORQA 1W8IA 2AR7A 1NBIA 3JD4A 2FN9A 3AUAA 5HCUA 4M1MA 3KLPX 3SNHA 1GNTA 4Q3BA 2QZZA 3NVAA 5TE9A 1GFWA 2HTEA 2H1CA 4I08A 3OEHD 2ZAYA 5EFZA 1Z3IX 2R4UA 3LT5A 1L4YA 1L6RA 4G23A 3VR0A 2WSSD 4D44A 5LLDA 3C6ZA 2ERCA 3AXTA 4HDCA 4TQGA 1HYHA 2XUDA 1CJCA 3AJAA 4IQ0A 2MR6A 1UBUS 4CMGA 1L5YA 1V95A 1Z13A 4U7FA 4XWOA 1YA4A 2DG2A 4PGAA 1PT5A 1HDZA 2PX0A 1NV8A 3KZCA 3M3PA 3OZTA 3CR7A 1FYXA 1T0BA 1UXKA 4ARZA 4YMUA 3KQLA 2OD9A 4A0SA 4E46A 1D9ZA 5KNCD 1SUSA 1HR0B 4GECA 2IP2A 1BO6A 2O6LA 4AL4A 1PYOA 1W5BA 1KFEB 4X24A 1AX9A 4GO1A 1CUWA 1UBNA 3DMTA 2C04A 3H18A 4GIBA 4CR8A 2J3JA 2P4UA 2ZI7A 3IVGA 2QQGA 1Q7GA 5HIMA 3IAS6 5FOWA 1Z0AA 3UM9A 1G5RA 3LWBA 1KI6A 2JJ2D 2AI3A 4WW0A 3S55A 1NR7A 1ZW6A 3GJQA 1HDGO 2O0HA 3ZVNA 3OZAA 1TCUA 4OHCA 4Q9IA 5A4JA 1CUIA 1H1LA 2IHBA 1I94B 5FTMA 4UCFA 1FFHA 1I9GA 2G71A 2ZULA 3H2GA 2O8VA 2XB2A 5FRDA 2B7CA 3I53A 1C9YA 3K5PA 4AICA 1NAHA 1O97C 3SHOA 2NSHA 4N7BA 2NO6A 2WFLA 2HW8A 1HDYA 4K6FA 5G53C 4H3KB 5EJGA 1F2UA 1ZGBA 3W9BA 1SQ5A 4ERNA 3N1UA 1O4VA 1AKVA 4R31A 1CDOA 2YWXA 2W2XA 4ESVA 9LDBA 2PEZA 2WZDA 1JTVA 4GMHA 2RAVA 3H17A 3QSGA 2BKEA 4G0NA 1ZK4A 3TSOA 4J3NA 1NRJB 4MUJA 4XWWA 3BX1A 3N2LA 2QT9A 3IP1A 1GQFA 4HBGA 2A9PA 2PX3A 1EJBA 1RE1A 4OXRA 5KTYA 5ES4B 4IMRA 2P90A 1LRLA 4MJXA 3QVGB 5CA1B 4UCQA 5EWLB 1BGVA 3E81A 5FNVA 2H2IA 2X6QA 3JY6A 4HDSB 2OEPA 1XB2A 5AJWA 1KO4A 1T6XA 5FUQA 2Q9AA 1IM5A 1ZJWA 1N33B 2I1WA 4KSYA 4Q3DA 5CLJA 1TEZA 1U5BA 1Q15A 3IAEA 3COWA 2FPPA 3OWHA 3DOFA 2OUKA 3DR3A 5KJ1A 2QZPA 3EDCA 3LXUX 3K8OE 3SLGA 3OBIA 4L3VA 5KYXA 1WXWA 1XJ5A 2WQ6A 4JCOA 3TKLA 5D3KA 2B4AA 2O07A 4J8PA 2FLWA 3KR1A 4CCWA 1H6AA 2WTAA 5C5EA 2C98A 4EEZA 4PVDA 1YVPA 3M3DA 4P33A 2IZ7A 4YP5A 4DUPA 2AJCA 3J80A 2D1SA 3MS7A 5TQJA 3ZNQA 1Y7IA 4TV8B 3AOEC 3KQVA 3UHPA 2A0XA 2XIJA 2ZE5A 4H3SA 4Q9HA 1L3IA 1Z7EA 5KX5B 3IPAA 3ZXUB 4BTLA 2BFFB 2QUIA 4QNNA 3TS1A 1HBJA 3LUBA 4EFMA 5K0SA 3DFIA 2EQAA 3VR4H 4RQTA 2WPDA 4WJLA 3U7QB 4GR4A 3ZBUA 2P6UA 4CQMB 1S5PA 2V7QD 3EFBA 3EXAA 4ZZ0A 2PUFA 1PR6A 1IQ0A 1T8YA 3MRVA 3D59A 1V37A 4JXKA 4KAXA 4OA8A 4C7BA 3WKEA 2E2WA 4OVKA 3STUA 2A5YB 1VL2A 3ZU4A 2VQFB 4F9EA 3FDZB 1JG2A 4LQLA 1U90A 2F6RA 2J3HA 2Q41A 4L08A 3VJMA 3GJ0A 2WYOA 5KMGB 1E5LA 2J0UB 1ZA1A 2OO3A 1ZJ6A 4J0DA 4LS3A 4CQLA 3NYRA 4O4LB 3BH6A 3SKVA 2HA2A 4UUBA 5DLEA 4XASA 1EG2A 4LDJA 2BBSA 1JNXX 4GEKA 2C88A 1ZUIA 3WIDA 4PYKA 5EKTA 5KCMA 5TV2A 3EDRA 1B6RA 4WFQA 4PINA 4OHZA 1Z06A 3WLOA 1KXZA 5M5BA 5D6OA 3LM8A 4NNOA 3R7NA 3E4DA 4II7A 1DWQA 4LRYA 4WXHA 4ESEA 3H2BA 2VTBA 2JLZA 2DBVO 2PMBA 4F6CA 3LZ6A 4H08A 3L1HA 2O7SA 3MS2A 1DRJA 2N3ZA 1ZO8A 3HO6A 1EBFA 4DDTA 4P53A 4Z1OA 3TQTA 1XVLA 2QJRA 3LBYA 5LP1A 3EXFB 4OQ4A 1TKBA 3O0DA 4IXWA 1MNAA 4J7XA 3ZCVA 2VTVA 3H6HA 3UENA 3UAGA 3LPDA 4QRHA 3TD6A 1QGZA 5KOYA 4Q15A 1GTJ1 1NE7A 1O0BA 4XB2A 3BL5A 3Q5EA 3X1YA 1N2CA 2A78A 3B7PA 4L5CA 1COWA 2XGOA 4JBWA 3ESQA 3HLTA 4LJ6A 3VYTB 5A3VA 4P54A 2ADFA 1X8KA 3EGVA 1Z6ZA 4L02A 4EO4A 4Z51A 2UU9B 5LXTF 1O8BA 3GYGA 4YGXB 3DGFC 1IIBA 5JOQA 1A76A 3V2HA 2VHWA 4A36A 4NBLA 4A2QA 3MGBA 4WCVA 1QK3A 3FDXA 1A4UA 2FZGA 1P7CA 2WPNA 3OPXA 4JBLA 4A0GA 3UBMA 1KDTA 4ZEMA 4HQOA 3K9CA 4N0DA 5HILA 5BRNA 3ZLBA 2YXLA 1JU3A 3ZIAD 1B76A 4YJ3B 1EP1B 4Y6LA 5KQLA 2BBOA 4O25A 4B4WA 1ZK0A 4CIAA 5MF6A 5CCEA 4X64B 4HH0A 1NRWA 1DSSG 2FEPA 1L4EA 2OM2A 5HF5A 3HYCA 2ZT8A 2CVFA 2VA9A 4LNHA 2C4HA 3DHEA 1NW5A 3DTVA 1E3DA 5DCUA 3UWMA 2H85A 3BMQA 3WK8A 4D8YA 1IH8A 2GM5A 2V9PA 1U0HC 1ITZA 3P71T 4AW9A 4PLYA 3ZE6A 2R6FA 1AB5A 3T1TA 3C1TA 1E4EA 1UC8A 2FW6A 1JI0A 1R1DA 4KTTE 1HX7A 1OFVA 4R2XA 3NHAA 1XZDA 1VIAA 4JHXA 1U9ZA 1CY7A 3B85A 3JASA 4G4SO 5ALPA 3RBAA 3TEFA 3JYNA 4Y2TA 3LK6A 4QKQA 4Q00A 1ZINA 4B09A 3EOBI 1ZOOA 3KX2A 1NLFA 3HFRA 1JR6A 3EHEA 3G0IA 3FYTA 5T64A 1DDOA 4DKXA 2RHHA 1VB5A 2YASA 2EIXA 2XNKA 4HAYA 3KSZO 4UM7A 4NOJA 3RVSA 4BO4A 1PLKA 4ZVSA 2CW5A 3R3UA 3U3XA 3O4FA 3RD5A 5ALHA 3V4OA 1R4MB 3CV3A 4M9RA 4Q19A 2QTFA 1IULA 5A3SA 2GILA 5FBLB 5DXAA 3VMMA 2IE8A 4UUQA 3FCCA 3PT9A 1HMYA 3HZHA 2FPOA 4B31A 4CQJA 4F2DA 1V48A 4B45A 1F5NA 3BCRA 1QC5A 3CRW1 2VXBA 3M6WA 4DLKA 1U8EA 2WK1A 2EZTA 2C7QA 1U4OA 4JVLA 1RJFA 2VPYA 3WLJA 2VZLA 3AI3A 1T2VA 5DM0A 1JFRA 4BO2A 4B3IA 5IU6A 1QO0D 3ISTA 2G9VA 3F9IA 3BAFA 4K2HA 2VNIA 4OB6A 4OHMA 3A6GA 4E15A 5FP0A 3A1DA 2NMVA 3C6YA 3MK31 4HZIA 4N01A 3T12A 4DSAA 1PJAA 5K1ZA 3FZQA 3SF8A 4QZVA 5IJ9A 3UPUA 3GC6A 2JGEA 4P0PB 2ZJ4A 3K9GA 1TI7A 4O4HB 4Y2VA 1T5HX 3IV7A 3MXOA 4OKNA 5DI3B 5LA6B 1AA6A 3EGDB 3OHPA 3SFVA 4B3HA 1E18A 2Q1YA 3HJCA 1P5HA 3O3MB 5AM2A 2JFPA 3ORRA 3UTDA 4A10A 1WP9A 1YOVA 3HA5A 5LU8A 1F2TB 2PLFA 4U2FA 4UEJA 5GVSA 3HJRA 1SR8A 3HCFA 1IXKA 3QLEA 1DRUA 3NC4A 2B69A 3UV6A 2CF6A 1L7BA 2J33A 4KPGA 4YCAA 3ILVA 1DXQA 4PZYA 3HJFA 1GA4A 3O1LA 2QE6A 1AV7A 3QMPA 4L50A 4Q4DA 3RQIA 1SC9A 1QJCA 2PS3A 3K4PA 4QODA 5BV8A 1EP2B 3LC1O 4N76A 1E0KA 1GSHA 1OIXA 2I03A 4MTLA 3QI7A 5D5QA 2WUEA 5FOXA 1J8FA 1JKIA 1X77A 1Y42X 3LY8A 1VSTA 4YP7A 5J2TF 1ZU4A 3W8EA 2A5FA 2B6NA 1DBQA 5E9QA 3EVZA 4OREX 2ID9A 3PQ8A 1ZNZA 3U17A 1ZDMA 2VF4X 1EVIA 4DIEA 4F3RA 5IAEA 7ADHA 1ATZA 1JEQA 1ZCFA 1M7GA 3CKKA 3G5LA 3ZUGA 3L0PA 4MLPA 1QH8A 5I9MA 2WOOA 3AHDA 3W79A 4PO3X 1YS4A 2R7KA 3FZYA 4PWZA 4CHTA 1XWFA 1XKTA 3JTEA 3H3FA 3SHTA 1EP3B 2GJ4A 1Z74A 2RHTA 2ZI6A 3NI2A 3N7AA 4URZR 3PNKA 3S2UA 1IY0A 4PIMA 1J07A 4D26A 3E7FA 5D8DA 5AOBA 5BOSB 4RKEA 4ZJUA 1W88B 1M83A 2Y76A 2VNSA 4ZHQF 3KBBA 3AQ4A 5K8VA 4B48A 2G6TA 2FJPA 4F97A 1RQ7A 1RZ3A 1XT6A 2EV9A 2GYUA 2RKWA 3RTBA 4BTVA 2ILVA 3E8SA 3ETHA 2C58A 3OUTA 3STWA 1IJBA 1JDPA 1KPIA 2WWIA 3CUYA 1YR6A 1PLLA 3E9QA 2W58A 4FZ3A 1ZN7A 3AESB 4W5NA 1KZHA 2GN8A 1LJUA 2FX5A 2W22A 1EM8A 2V9ZA 5KQSA 1TVMA 2HNKA 3L7YA 3FNFA 4GP7A 3B6MA 5G4KA 5LP6C 2YRFA 4J75A 1YK0A 4RM3A 1WMDA 4RXUA 5F51A 3RRNA 1KSJA 2QN1A 2PANA 2LCFA 3OZRA 3A3KA 1JYSA 1YR9A 3VU9A 5IM4A 4ZVRA 3TW0A 1BVYF 4PXYA 2ZJ3A 3DV9A 3HMKA 5L3QB 3ZZMA 2BDTA 1S4MA 2Z43A 4GT1A 3DFKA 3OCXA 1JDZA 4R8RA 2OCGA 2QV7A 1G6Q1 3HU5A 4ALMA 2BMDA 1YBVA 3NUQA 1S01A 2H06A 1W36D 4YO8A 5AIAA 4OBBA 2QNBA 4OQXA 5FOTA 5HNKA 4CIWA 2I8CA 2B1QA 1HTWA 4YAIA 1OH8A 1SBCA 2QL9A 2MSCB 4D9FA 3QU9A 5E4JA 1P45A 2ECKA 1MT0A 3WGQA 3UMGA 2Q7XA 3PGVA 3AL0C 1RQ2A 2PVCA 1AK1A 3AUJB 3QVVA 4EUSA 3X43A 1WVIA 4HYQA 1LLDA 4IZIA 2FXIA 4O2BA 3CU5A 3IHLA 3LKBA 4C7JA 3EAGA 3L7NA 2GTHA 1JRLA 3P20A 1FP4B 4URVR 3GVXA 5AP9A 3Q3JB 4JQCA 4YAKA 4IZHA 4PCAA 4Y98A 4IDAA 2Y0EA 3UJ8A 1HFKA 3VGJA 1QUEA 4Q1VA 3I3SR 4W82A 2B8TA 4QRDA 2LNDA 4ALKA 3DEKA 3WLAA 5HOQA 1TIPA 2WJVA 1FSPA 3Q98A 2C97A 1LNZA 2FR1A 3TECE 1RQNA 2P91A 1A8QA 4QU8A 3TZBA 1RC0A 3LQFA 1PV2A 2C29D 1OYOA 5LOVA 2BV3A 3PKZA 1ZNWA 1FW8A 5HMLA 3RYCB 1M2HA 3RBVA 4YCMA 4DV4B 1SM4A 4FLMA 5EJMA 4QFDA 1NR5A 1Z82A 3AEXA 3PR2B 3S2EA 3UHFA 4BNJA 1ULHA 1XMVA 3ZH9B 4EMBA 2QAIA 3CXUA 4JJFA 2B4YA 3W0LB 1SU8A 2PUHA 2ZROA 4LZPA 2IYQA 3LWNA 1KA9H 121PA 3K30A 3ZHZA 3E84A 2D3TA 4F4JA 4QUKA 1XRNA 1UZUA 2G72A 2OFXA 3N6VA 2AJTA 5IN5A 4CFYA 1CBUA 1KH3A 2I7TA 1ZVVA 2O8BB 1F2DA 2WDPA 1FXUA 4R9NA 4RQBA 1EWKA 1KI6B 1FMCA 2Q4RA 3IDZA 4U02A 2O50A 4W5TA 2DMRA 1OF1A 5AKGA 4B87A 4R8LA 4JUIA 3U4MA 4D8UA 3WAGA 1AQUA 3I9V6 3GZNA 3KRTA 4EF4A 1FP6A 1PNQA 2C59A 2VDUE 1BWRA 2HIHA 1C7QA 2WYUA 3NHKA 4LISA 5TQ2A 3BJEA 2WOJA 3VC7A 4LC0A 5JNWA 2FHPA 1I1OA 4UDNA 3WMGA 4ZCRA 3ASVA 3O1JC 1UBJS 2QMZA 3DNFA 3KR9A 4UTOA 1ZH6A 2P2GA 4PPQA 5DM2A 1J21A 1GDTA 3PE3A 1Z83A 4BGUA 4LX0A 1JPJA 1VG0B 3LFUA 3N58A 1OLSA 3T7IA 4L73A 5JRJA 1M2VA 5G4KB 3KQQA 4FI3F 3FWKA 3UXYA 1E6EA 2LCIA 2O2GA 3RUDA 5C4MA 1OROA 3AILA 3Q10A 1ZK2A 3KQUA 1SY7A 2LV8A 4R41A 5A06A 1EVEA 1Q2XA 1LK5A 3NHZA 3UAWA 1GTMA 3U4QB 5H3CA 3A1UA 3GGGA 4DYDA 3WQRA 3CR3C 2G1UA 5DF1A 3GLQA 4LBVA 4ID9A 4DS3A 2WYHA 4EGAA 4P35A 3D43A 3AEQB 2KBFA 3VNBA 4ECEA 3V8PA 3UPTA 1T0HB 2AUMA 3HR7A 5JFOA 4ARCA 2XMCA 3CUKA 1KSHA 2GN4A 4YQZA 3MJ4A 2NU8B 5I9IA 4V2UA 4RZHA 4Z99A 1HQKA 5GONA 5BR4A 1MX9A 2YMQA 3DYIA 1HURA 4LTDA 5D01A 4IDOA 1JJFA 4G5HA 1N3LA 3W2IA 3PFHA 1U8YA 4F56A 1YQDA 1ZEMA 3OHMA 1EVZA 2QM0A 3OX3A 3QYPA 4HKTA 4JJ8A 1BIFA 1B3RA 2GCOB 2H17A 3D31A 4ZVTA 2C5LA 3MUNA 4KC0A 4LSMA 1DKLA 3JSAA 1U2PA 2GZ1A 5LZ2A 3IUSA 1QF7A 1Z17A 1SVOA 2ANBA 1Y4SA 2IDJA 2XXBA 3LIPA 3R6DA 4LY3A 4MUMA 1FTNA 1SCKA 5AVOA 3HKEB 2PWAA 2DWPA 3NALA 3X1DA 4ME6A 4YP6A 5HS4A 2YHAA 5LCXA 2OCXA 1YKGA 2ZCUA 1FRNA 3SX4A 3VPAA 3VPHA 3EBOA 4FYJA 3ZD9A 5DHUA 4E5MA 1T3ZA 4XD2A 1QM5A 1S3FA 2Y2VA 4QEDA 1IZZA 4UTRA 3TSCA 2AFIB 4R98A 2VR1A 3OCCA 1ENZA 3HP7A 4OHOA 3DB2A 2NO5A 1L4HA 2OBMA 2YJ3A 5EE0A 1CZKA 5TF4A 3BMCA 5UKDA 1L8LA 2XHEA 1ZJ5A 1L5HA 4AJLA 3D1VA 3QVWA 2W98A 2EBUA 3K9HA 1NPDA 2FFQA 3E9ZA 1J8YF 1UMDA 2QP3A 3JALA 3VH4A 2VH1A 4BRUA 3CKYA 4H0FA 1JQEA 2FWRA 3SZUA 2I54A 2XV1A 5FNVF 3VZSA 2HLDD 2DCUA 2WKQA 1S2OA 2AVDA 1DT3A 5JCZA 2OTCA 4EGFA 4MKFA 4OBEA 2AMJA 4MJ3A 3T9AA 3VA7A 2NYUA 4N03A 4X3OA 2QAGA 5HM6A 1H1DA 1CY1A 3MA0A 4YIHA 1WS6A 1VJ5A 5FUYA 3R76A 6AT1A 1K3FA 3VHQA 2Q29A 1IXRC 4PBSA 3ZKWA 5JCJD 3K8YA 4CIVA 3RF7A 1QQTA 1WUHS 4UU8A 4KN9S 4MP6A 1W4AA 3B1VA 1PS0A 1SIUA 3T06B 4AS3A 1ZGCA 2GCPA 2V45A 4FCVA 4GM1A 3W4KA 4QXMA 2VJAA 3NB0A 4ND4A 4YJFA 1T1IA 2NV6A 2OCLA 3RGWS 4KRGA 2RE8A 1TB4A 2SHKA 4GPTA 1U2GC 5KIAA 1BQ3A 4MIKA 4Y9SA 2NSDA 3O8BA 4Q4LA 4A03A 1RRCA 3NIFB 2PGLA 1QDUA 3JPYA 3LOUA 2ZRFA 3LPNA 4L9SA 4YRMA 3VSAA 1T4MA 2QNIA 1VPVA 1GPH1 2ZPTX 2GAOA 4KZKA 3FIUA 4S0ZA 3ZE2B 1AXRA 1G0OA 2DPLA 2O2CA 4BBZA 1QRTA 4NWIA 1YJBA 2BP7A 3KXKA 3IHKA 1EVKA 2W7TA 3N8IA 4PHCA 1UKBA 3EJ6A 4MS3A 2F3RA 3NAQA 4RE5A 4Z4FA 1Y7PA 3TRIA 3KJXA 2XAAA 4ZO4A 4C4RA 2JZNA 3WWYA 3UZUA 1ONNA 4Y9DA 5AKHA 3D7NA 1N3BA 1Q20A 4QNRA 4B6FA 1F4VA 2HA0A 2RHWA 4GOXA 3P96A 2BTOA 4PPYA 5DBIA 3TINA 5L8VA 5HFNA 2HWXA 2OT3B 1EXDA 5KC9A 2XWSA 4BEBA 3RBXA 2FMFA 4IG9A 1E63A 1XRRA 1V1RB 3DO8A 2HPHA 3EGCA 3JWJA 3KTDA 4J9UE 3SOZA 3V7WA 3K8QA 1KS9A 3P9IA 4G4SP 5TMEA 2FSPA 4TLAA 1QTIA 3B89A 1R4NA 4W5HA 1G8YA 4M86A 3IXMA 1WCYA 3H2JA 5KDLA 2CLCX 3MQ4A 4E4YA 2QLTA 4NJMA 3I0NA 1WZEA 4HGOA 2I65A 4NBTA 3NR2A 1K1EA 3BWMA 3TPFA 5HUQA 4NCJA 3WTBA 4DLVA 4PPNA 5IM4F 4YASA 2VHEA 1PEKE 5JZ9A 4AJNA 5K8CA 3NHLA 5CPBA 3ZI7A 1FJHA 1VRVA 2ZB3A 4Q39A 2IXEA 2GPYA 4LGCA 1VKZA 2REBA 1GV1A 1AK9A 1NM5A 3E3LA 4OHXA 4FFMA 1H1TA 5CRIA 1XTIA 5JVDA 5D7BA 5DPMA 3V2UA 1U28C 2GF9A 5EUQB 1W29A 3BERA 3U62A 2AMFA 5JXIA 1TX4B 3BZWA 4ISBA 2DY0A 5B6IA 2OD2A 3C2QA 1Y9EA 3KUCA 1KQ3A 3DHWC 1UZAA 1Y8QA 2IVFA 1SBZA 2JCVA 3H87A 3H9GA 3O5AA 1U3GA 3UTCA 4CTKA 4EQZA 4BAGA 3BDVA 1SOWA 3KEFA 2O8CB 2X9QA 3MTBA 2V65A 1ADYA 3I64A 4JLOA 1X1BA 3FLAA 1IN1A 1YJQA 4NPCA 4QBIA 1P19A 2J9XB 4PQEA 4CDNA 1U3DA 2EW2A 4NNPA 3G0DA 2JJ2A 4PLCA 2XT9A 2PN1A 1DVRA 3GFVA 5IABA 1DLJA 3WL7A 1E1RA 3L6RA 1LD3A 4QHYA 3GN1A 3IA2A 5B36A 1YZVA 2JH8A 2ODTX 3KV3O 4PZAA 3A8TA 4RSRA 3ZDQA 1Z7WA 1C8BA 4HDAA 2FPWA 2PJDA 1FDSA 1D7AA 4AMZA 1LEHA 3FAZA 3RSCA 4HYTA 3FLBA 4NZOA 1JFTA 1VGQA 1E0AA 4EVIA 3VUFA 3ZU5A 1P61B 1JKJA 4JI5B 3MWJA 1W8DA 3QWFA 2YFKA 2A92A 5CG1A 1YS7A 2Q46A 2R8RA 3MFQA 2E1RA 1TUBA 4RANA 4S1NA 1NJ6A 4OIMA 3C3XA 1VJCA 3EGXB 1W46A 1WCIA 2I6XA 3VX3A 5DJ5A 3G2PA 2GSWA 4P4LA 4FMDF 4IHJB 2UYGA 4NYIR 2D0PB 3FMFA 3FGPA 2H92A 2WSSA 1WR8A 2XMGA 4NMHA 2QTCA 2PLAA 3MC1A 2ZITA 2BFPA 5CR9A 5JS6A 1Z33A 1PZEA 1M72A 3BBLA 1O08A 4OK5A 4MX8A 3VDQA 4XTCS 1D5CA 2HZBA 2BDEA 3HG7A 4ZYXA 4XPIA 3I34X 4P7JA 4J76A 1MHTA 4RMIA 5A5VA 3HN2A 1ZMRA 2Q3BA 3VOBA 2CKMA 3R40A 4NVRA 2PKWA 2CE7A 2G40A 3RRMA 3KPWA 2KI5A 1QU3A 1KEEB 4IJQA 1QRAA 3BPSA 3VU9B 1VL1A 4B34A 2PUTA 1U3FA 4E13A 4UU0A 2F9FA 3NHYA 4L95C 2GAJA 1UK8A 2JAHA 1P8JA 1VPLA 4JP5A 4HDOB 4RGQA 2JATA 5LQUA 4RKFA 3SSAA 2J0UA 4CF7A 1Z0FA 3HDGA 3OZUA 4GE0A 4G84A 1E3JA 3TW8A 3MWGA 2X5NA 3F8TA 3THXA 3H0EA 1QAMA 4Q02A 4HDSA 3S70A 2I6TA 2XBLA 1E4YA 4AP9A 2IOQA 4Z53A 2WTEA 4BJ3A 4CM8B 3ZS9A 4E21A 1LBQA 4LYDA 2JK1A 1UKCA 2P40A 4IVNA 4ER5A 1IOWA 5AVXA 4IJMA 1E9CA 1P5JA 5F2OA 3EB9A 2IOHA 1GZ6A 3H84A 4M6WB 2OCAA 2JB9A 2BHSA 4FYPA 4E4TA 1GG8A 4OGLA 1W85B 3JTMA 1PR9A 2FG5A 4IKEA 3GIWA 1UK7A 4I7EA 2OA0A 5GIPE 2ZR7A 1CJKC 4H2DA 4HB4A 2FWIA 3KVOA 3P0EA 3L8FA 1TF2A 1Y63A 3DBHB 3OICA 3KK0A 5AUOB 4F3TA 2FR8A 3UCEA 3VR6D 1KMIY 4RTQA 4IXTA 4LFBB 3JQ7A 3QIAA 3CPHA 4M8SA 4LFCB 4OFZA 3UYLA 4AMVA 5BPHA 3OOYA 4QTTB 2YVUA 4CIDA 2ZXUA 1ODJA 3K6KA 3MRSA 2WINI 2BFFA 1HDRA 3G0CA 1I4TD 2MINA 3PDJA 1A95A 3NWEA 1YZLA 4HWGA 1EH5A 3EZGA 4WZAA 4EARA 3WISA 4RZ2A 2J6BA 3VR2D 2A84A 1K5DA 1JEYA 1TFUA 2RKBA 3GLFB 3FFWA 1BJKA 1NLZA 2FZ5A 2H5LA 1XKXA 2OVFA 2FG6C 2VP9A 3BXOA 4NOMA 5A04A 4N7RA 1QVAA 4RD4A 1BX1A 4D46A 5AJUA 4NHEA 4ITUA 2EKLA 1CZUA 3WLNA 1ZI9A 1SOAA 3PC8A 1R50A 2BFCB 2CL7X 3CLKA 3GRVA 1HK7A 2OSVA 2P5TB 3OPYB 4J16A 4PZLA 1BA3A 1USVA 3ZV6A 4KO8A 4XEUA 2OXEA 3GUZA 1JLKA 3F8WA 1RMYA 5B30A 5HP4A 2H2HA 3P5SA 2NYAA 2HPAA 1QRDA 2ZIVB 4GGMX 4NCXA 1XMPA 1KEPA 1SCJA 5AXDA 3UK0A 4E2FA 1W36C 1C9JA 5JCJA 4C6RA 4Q03A 4DSUA 1NBHA 2P62A 2VHCA 3PRJA 2MU1A 3BK1A 2Z4TA 3G02A 3I9KA 4D74A 2ZI9A 1Z6TA 2TMGA 4H9GA 3NPAA 4I3GA 4AU1A 3UPDA 2PH5A 1L7XA 1K3UB 1XN1A 4NH0A 2IA5A 3DLTA 4B2YA 5TY0A 1JIVA 1U7XA 5I7OA 1DIAA 5HKOA 5JSHA 2XRYA 3P94A 1G8MA 2PSEA 1EJ6A 2FOXA 1JPUA 1LLQA 2Q2OA 2V0CA 3AWDA 4JFRA 3U3ZA 2V5VA 4OI2A 5JZMA 4HEA1 4TMKA 1N7HA 1NBME 1DEXA 1F17A 2XE4A 3CIFA 1NBMA 1QZTA 1SKYE 3LKVA 3R3WA 1W34A 3ZE1B 4GXTA 1L7RA 1U3TA 4HDMB 4D1YA 3RNLA 2TSYB 3ZY6A 5L53A 3ADCA 3NONA 4I3FA 2G36A 4Q5IA 3CWZA 4O5OA 1GILA 5LIRA 1L9XA 2BEVB 4MAAA 3GCWA 3MXTA 2DX7A 2XGSA 4MR9A 2FWBA 2YRWA 3DM5A 1EUDB 3THRA 3EG9B 3TH5A 4K1XA 1SEPA 2WF9A 3GDFA 5LD2B 4IIGA 4TXNA 3SOPA 1F3LA 3P9XA 1DARA 1WXEA 1I7NA 4LZWA 1M2KA 4MWCA 3V1MA 2G1PA 3CCFA 3TQCA 4QULA 3VBEA 3QTBA 5CTAA 2M6SA 2HA4A 1ZMXA 1LI7A 2J48A 3B53X 2IHJA 3CLVA 3BRSA 4J6EA 3RIXA 4BKUA 4DZRA 2IEBA 2WSBA 3AVOA 2J9GA 3DMGA 2QDXA 2GUGA 3IQWA 2GFQA 2DHRA 1EJ0A 2FSUA 3C0KA 3QU2A 4LE2A 4V24A 5JSYA 4KXQA 4LYJA 4TTQA 5JAHA 4HEJA 2Y6VA 3GJRA 1Z4MA 4UOEA 1I2AA 1XTRA 5C8VA 2NWQA 3F1KA 3H1TA 1X8XA 5E38A 3DG9A 1XMIA 4Q6WA 5FA8A 1BQEA 4CKWA 4LOHA 4EG3A 5AVZA 3IA7A 1ZAYA 3L92A 4CT4B 2VCEA 4YI5A 3KJQA 1VJRA 3PNPA 4UEKA 2ZS9A 4HS9A 1U4NA 4OBXA 5KNDH 1CDEA 4FILA 4WK4B 2QW8A 1TMYA 3EZNA 1UXHA 3AC0A 1K97A 4RL4A 1QP4A 1N2CE 1ISJA 1E1QA 3QELA 4HS4A 3AEQA 2ZYRA 5LC1A 1SQGA 1GP2A 3B6ZA 2QG4A 4IDEA 4UDYX 3NV7A 3O75A 2X0IA 1Q84A 1GPJA 4TV9B 1KYIA 3S8YA 1J8DA 2JVJA 3KHSA 2QTVA 2W2PA 4GBGA 5K3FA 3TI9A 2HT1A 3JQRA 1NZDA 3PI7A 4GNRA 2Z3WA 1KIFA 5C34B 4OKSA 1GYPA 3DV2A 4JVNA 2AG6A 1U1IA 1JVSA 1Y5LA 4O0MA 1Z6QA 4IO1A 4ZAYA 3SI7A 3ETDA 2X58A 3DBLB 3V46A 4DDWA 3GPLA 1MR3F 3X0DA 1T35A 1CQXA 3ZIAA 3C4QA 4TVOA 4HRAA 4RPIA 2P4HX 2Z8XA 1RKXA 1X9HA 2VDVE 3SZGA 2XXAA 3FPHA 2C0CA 2VQDA 3VR4D 5JUWA 1GUAA 1OGYA 1H3EA 1IJKA 1AHPA 4WACA 1TLTA 4DJEC 5SY6A 2XCRB 2B0CA 3C7CB 1G5FA 4AQDA 1OXBB 4TLBA 1YNOA 3DHYA 1SVIA 2WJAA 2B20A 3A1TA 1IIRA 3O8QB 1T0UA 1ZR4A 1QO9A 3CQ9A 4IIVA 2VWHA 3BF8A 1TGVA 1BC5A 2AGVA 5D51S 4BCDA 3ZXIA 3KKPA 4RH0A 2FN4A 3CX7A 5K3SA 1EFPB 1W5FA 4ZI3A 5MN4A 2GYVA 2X4DA 3CLRD 4OX9Y 1XNQB 4JIGA 3OT5A 1SO8A 3OIFA 3O47A 5DYNA 1G3MA 1QONA 1SXGA 2QRVB 3LT4A 4ILKA 3C7KA 4N65A 1YQUA 5ECGC 5EWLA 1PCXA 1KDVA 1BGXT 2QUAA 2XSZD 3HKBB 4NTZA 2WB2A 1P5ZB 4HSEA 4ROTA 3RSHA 2HRZA 2FW1A 3IXLA 4OXNA 4DHEA 5SYNA 3FCUB 4C20A 4NV3A 2WWYA 1LRKA 3NH9A 5BSRA 2BONA 4DQKA 3NTVA 3SBDA 1V1JA 2W2NA 2AD1A 4AF6A 2AOWA 4JSTA 4R1NA 5KOHA 3FVTA 4YUZA 1GTZA 2HDNB 3WJAA 2BFCA 3WY9A 4G4GA 3F6PA 1OLXB 1E7MA 5K5EA 2R00C 2IEGA 1K88A 4ZCTA 1DC5A 1IXYA 5EMJA 2PEYA 2QVYX 3JQCA 1TT7A 4QUGA 3KHUA 2IDMA 3U7HB 4S05A 4LNUB 1KI4A 2B7BA 3HB1A 3OOWA 2YNMA 2C61A 5DN9A 3LQ4A 5C1DA 1V7QA 4AYWA 4ZEOA 5FR2A 1J0XO 2D59A 4RA9A 3ICQB 4AP6A 5JSKA 3FNHA 1ZS9A 1UJCA 3KE8A 1JFFB 4S1VA 1UOQA 4RF5A 2G0NA 4Y2QA 1QTQA 2D13A 1J97A 1T9KA 2H1SA 3EA4A 1NBWB 3IESA 3EXHB 5SY9A 4IIBA 1TMKA 1U8XX 3DMPA 3VSEA 3ZVLA 1UXJA 5EHGA 1G4HA 3MOIA 4FNOA 1C1XA 4F46A 3RGGA 4BBPA 3LC0A 3VJLA 1RM5A 3ZN2A 5DNEA 1BRMA 4KLNA 5BORA 1WB6A 4CQMA 4FGZA 4ED9A 3CPJB 1GGNA 3GJ3A 4FWTA 5DXFA 1MRSA 3JQGB 1C3VA 3HL0A 1H6BA 3I45A 3HB0A 1U6JA 3PENA 3PJEA 4MRSA 4PNZA 1F14A 1TM7E 1KMMA 2PRYA 4DJ5X 5HQ3A 2VJMA 4BLPA 2G5TA 4JP8A 1SVMA 2ZIEA 4BX2A 1MQAA 4BX9A 2LD4A 5I7VA 5JDCC 3WIBA 2PZLA 2I7VA 2JGKA 5C5CA 1YJ8A 1A97A 1Z4QA 2YJGA 1XZ8A 3NYWA 1LRJA 1U2SA 4KGZA 5T4HA 3EF3A 4CM4B 3F2VA 1DLIA 3KEMA 1J20A 3MWLA 1W73A 4BNVA 2WQ7A 2ZSFA 3DEIA 3N7UA 1N5IA 4AJIA 4YR7A 4Q66C 1N6OA 3KHTA 1ZAKA 4DR5B 1Y33E 4OXIA 2AJDA 1P2VA 5CNIA 4URYR 5IJXA 4DMKA 4DXHA 5LQDA 1QP0A 4QNMA 3VR5A 1QFSA 3ELWA 2JFQA 1IHOA 1LTKA 1M8GA 3JRNA 3L7JA 1YTLA 3GLHA 5EQJB 5C4IA 4CKWB 5ED0A 1EWRA 1SCUB 3GH1A 3ZXYA 3D6TB 1TUIA 4XRRA 3WLHA 3K32A 5CD9A 2KLHA 3DOCA 3ZGNA 3C6KA 5ELLA 2JLBA 5AH0A 2E4XA 3TAHA 2GCIA 2OBXA 3A1FA 4DB2A 1BYIA 3E9MA 2WWVD 2PGJA 4DT1A 2B5WA 1HC7A 2ATEA 2FGKA 2WMOB 1WF3A 1KVTA 2EJBA 2EKDA 4M0PA 2EL9A 3N3AC 3UC9A 3PCTA 1F06A 3RYCA 4HD8A 4UNNA 5EIHA 3Q9NA 1FY2A 1S8AA 2JIZD 1YSCA 2YY7A 3E9CA 3H4TA 1GGFA 3L79A 4OF4A 4EFKA 3JWIA 2PRIA 4Q4CA 2ILTA 5B7PA 1YS6A 5CDHA 2B8JA 3OF2A 2J9FB 3A7DA 1NNUA 4LSWA 1WM1A 3ONNA 4L0CA 3I04A 5K6RA 1O89A 4QGFA 5DT2A 1UXOA 2NVUB 1A1VA 1NKSA 4G41A 1U8TA 4EUHA 4F9GA 1DIOB 3B6KA 4G8CA 4LXQA 2BEUB 5J9FA 2GEKA 1G3QA 4C6SA 5JXHA 4CMAA 3AR8A 3VPGA 2CD9A 2MWMA 3EIHA 2C4WA 3ED1A 1YB2A 2BISA 4RPKA 4ZGGA 2HL6A 4OSOA 2GESA 2QPOA 2P6OA 4MW1A 1T1JA 3VYUB 1Q92A 2JS7A 2YHBA 4EF5A 1VJ0A 4EW2A 1G2OA 1U2DA 2BWJA 4TWBA 1G2PA 1GSAA 1VG1A 1MVLA 5ED4A 3KVRA 4KUGA 2IIBA 4KR0A 4CLXA 2R97A 5HSGA 5IH7A 4F4CA 5F5XA 4ZV9A 5I8ZA 3CLSC 3TEMA 2J3LA 2QD5A 3DC2A 3BCHA 3E15A 3GPDG 4NE7A 3G5TA 3GZJA 3FUVA 1SURA 2HRBA 5JFTA 3IP7A 4ZGBA 3KOXA 1NXPA 3ND8A 1DMRA 3JALB 1PQYA 4K3UA 4YIKA 4IF6A 2JFBA 4MAMA 1CUXA 4OOEA 2VAXA 3ZBTA 2AJBA 1RXYA 1Q16A 2OLJA 2G09A 3NPMA 1UFKA 1JG3A 4GPZA 4K5QA 3L93A 3P0IA 3TAUA 5C46F 1E0SA 4U2CA 1RXUA 2C9YA 1CS0A 3KT6A 1G8PA 3R8FA 3EARA 2R87A 1CJMA 1U1GA 3F4LA 5G40A 4D9BA 2DBZA 3BDIA 3ZV3A 4N1AA 2PNJA 2GT1A 1HY3A 4CMEC 4M9SA 2EJUA 1L1FA 1EXVA 3NHWA 3KEGA 4CFSA 3Q6IA 3OO1A 3FZEA 3UFXA 4DMHA 2YC2C 3JATB 4DNQA 3EVDA 4RGVA 1WSWA 1QPGA 2TMDA 3BJMA 2DQKA 5K4GA 1G1AA 1MT3A 2QAGC 3ZOKA 1HGXA 2JLRA 5EXEA 1QGYA 3STTA 4UAGA 2BEJA 1RXEA 4BGDA 4MHTA 1WNTA 4G8DA 3FW1A 1U0GA 2AN5A 1MXHA 4YMIA 4LZAA 1KE1A 1XTSA 3MWDB 5JMWA 1UPXA 1WA5A 2X1MA 2Q5HA 1ZIDA 2DFKB 1GADO 4CKBB 1GSIA 5LL6P 1JGTA 4YRIA 4FU0A 3B2QA 4H7EA 4JLKA 5CT8A 1WTCA 4E5NA 5JW6A 3S5JA 2IXTA 3AM1A 3UUFA 1RXVA 4C0HA 2NZXA 1NDQA 5LZ5A 1YVRA 2P2NA 3TVYA 1IB0A 4HQFA 5CVVA 1C7IA 3D8SA 4KOAA 4L07A 3ZEAA 1D8AA 4K8OA 3HCAA 4ARZB 5HGXA 5KAMA 2X8BA 5BYAA 4CV1A 3QLVC 2ZAMA 4PCUA 1GUZA 4LOKA 4M22A 4TKVB 2N46A 4BX0A 4JFAA 4NULA 1EGMB 3CWCA 1QOPB 1VM6A 1X13A 3GEDA 3EOZA 3V4LA 2VJMB 1PR4A 3N28A 5LP6A 4U8HA 1PJCA 4JROA 2OO5C 5DEOA 3EXIA 4PCLA 2ZBRA 1O94D 3IUQA 4NL4H 3TEJA 4D4LA 3FNQA 1HL3A 2R84A 3RC3A 1FLAA 3TZHA 3VDXA 1P0PA 2DPXA 3CMCO 3UW3A 1QAOA 4A0FA 3DVSX 5JAQA 4LHZA 3EIXA 3H5WA 1H2HA 1MZPA 3KL4A 3AGPA 3G8AA 3ISVA 3VOAA 3IBFA 1XMJA 4ZAZA 2LXNA 3AHIA 1FUUA 3MW8A 2J45A 4QPNA 1FX1A 4HXYA 1J1IA 1ICEA 5AM5A 4NS4A 4C6HA 3G5UA 1IHPA 1E61A 4I50A 1U11A 3MERA 4E51A 5IDWA 1V39A 3OX1A 1R9GA 3SJUA 7REQB 1SZCA 4U3JA 3BA6A 2XYGA 5CX1B 1MQSA 2V59A 1THGA 4IIJA 4LK3A 1TZMA 2HA7A 3CVOA 2E6UX 2XRFA 1F6WA 2Q07A 3BF7A 4FE4A 3V8EA 4D9KA 4IH1A 4JL5A 1XZNA 3VPFA 3OTOB 2AF4C 1TK9A 1USWA 3NBQA 2P5YA 1PUXA 4FS8A 2PRKA 1OLUA 1YFJA 4EGJA 3JVUA 3WB0A 4BZZA 3LCCA 4P7KA 4PS1A 4ZOLA 4CCYB 2PYDA 3R6LA 4A8JB 5A9TA 2ZJOA 3Q9SA 4L0QA 2GNOA 4JI4B 3MLAA 3FTPA 2ZBDA 4J49A 1GZ7A 3PRYA 4BMYA 7MDHA 2QENA 1T4BA 3RO7A 1NY5A 5H3LA 2IW1A 3UK1A 4AJKA 2FDCA 3DDZX 2DCMA 3SMQA 4DUGA 4K03A 1E79A 4I2VA 2J9FA 3F78A 4N54A 1Z07A 5C1OA 2IU0A 4BY9E 3SYRA 1T5BA 2RBGA 4BNIA 4U9HS 4A2PA 1NOJA 1XU7A 5EXTA 3MCWA 4DDHA 5I7UA 5C8YA 4U6QA 1BQ4A 2UUBB 3AEUA 3WOHA 2RKOA 4ZYWA 4QA9A 4WKPA 3HU3A 1T1RA 4RYDA 1E4OA 5J1TB 2IK8A 3B52X 5GQSA 4DG5A 3SGLA 2WF8A 3ZJVA 5LJIA 1MX5A 3AEKB 4LJ4A 1R6DA 5HJ7A 1R6UA 5AR1A 2C8JA 5DEIA 1JJVA 2RGNA 4YONB 4B4VA 1N5DA 5KVQA 1E9BA 3DT9A 3UJPA 4W7HA 1KQNA 1M8FA 3TM5A 1YNSA 1AOXA 3PJDA 3GEEA 5THQA 5DM4A 1K98A 4GXRA 1UAYA 2NV2B 1SB9A 2EZUA 1T43A 3DULA 4LG1A 4LXXA 3PPXA 3S7TA 4NOKA 2QVGA 3BFKA 4E1VA 1PFWA 5HIIA 3ZCUA 3NWBA 4FDLA 4JV5B 4IIXA 5IUJC 1I3NA 2HU8A 4DY4A 2ZANA 3AUFA 4KDCA 1L7AA 4PLGA 3DOEA 1RYZA 1ORTA 5HWSA 1Z22A 5B3LA 2C4TA 2JKZA 1TAGA 2UV8A 3EEYA 4QHSA 5JY6A 3B51X 3M4YA 3ZE7A 3D3KA 1Y5RA 4DMMA 1A8HA 3COSA 8ADHA 3P2YA 3AM5A 4YALA 2GZDA 1W4ZA 2BH2A 1X15A 2HWKA 3FB4A 4FX5A 4HX2A 1WUIS 2HLPA 1XZGA 3NJ8A 2NZ8A 2IXAA 3RRFA 4R69A 4W8HA 4RNCA 3IOEA 2QMQA 1T13A 5F2KA 4UNIA 4C4YA 4F93B 1WB5A 1RMTA 2XUKA 1JFLA 3EA0A 2X2OA 1NPYA 5EKDA 4B0OA 2RB5A 3G6WA 1UOOA 1ZCJA 1II9A 3PUXA 1XGKA 2QN9A 1JLMA 1ZX1A 1RRGA 3GRKA 4J9VA 4JMLA 4NE2A 1N4AA 3OJWA 2BI8A 4AMUA 5LZ9A 2HV8A 4BS9A 3ZV4A 1MV5A 1FP2A 1LZLA 3EPKA 2BW0A 2VQSA 3AFIA 5E7JA 1NY6A 2ZCVA 1G20E 1HWYA 3TK1A 3WGTA 4KAJA 1M73E 4PQYA 1XZQA 5EWJB 5BN5B 3N0VA 4PRLA 3DBHA 5FPKA 4YTEA 3RTCA 5C37A 3LF2A 4MRMA 5B1SA 3V8BA 1JU9A 1F8YA 2GEUA 5EP1A 1NN5A 1NIPA 1O57A 1JZSA 4FJ2A 2YN2A 1R2QA 4KLRA 1KI2A 2AT1A 4BMXA 1ULBA 1THTA 2EX0A 2PX6A 4YLEA 4GI3A 3ECCA 4QUIA 1BHSA 2ASVA 1KK2A 2X9GA 4KVFA 4D9EA 1VXOA 3LLVA 1P4GA 3OEHA 4ZYLA 5J4YA 2NP7A 1ZGGA 3KLOA 2F1RA 4F0JA 4F8JA 3DCJA 4F4FA 5CXQA 1E89A 1KMHA 1SZPA 2I2FA 4RDHA 3C5CA 3DBVO 2OB2A 1U0RA 1T9HA 5G2OA 3ZVRA 1Y3CE 4L8LA 3D7KA 4ERXA 1GOTA 5K9ZA 2H1LA 2YWDA 4TUYA 1X0XA 5DK4A 3NZEA 4EKEA 1VYTA 1W52X 2W11A 3HCBA 3I28A 4E5DA 1X94A 2HUPA 4C4OA 3L8MA 3SS7X 3H83A 4K0RA 2D8AA 5AVRA 2WSYB 4H59A 3GFQA 1PEYA 2VG8A 3C3JA 2CGEA 3OY2A 3RASA 2JLAA 1LDBA 1RLMA 3STHA 2C9ZA 3I37X 4JJGA 1L5WA 1VP3A 3LX4A 5B5SA 8ABPA 1PNVA 2X6RA 2CLEB 3D7MA 1KEZA 4GBMA 3Q7RA 3T0GA 4PG4A 5KWIA 4RDIA 5FBWB 4V1CA 3A4VA 2VJKA 2JGRA 1V5WA 1QO0A 5AJTA 4Z9BA 5FYDA 3RRYA 2I6FA 2E48A 1WBJB 2CFSA 3TSZA 4AUNA 1BE0A 2QTHA 4RKYA 3KKLA 1PU2A 4HQNA 4F6RB 4C03A 1EIWA 5CVEA 2PK3A 1V4BA 1F0PA 2Q6OA 2CXQA 4NAVA 4Q47A 2B2XA 3NAGA 1EGQA 1DIBA 1QWSA 2QJTA 1HNZB 2OE2A 2CCJA 2C5SA 3CUUA 4DWJA 1PV4A 4KR2A 3DWIA 3RRBA 3NG1A 1UFRA 1M8JA 1NFFA 2XPCA 2GPSA 1B73A 1OCEA 1ZRMA 2ZWVA 2XMBA 4G0MA 4IS2A 1SC6A 1QIJA 3FN4A 4BVAA 2QMEA 3A6PC 2A7XA 1QYCA 2YWCA 2GJSA 5DFAA 2ZQZA 1C81A 4BFWA 3HCOA 3Q7TA 3N8KA 1J8MF 1PG2A 1AMUA 3CGWA 2JJ8A 1X80B 4A8JC 3GT7A 2YUIA 4WK2B 4RD1A 1UQUA 5AI8A 4L2IB 1JX6A 3CPEA 3ENWA 3GB9A 5KWEA 3C39A 1G3RA 3S6JA 1LPAB 1R6TA 3RSGA 1IHDA 2JIOA 1FNDA 2VDPB 2ZUBA 4PTLA 5EOVA 4N82A 1NI4B 1JPVA 3H1BA 4Q1EA 1AQIA 3QENA 3USCS 1J90A 2VT2A 1P2BA 3RAEC 3A6LA 5AOCA 5DT9A 1D2EA 1V11B 2OPHA 4YB8A 2VHXA 3REGA 3Q3CA 4NDZA 3A06A 4EI9A 5LB2A 5FNZA 4B7CA 1HI9A 3PQCA 3EW7A 4I4TB 4QIHA 4JJEA 4ER6A 3TXYA 4X60A 2HDOA 1MN6A 4K6MA 5B12A 1BFDA 1MO6A 1R3DA 3RT9A 3TD9A 1KYTA 3OIGA 2O8NA 2RH9B 2KMLA 5IS2A 1E32A 5JS7A 3D1JA 1FLDA 4ZT2A 2FFRA 2Q3JA 2FQQA 3FFAA 3O95A 4CF3A 4EO9A 4YRKA 4BRZA 1KDYA 4KXWA 1XRJA 2RI1A 1Z4LA 4H4DA 4Z54A 2O2EA 1JIIA 1X7XB 3FOWA 1ECLA 2ZLBA 1DRKA 1EXNA 4PLWA 4ZO7A 5T6BA 5TJ9A 2J3IA 1PUIA 1NOKA 3O4HA 3Q3IA 2EF0A 3REQA 3LO8A 1J4AA 4ROSA 4B6SA 1XTKA 2GA9A 3RYTC 4F71A 1HORA 1Z8NA 3SQDA 1NM5C 2QVCA 5EIBD 4YI3A 1IUPA 4X7RA 3ZJYA 3VKFA 3UKJA 5GZ1A 4OIFA 1H0RA 3DVQX 4IGAA 5GGXA 2Z9CA 3PYLA 3FOFC 1WUTA 4PY2A 4BKOA 1COWD 5AW6A 2O3JA 1Q7RA 4G0XA 4A6DA 3CONA 4F7WA 1Y6FA 1CR1A 1MIOB 1V1RA 5CFMA 3KYBA 1DP4A 5KU7A 4KWIA 1LBTA 4Q01A 1WX1A 2GO1A 3P1JA 2VQEB 1RSZA 1GRQA 2BEVA 4R6WA 2IWHA 3K70C 5LDHA 1CX9B 4UU1A 2C2WA 1EDZA 1EX7A 1H42A 5ADWA 4BYMA 4WEOA 1G63A 2Q1SA 3SM9A 3QLTA 4YYZA 1HDCA 4KFSA 1YT5A 2BEKA 1E2LA 3GDHA 3NYIA 5ADHA 5DGHA 2R86A 1VI6A 2J5QA 2RAUA 1DJNA 3CF4A 2CLHB 2L2QA 2O48X 4LPKA 5EP4A 1Z56C 2YR0A 1E1MA 5EJ4A 1NC1A 4D4MA 5JE8A 1C9NA 4C78A 2CVZA 3CX3A 4JODA 3ABSB 2O52A 4DGSA 1KDRA 3I23A 4GWKA 4PM4A 5H81A 5EN4A 1T2EA 5ALUA 3CS3A 3G88A 1BX0A 1Z39A 1J39A 1IMOA 3ZVKA 3IX7A 4KHZA 4RLQA 1USUA 4YV7A 5KOIA 2ZP1A 3C45A 4FDTA 4P2BA 4ARAA 3BIXA 4ZAFA 1WDKA 1GIAA 1I32A 1PSZA 2VKQA 1DEAA 3IO5A 4YRFA 4R54A 5I4BA 2IEAA 1RZRA 4F72A 3U4QA 4AZ0A 1ZD2P 3EG9A 1RI4A 2QL7A 2BFEA 3H7AA 3DXYA 1E7YA 4BLTA 1V1MA 1I2MA 4MKZA 4N5MA 5DOZA 1XRPA 2MJLA 3MJRA 3BORA 3K8ZA 3OVMA 3OIWA 2YWGA 3I42A 1VECA 2CCGA 3EE6A 4FE7A 4R7GA 2WP8J 4EBFA 3A9TA 2QM7A 3LH5A 1VPEA 5JI2E 1ST2A 5BXYA 4R2KA 1P18A 3LDFA 2FQXA 3DTTA 3OZVA 2PZAA 1UKEA 4RQAA 2AA3A 1OC2A 2C9MA 1XHFA 3DMTC 4RMNA 4V0NA 4EK9A 5BNIA 2O5EA 1TDJA 4KO1S 4OO3A 1EDDA 1T9GR 2R8EA 1J8QA 1N7JA 3GBVA 4XB6B 2E7ZA 3ZLTA 4AO8A 2BHNA 4JGBA 1KYVA 1Z36A 4X92A 4R71A 1QRSA 3LYHA 2GRUA 2PL5A 2C77A 4HLQB 1DJPA 3ND6A 3SYTA 5F7OA 2AS0A 2CXPA 2D2XA 4X6UA 4LGMA 4MMYB 1NVEA 1H4TA 2QEQA 3G49A 1MIHA 2XCTB 3JYLA 1CT9A 2P9HA 3ISJA 2F4NA 1V4NA 1T36B 4HQLA 1Z37A 2AV6A 1DOZA 3AUUA 3G89A 4HEA6 2R7MA 4HDNB 1Q22A 1EWVA 2VT6A 3LQQA 4UFNA 3V1LA 5JYDA 5CBKA 2ONCA 4HFJA 2GNPA 2YHUA 4JLNA 4DR4B 2HNAA 3AM4A 3I9OA 2V6FA 1KHTA 3DAOA 5CTJA 1DO8A 1JDUA 3P2IA 5A6VA 2XUOA 1C50A 2WFAA 3LFTA 3QF7A 4IICA 3MWFA 3DYBA 4X66B 3NLLA 2DR2A 1SVUA 2Q4OA 2Z1MA 1GA6A 4S2EA 4X84A 5EZYB 4MLDA 1Z2EA 2P9GA 4CI9A 4LSZA 5KU1A 1IY1A 1TM3E 2G9ZA 2ZQYA 3VYSB 2PZGA 3BL8A 2R2AA 1JS1X 4Q7EA 5EJAA 5HKBA 1CRPA 2GHTA 2OUIA 1XMQB 4MW9A 4OJQA 2B61A 2QR5A 4Q3OA 3NRBA 1SCBA 2W48A 3D4BA 3OM8A 4MCHA 3ROEA 3TRJA 3RVOA 3G7UA 4FB4A 4B40A 3K16A 5H59A 4PZ0A 1EDBA 4EKGA 2DUNA 5DTRA 3PFNA 4Y2XA 1RLIA 5HCIA 2YYSA 4RY2A 3EZ9A 5TQ2B 3M6AA 4V39A 4M8KA 4P93A 1M7HA 1RBMA 3W6UA 1RW4A 4J0EA 3PPVA 1AUXA 1T1SA 3NM4A 1QHIA 3SF8B 4DMRA 4F9TA 2O8FB 3GUUA 2I2CA 1DUSA 3H8JA 4I1SA 2ES4A 1N75A 4EA8A 1C0PA 3ZY3A 2WWTA 3E9DA 2XLBA 4GKBA 2HT6A 4UNSA 1H9CA 5K3AA 1U63A 2JKVA 1FRQA 4L85A 2AFIE 2Q5CA 2IYWA 4DQDA 3BHJA 1RQXA 1CG6A 3D5EA 2JGMA 1ULAA 1HF3A 4PF1A 3PDUA 4TQAA 4QSMA 4U4AA 5EXSA 3AOEA 2PKRA 1GUYA 1T9GS 4BECA 2C82A 5FWAA 3VHLB 5DIFA 2QZSA 1HZJA 3BXFA 3I9NA 3H11A 2FEOA 3OESA 3ZHUA 2UVPB 4FT4A 1EPUA 5JD5A 3AB7A 1MOQA 3OM1A 3FPGA 2O0LA 5J4VA 1ONPA 2PJUA 1A9TA 1ABEA 3WRYC 4L9RA 4MV4A 1UWKA 5F1OA 4DA7A 1U3CA 3F49S 3V42A 4DANA 2PYIA 3A9UA 1Z2PX 2A67A 1FXWF 4RIGA 2LDXA 3ADKA 2EF1A 3KT0A 3OE4A 5DLQC 4DCCA 3C98A 3WGNA 1RHMA 2VDWA 3R7SA 4DL9A 2FPPB 3MSXA 4CUZA 2KHZA 2OBBA 3C4VA 3UGJA 1XEWX 4X91A 3QUBA 4ZJYA 4CM1A 3TRKA 2WU0A 2Z4SA 2VEDA 5DLYA 4DAOA 2P9FA 3F5FA 3Q2IA 3EXHC 5G0VA 5A1JA 1KEVA 3HBFA 2RHCA 4JLMA 2JAPA 4KWCA 5LDGA 4BO0A 4FB5A 4BFCA 3DCIA 3P26A 2ZJ5A 1UMCB 3CZRA 1MNQA 4LE1A 5AVUA 2R7LA 2X3YA 3CT6A 3HACA 3QA9A 4E5UA 4N0EA 1RE0A 3S2FA 4H7KA 3B7WA 3NQ41 1MG5A 3KQKA 3QBVA 1P7PA 1GPKA 2W43A 3T5BA 4RPLA 1LFDB 4AZSA 1ILWA 2Y1OA 3N2IA 4ND3A 3I52A 3A4TA 4DLYA 4OLHA 4BFSA 4WHMA 2FGJA 3CEPB 4IMPA 1F2UB 1H8ED 3FRIA 1TKRA 3QFCA 2B92A 4OB7A 5TS2A 1NUPA 1TYCA 4UVDA 3DKPA 4J0QA 2IY9A 4F8YA 3TL6A 5HQ3B 3VAAA 5I7AA 4RNDB 1AKEA 4PC3A 1DAKA 4LPSA 4DR2B 1VYUA 3WMFA 4RPGA 3MCVA 1M1ZA 2BCJQ 5A7GA 2V7WA 4PG5A 3RRXA 1PFKA 4C4AA 5LA6F 1HT3A 2ZRLA 1DAGA 1NW4A 2YXEA 4IP0A 4M7RA 2B8NA 2RFLA 5CCBA 3N0TA 2GDZA 1M75A 5KVSA 3HB4X 1KQGA 3LWDA 1LF5A 4PVCA 2RJOA 5ITZA 3EPRA 3TJMA 3AFHA 1D2RA 1TYDE 2WV9A 2ODAA 5AHOA 3LG2A 1TCVA 4BZPA 1JMYA 3EN0A 4NBUA 3RWMB 2QU7A 3O4VA 1W6UA 4M0FA 2BM0A 4IUDS 4DCTA 4DE5A 2G70A 3IOMA 1X3SA 3C5WP 5THKA 3ONFA 3NS7A 1FP1D 1VI5A 2XZLA 1TQ4A 2Q8PA 1LQ2A 3L01A 4JOCA 4ON9A 3T5TA 4G1EB 3FHOA 9ATCA 1DJOA 4TMTA 3EXFA 1UJ4A 3EISA 5FULA 1OI3A 4MS1B 1T36A 2Y1DA 3C43A 2G7ZA 2QPTA 3UBTA 2WY2D 3ABRB 3L1KA 4DVGA 3G6KA 1EFKA 3M4NA 1MABB 5DN6D 4KITB 1N1DA 3ZE8A 4DBZA 4YLYA 2I1VB 3C6BA 3RU2A 5J2TB 4TXMA 5FLYA 4KIGA 1DCKA 4Y67A 5ALYA 3GFPA 4YWHA 2GRAA 1XAGA 1YZQA 3D3JA 3DKVA 2ZYHA 3WGHA 1SUBA 5GAJA 4CMJA 5E6RB 3TLXA 1IOZA 3ZX5A 1V6AA 1TZCA 1KFKB 3FPEA 3NHMA 3ZU3A 2VHTA 1Y6RA 4MUFA 3W5AA 1MJNA 4QDTA 2BEUA 2IU3A 2NXNA 3OQ6A 3EUAA 4LC1A 3SQXA 1Y5NA 1CR2A 1E3TA 3AHCA 1GQYA 3EIOA 4UQOA 3PDCA 5B58C 2Q6LA 3KZXA 2OXIA 4XUGB 1ONOA 3BGIA 4G1FA 4N5LA 2F8SA 3FROA 3AYXB 3PXEA 5ALDA 3W4JA 2CB9A 3IV6A 1R74A 2GI4A 4YP9A 4LFAB 3IT2A 4JX8A 5J2UF 3RC1A 2BTEA 3BXXA 2H2GA 3G7SA 3W05A 4QGSA 2V03A 4DB4A 1UBHS 3GN2A 3GLGE 1W93A 1E60A 1LCIA 3INGA 4QOFA 2AH5A 3OT1A 3SXJA 2ST1A 4FXPA 3G1WA 4CLDA 1GA1A 2DQZA 2H4ZA 1LWNA 4X71A 5D7NA 4ZT6A 3RSLA 3SYMA 2CJYA 1YFKA 3BH7A 1EA5A 3R6WA 5IYZF 4O08A 5K8JB 1XZBA 3DEAA 4PCVA 1HOTA 4OQMA 1MHPA 4X00A 4OFBA 1OHHD 3GQBA 3H2YA 3RV4A 4RA6A 4GMXA 1P0CA 4XJXA 3ZDRA 5KZMB 1YFZA 3S2YA 3UC5A 3W5VA 1WKCA 4AWBA 4BNUA 3M82A 4FVTA 5BSMA 2BTQA 4HAVA 2VO1A 4UXJA 3VR1A 5JEEA 2W0SA 3FJ1A 2J59A 3F7TA 3E2IA 3QEKA 3K72B 5JJBA 3DEFA 2F3PA 4MWZA 2FUG6 2Y68A 5M7EA 1IBLB 2CEAA 2F17A 4IAOA 1NMYA 1GRCA 4JENA 2AWOA 5E9AA 1WQ3A 4TZ6A 3G9UA 4Y9RA 3TVDA 4C22A 5JANA 1MO5A 5GPBA 5T7BA 4FM9A 3SEZA 4EGCB 1SVKA 2EFEB 4JLSA 3U5TA 1R9MA 2OORC 3GHYA 3VYWA 3ZZ1A 5B3KA 3GCGA 5DDIP 1ZWKA 2XWPA 4KNVA 1PP4A 5KNBH 4UDOA 1RFGE 4JJ4A 5CNKA 4W1PA 5GV8A 4XVUA 1QC5B 1A4RA 5DB4A 5EA2A 3BWDD 2FY8A 4IKOA 2BI7A 2AEMA 1JR3E 2V58A 3JWEA 4K9PA 4XOIA 3UMRA 4FYMA 4LZNA 4UVGA 5I6DA 2JHCA 4Z9AA 4ZT7A 4YDQA 3GLFA 3QPVA 2GZAA 1DKOA 3CX4A 1Y48E 1Z7GA 3P4XA 4UHDA 3SHWA 4HYYA 5FBZA 2B9VA 2W6NA 1RZUA 1PJ4A 1U7UA 2HNBA 3MWEA 2R8BA 3M5CA 3T7SA 4EHDA 4LZOA 1NU6A 2XYVA 3E7PA 4A4DA 5AFSA 4C30A 4Y6QA 1A7JA 3GT3A 4O4HA 4Z9YA 2WM3A 4CLOB 4OAPA 3EYAA 3QQPA 1RM4A 2Z5GA 4YRQA 5DRTA 5BWBA 2A0YA 1DADA 5JJKA 3PK0A 5KWVA 2O23A 3PTLA 1ORDA 2R6GA 1M1XB 1PQUA 4RFSB 1BDIA 2OZKA 4O4IF 3FYHA 4P3YA 4E5YA 1I3CA 5JVDF 1DQSA 2G04A 4LQDA 4OSEA 1KZ1A 2VPXA 1AZLA 3BBPA 2XRZA 4R1QA 1K5HA 4TKVA 3Q4GA 4AMBA 5AHWA 2FQ1A 4FHCA 3DF9A 4XYGA 2IKSA 5BR7A 1FJGB 2GYWA 3IMCA 3AKZA 2IKQA 2Y27A 3CX6A 3I5YA 1DPFA 2VH2A 1JHPA 2X42A 4G0QA 4MW6A 4NAUA 5ALRA 1I7SB 1IE3A 3R9WA 1DX9A 5ICCA 4BNMA 4TS4A 1KEEA 4EUKA 3OJXA 3ST7A 3DOJA 1TT5A 3QNUA 1ZIOA 1XMSA 4BUJA 4HI0E 2NUPA 3QV1A 4M0LA 5A4FS 1N2GA 3SXUA 3UAXA 4M60A 4GX1A 3ZUPA 2HK7A 5AIBA 4D4GA 1KAHA 3D2LA 4E4RA 2FB9A 3IEXA 3VU1A 1M0WA 4D0SA 4G5GA 3K0CA 3SSNA 4EB6A 2ZTMA 4KQFA 3K9LA 4C2BA 4HT3B 4QUJA 3QXJA 3Q88A 5TIIA 1KOGA 4IILA 2VXCA 4M1OA 2VPZA 3PGMA 2WU1A 2I8AA 4N6OA 3VPSA 1NONA 4QO7A 2J1LA 4DWVA 2XW6A 5T8KC 3DWGA 5EMKA 2O7VA 3B2NA 3HXMA 4TLCA 2GK3A 2VOJA 3PQFA 3OC0A 1SGWA 1TJYA 5KHAA 2B1RA 2JFFA 3PC2A 5EPUA 4YYEA 1KMCA 4FMCF 1OFTA 3C15C 2E5FA 2H8GA 2X1HA 3D7SA 3SR0A 3R0IA 1KYZA 2EGHA 3QVXA 4ANFA 3TNFA 2O2YA 1PGOA 2XVXA 1J0CA 4BVEA 2ZW9A 2ZVPX 1TEXA 1PHRA 4TTJA 4V38A 1U3WA 3OFSA 4Z0HO 4CMKA 4Y0NA 2RJ3A 2VLBA 3FOAA 5E9JA 2DPGA 4PYNA 4AD8A 4DDUA 4H7IA 1V8DA 3W78A 1UC4B 1SCQA 1V5EA 3KOUA 1AO3A 2L69A 1GZUA 2PMKA 3JQ8B 3PVSA 4FMCB 3VV3A 3ZQJA 4CR6A 3LKZA 4KQHA 5E3IA 4UBLA 4FEEA 3CZMA 2OCDA 3NHJA 3SNKA 4ALLA 3OA0A 2FMTA 3EZYA 4D81A 1JSCA 2QTTA 4I6EA 5HHTA 2K2WA 5LBIA 3ROPA 2P5SA 4KDFA 1IBKB 1FPQA 3M4ZA 1DE0A 4FONA 4ZAXA 5EJ7A 1P77A 1KMHB 2CNOA 1NUHA 5B2EA 2GB4A 2GPBA 4KDEA 4J0JA 4MP3A 4EECA 1H0SA 3O3CA 3OE7A 1G5HA 4ICIA 4ZCLA 5TGZA 3GVCA 4M0UA 3W1VA 4E12A 4F1WA 4F2HA 1JU4A 3EEBA 5H9WA 1NF8A 4UBKA 1KKLA 1MV8A 3NHSA 4KXUA 2IV3A 5BUQA 3HLYA 4O5AA 2HD4A 3ZHTA 4LYEA 5FPPA 4NMLA 5L3ZA 3PE4A 1T5SA 3U5ZB 2OO7A 1U0OC 4F38A 3BMXA 1H22A 2HGSA 5U4XA 3K4QA 1GV0A 1LI4A 4PO8A 5FLKA 1YRWA 1HE5A 3KWLA 5F3WB 4NENB 2GR9A 1CYDA 4MVYA 1GKYA 1UZLA 1ZY2A 1KJWA 3KJFA 4HB3A 3WL3A 4HWTA 4RA6B 5BW4A 1LDEA 3FETA 4G86A 1NNEA 2H4WA 1G41A 1N2XA 5FQOA 5JATA 1LDGA 1SOUA 3HUTA 1I4OA 4R2MA 5JVDB 1GVNB 1OXTA 1URPA 1GFIA 1EFTA 4HAOA 2QTGA 2C2MA 5E2AA 1XD2A 4BWYA 3TQIA 1CIPA 4MPJA 1QGUB 3RLFA 4D3ZA 5IULC 3BQNB 5K0TA 1XD9A 1DIRA 2VXOA 2SECE 3QVSA 1E0DA 4R68A 1TT5B 3S27A 2YJ4A 2JFYA 5KTPA 4NCBA 4V0LA 4G2NA 1JIUA 4FNMA 1UBCA 4YLGA 1NVBA 1PZFA 4ZI7B 4DSTA 2GPTA 1CQPA 2ZR9A 1T6BY 1X0VA 3RS7A 5DASA 4RVOA 3UJ6A 3QWAA 4MUYA 3X2EA 4GM0A 3WFIA 4BNWA 3ZDFA 4AY4A 3LA6A 4EY3A 3TVTA 5A3JA 3JXEA 2XWJI 3ZWNA 3QQ5A 2HQOA 4P6VF 1Q6ZA 4MIOA 3VZBA 4N41A 4R9UC 3D3EA 4EENA 2FHSA 3HDVA 5FTWA 4BQRA 4C0SA 1P7ZA 3M4XA 4CR7A 1U0TA 4IJVA 2I2DA 3REOA 3VAZA 3X1XA 4UNRA 4LJ8A 4EPWA 1G8GA 4FUQA 1JIKA 1XRLA 1QPZA 2I3BA 2ODPA 4GVLA 2HBQA 1LVHA 1TA0A 1VA4A 4FXOA 1QV7A 2NZYA 1ST3A 5T4FA 1SG9A 1ZNYA 3LNCA 5IMBA 4XJSA 1LF0A 2D62A 2RH5A 2AJ8A 4KXMA 3LYAA 3C3BA 4UXIA 1OT3A 2EXXA 4DLLA 1QNLA 4Z7OB 2UXDB 2HK9A 3UOGA 1NF9A 1V43A 1R66A 2D06A 1FQJA 1CK4A 4MYCA 4PSAA 3LBIA 3VM6A 1L5OA 3OP1A 5FWXB 2J0EA 5CDSA 1KYYA 3H65A 5AK3A 2YMLA 2XBUA 2CWWA 2ZAOA 4P7BA 3UO8B 2BM1A 1KYWA 5HBRA 3MCUA 3QIVA 4MQFA 2HGZA 2VYVD 2JDIA 1PKEA 3VKGA 2IGTA 2JGIA 4BC1A 4QC2A 3PJRA 2ZT5A 1TTPB 2JGDB 2VNJA 4K05A 2F7SA 4RK5A 4W9NA 2HHCA 2AG1A 2GN0A 2E5WA 3VFDA 2OV4A 4WY5A 4H6XA 3R4VA 4UE3S 4N40A 1ZIPA 2PKEA 1UZMA 3B1ZA 1K68A 3RROA 2I66A 4CQLB 2A7QA 4KAFA 2JA1A 3ZVMA 4M46A 2DRIA 3TXXA 4KQ2A 1QIIA 2Y4NA 1UOPA 1DBRA 1XZHA 2YQ4A 1W0KA 3DHNA 4O2RA 3DDOA 4QFBA 2QJWA 2HXSA 4HPJB 3OZIA 4QG3A 1EB8A 3ORSA 2ZB2A 2OK8A 4F86A 5BQOA 1P0IA 5BSGA 2OXFA 4HUQA 1GCGA 1YS9A 3ZZ0A 4DQXA 3P32A 3KWMA 4LY9A 3L8CA 3D6FA 1YCDA 2P11A 3HKEA 1JKMA 1WMSA 3Q15C 1OX4A 4B80A 2ZI4A 2VZ8A 1OR8A 1ZM2A 4FGSA 3IILA 1JDNA 4B84A 3KSDO 4EZEA 2QVZX 3C6MA 4NZ9A 4IIJF 1VMIA 4L8WB 1D8TA 1P74A 5GIOE 3QY9A 2HV9A 4H6VA 4C7MA 4D9NA 2BFNA 1BX3A 1VIDA 3ANNA 5CBPB 1ZC4A 1KIMA 1O96A 2ZBEA 1P2GA 5IKOA 5G1PA 1OTHA 1QDLB 2G82A 3GLHB 4HNRA 4NBWA 3ZK7A 5BWCA 1YJXA 4JY7A 5JQGB 3GGDA 5LPNA 5TRTA 1PNOA 4I46A 5EKUA 4Z7QB 3D7RA 4GVPA 1R9JA 4DN6A 3UFBA 4RKRA 2PZKA 3WSWA 4BASA 4GLBA 2QT1A 2BFMA 3SFZA 5KQGA 3DXFA 3AUSA 4OP2A 3NM5A 3FOEC 1CB7A 3LLMA 4Y1GA 4DBVO 4EYSA 4P5PA 4CLRA 2BKLA 4CUKA 1PJTA 3AXSA 2ZFUA 5ABPA 5IVPA 5J3JA 4HQ0A 1NHGA 2I3AA 3I83A 3W5UA 4EVSA 4F4DA 1E1CA 3OH8A 2RSLA 1K8ZB 5C8YF 1S0UA 3PFIA 2OYSA 2C00A 3Q6MA 2ZS8A 3IELA 4KRYA 4RVDA 4W9RA 3GPBA 3DE1X 4F45A 4JHLA 4ZOQI 3FAKA 2ENUA 2P9YA 4D5GA 3DB1A 3TYXA 1VQ1A 1ND6A 4N7JA 4BCBA 4AKHA 3PFKA 4Q3EA 5IUNC 1M34A 5KNDD 2FMUA 3CEAA 3EGIA 1C80A 1JQJC 3G9ZA 1P0QA 3SQMA 2PA3A 3TLYA 4F21A 1E5XA 4S04A 2PXCA 3OIYA 1QLWA 2P5UA 4Y2PA 5K3BA 4U39A 3PG5A 3UJBA 1T4GA 4R0MA 1T3GA 1IG0A 3A3OA 2OHJA 3PIRA 4FNGA 3JQBA 5EJEA 5K05A 2ZSKA 1CNFA 2RCYA 3K9BA 3T3HA 4BXOB 3LBNA 4MP8A 3OM9A 3A10A 1QLJA 1P6UA 3TLMA 4E88A 3FBWA 4PFJA 3KXPA 1ZC3A 2GOYA 1MB9A 1FTSA 3W77A 1JB9A 1UM9A 4M7PA 3V4FA 5JYEA 3ZWBA 2QIPA 4C3UA 5IX8A 1MD9A 5A9SB 4O2AA 4X45A 1ZM9A 1N9KA 2W6ID 4RD3A 4L8FA 3CB4A 4D8TA 3K0AB 3ER8A 2CK3A 2OY0A 2REQB 1WKBA 1M54A 3AERA 3I4LA 1GKUB 4TWZA 4F85A 2RGDA 1YR8A 2F1OA 5FBVB 5TT0A 3TJRA 1EHYA 2NNLD 4LMBA 3FKSA 1GPBA 1XCMA 2C7VA 2O05A 2B4TO 2Y9PB 1VA5A 5KPJA 2ONJA 2P1ZA 1CR6A 2R4QA 2CDBA 2J4DA 5LZ8A 2O8EB 2PUGA 1OV6A 1MZVA 1XA4A 1LQUA 4WBSA 1XU4A 3GQVA 1T2NA 5FL3A 3RHTA 5CCDA 4CU5A 5F3RA 4WOBA 1GAQA 5KYTA 3E05A 3L0CA 5EQTA 1FDUA 1N2ZA 1RLJA 3HXTA 4AXBA 3TO5A 4DQLA 4LY6A 5BWOA 4WNAB 3KWJA 3I01M 1JIXA 1ZONA 2ZDHA 3L7BA 4K2AA 2FPSA 3HKDA 3UV3A 1E2IA 4Z4EA 3AF5A 1KZ6A 1GNVA 5DGIA 5B1YA 3WWDA 5BUZA 4JI6B 4KN6A 4YJFB 1M76A 4ZCSA 2JDID 3T7DA 2ABWA 4NOLA 2VHJA 2EFCB 2ONKA 3ICOA 4LY0A 4LV5B 4UUOA 5A9RA 5DXJA 4EGQA 4O2BB 4XLZA 3QFHA 1TYEB 2FYTA 1P9NA 3EC2A 3UHJA 4BMNA 4DBLC 3HJBA 5L7WA 1M6VB 1Z5VA 3H13A 3UT5A 1DC7A 3VZDA 5B37A 1KR2A 3JSXA 4L4RA 4LNAA 1D2GA 1HOXA 4A82A 4WBNF 1R0CA 1QG4A 4WPGA 1B0PA 1QXSA 4J7AA 4ALNA 3L7CA 1Y7HA 2IOFK 1Z0UA 2WE7A 4MQFB 5JHGB 1PWHA 1MENA 3D6VA 1BU8A 2PE5A 1FJ2A 1WABA 1J25A 4FD3A 1YJ5A 2H18A 3LRPA 4HXEB 4BVKA 4ZIRA 3SYLA 1OT5A 1BDHA 2O2DA 3D4NA 4HDNA 4P83A 4HUTA 2A30A 3HS3A 4U6SA 2WSIA 1X1QA 3A6HA 4PYRA 2ZOSA 3BD9A 1ECFA 5LVAA 4P0QB 4EX7A 5L6MB 3KYDA 1JE0A 5JI3E 4NATA 4NFLA 2YV2A 4RGBA 4XUDA 4MW7A 1IOVA 4ZVUA 2RIRA 3RSQA 1B0AA 3VZPA 4DJDC 1L4LA 3N5CA 2JAXA 3W2EA 2O20A 1EEXB 1ELOA 2GK6A 4NU0A 3GRAA 3PV0A 3WLSA 4P3XA 4CF6A 1PJQA 1CUZA 4II2A 1AB6A 2FN7A 2F8LA 4PX2A 1YBHA 4JK3A 1P2FA 3QKIA 5KVVA 4MK4A 1CPYA 3DMNA 2C78A 1L3BA 5CA0A 1JLLA 6LDHA 1IUOA 1PJZA 2PR2A 3IFSA 1Z8DA 3TSWA 1XRQA 1BCRB 3HZRA 3HO8A 2RG1A 3ASZA 3UAVA 5JC8A 4K81B 4LWQA 4R05A 2EEPA 4P5EA 3KJIA 2LWIA 4ILEA 2CJPA 4WGFA 2OBNA 2X77A 4B35A 2GX6A 4UEQA 3EGOA 4BPBA 1MH1A 2RDMA 3ENQA 3J81A 1TIKA 3JZIA 2ZB7A 3PRKE 2Z83A 4HNGA 3TQQA 1EG7A 1KYXA 2QSUA 3MCTA 4JS0A 4EPYA 4FHGA 2KB0A 1XR3A 1T9CA 2BKUA 5EZYA 3IAAA 1ZGZA 3WDKA 2OMEA 3CSUA 5ERXA 4G4IA 1RWPA 2M32A 2YIDA 4RVFA 3VV2A 4RIHA 1NKVA 2FUEA 3FF1A 3UAZA 4BFXA 4ETWA 3ELYA 1ZVKA 4OHWA 2VF7A 2CL0X 3GJ6A 5D5HA 1VFNA 3EDYA 2IDKA 3KZNA 2ZBQA 4DARA 1SD2A 3EZ6A 2VYVA 4MKGA 1SXJD 3DE6X 3DO6A 1Z4JA 4EBBA 1ABBA 3A6ZA 3R3YA 3NTQA 4UHBA 1RWKA 2FPGB 2WU4A 2QYTA 4RV4A 3CZ4A 1FVFA 1OJLA 1YVDA 3K1AB 3QPCA 4IM7A 3DCYA 4OAOA 5KCZA 1KIAA 4MQ4A 2QMUA 4YX9A 4IVRA 1IPEA 1Q1QA 4PE5B 1IMJA 3B9PA 3V8QA 3VC3A 4CU2A 1OLXA 4RTJA 5CVUA 3FLMA 1KP2A 1TD1A 3JS5A 3JRXA 5DTQA 3HPRA 2Y71A 3ANLA 1O6ZA 1P7WA 4BN5A 4FINA 1NUTA 3ZTWA 3FWHA 1JA9A 5FI0B 3V00A 2OKGA 1FDWA 3UQZA 5CYOA 2LGJA 4JJ6A 1FEZA 3K1ZA 1GZ4A 7AT1A 4RU1A 1XPJA 5DMXA 4IGFA 1G21A 3GFSA 1ADBA 2REOA 1N2EA 1QLHA 1Q1BA 3ZQ6A 1V9SA 4YDRA 1P4SA 3TXAA 1NXSA 1XZIA 3LX8A 5M3BA 3E9NA 4ARVA 2P7IA 2YQZA 5ECDA 3AEYA 4MV3A 3K70D 1WCWA 2IXFA 5F4ZA 3KJHA 3O82A 5C35A 4BVHA 2OCKA 1M2FA 4TMXA 1AUVA 2GKSA 3TNDA 2GJAA 5L3VA 4RORA 2JEOA 4WZZA 1J49A 4M83A 2Z8YM 3MG9A 3ZH2A 1YD7A 1ZYUA 4ZICA 5L45A 3OA2A 3R6GA 1L7OA 4XPIB 5CCXA 1K7EB 3WB1A 4FKZA 1ML3A 4X93A 5ER9A 2QN7A 2N1MA 1M2NA 1EEHA 3M6MD 4JUCA 2V0GA 3DLHA 1T9ZA 1MQ8B 2IEZA 3X1ZA 4R8MA 2LKDA 1WTAA 2N0SA 3GD7A