1N4DA

The ligand-free structure of e coli btuf, the periplasmic binding protein for vitamin b12
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
244
structure length
244
Chain Sequence
b'APRVITLSPANTELAFAAGITPVGVSSYSDYPPQAQKIEQVSTWQGMNLERIVALKPDLVIAWRGGNAERQVDQLASLGIKVMWVDATSIEQIANALRQLAPWSPQPDKAEQAAQSLLDQYAQLKAQYADKPKKRVFLQFGINPPFTSGKESIQNQVLEVCGGENIFKDSRVPWPQVSREQVLARSPQAIVITGGPDQIPKIKQYWGEQLKIPVIPLTSDWFERASPRIILAAQQLCNALSQVD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Vitamin B12 transport protein btuF
publication title Crystal Structures of the BtuF Periplasmic-binding Protein for Vitamin B12 Suggest a Functionally Important Reduction in Protein Mobility upon Ligand Binding
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transport protein
total genus 67
structure length 244
sequence length 244
chains with identical sequence B
ec nomenclature
pdb deposition date 2002-10-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01497 Peripla_BP_2 Periplasmic binding protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1980 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Nitrogenase molybdenum iron protein domain 1n4dA01
3.40.50.1980 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Nitrogenase molybdenum iron protein domain 1n4dA02
1L5HB 4OVKA 1M1YA 4BBPA 3R5TA 4IRMA 2M6KA 1G20A 3EIWA 1MIOB 2AFIB 3AEKB 1M1NB 1QH8B 2Q8PA 2R79A 2XQVA 3ZK9A 2AFHB 4NNOA 4TKUB 5BVHB 4FI3F 1FP4B 2O1EA 5KOHB 4WNAB 4WESB 4UDOA 4NNPA 3AEUB 2QI9F 2OSVA 2YNMC 3R5SA 1N4AA 2WI8A 4WZBA 4N01A 3BE6A 5KHLB 4INPA 5CR9A 3MWFA 4HMQA 4G07A 5CX1B 4WN9B 4UTPA 5BVGB 5KOJA 5AFSA 2XDQA 3EIXA 4WZAB 3BE5A 2AFHA 2OGWA 4TKUA 5HDQA 5HX7A 2XV1A 3ZK7A 5KOHA 3MFQA 1QH1A 3AESA 3U7QB 4LJSA 3AERB 1KARA 1TOAA 1M34B 1G21B 3MINB 4TKVB 2OV3A 2MINA 3AEQA 2M6LA 5B58T 1N2CA 3CX3A 3AETA 3HXPA 4HN9A 4ND8B 5FLYA 4WN9A 3G9QA 1KAEA 3PSAA 3LHSA 4MX8A 1L5HA 3HH8A 3NU1A 3MD9A 3TEFA 1H1LB 2OV1A 2PS3A 1QGUB 5JJ5A 4K3VA 4MDYA 1MIOA 2AFIA 3AEKA 1M1NA 1QH8A 3UJPA 3ZKAA 2XH8A 4XPIB 1K75A 4HMOA 5BVHA 1FP4A 1PSZA 4UTOA 4WNAA 4H0FA 3ZK8A 4WESA 2Q8QA 5GGYA 1M1YB 3AEUA 2YNMD 2WHYA 4G09A 1G20B 2PS0A 4INOA 4UDNA 4DBLE 1H1LA 4FKMA 2R7AA 2RG7A 1QGUA 5M34A 1XVLA 5CX1A 3PDIB 5BVGA 4OXRA 4WZAA 4MO9A 2XUZA 3ZTTA 4PAGA 4OXQA 4CL2A 5GGXA 4MLZA 1ESZA 4WZBB 2X4LA 2PRSA 1PQ4A 2XY4A 1EFDN 4M7OA 3U7QA 2PS9A 3AERA 5M3BA 3K1AB 5JG7A 4FILA 1M34A 1G21A 3MINA 4TKVA 4H59A 5JOQA 5JPDA 5KOJB 5M2QA 2XDQB 4PM4A 4GICA 4ND8A 3PDIA 3MWGA 3PSHA 1QH1B 3AESB 3GI1A 3HJTA 4HMPA 4LS3A 3TLKA 1N2ZA 3TNYA 4FNAA 5M29A 1K7SN 2ETVA 2MINB 3AEQB 1K2VN 1N2CB 3K1AA 1N4DA 3AETB 2PHZA 3LI2A 4XPIA 1KAHA 5I4KA 4B8YA 1K0FA
chains in the Genus database with same CATH superfamily
1JEOA 1OXBB 4OUDB 4PC1A 4YRRA 1QFMA 1IQRA 2GCEA 3C6KA 1A7JA 3I6BA 1F48A 1BDIA 3JASB 3ASYA 2B4RO 1F0PA 2Y1OA 4F2GA 3H1GA 2IHZA 1WU7A 3KTAA 3PB3A 3DWFA 5I8WA 4LGMA 4I81A 1GDDA 5DN9A 1YAJA 4KXNA 2W4IA 3TTYA 4MUNA 5AJYA 2PNJA 3AI3A 3ANYB 4UQOA 3RHTA 2BT4A 1F1BA 2RHWA 4W5OA 2P9QA 4G0ZA 1VBNA 1A96A 3TR0A 1UC9A 3E2MA 1F2DA 3R0IA 2I6UA 4UM5A 1P2DA 1FSZA 3AY6A 3EIXA 3K5HA 4MGZR 4TX1A 4CMGA 4CQMB 1VIAA 2QNRA 1Q1EA 3J81k 1A69A 1SC1A 3ZK7A 2ECPA 2GCNA 1FVOA 4JT8A 4M87A 5I8ZA 1KDRA 2J7PA 4I50F 1MXFA 3V4VB 1OWLA 5I3CA 2ADMA 3I0ZA 5IM4A 4U2CA 4RTPA 2DBRA 4LF9B 1OZGA 1GEGA 2V45A 1DAGA 1PD1A 1QUEA 3ZNOA 3D3NA 1IHXA 3E0QA 2PJZA 3OZBA 5MGBA 5AICA 2Z3VA 2NMVA 4AWAA 1M2FA 3G9QA 3PSAA 4Q1VA 1B93A 4F4IA 4NS4A 4CR6A 2W2OA 4FGZA 2ZM6B 3C8UA 1K5DA 3UJ9A 4WZ6A 1ZVQA 3F6EX 3HLKA 1ZXXA 2HLDD 3H9CA 3OJEA 4PPNA 1FVHA 4XUDA 2X1VA 5IC6A 4EJSB 1FF9A 2AW3A 2CXOA 2P5TB 3N7UA 5DNWA 3ZKAA 4R3NA 3KHKA 1DS6A 3O8BA 3U2QA 5FOQA 2LKCA 4B4VA 4J7XA 2UZ0A 2ZRHA 4O63O 5TV2A 3KSDO 1KEZA 1XNGA 1X7GA 1CUXA 3A1DA 4QU9A 4UU1A 3VX4A 3HXOA 4PWZA 1TL7C 1GFWA 2GJ9A 1UPFA 3LCRA 1JQKA 5DULA 4ASUD 1Y4ZA 4PW0A 3K32A 3QW2A 4I2NA 3RKRA 2WMNB 1FNNA 3PD0A 2EJTA 1XI2A 3CSDA 3RJMA 1DWPA 4EW6A 1Y6QA 3L7IA 4E5VA 1HT2E 2B5OA 3IA7A 1BXGB 3PEUA 3DAYA 5HCUA 1XLTA 2FN8A 3FDJA 3OETA 4M37A 5G0TA 4ZJPA 3VJMA 3FE2A 5FPQA 1JL3A 8ADHA 2XCOA 5MFZA 2CVPA 2QTAA 4P5EA 1SWWA 4BWVA 5ICCA 2QD1A 1WDMA 3JZDA 4ID9A 3AR4A 5H7XA 5ILQA 4ZI7B 4EAQA 5EHZA 1T6NA 1YZKA 3SIRA 3IKMB 2WSIA 4W99A 1GGJA 3ENWA 3GD7A 1KU6A 1WTCA 3JAWA 3N76A 4QLAA 4R71A 5L4SA 1J09A 1BO6A 3IBYA 2DBZA 4LOJA 4PM4A 4EY6A 4QUKA 3IUYA 4NEQA 3CJQA 4DLKA 2BYTA 2GBFA 2YBEA 4YJ2F 2UYGA 4C1NA 2MYTA 1XU7A 2CLSA 2HBRA 1VHDA 2WUDA 2F1HA 3KE9A 3PNPA 4JUAA 3T6KA 2HA6A 2PH7A 5DXFA 2BKXA 4PEVA 4XVCA 3HXQA 3SM3A 2OAEA 3EVAA 4K88A 2CBGA 5TPWB 4CT0A 1CRZA 3D8SA 2UZ1A 3FMIA 5KNBH 4X9XA 4RE5A 3V1KA 4DQDA 1GQSA 3M6FA 1HT3A 1M8GA 4QGGA 1I7LA 5B3AA 5I4KA 4UMFA 2WZDA 2V5UA 3M4JA 5FADA 1TQ2A 4RE6A 4TPKA 4R1OA 5BR7A 2JD2A 3NHJA 3QU5A 5EKTA 3L93A 1MABB 1T1RA 1EFPB 3A11A 1FXWA 3AG5A 1XEFA 4LJRA 3UT6A 4BXOB 3ESQA 3U16A 4RAOA 2H0QA 5KKAA 4ND6A 2YXDA 3WIOA 5KVVA 2LIPA 4Q19A 1XCMA 5CCDA 1TMYA 3PPXA 2VHWA 3CONA 2DH5A 5IPFA 3K1TA 2A0KA 2QN9A 4EEKA 4HUTA 2JIOA 4ARCA 5FA8A 1Y7HA 1IONA 4UARA 3OX4A 4V0NA 2PX2A 2ZPAA 2AJ8A 3W4JA 1K3UB 3LYHA 3TWOA 4FSDA 2XMSA 2R6DA 3MGKA 1QH1A 3MJSA 2GD0A 4V0ME 3A3KA 4M53A 3KKOA 1Z6QA 2BDTA 4LRYA 4ZYVA 1DQZA 4DV2B 3HDHA 3BK2A 3U7RA 4D5EA 2VP0A 2E1PA 4YWJA 1R0SA 4B6OA 3G0HA 3E9ZA 4RKFA 3WGQA 1FJGB 1R6BX 2YICA 4NDZA 4NOLA 3ELDA 1PJLA 4DIMA 1G8YA 2Q0SA 2VYVA 1E6KA 4LJ7A 2D7DA 1UAAA 3KYJB 3T5CA 2YINC 2QM3A 1RBMA 2CMDA 1EXDA 1YZUA 4W5WA 5KINB 1LSJA 3DTNA 3F1KA 1AV6A 2IDKA 1G8PA 1SBHA 2AN5A 2ATVA 4HDMA 3CTMA 1CUSA 1JLLA 3DDWA 4GBMA 9GPBA 2PL5A 3BF7A 4TS4A 1D2RA 1TU3A 3ISJA 4K2AA 1AK1A 4JFRA 3L1JA 3R7SA 1ZR4A 1AXEA 2NUTB 2HF9A 2X2PA 3ITKA 1M2JA 3K09A 3PP8A 5FFMA 3WZMA 4D8VA 4XVUA 3IUMA 2GBPA 2HZBA 1QG0A 3MMNA 4G09A 5EJ7A 4FOLA 2AR9A 4LRXA 3MFYA 1N2EA 1Q0HA 3COVA 2EV9A 3HJHA 3NBYC 4GX0A 3RYHB 4A7PA 4E22A 1S8NA 5EYPA 421PA 4KRGA 1G64A 2GK6A 1CUCA 1G8JA 1L4BA 2IYVA 2FEWB 3CNBA 3FFTA 3M5PA 4IIJA 2ZJ0A 2JI8A 3D3JA 1DO2A 3DOIA 3PQ4A 1FMCA 2AQKA 4YJ3A 3VPSA 5INTA 4AF7A 2P9GA 2NW6A 4R2LA 4F2HA 2QX8A 2BR4A 2Q46A 4MWGA 3SYMA 5AQEA 3IFSA 3O9VA 4GGPA 3VDNB 2HXYA 1K08A 1FUIA 1RYEA 1Y8AA 3AIIA 2J9FB 3GEGA 4YV0A 4P38A 3AB8A 4KXVA 5AVXA 1XXLA 5HYVA 1PSWA 2QLJA 3BD8A 3NT2A 4RXMA 4ZAZA 4W9NC 4PYNA 3MWGA 4PRZA 5JCOC 1SXHA 2HHAA 2O2JA 3C14C 4KTTE 5JO9A 1E1CA 4DMMA 2Y67A 3W2HA 1TM2A 3A4LA 1ZUD1 4AY2A 5LWQA 2PGLA 3DR5A 1UZNA 1WHTA 3FZQA 3IOMA 2GKSA 4PG4A 4CT4B 3QPWA 3IT3A 2C4WA 2VUSA 3ETNA 4Y2TA 5JAQA 3IIIA 5AH0A 2CNWA 5ALSA 4AU1A 2O1SA 2NGRA 2JGDB 2R86A 1ULSA 1IL0A 4C22A 4F4CA 4LQLA 4YGYA 4J7CA 4YUVA 3N6XA 4OHOA 4H0CA 1V71A 1W1IA 3BCRA 3FUUA 3BTOA 2QRVB 5F76A 5HRCA 3HKEA 1E4EA 1T2NA 2HWYA 3P2JA 5CAEA 3W8EA 1T2AA 2ZR7A 4Y2RA 2PBLA 3IBFA 1BMTA 2AQ8A 5F2KA 1CYEA 1WA5A 4PYIA 1P75A 1STOA 1LNQA 4XWYA 3UATA 5IBCA 5EMLA 3QP9A 1OFTA 1S7CA 3UN1A 4OJQA 2BELA 2IE8A 2QXYA 2BRUA 3KOMA 4M1KA 1BJKA 4QOHA 3SDSA 3FM9A 3MELA 3EIUA 4CDMA 2W6JD 2J6CA 2VH5R 1DT3A 3LIPA 3INGA 2W9XA 4J16A 3N58A 4J3JA 1FNBA 5C53B 1XDDA 2LBPA 4RZQA 4WK0B 5F35A 3ILHA 3WGNA 3CVOA 4YUYA 3QWBA 4JXXA 3IRUA 4YP0A 4RNCA 1NF8A 1DC7A 4YLYA 1SXJA 4AB1A 2EYQA 1K6EA 5LD2C 4PZZA 3OCUA 1I51A 2Q27A 1BXRA 3A4IA 3IGFA 1QCYA 2VNIA 5KQRA 4YAJA 1EVQA 2ZJ6A 4A8JB 1X19A 1P5RA 1VDZA 1KZ6A 4KQ1A 2WA1A 4NEGA 4OFZA 3ZWBA 4XD7A 3EEYA 4L78A 1DARA 5M5BA 2F90A 2ZZNA 3IP3A 3K72B 2BJWA 2JGFA 5IAOA 2G72A 1FRVA 1FCJA 1SJ9A 2PYDA 3LX8A 1LWNA 3PHBE 5BT8A 2WAYA 3S4YA 3QPUA 1E7MA 2IXFA 1SVLA 3IP7A 3DHWC 4CKCA 2GEJA 4V1CI 1PWYE 2RHLA 3AP2A 5E0OA 3RYCA 4YRBA 5T64A 3ASZA 1KTVA 2JKVA 2UZIR 3PXBA 4NPAA 1W36B 4UBJA 2A57A 3U49A 1M1NA 2COKA 4IDQA 2WW8A 1C50A 1D6NA 4BNDA 4EO7A 3T1TA 4W9RA 4FS3A 3KPJA 2AMLA 1NLYA 1QFZA 1ND5A 1YKFA 1CJKC 2E4UA 2A94A 2CMHA 2OLKA 2IHTA 1RJ9B 3FUWA 4JR2A 1G8FA 4KGDA 4Q34A 1JJ7A 3O0TA 3ZU2A 4Q7LA 2NADA 4XIJA 1DCFA 3KPYA 2HUNA 1KZ9A 3GOQA 4MPJA 1RD4A 2CY0A 1P2UA 3LAWA 3FNFA 3G0BA 3K94A 3LT2A 2CLFB 5FTKA 5FBVB 3KPVA 3K6KA 5FFNA 1SC3A 1V9LA 4PYMA 1OTHA 2EFHB 3DC2A 4J0HA 4LHWA 2O7QA 1E7QA 4TMVA 1H8ED 3LPNA 5L3SA 5K20A 3ZWXA 5KKNB 4FMCF 1DDOA 1KK0A 2GPJA 4YJDA 2PS9A 2FKAA 2PJDA 1LRKA 1ONPA 1TXGA 1ZXLA 3PV0A 1WR8A 4RXUA 1KKMA 1I3LA 1CV2A 3QEJA 1PQPA 1QE0A 3QSGA 5DX8A 1XKLA 3PNSA 3FPJA 5CT8A 4DA8A 2EW8A 1IE3A 3EZXA 3RUEA 3GJ0A 4G0PA 4GXTA 4NCIA 4HS4A 1XZKA 1UADA 2CJXA 1ACMA 2Y0DA 1RZUA 4M9CA 1V1RB 3DO8A 5FQNA 1OH7A 1FS4A 3DQPA 3S2GA 1H42A 4KXLA 4MQLA 4U2KA 1ZHHA 1Q20A 4GE0A 5I7HA 5ITVA 2FUG1 3K05A 3PGXA 4FUTA 4IM7A 2RBKA 4L6CA 5HFAA 1NMEA 4KQ9A 4YQEA 1QRAA 1JAHA 5ALQA 1MTZA 2VKQA 2OBNA 1S01A 5AOCA 2N1BA 1V4NA 1D07A 1FFDA 1H0RA 2VCHA 4IWXA 4FUQA 4B4WA 1U0GA 1UMBB 1X39A 4E2XA 1SCUB 4MPDA 3INTA 6REQB 1JLMA 2Q8PA 2DPHA 1GGHA 1RI4A 1JWAB 1S2DA 2YN4A 2MYUA 3DP9A 5EXDA 3DHEA 1QQTA 4PGMA 1E6EA 3GRPA 2D06A 3WI7A 4PO8A 3GZNA 3H75A 4GKKB 5HKAA 4ICIA 4HGOA 5LUBA 4FZ5A 4ZJUA 2I8LA 4GWGA 1C9DB 4U3JB 3WXMA 3ZWWA 1KVUA 5DM0A 3SHTA 2JLVA 3KX2A 1C80A 1T36A 1QIKA 2PL3A 4NICA 3HO1A 2BH9A 5DCYA 1W7AA 2H7CA 2D2IA 4HSGA 3FKSD 3R5KA 4WZAB 1HQKA 1XZHA 2D6FA 2O2HA 4HQLA 3ZJYA 1L4HA 2OILA 1GT6A 2JAOA 3BKWA 3ORSA 3NALA 3UJDA 4WHMA 2UZ4A 4NVRA 3TO5A 4B3GA 2IP1A 2CYCA 1GQQA 5DE3A 4AJ1A 4KWCA 2P3SA 3M4XA 5H3HA 3EWIA 4JC8A 1T0UA 1XUOA 2VO1A 3ROEA 1W5EA 1C41A 2Z5VA 5K05A 4HAOA 4CTOA 1UEXC 3IQHX 1E79A 3I5XA 1CETA 1UT6A 1FU8A 2QX9A 3E9DA 1UC4B 1MAHA 1XL1A 3PFIA 4RHEA 2IGBA 2XMBA 5G0WA 4Y2XA 1NV8A 3E9CA 2QAGB 1ARZA 4V0KA 1PR4A 2IE0A 3U40A 4EQ6B 3E5NA 4FBLA 3WSVA 1VDMA 3HYTA 2QTZA 1ZWKA 4BVHA 3NBKA 2GN9A 3I62A 2LTAA 2WTMA 8OHMA 4MQ6A 3AU9A 1R00A 1XELA 3LUFA 2PKXA 3LYUA 1VG9B 3VNBA 3LFTA 2R1TA 4LSGA 1WF6A 3QFRA 4URYR 3RIYA 1J49A 1GZ3A 1Y1KE 4IVNA 4JUFA 4R68A 3ROKA 3RRYA 5D6NA 8LDHA 4IUCS 5HQ3A 1M5RA 3C97A 1JG3A 3BSWA 1F8FA 4PNHA 2I91A 4RH1A 1L7NA 3DA8A 3QU9A 4OQZA 1EFVB 1I4LD 1RSZA 4DXHA 5LSAA 4M8IA 1L9KA 4OB6A 2IODA 3DFUA 1GFIA 1E3SA 1UQTA 1DJPA 2Y77A 1S96A 1I1OA 2GCPA 3K1AB 3OJOA 1ISSA 4UPDA 2FFAA 2B8EA 5G02A 4E88A 4I46A 4AO6A 1ISFA 1YZQA 3NC1C 4MP3A 5DYNA 1Z74A 2PSEA 4L02A 4X62B 2EJVA 4CIWA 4G8JA 2A6PA 2I4IA 4B2PA 2O8FB 3FDFA 4ZALA 4C14A 2WSLA 2GZMA 2YVQA 2VAMA 1UJCA 4KXYA 1NBWB 2XB2A 1R7RA 3VOSA 4HJXA 4GKAA 1R37A 4D7AA 3JQEA 1WCYA 4M38A 1WZIA 1YFJA 2YHUA 5BYBA 4YA6A 1E64A 1N3BA 1ZVKA 2W98A 3AJDA 3QELA 4WCFA 1COWA 5CNMA 2QX4A 2W48A 3OQ1A 5K0FA 3JYPA 2VRCA 3IE1A 1RVV1 1VG0B 1AF4A 2XYPA 4FFVA 1AXRA 4MPTA 1RMYA 4Y0NA 1DC4A 3L8CA 3OKFA 3BF8A 4NENB 5JH7F 4B2LA 5CCBA 3ELUA 3W6UA 1FUUA 5D01A 2X8WA 2VSNA 3QRWA 4N48A 2HU7A 2GEBA 3TTWA 3A1EA 1T9HA 4WK6A 4J49A 3HKCA 3MRSA 2RC5A 4L9RA 2HK6A 3BCHA 2I7DA 2P62A 1PTKA 4W5TA 2YNMC 4FD2A 2LCIA 4OLFA 2QRJA 4DIEA 4EYKA 1U3VA 1B8VA 1E0DA 1GQYA 3KETA 2HV9A 4KUHA 3SSOA 3ZW7A 3FJ1A 3G2KA 3GBPA 1GTVA 1CQJA 1IEVA 1U94A 1H0SA 2GR9A 4ZI5A 4ZMRA 5LYJB 4FGUA 3S0JA 3I30X 3DT8A 3NKLA 2NUBA 5FO1A 4CF6A 3CN7A 3IYLW 1XVVA 3QVXA 4QUAA 2E3JA 3PL5A 3AOEC 3EGVA 4XOUA 1HMYA 3EGWA 4MQEA 4NQRA 3MJTA 4AWXA 1Y48E 3TTSA 1IU9A 1LBTA 1ZN8A 2GAJA 4JB8A 1TOAA 1V6SA 3HUTA 3N5KA 1MHTA 2ZGVA 4NG4A 5T4FA 4A82A 4PSCA 2FPPB 4UBMA 1E0JA 1S2LA 4BNZA 4DPKA 1TCAA 1NBIA 2HIMA 4TV9F 4FFWA 1X1QA 1VPWA 3OICA 3D3EA 1KAEA 1II0A 3T5TA 5C1OA 4E5UA 2XMCA 2IYLD 2WOOA 2FW8A 1D5CA 2Y1DA 2BJHA 3O1IC 5AW5A 2WJWA 4O2RA 5F5XA 2XUGA 3NIDB 1JSXA 5CM2Z 1E1RD 5HKOA 2AJTA 2XB9A 2J9GA 5FI0B 2P2DA 2BE9A 3IA2A 1PT9A 3N8NA 4GDMA 1ZONA 3CRNA 4B48A 4UAUA 1SA0B 4MAFA 4W82A 1IJEA 1IXRC 1MJGM 1XD2B 3TL6A 4JQCA 1Y1QA 1QF7A 1LTHR 2MSCB 4RLSA 3S70A 1BQEA 3FTEA 1JKMA 2YV5A 3H5IA 1L5MA 1JE1A 3TMYA 3HBAA 1R4NB 1NPDA 4I99A 4J0IA 4JNCA 4UZSA 2BMAA 5FAXA 2ATXA 2QPOA 2CYBA 1JKFA 1G3IA 1UM9B 1WPQA 4OL9A 4Q3LA 1KIFA 2QDXA 1H5QA 1VYTA 3AJ8A 4JI8B 2QPAA 2VS1A 1RLIA 5E3IA 3AR5A 3Q3JB 4FYIA 1L1RA 2RHJA 3HCRA 3K35A 4NCXA 1QOPB 4P8RA 3SG0A 4PLYA 4AVYA 4QT4A 1WSBA 4F1KA 1CUFA 4WERA 2NN3C 3NDIA 1B16A 3KQYA 3LDAA 4TYYA 4CQMD 1D5WA 2DR2A 2PAAA 1KDVA 4D9KA 3R44A 1XNRB 1Q14A 2O54A 2ZG6A 3IEKA 4PC3A 2JLRA 2B20A 1F9EA 1W93A 4LX0A 1C7EA 2IOFK 2HV8A 3AESB 4RIGA 4YNBA 4DQ0A 3FRIA 1DRKA 2VJPA 1Y80A 3FPAA 4X1IB 4X1YB 1TAUA 5ALRA 2D0PB 4BNNA 3OFNA 1HOXA 4F6RB 1ECLA 2Z9BA 2IBMA 3I9NA 4F7WA 3I04M 2AEMA 4PX2A 5BWCA 3RWOA 4R1SA 4WWHA 1P33A 5CJPA 1NBAA 2VQFB 1T2FA 3IIKA 3P45A 2ZE6A 3QF4A 7REQB 2XYRA 2M6KA 5IEJA 3BGWA 3OO0A 5HRAA 2OZEA 2Y92A 5JYDA 4OP3A 4G1MB 1C9JA 4CT5A 5KB3A 1GVHA 2JJ1D 4RZIA 1PFQA 1FBNA 1M6VB 5CHEA 4C7VA 5AVYA 2FPGA 4FQ7A 4YYEA 2IXAA 3AUAA 4D8UA 4UBNA 5ESDA 4ENVA 3NVMB 4TYWA 2I2XB 3AR7A 2EFJA 5E1OA 2PKQO 4F11A 4KQKA 1TRHA 4BAUA 2AN9A 5GONA 4NBVA 1RWXA 4BB6A 3QK7A 3V4RA 4N01A 1ATIA 3BERA 3N2YA 4N5DA 5AYVA 4F0JA 1R6XA 4RK5A 3DLBA 2IHBA 3QE9Y 4XGIA 2VCEA 3FR8A 2Y9PB 1A7AA 1HA3A 3SFTA 4EITA 1ELOA 1UMDB 2XI4A 1ZU4A 2I2AA 4LJKA 4JC0A 1Y3BE 3NEYA 3UAOA 5LD2B 1FNMA 4IHAA 4N1AA 1B76A 2Q41A 3JQQA 3G0OA 1PJ2A 3OLVA 1DHTA 1YCHA 3JQ8B 4KC0A 4LE0A 4GL4A 4MYDA 3ROPA 5A2GA 3CNOA 3DKRA 1OLOA 2J3KA 1Q3TA 4RF5A 3AETA 3EFBA 5BYJA 4CMCA 3FZNA 1KSGA 2ZTLA 4PX9A 5KYNA 2FPKA 3SY8A 4MX8A 1OLUA 4TTRA 3QXJA 1UR5A 4OP1A 1FFWA 1GSAA 2J41A 4C0SA 2VYNA 2QE7A 1ISRA 4AO8A 4JKOA 1AG9A 2P4QA 3T7EA 1IXZA 4P92A 2BSQA 3V32A 5FUYA 3ZHTA 5A04A 2FKNA 1LDBA 1QDUA 3IIEA 5F77A 3AZQA 5JSKA 4FFBA 3TI9A 1MV8A 4WE3A 2ZKIA 4P7KA 5KTSA 4HFRA 5CBPB 4D56A 1KSFX 5TPZD 3UB3A 4P81A 1X14A 3TCNA 2A59A 2FR1A 4MNTA 3TLGA 2R44A 4C2TA 3RRXA 2ORYA 4ZXFA 3VPBA 5IC4A 4D26A 1TT5B 2ZJ4A 3T3HA 3BWBA 3U37A 1HDXA 3K1YA 5H0IA 1IATA 2ZUTA 1HSOA 1WUKS 4QDKA 2OQIA 1N2GA 3BMQA 1XWIA 4WZAE 3RYFA 2YDXA 2YMPA 4BP9A 1WF3A 3AR2A 3M6XA 4HAUA 5CRIA 2C5FA 2XTZA 3X1KA 2CYAA 1SD5A 4AS3A 2WB4A 1FFXA 1OXTA 3ILYA 5HF6A 5LBUA 4L7QA 2D5CA 1KQ3A 4WW0A 1HR0B 1XAGA 4TTPA 4CMHA 1SCNE 3HACA 4LFCB 4Q48A 5B2EA 3AR8A 1PK7A 2AR7A 1EBFA 3WGTA 1RXVA 3IMKA 5AJVB 5E2IA 3CB4A 1IK6A 3B51X 3LDHA 2C4NA 2MMCA 4KLAA 5ALMA 2NYRA 4FZRA 1JH8A 4NE2A 3C45A 3SQWA 4YP5A 3UXMA 2ZWMA 4HGZA 3WRVA 4HDSB 1YU9A 1HG0A 1X8JA 1J8QA 1K97A 1XYVA 1BW9A 4Q66C 3A4VA 5E7JA 1OROA 3GLKA 3TLEA 3WISA 1DIBA 4R81A 1NBOA 1KTIA 4V0SA 3HYLA 3L79A 4WLNA 1D6MA 1CZKA 5ALDA 3BJIC 4XFDA 5FUWA 3P9YA 4OU5A 2OY0A 3RAEC 2O07A 1BCRA 1US8B 4EEZA 3L1HA 5LMZA 1ZOLA 2R00C 3LRXA 2H4YA 2IIBA 4LXUA 2QKYA 2UZAA 2WPDD 2R6CA 3K30A 1DJOA 3ZZUA 3QBJA 3RS7A 4QD3A 5C8DA 3CRMA 4GWLA 4NNOA 1KEEB 4MLPA 5LOVB 1W0JD 1PFGA 1N7IA 3QVKA 3F5MA 5KSWB 3SQOA 3KQKA 3AKYA 3I3OA 1DWQA 4P22A 3BXZA 4C29A 2R47A 3REQA 4CV2A 3ZHXA 1T3SA 3ILSA 1N4AA 3HXTA 2ZEJA 3NNDA 3UOAB 1LS1A 4O4LB 1E2NA 4EHFA 2RKOA 1EDDA 1PZGA 1VCOA 1QGDA 1B8OA 1Y3HA 3HBJA 3SSAA 1PZHA 1UKYA 3MS7A 4L0QA 3GLUA 4BGDA 1PJ3A 1PGQA 3IXMA 2YOHA 3QOWA 2PN1A 1G5QA 3QFHA 2V7VA 3AUUA 4W7IA 4YP1A 5F52A 5JD3A 2ZR9A 2YQZA 3MSCA 4BQSA 3CVUA 3FYCA 3BS4A 2VJQA 3AYZB 2XXAB 3KOOA 4DEVA 3K70C 3C43A 3L3BA 5JSUA 1G3RA 1E3WA 2VK2A 3ZJTA 4LJSA 1RHRA 1KP9A 5E8RA 2H2GA 1WB9A 5BV7A 3GP3A 2MYNA 1L7AA 2C78A 4KNVA 2CDNA 1RWQA 5I7AA 3MT7A 1Z82A 3S7TA 1ZRMA 4LECA 4U7GA 5TS3A 3KKPA 2PYIA 5K3BA 1QVRA 3V4LA 3V9AA 4C4SA 3E5RA 3T52A 4G25A 3EDOA 3KZCA 4WOCA 5DGCA 3VSCA 4BGUA 4DADA 2BFDB 1NN3A 4P3OA 5JZSA 3UBMA 2JHGA 4U7TB 1SUEA 4BX9A 3THRA 4KN6A 5KMGB 4LG1A 4F71A 1TIKA 1D8AA 4B31A 3UH1A 1OPRA 3L05A 4G89A 2TS1A 4Z4QA 2ZQZA 2V3VA 3ADOA 1JYEA 3EXAA 3G3EA 3A6LA 5TEVA 2X9VA 1I0ZA 2NVOA 3OIDA 4X8LA 3JAKB 4ER0A 3I8XA 2HCFA 3G5LA 1P0IA 3CH6A 2NNWB 4YUWA 2LDXA 4NBUA 2V6FA 1XEXB 3Q2KA 2DSNA 3TMAA 2E82A 5HJEA 4MA5A 5ICGA 5AVRA 1R3DA 4WNYA 2G6TA 4BN5A 1XRPA 4C03A 5EN4A 1ZN9A 3BRSA 3R0ZA 3HSKA 2V3WA 4PZEA 3PT9A 1ZIOA 4GZLA 4DB2A 5C4GB 1CY7A 3V8RA 1JSRA 3KYIB 4PWYA 3UC9A 5JG7A 2L19A 1U81A 3F98A 2BTOA 2ZYIA 3NM4A 4MA0A 1RU3A 3RVBA 2JCYA 3EC2A 4ZI3A 1JEYA 3VH1A 4MSUA 3NAMA 3QUCA 3C8MA 3AEXA 4CN9A 4KBYA 2VT7A 1Z4OA 3EF0A 4DG5A 2VZ0A 1I7PA 4LS3A 4LZPA 5IHPA 1C1XB 1NQWA 2WWRA 5AJWA 2FWAA 3IBGA 4E1VA 4A2QA 2RGWA 5FWYA 4Y3UA 1DX6A 1VHJA 1GPDG 2A9FA 4IO0A 4TV8A 5K1ZA 2BFBA 1Y8QB 5JFOA 1CEQA 2R60A 3Q5EA 5A9SA 1CR4A 4O4JB 1H2XA 4INJA 1SVUA 2GEVA 1DTEA 1ZQ1A 2ONZA 4K9DA 3C39A 5B7QA 2QRKA 1DIHA 1OTYA 3IUJA 2REQA 2IBSA 1L8XA 2Q1XA 4FXOA 4HADA 5EMHA 5EJAA 4ZC1A 4EJ6A 5UKDA 1W36D 1V6AA 1XMPA 3VR4D 3MB8A 1LLUA 3ZGLA 3JD3A 4CIXA 3AF2A 4YJKA 4PXYA 1MZVA 4RV4A 1ZGJA 4M86A 3EGDA 3U31A 1BVYF 2NO1A 4QUBA 3T7SA 3DFKA 5DLEA 4AP9A 5KTMA 4M1SA 3B8HA 2OBBA 2Z08A 2FWPA 3A3NA 3OO1A 4DG9A 1V8DA 1PYGA 2LV8A 2BFFB 2Q6LA 3N8GA 4WKGA 3FVWA 4U6SA 4ZGGA 2R8YA 5J5VA 3WHPA 5IU6A 2XGOA 4ARZA 1CUIA 3DULA 3IDFA 2D2FA 3GG9A 3L2OB 3SBXA 3F2IA 1M1ZA 1GZSA 1ZOOA 2ZANA 2OT3B 1LU9A 2VDJA 4B87A 1EBBA 1O7JA 2OXCA 1TLFA 4IUYA 1MLDA 4IOLA 4KWTA 1XZFA 1H9BA 3HWSA 1NGSA 2EJUA 2I3BA 2QVXX 2XADA 4ZOLA 4EW3A 4GFDA 4NZYA 5EVCA 1NLMA 2E89A 4WN9A 4C05A 3CR7A 1YQTA 4YMWA 4F5YA 3RF6A 3PJGA 2COEA 5L3QB 1IQPA 3ND8A 3PBKA 1NQUA 4EYQA 2XQFA 3H8WA 4B40A 3AVOA 2CXRA 1AK2A 4I6EA 3N74A 4P3NA 5JJ5A 3OOEA 5LZ2A 2HBQA 2FUCA 4IMIB 1G2IA 3QKIA 4Y2PA 4CIAA 1S1CA 4S1VA 2OC4A 3R3XA 3SVZA 1XZQA 3JD2A 1VKRA 1X6VA 3DYIA 3ND5A 4CEJB 5THQA 2DR3A 1MG0A 1V1MA 1B8NA 1PR2A 3KFVA 1T5SA 3F6YA 4DBLE 4NOJA 1GKLA 3FOBA 5F1YA 5BN1A 2QRLA 3MYRA 3ZNPA 1ZBQA 1N2IA 5BRAA 1D4AA 4N5IX 5AXAA 3FRJA 4XYMA 1YWGO 3PLRA 4YUXA 4OSOA 3DFZA 3PGA1 1QZZA 1A71A 2RI0A 1C30A 4RHCA 3ZUGA 2CHFA 2CL6X 3NOXA 5JRDS 1MJNA 3VU1A 1JHRA 4AY5A 4Z2AA 5EJEA 1KJIA 5TARA 4KODA 4X8OA 4HWOA 1YOVB 3WC4A 2XEDA 3C7DB 3SOPA 2FFJA 5TIIA 1II8A 4GPTA 3V55A 4C9BA 2JFNA 1NN0A 2PEYA 1TYEB 3HRKA 1A9OA 5AT1A 3ERCA 1BCSA 1K92A 1H22A 3IMEA 1W581 4RMHA 5KX5B 2RK6A 1XU9A 3MWKA 4FNAA 3TL2A 2F7SA 5JTTA 2B35A 2VAVA 1UFOA 4DL9A 1QK4A 2WVGA 4L27A 4LC9A 3KAKA 4Q3CA 3IAFA 3G6WA 4CM9D 1M2GA 1E4VA 1RAFA 1R66A 2DE0X 3CEMA 3EAQA 3JQCA 2C83A 1E0KA 3BSSA 3L7OA 4F12A 5K7SA 1C0PA 3AI7A 5F3RA 4BBPA 4V3CA 2PUVA 2VH1A 4LQ4A 4ZKEA 3OTWA 4HWSA 4LWPA 4MDHA 3VRHA 5L9AA 3JAMA 1O97C 1ZO8A 3PFCA 3SC2A 3WYGA 4ACBA 1J23A 4BWFB 3JARB 3WBFA 4OJYA 1XQ9A 3V8BA 3RLIA 2ERYA 4M1TA 2JJMA 4F8EA 5JS6A 1NNSA 1EKXA 2YVLA 2UYQA 4IXWA 4LQCA 2OKGA 3GXBA 5I01A 4BVKA 2W6QA 1COZA 4P0TA 3HUEA 4DIFA 3KYCB 1N1EA 2X5OA 1AA9A 1KY2A 2NLOA 3KQTA 3PQCA 4GRDA 4ND4A 1GUFA 1ORHA 3GVIA 1FQJA 3HJBA 3A7DA 2ATEA 3M9XA 4JUIA 1YS6A 4L6IA 2PD6A 1OVGA 1Z5VA 3AU8A 2PTHA 3BMOB 3GPBA 4HDQB 4IYJA 4TKUA 5BV0A 3FAZA 2C7PA 1C81A 5CVCA 4BX0A 5CA1B 3AILA 5E4JA 4S2EA 3H5NA 4DLYA 3MXOA 1X1BA 5FUBA 3RUFA 1KBZA 4WMLA 5TGDA 2BD0A 1BEUB 4BLUA 1SIUA 4OYHA 5CEJA 3LF2A 1JSLA 2FEPA 2BAGA 2ZWPA 3P0RA 4MH0R 2HT1A 1JDBB 3RC3A 4X20B 3E15A 3GJRA 1JR3E 2BKUA 2G28A 2IYQA 3GJSA 4UVEA 4G5SA 4CEHB 1UFRA 2Z1DA 1ZS9A 3HUDA 2P8SA 3BILA 2AHRA 3CO0S 5H3LA 4OX9B 3GCDA 4NYMQ 3RS2A 5KNBD 5HIAA 4DDWA 2D1SA 2PLRA 2VL7A 3ICQB 2JCSA 4L0CA 4ZI7F 5BWNA 1E66A 1FSFA 3TF5A 1E1QD 1EVJA 1UKVY 1L7RA 1VXRA 1R4ZA 2R5WA 2BM9A 4CCSA 5B3JA 1GYRA 1RT9A 1WAMA 1PT8A 2IOQA 4X95A 5K6AA 2Z8XA 1LI5A 4LI3X 2FG7C 1CTQA 4PZPA 3CTPA 3DL4A 1RZRA 2I2WA 3K5PA 5EPEA 1C0KA 4BX2A 1QTQA 1WLYA 2HRCA 4LZOA 4LBWA 3H2JA 1WBDA 2IYAA 5DHTA 2AYXA 1ORWA 2CVFA 2C04A 3KTAB 3LECA 3VO9A 4YPFA 2RJNA 1MOZA 3R3JA 1YBFA 1M9NA 3R0QA 3BBLA 4TYPA 2QQ5A 5J1SB 2SHKA 4LJ5A 4Z5XA 5AXCA 1DZ3A 2NSHA 3AB7A 4CKXA 1RLUA 3FSJX 2BFPA 3H5LA 4ZZ3A 5JISA 5JBIA 4WLFA 4OP2A 4HH3C 2BHLA 1HKUA 1CX9B 3CKYA 1WX1A 4BZWA 2KX7A 3MHTA 4PSVA 1Y4AE 2PGIA 3GN1A 4WH0A 2VSQA 3AVTA 3DMFA 4Z0TA 4HAXA 4TYMA 1GNRA 4I6GA 4LOIA 3I8OA 2BZ1A 2SNIE 4XQGA 4YMVA 3U6BA 1N92A 4URZR 4JHXA 3EXEA 3GNSA 2ATCA 4HQOA 4KB5A 5D00A 2PUAA 4WLUA 3ES9A 4BL5A 3CZPA 2WTUA 2GH1A 4BOYA 1H9CA 4DA7A 3NJ8A 2GZRA 3KQOA 3ID6C 3JZIA 3DE7X 5CIQA 3R09A 5DIZA 5C7OO 2HSZA 3CVXA 3COPA 3U44B 1PW5A 2CVZA 1KC3A 4PZLA 1DCTA 1EI9A 5TF4A 3TQQA 2P9ZA 3EGEA 2DSTA 3MRXA 4DHEA 1MC5A 2BBOA 1EA5A 1ZGCA 4R2IA 2OAP1 4AP5A 2V59A 3NS7A 1F14A 1SBCA 2F3QA 2WAAA 4CDRA 5BN4A 1Q0PA 1TVKA 3W2IA 2Y0PA 2FCRA 1UBEA 1Z0DA 4TOIA 2R6JA 2GWRA 3P0IA 1OAOA 621PA 4TMWA 2L2QA 1KEUA 4JZYA 2PMWB 2R6AA 1RTTA 4TQ9A 3AM3A 4WJKB 5DI9A 1J00A 3A1WA 3KKEA 1M73E 1ZW6A 3DBIA 4FGSA 3VYTB 3Q7SA 1CDOA 1Y5NA 4KFRA 4L76A 3H1AA 2AI3A 2QGFA 3I2FA 4R40A 4PIPA 1Z36A 1H6DA 3VHRA 5IAAA 2QB5A 2XTAA 2Q5FA 3QLVC 4JN6B 3UJHA 3NTXA 2A0FA 2K87A 2R5FA 2WT4A 3AMVA 3H2KA 4LY9A 4ZYUA 1QYWA 5CT4A 2EL7A 1XZBA 3RK4A 1U90A 3UMRA 4DMUB 1EFRD 1VP3A 3DW1X 2J3LA 2P2YA 4NZNA 3RFCA 3JAWB 2PEZA 4N7BA 4K9OA 5EMJA 3A32A 1GT91 2AJBA 1OASA 2OXFA 3GZ4A 1V41E 4KFTA 5AUQA 3VPDA 1P39A 1KS9A 3ZG6A 5ALGA 2GEUA 4EI9A 3C5VA 4ML3A 4C0WA 3IULA 4BNYA 4BX3A 2H4JA 2E1RA 3DB1A 2VT6A 1KZ7B 3Q6NA 4F85A 2O7SA 4MVJG 1V8BA 1K06A 2DOKA 1SOMA 2UZ1B 3KXPA 4QJ5A 1T9GS 2WU8A 4OOFA 1EZ1A 1JHAA 1RAGA 1XROA 3ZV5A 1JLRA 3RDPA 4CIDA 3NOVA 4Y9DA 4DYHA 3QNWA 4ARSA 2CMFA 4KKVA 3AEUA 3L0IB 3NHPA 4D97A 1IZ9A 4JOBA 4KQMA 4LYYA 4IZHA 4JASB 4HTFA 5AK5A 1LBSA 2NVWA 1Q77A 1CUWA 1ORVA 1TJPB 2FPXA 2O3JA 3IHKA 5FEMA 5TQJA 3ZEIA 2A78A 3IOBA 4G5FA 4AT1A 2P9TA 3HCPA 3HYRA 2W6NA 3F0TA 4QYTA 3EXFA 1C1DA 2QSUA 1R0ZA 4HDNA 1U80A 3CW9A 3FI0A 3L0PA 1IIRA 3DCIA 3DMDA 3Q40A 3UENA 4CGYA 1HE2A 1Z7BA 4KJXA 2NTVA 5B36A 1AZLA 1VCMA 1X1DA 2DPXA 3B2NA 4RHUA 4C6TA 5DM70 3MMXA 3PXAA 3SBOA 2VP6A 4HBZA 3JPYA 2W70A 1ZD2P 1ND6A 2CNKA 1FJHA 1WY7A 1P7YA 1VM6A 2J9XB 4ZQCB 2FEOA 2O2GA 3JTEA 1M74A 3SMQA 2DBVO 3TUIC 1CUAA 3PDIA 3KWLA 1QH1B 1YI8A 3M1YA 5E2AA 4M0EA 4PPYA 4CHGA 1LDEA 4GH5A 3LP8A 4J94A 5DV9A 3WYAA 4F06A 3G0IA 4QA9A 3AV0B 2V5AA 4DPLA 3MJ4A 4HPJB 4C01A 4CTNA 2FW7A 1O95D 5B1HA 1YCGA 3ZVLA 3LC2O 1SKYB 2PUDA 2GLUA 3F47A 2F17A 2ZYDA 4DYVA 1P4SA 1K68A 2AG1A 2VPZA 4KLRA 4KLNA 2FF5A 1RWKA 3I2JA 3LI2A 3LQ4A 3OIWA 4U5XA 4N8DA 4Z0PA 1UKCA 3LUHA 5EZ5A 2FR8C 3TOSA 4BKOA 5HWSA 1P0QA 3FCUB 4EUNA 4IW3B 2H9AA 2X1LA 4BZPA 2F3TA 4RC9A 4ENTA 1L4GA 5I4BA 4QNMA 2CB9A 3ER6A 3EQ9A 4HDMB 2VXYA 4KH0A 2WJVA 3MUEA 3NEPX 3GLIA 2Q3MA 2YJ5A 1NUSA 3VR3D 1UWVA 2OORC 2P27A 2XVYA 4NPHA 4QYSA 3HDYA 4UEQA 4H1WA 5CB4A 4OSEA 4DSNA 3TJZA 3Q11A 1GCIA 5H83A 1PS0A 3R7WA 3DWEX 2EWWA 3VTAA 3D81A 1DTSA 5DGIA 5HBGA 1NVKA 4YAEA 4F9GA 4F92B 3K92A 3RJ9A 3IPXA 3I6YA 4S35A 2UUOA 3O93A 5EYPB 4NEHB 2XZDA 3FWNA 4IIJB 2YTZA 3K6RA 4JJ7A 2V6BA 1XTRA 4YJ3B 4UDYX 1ZISA 1DBRA 4FFLA 5C34B 1MW8X 1J5PA 1TM5E 3MFQA 2VF2A 5E1MA 1G1MA 2PX4A 3ZNQA 3OZVA 2II6A 3NT4A 2G6BA 2CBXA 2DQKA 4YR7A 4QREA 1CJSA 2BPOA 2NAPA 2NV2B 2NOAA 3DC7A 3JQPA 3LKDA 3QKSA 1CZRA 4QFDA 3PR1A 1X1TA 4Z7JA 4IHKA 4YC7A 3THSA 4XWWA 1T3GA 2X42A 3QLUC 3C7CB 2GXSA 2PXAA 1P2SA 4Y2YA 1BRMA 3OPQA 2OA0A 1NT2A 5K03A 2NUPA 1E1CB 5DTRA 1KOGA 1KJ8A 2OYCA 4C21A 4D3XA 1WHTB 5KNCA 2B34A 1WD5A 1UK7A 3L01A 5I3ZA 1R0YA 3GA5A 2IPMA 3EHDA 1K75A 3MS4A 3IBCA 3TD6A 2FFHA 2RGXA 1VG1A 2DEUA 5GIPE 1YS1X 1Y3CE 2WC1A 4AMVA 1Y8CA 4JVLA 1K6MA 1QHNA 1T4MA 5C0OE 1E4EB 4FGJA 2XE4A 5CAEB 3VVLA 3HFGA 1FLVA 3EGCA 3ASVA 5CYGA 1ZK3A 3TPFA 4NONA 5LQNA 4OGKA 2O6LA 5AHWA 5EESA 4UE6A 3NM5A 1DLJA 4LOLA 3U6KA 4Z1MD 4B6RA 2FX2A 1EUDA 2JIZA 3AHCA 4MB0A 4NULA 1ADCA 1BU8A 4IVQA 4DDUA 4MTLA 1N5DA 1Z38A 3KJXA 3UUFA 2F1KA 1QJCA 3L7AA 2QTGA 1YHYA 1ZC3A 2HC9A 1Z4NA 3HN6A 3R6TA 1LPMA 1J0DA 3B5EA 1V3VA 1Q22A 4F6CA 1BX3A 1GL6A 2W22A 5EE5B 2J33A 1N9ZA 4PQRA 1SQGA 4J0FA 4G1EB 4ATNA 3KSAC 3E9NA 3CF4A 2FQQA 1M7GA 1PF7E 1DQYA 4GKVA 4MR7A 3UT0A 5A5DA 3NANA 1Z3CA 3B60A 5IT0A 1EK0A 1QP7A 3PUZA 1JZSA 3LPDA 2WHRA 3PDJA 1DBWA 1JIUA 1OREA 2YHBA 4BO0A 1N7JA 3BL5A 2ZQYA 3ILXA 1GRCA 1ZUNA 2PNFA 3K2EA 5DRTA 5DRYA 3W79A 1X70A 4CKCB 3L8YA 4MCAA 3RYCB 3HI6A 5LQKA 1P1KA 3RYIA 1FC0A 1P9WA 2DPLA 3HB1A 4K28A 5ER6A 1M1NB 3IQEA 4MPRA 5H16A 4BNDB 4NZ9A 2ON6A 1X8KA 2IEAA 3F67A 3K0KA 4M9SA 4BLQA 2B8TA 2HFKA 1I6MA 3NYQA 1M7BA 4DQLA 3R5HA 4KZKA 2OVBA 2C3UA 2UV8A 3B3FA 3AL0C 1USKA 1T9AA 1NKSA 5C1BA 2A9VA 2Z58A 5EG5A 2PGAA 1N7HA 2SECE 2H2IA 3D7KA 4TLDA 4ZAGA 3U3KA 3UG6A 3NWBA 4R8SA 3NHWA 3UUEA 1P2FA 3HK2A 2NUAA 2VPPA 4P4LA 4L9SA 5L7YA 1K6JA 3CH5A 1P72A 2O7RA 1GTZA 1SAYA 3OUTA 3X2SA 5ILOA 3THYA 2H1HA 2ZVPX 5BV1A 1TJ5A 4OK5A 1DG3A 3B36A 2BUCA 1FLNA 4CJXA 5L3SB 4UAGA 2JZNA 2CCKA 2CSUA 4XJVA 4E5SA 2JS7A 4JBLA 1ZCBA 4POAA 1ETHA 1X86B 4V2IA 5AUPB 1JILA 2WU3A 5EWMA 5FPYA 1ZVVA 1P31A 1XZJA 5G0UA 2D1QA 2QNIA 3ONVA 1P62B 1NN5A 2VTEA 1NW3A 4JYCA 5GAJA 1XHFA 2QUBA 4JQYA 1EAMA 4EY4A 1RKQA 1WHSA 2EIXA 3AHHA 2BEUA 3K1ZA 2OG1A 1EB9A 1B6SA 1NC1A 2F43A 1PL6A 2JAWA 3A8TA 3D5TA 4MKXA 1R12A 3RV3A 3AI1A 3GJTA 4KYIB 3WLTA 4QGSA 2IW1A 2C9YA 1UBCA 2R6FA 4PYJA 1PBNA 5EZ6B 4FX5A 4RENA 3GD5A 4Y2QA 5LQJA 4LZNA 3R24A 2HSDA 3AY7A 3VR0A 3WJ1A 4EM6A 3RCBA 3EDYA 3UAZA 3WK4A 4HGRA 5F2EA 3TCXB 1ZPDA 2FPSA 3L7MA 1ZL2A 5FTNA 1Z0JA 3RAFC 3LXUX 3VVBA 1QH0A 2J5XA 5JALA 1I7QB 2XGSA 2YR0A 1PL7A 3O8CA 4RDHA 3JWJA 3RS9A 1DKNA 3TIVA 4KAFA 4M76B 2VPYA 4MW7A 1CJTC 1NF2A 2LP4Y 1JXQA 1MB3A 1QC5B 3GZNB 2AK3A 5L3VA 1E61A 1H2WA 1RAAA 4NLLA 5C35A 3BMXA 3KQNA 1VHWA 5E9AA 4PG7A 5LBTA 4BNKA 5G0SA 2C5LA 1T36B 2JHAA 3ZLBA 4GQAA 5CA0A 2QLMA 4IXMA 1RQRA 2H1RA 4KXWA 4OGWA 2SICE 3A04A 4JBIA 4II7A 1W88B 4WNIA 2AKAB 2B4QA 4WOKA 3LUKA 1QX4A 3MUNA 2FMHA 1LFDB 1MOSA 4R2KA 4DZRA 4QL3A 4IS2A 3ROZA 5K01A 1V11A 4J3FA 5EJIA 2VNSA 1T5IA 5DNAA 1M2VA 2JFFA 2IYEA 5EHXA 4CODB 3N0TA 2XECA 2D1YA 1C3EA 1YBHA 2C8JA 3ZJ5A 4ND2A 1NVTA 2FOXA 3CMCO 2OXRA 3DD1A 3WLSA 1D2MA 3G85A 1QIHA 1J0BA 2MSKA 3OD1A 3HWX1 2YMQA 2CJWA 1GP2A 1T5BA 4RK1A 5LYJF 1HSZA 4UATA 3W3AD 3BB4A 2PA0A 3AX6A 1OI7A 3AUJB 3HR4A 3K2QA 3RBZA 3DZHA 3WLKX 3NC0C 5CPFA 3SR0A 3H83A 3A4MA 2IYTA 5C8ZA 2R0QC 1LZKA 1W6RA 2AI2A 2G0AA 3KZOA 1T35A 1VSVA 3ESAA 3FPFA 3ZI4A 5M04A 1U9JA 1XVTA 5JXHA 5DN6A 3N2KA 2G1UA 2R1TB 2X0NA 3COJA 1U2GA 3JQ6A 3GF4A 4HGNA 3V7WA 5B2FA 3ZBTA 1FYWA 4QFMA 5HQ3B 1IZ0A 3EGXB 1T8SA 4X71A 3KAJA 4DILA 4Z4FA 1JI3A 3FTDA 3ESXA 1XNJA 2V5VA 3ICCA 1ADBA 4G23A 3FTQA 3VU8A 1PR3A 3WS7A 1CNEA 4BN0A 4DCGA 4KGXA 3W8RA 3LP5A 4UUQA 2P6PA 4ZEOA 3M6LA 2D54A 2DHDA 3T3IA 3M7IA 2PUJA 4NIMA 3ZCSA 4NFSA 2LPMA 1YHZA 4KR0A 2NV6A 1IZ7A 4MTCA 3H4VA 3GZTB 2QZ4A 3FPCA 4OHWA 3F3SA 3OJFA 1B26A 2XUPA 2RHDA 3OM0A 5DBFA 1YHNA 1IN8A 2WMDA 4H16A 4RSGA 4OG2A 1ZCZA 2W6ID 4AN4A 1P45A 2Q0HA 4MVWA 1WZNA 2ETXA 4JITA 3ZGXA 4C2UA 1SKYE 2FZLA 3CVJA 2E48A 4ERNA 2O14A 4U2FA 1DVRA 1TYAE 4C4AA 1WMFA 3UK2A 2EKZA 3E3AA 5GZ1A 1TO2E 3E53A 3WRXA 3CRW1 2EX1A 5DF1A 3ETJA 3ZWMA 2J6IA 1PT5A 1EK1A 4UD6A 2Z56A 1LC0A 2QS9A 4NBRA 3M82A 5K0LA 2WILA 1EGAA 3E2PA 3M3PA 1GFSA 2MSNA 4V2UA 2YVKA 3GXOA 1W8IA 4KN5A 4YJHA 5B7GA 3OIFA 4PR0A 1J2UA 4FINA 2NU9A 1LJLA 1M75A 1Y1RA 3ECAA 3IDSA 3QELB 4RIFA 4WCFB 4ZO9A 2ZCUA 3TQSA 2O2CA 4TTIA 4EUFA 5I45A 3A4NA 2EERA 3L0DA 1L7MA 4KRXA 1TM7E 1NUAA 1U8YA 1DCMA 2JBWA 2RHBA 1EVZA 1O94D 1I1HA 2JKZA 2VKTA 2Z04A 4RPJA 5A2QA 4H27A 3R0JA 4MGYR 3N2EA 2PA3A 3R40A 1Y98A 1YK1A 2AW5A 2LVBA 2VRWA 4ND7A 4XOIA 5DYGA 2WIBA 3M3HA 4EGQA 1VA5A 3PZRA 5D3KA 3ZV4A 1QNLA 3K0SA 1E9RA 1PV4A 4KXUA 4CQJA 2PO5A 4IQFA 3RH0A 3SQNA 2JVIA 4RJIA 4OMUA 2ISSD 1NR1A 3JQAA 1BA3A 1JG1A 4WKNA 3V34A 3VKUA 4FB5A 5ABPA 5B6JA 3OZUA 4GU5A 4NL4H 2IOYA 3N2ZB 2VG8A 3KKZA 3OEHA 4FR2A 4N6GA 1CQJB 2R11A 2FDRA 3Q8KA 1IM5A 1G9TA 1MPXA 3D7NA 4ZAVA 3CUSA 3ICPA 4RA6A 3RVKA 1NXWA 2QN3A 4ZIRA 4FN4A 4G5XA 3AFGA 4NYIQ 1A8IA 5A0VA 1NNLA 4MQEB 4B32A 2DWCA 3CLTC 2R48A 2I4RA 5M29A 3M9WA 5EMNA 2IXTA 4KGZA 3KSUA 1TA0A 2FW1A 3OLXA 4JJ6A 1NW7A 4TTVA 3UJ6A 1S1MA 2DYKA 3ONEA 2XRZA 1ULAA 4G37A 3HCOA 4EX7A 3T34A 2PMCA 3MGBA 4BZXA 1BJTA 3SZGA 2AG6A 1GLVA 1JG6A 3IPRA 1JKJB 5EFOA 4O2LA 4P2BA 5L45A 4GOXA 4IDFA 1QHXA 1DPFA 1I6LA 1KP3A 3H87A 4J43A 3OF2A 1AXGA 2ZYHA 1HQCA 4PANA 2W6OA 5AM0A 2R4TA 1Z8FA 1EJ2A 4I08A 5JMOA 3FHTA 3K9BA 1NU8A 4I1IA 4CMEA 4FGKA 2HGSA 4FK8A 2ZP1A 3FKQA 2FV8A 3G0CA 1SULA 1VKJA 3AKZA 3OPVA 4X7PA 5DO9A 5F51A 5DNYB 3Q7PA 1QDEA 3OT1A 1ECPA 2J08A 4H17A 4M83A 1D6SA 1BTOA 1EWYA 2ZYRA 3K8QA 5DP1A 2GPYA 3ZKWA 2GX6A 4IILA 4EY5A 2B2NA 2MSWA 1XKQA 4JC4A 2MIIA 3MS2A 4AJHA 4ZV9A 1GPWB 3F3KA 4FM9A 2VHVA 4O4HA 2JW5A 1TJNA 3GDOA 5EY5B 3TZKA 1R64A 1SOVA 4B7AA 3RVSA 1U0OC 2G1PA 5B3LA 1CF9A 1UWLA 1SXJE 4EJ0A 1PNTA 2QGNA 2C20A 2GRJA 4QOEA 3DR3A 3CUVA 4F3KA 1E3JA 3PPVA 1BDJA 4EPWA 2IYZA 3OUUA 1B00A 2XNSA 5J2TA 2POCA 2PK3A 1SG6A 2PBZA 1KJWA 3FB4A 3FFWA 4YBZA 2ZRMA 3RASA 3IVAA 5H68A 3CS3A 4ZHQA 2V1XA 2ZFUA 2PWBA 1TVMA 2FZVA 4OGLA 4DWVA 1UBOS 1YDFA 1A9PA 3COZA 5A0TA 4ZV4A 4EKGA 2DP4E 5HR5A 1E69A 1P0PA 2VNAA 4GC9A 3SSMA 2XWJI 2FSSA 3KR1A 4ZVSA 5CVEA 3BWMA 1YIDA 1SC9A 4TM7A 1VJDA 3PFKA 4H7DA 3QF4B 5EJ5A 3BXFA 2Z2YA 1HLFA 1ONOA 2K7FA 5LZ7A 2ZU0C 2RARA 1K2WA 3UOWA 4TLMB 1WMEA 2FSPA 3PE3A 1HYGA 3FPHA 4HS9A 5J47A 4TYNA 2C7RA 4N18A 3T7TA 4AICA 4RVSA 2LZ0A 4DA0A 3P71T 5DISB 3DT9A 4X5OA 5GONB 3EZFA 4D44A 4OYLA 4EL0A 2IFTA 4X94A 1JMVA 2DTDA 5AESA 3F7MA 1W6UA 1XO1A 2BM0A 2QTRA 3M34A 1M67A 3QITA 2YC4C 5AW2A 5DM60 1JEDA 1Z5ZA 3D4NA 1NUUA 2J1LA 1UPXA 4DY6A 3LT5A 3OUZA 4L4YA 5LOVF 2JAQA 2AHOA 4NBTA 3HLYA 2REOA 4G0NA 4MW6A 3ESRA 3GG2A 3ODGA 2X86A 4EJSC 4UTVA 4WVFA 3ROFA 2BGGA 1T9DA 2JGJA 5IP5A 1TI7A 4J2HA 3OZXA 1RLJA 1W8DA 2ETVA 1UQUA 4MV1A 2XIJA 4O4LF 1YZFA 4KO8A 1EJ0A 2F48A 5CJ2A 2B30A 4BNJA 3W8DA 2BGLA 1JPNA 2CXNA 2INGX 3A7EA 3AETB 3BA1A 5D1NA 5SZIA 1Q0TA 1K6IA 1W96A 3F49S 4WBSA 4I9FA 4BKMA 2OO5C 3LNCA 1IAQA 1P1FA 3B1ZA 1C14A 4YAKA 1VZ2A 1F12A 1CUVA 2I22A 5H02A 4KK3A 4QODA 3WYNA 3ODPA 1PR1A 2C5EA 1YFZA 5K9ZA 1XMOB 1YTUA 5ADHA 1AIPA 3ADDA 1Z4LA 3OPMA 1IMOA 4QATA 3VDXA 4EZIA 3KJQA 2XGJA 4DUPA 4KR9A 1XHLA 1Q1GA 1QHGA 3CG4A 1T5HX 1RC0A 4NNPA 4FFBB 4ED9A 3O8QA 1IOLA 4OAPA 1IZYA 2VRBA 2X6TA 4I2VA 2FY8A 3O82A 3HVJA 4HVLA 2QWXA 4BZZA 3RUHA 5IF3A 1WL8A 3FRHA 3TLGB 4W4TA 4JVMA 4XKJA 4RTJA 1O6FA 2RAUA 1UXIA 4TSKA 3OEWA 4DY4A 1OZFA 1R4AA 1KO4A 3H1BA 2QP9X 4QGAA 1TCBA 2QDKA 1XVUA 2ZDQA 1YR3A 1W87A 3PHLA 4JLOA 4LMBA 1T3LA 1QTIA 2QD5A 2YYYA 3BMQB 3NR2A 1NJ1A 3PC7A 3RYFB 1D6JA 1N8SA 1RYMA 4PX3A 5FPSA 1EG2A 3E84A 2WA2A 1OAKA 4LSWA 3FVVA 5IX8A 1EWKA 3F96A 4I8DA 2GJKA 1YZNA 1RKVA 5EIBD 2B9VA 1WNTA 1MEJA 1NE7A 1RTKA 1E3EA 2HEIA 3B1XA 3GLQA 4TT3A 4OXNA 2QLNA 4JJFA 2D3TA 5CH3A 3HXPA 4GEKA 2GQ0A 2ZIAA 4PO1A 2C1XA 1Z8DA 1DAFA 4GM4A 3VMMA 4LQDA 1J0CA 1QP0A 1IHPA 1N2HA 3SJUA 3NG1A 2COUA 2ZT6A 5FI3A 4KBFA 4B09A 1R4MA 3LTNC 5LWHA 1BW9B 1A76A 3C0KA 3S2YA 3E8XA 3PENA 3BWXA 1R10A 5LLSA 2YWRA 3ECCA 2JAUA 1GN8A 3Q7EA 2VYVD 1VBFA 1FP4A 1PSZA 2VPIA 2VDPB 1ST2A 4K8OA 2PE5A 2JGNA 4YPVA 3U4IA 1BCRB 2I7XA 3A1NA 4B4UA 3T3NA 4RJJA 4XSGA 1OLSA 3R3UA 3NHRA 4RZ2A 2X0DA 5JR3A 4GP6A 1HPLA 1ECJA 2V9ZA 5A05A 3T1VA 3N86A 1RJDA 4ECEA 3RAGA 1V35A 3PFFA 3FIJA 2H29A 4Z54A 1HT1E 1KVRA 2BCJQ 5FBLB 5ETJA 1P3DA 1NX6A 2A86A 1VI6A 2AC7A 2H48A 3REQB 2Z2KA 1LCIA 2GDZA 4Y1GA 3LLSA 3TZLA 3WWZA 4LXIA 1L5ZA 5BW4A 2AXNA 3FYHA 1QYXA 4O4JF 821PA 4L3VA 2PLFA 2G63A 1L1FA 5M3BA 4B6FA 3IMGA 5CNIA 3MWYW 2OZLA 3MW8A 4NR0A 3VHXA 3R5FA 1RS0A 1T13A 4N54A 4TV9A 4DIOA 1N2OA 1FFCA 4P4SA 2JF0A 1W25A 4MVXA 1CLUA 4XDGA 1BYIA 1NMXA 4GOOD 1E3WB 3MCTA 3QE3A 1GUDA 1QVAA 3RABA 1KI4A 1TC2A 5G1NA 3PHGA 2JIRA 4DKXA 4ZJZA 2B4TO 4IFBA 3RS3A 2Z30A 1U9IC 1U7HA 4LFAB 1XTQA 2CBZA 2V6JA 3D6MA 3ELBA 3JSAA 2W42A 1JHXA 1KY5A 1J1ZA 1YS7A 4NTZA 1JQ3A 2HX1A 1DAOA 3CF6R 2IXBA 3LW8A 3GLHA 3NRCA 1II9A 4KAXA 5AUOB 2ZSDA 3I6QA 1EP1B 2BKEA 4HBGA 5JNVA 3DZBA 3HRHA 4BEWA 2CNWD 2E4WA 1NOJA 3TEMA 1QZXA 2OOKA 5KYWB 4RXTA 3LHKA 4FE3A 2BV3A 4L2IA 1Y7TA 3PG5A 3V2IA 4RVUA 5ELMA 2A8YA 1KC1A 1PWZA 3PXUA 1IULA 3F78A 4DV3B 3H5VA 3I1IA 2YH2A 4LTDA 2IU0A 4AQYB 2C07A 3ROTA 1JQDA 3I37X 1DDGA 1Z22A 1TF7A 4WBXC 3URMA 1DO8A 2WSBA 4M7RA 3OE5A 2O4CA 1SQ6A 4IIEA 1QHIA 5FUVA 2DWPA 3BWDD 3F4LA 2YASA 4A1OA 3L46A 4BV9A 3H1TA 4G24A 1OJLA 4NC9A 4RTQA 3TG2A 3RQIA 5BV2P 4OMDA 3VYUB 4A4DA 1WIWA 1OHHA 2QM7A 1G5FA 4XDZA 1CUHA 5LZ9A 4OATA 1RQXA 2PPVA 5FTJA 4EB6A 2I03A 5C2JB 2NP7A 1SU6A 4GQBA 1JEYB 1JEAA 3DZJA 3RROA 3LUDA 5E0KB 3U7JA 4RWEA 3R2JA 4HH4A 4XDHA 2BGWA 2EJCA 3H42B 1Q12A 3T1QA 5AI5A 3E82A 2AKYA 4ZPXA 3TZBA 3HCNA 1FVFA 4NZPA 2PSFA 4L75A 4EYSA 1GTRA 1S2MA 1H6BA 3IAAA 2CVHA 5HBRA 5FWYB 3HB5X 4KJZA 4XD7D 3RG2A 3VTZA 1SIBE 4TV8B 1QH8A 4LF4B 5IZCC 1B8PA 2BFBB 1RIFA 3ZZTA 5I7FA 4B44A 1CF2O 1YGPA 5A9SB 1JXMA 1MH9A 1UPCA 3DL7A 5AIAA 1SHTX 1FDIA 3RTDA 3ZDFA 5DTMA 4NH0A 2REQB 3PJDA 1TTPB 4C7MA 5BURA 1E92A 1DAKA 1XRJA 4FZ3A 2IX3A 1P8JA 3FLBA 1TTQB 5U9CA 3HY3A 3G7SA 3L07A 3P97A 3PUHA 4HUQA 3W0LB 3R7BA 5KX5F 1L4NA 3HSYA 1D03A 4XXHA 3N87A 4XH9B 2QF7A 4HTAA 4FNOA 2C2WA 2EZ9A 2CDBA 2HMVA 1TCUA 3EGDB 4FSHA 4G41A 3DGFC 4BQOA 1XP8A 3P9XA 2WSYB 3UK7A 3KOXA 2Z57A 3A2KA 5FLKA 3LBYA 3GL9A 2B99A 1RWWA 4J1SA 3ZBPA 5FOSA 4A8JC 3AERA 3HL0A 1QV7A 2O06A 4IDAA 4QPNA 4RS4A 3V4OA 2BEJA 4AZ0A 3BGDA 4BDTA 2N0SA 2VQ3A 2CLLB 1YSCA 2BHRA 1CQWA 2P2NA 3MJRA 3PX2A 1J25A 1HFEL 1IUKA 3A26A 3ZN2A 4ARZB 2P0YA 3HU5A 1PLJA 3P9NA 4PHGA 3WOHA 4PPFA 2EIHA 1AS2A 4ZDWA 4DT1B 5JRJA 2C03A 4TLBA 2ZE8A 2H07A 3TW4A 4QBTA 4RKWA 1TNDA 3N1UA 3O4GA 3RVMA 4BLVA 1NN1A 3ZX5A 1CSEE 5EXEA 5EHIA 4OJMX 4G0MA 3A25A 3EDQA 4PFQA 1D1QA 3DOFA 2BMEA 3IO3A 4L8VA 2Q2VA 3QTBA 5DHQA 2AA3A 2OZPA 4DW8A 4BYGA 4PGGA 2B0CA 1WDTA 2G06A 4ND5A 3WFIA 1OQAA 3C70A 1REQB 3EYWA 2KJQA 5CA1F 2HBZA 3EIOA 5E1DA 1DG9A 4LXHA 3RIXA 2EBHX 3G1TA 3UMJA 3PQ6A 1RKUA 5KNCH 3KZXA 3NIFB 1Y7LA 4F8YA 2ZAIA 2HFJA 4LHXA 4MHOA 4Q4CA 3EQ6A 1EP9A 2ZBGA 2F55A 2FE4A 4BKRA 3VUEA 1LD3A 3FNBA 1U2ZA 4AULA 1KRHA 3KCQA 1V1MB 1JJAA 5DT2A 4ZT7A 5EJ9A 1GITA 4LHYA 4CEHA 1TEVA 3GRVA 2R4UA 2GS9A 2CV2A 2G0TA 4QUEA 3T8YA 3DFFA 2AN1A 3KXIA 5KOJA 1SXQA 4UCXA 4AKHA 1CZHA 3DEYX 3K0CC 3JATA 2D3WA 3L1VA 2JIDA 4B34A 2O3SA 2C7OA 1BKDR 1C30B 2CFCA 2AWOA 3ZU4A 4W9MC 5J43A 4R9SA 4MUYA 4RHYA 2YV1A 3I2GA 3B6KA 1UFKA 1EVIA 4EO4A 1E62A 2ZREA 3QGMA 1GGMA 3F1LA 4IG9A 1PQWA 5B3KA 4EMBA 3VKVA 4YAOA 1UM8A 3H4MA 2HRBA 1G6Q1 1H8EA 2Z2IA 3AEQA 3L8HA 5LJIA 3V9PA 1C8KA 3CE6A 1II8B 4OQFA 2WKPA 1U8XX 1Z07A 2PFKA 2NXWA 4P5PA 5GP1A 4HB0A 3FD8A 2XA9A 4RETA 1NFRA 4UJ5A 3AQ4A 1E9AA 4RQAA 4TMFA 1AUVA 1OV6A 3HDQA 4JEUA 4B8WA 4CM6A 2BFNA 3L1UA 2GBGA 3NM6B 3OQIA 4IR7A 4QU0A 3NTRA 1NP6A 1P2VA 3ZDDA 5BSUA 4Z51A 3A14A 2XT0A 2QRPA 1TMOA 1F5SA 5BN3A 4BKPA 3UMMA 4BMYA 3EY9A 1Z08A 1JE0A 1P1IA 2ACEA 2H8KA 3WLNA 3DUFA 3BCUA 1DL5A 5K3DA 1E9FA 3PRYA 4E1BA 2G5TA 2IXEA 2QVLA 4R98A 3UXEA 3T7IA 3F74A 4EI8A 5KJ6A 3NKVA 3CB2A 3R8FA 5I9IA 2JEOA 3SXPA 1P0CA 5CNKA 5FBKA 3OMLA 1XWWA 1KJ9A 4E0BA 5CX1A 1L5SA 3FNIA 5FI5A 4CKWA 4D2IA 1VJ0A 3PFWO 3NW9A 4DTIA 5F7XA 1LK5A 1UK6A 1H1TA 3V1UA 2FK8A 3EF1A 3SC4A 5I48A 3PQFA 3STVA 4W5HA 1SURA 3X1MA 2ZJAA 3NYIA 4QT0A 2FWMX 2TSYB 3IP5A 3LDFA 3OESA 4W7SA 4ZOQI 4U4AA 5MF6A 2C3OA 4LJAA 2FZWA 2XJ4A 4MMXB 2ID9A 3LGXA 4WFKA 2GCOA 1RCTE 1XQXA 4M0FA 1YQXA 4Z8XA 1RAHA 2QTBA 2QK4A 3HO8A 1MN6A 3L92A 2QAGC 2QRNA 2DTXA 4TMXA 5TDHA 3RT7A 3FKSA 3TB4A 2JI4A 2WYWA 1QS0A 3K0AA 5AVOA 4UUNA 3SQMA 2J0UA 2QT1A 4G5OA 4AIIA 3G2QA 2YL2A 1SU7A 5DNCA 1U4SA 5ENDA 4UKDA 1V45E 1DIRA 2DH6A 3Q7QA 1L6RA 2GT1A 1N4DA 5ICEA 5BR8B 3VU3A 1F4LA 1GNSA 1T0BA 5A7FA 3OHMA 1ZKDA 3GPLA 4ARUA 2JGRA 3CT4A 3PFHA 4N40A 5AVTA 2XUDA 4RFLA 1Z6AA 3IBSA 4L0MA 4XJTA 1C9YA 3V7UA 1BS2A 1LV8A 3HJCA 1U5BA 3LQQA 2ZDGA 3U1TA 3I1YA 8GPBA 1ZIYA 4DJDC 5EJ8A 2PU7A 1JMYA 1COWD 1GVNB 1VJRA 1Z6GA 2IL1A 3AL2A 4GR9A 2VRCD 1Z35A 1EINA 4OFXA 1IIBA 3BRCA 4V1CB 4KACA 1Q6ZA 4CLHA 1DBVO 2X0IA 1XNQB 1UXOA 3PX7A 4G9EA 2WWXA 1J70A 3MC1A 3O8DA 4XUCA 5T8KC 4DNQA 2NZUG 4FDVA 1USGA 1MX5A 1WEKA 3ABIA 2X41A 3K31A 1YJQA 1KYTA 2XDQA 2W2QA 1KYQA 5DOZA 1JQJC 4D98A 5EIOA 2BHSA 4RKEA 2XV1A 5DNVA 3QSYA 2MJLA 1XDUA 3BH0A 4CMKA 2DPGA 1N5IA 2BP7A 2V6IA 4IIYA 3JD1A 5WRFA 5KSOA 2VA9A 1J2RA 4QAQA 3ESYA 5H81A 1XLVA 1ZN7A 5EHGA 2QVGA 2RCYA 3DDOA 5CLLA 1FXWF 2FXVA 1VKHA 3LP6A 4MV5A 4JL5A 5COQA 4HXGA 4O59O 1I4WA 1Z6TA 3N53A 1N5OX 1SK8A 5IUNC 5KDOA 2V0GA 1X2BA 4BASA 2Y0EA 4GOMD 4H7IA 3EXEB 1VPEA 3IDAA 3HYNA 1O0CA 2R1UA 3BORA 1DHRA 1DCKA 3OC6A 4K6FA 4B4OA 2ZRCA 3CYFA 1DKQA 1W46A 1XCBA 2ZIUB 4XB1A 3TTVA 3TDMA 2ZRIA 1JJFA 1B2RA 3AM1A 4K6MA 2J3IA 5ADVA 2C9BA 2Y4OA 4KVAA 1ZDMA 1NASA 3DZGA 2PS0A 3G59A 3C1AA 4ZCLA 3FGZA 2Q50A 3MPUA 3HNRA 1G8SA 3HS3A 5F21A 1FIUA 4GRAA 5BN4B 1FZQA 1TVKB 4AF6A 5CFNA 2BSXA 5DX1A 2PO7A 4E6EA 3E9RA 3HHPA 3H99A 3IKLA 4R0NA 1V1JA 4G5GA 2RK4A 4KQEA 2JL1A 4I36A 3ZVNA 1WDLA 3L6EA 4U00A 2O2EA 2O1XA 4EFNA 3S55A 5K3EA 4TQGA 2V4MA 4NDNE 4M99A 3ZV6A 3LOPA 3WLMA 4BIMA 2N9UA 1LRJA 2BF4A 1CXZA 2IZ0A 2X15A 2QRUA 5A4FS 1CULC 1Z83A 2Q29A 4MR9A 2X8JA 4F93B 1TMKA 3SDZA 4HKTA 4G4JA 3MOGA 5IM5A 4MYUA 1KP2A 1IYZA 4R51A 4X1KB 5FTWA 3DZKA 3RGGA 1CR0A 1FRNA 4C43A 3O03A 2JCVA 3TNYA 3ZE1B 3V1TC 1P9RA 4BFZA 2QJOA 1XZLA 3KU4A 4KUGA 4EKYA 3MLAA 4F96A 2O2XA 2C96A 2HDNB 2PHZA 2RJOA 4W8GA 5HOEA 1XJCA 4LJLA 4IJ6A 2BW0A 4IIJF 4U2EA 4HV4A 5B64A 1VL1A 4RK4A 3EC1A 4YJ3F 2OD2A 4G56A 1KMMA 4PLPA 4U63A 4C3UA 2TMGA 3NNSA 1NL3A 1SZDA 3OFND 2CLHB 3VR6H 2ODPA 3R7DA 3EIQA 1N9GA 1BHO1 3G2HA 3LLVA 3IEVA 3SQDA 5DI3A 2GPNA 1E1RA 4N5HX 1L7QA 1EWTA 4H9GA 4AZ3A 4OKSA 2YRWA 5CFMA 5H8WA 3WWDA 2JBAA 3AEUB 1HMPA 2HJRA 2ZIVB 4O5AA 3VH3A 4HTFB 4E21A 2X8BA 3NASA 2E4ZA 3E3OA 2OCXA 2FW9A 1YS4A 4NJOA 1C1DB 2EX4A 4XQ9A 5LLTA 3JCZA 3K9QO 1X0VA 3B6IA 3UMFA 1UOQA 1HE8B 4HDNB 1XTTA 1GUYA 2OD7A 1XTUA 3PNVA 2C00A 2GB4A 3GRCA 4CR7A 4DV1B 1E6LA 4BJ1A 1HV8A 2W0MA 4WLOA 2JLCA 2EZ8A 3WNBA 1CR6A 4P4UA 1NVBA 4R6WA 3O47A 1N6KA 5SICE 4PICA 2QW1A 3Q7RA 4ZOEA 1ZH0A 1EX1A 2VDWA 3IURA 2XUAA 3GZJA 4EY8A 1Y3AA 2OV6A 1PG0A 3FUVA 1U1DA 3ZXUB 3QYJA 4HGQA 4AP6A 2ZWVA 4BMNA 3JWPA 4KSBA 5AO9A 3LSTA 4DCTA 3E1GA 1YS2X 1NM5A 1AVTA 1TB4A 3KLNA 4AD8A 4DC9A 5AW1A 2FU5C 4X8HA 4ZAYA 1BWPA 3W34A 2X2FA 3PF8A 1U0BB 1DAEA 4LGCA 4I4TA 4AJEA 6GPBA 2D0IA 3K15A 3OPXA 3Q12A 1KMCA 4Y1EA 3HVHA 4ZWNA 4DBLC 5I7WA 5ERYA 2QZ9A 4IS3A 4B9EA 3ZE6A 2RD2A 1EEXB 1JG7A 2QE7D 3ZVKA 2C29D 3JD4A 4PNEA 4QIHA 4FLEA 1ZHFA 2GO1A 2PWAA 3A70A 1BNCA 4M6WA 3DB2A 3RYTC 1VE9A 4B84A 1X15A 4LE1A 5IYZA 5IK2A 3BREA 2K4MA 3RU2A 4AMUA 3KPWA 4MPPA 5KYXA 4H1VA 2XBMA 1JXAA 3RU9A 1Z2PX 2JK0A 3ON5A 2ISCA 4R05A 2A5LA 3ZBQA 1OA1A 3EF3A 3WTBA 1K7FB 3ZWQA 4LYHA 2DMRA 1T5LA 3W5SA 2GAOA 5ELXA 5JAHA 3P4YA 2EWVA 1A8PA 2EF0A 2IZOA 4ZYZA 3FH0A 1R8SA 3O2QB 1NC3A 1RWBA 1XK7A 1P2BA 1VFPA 2C42A 3D4BA 3WL5A 3L0CA 1ZQ9A 4UTNA 4AURA 5DYTA 4BNIA 1AURA 4WGFA 1KXJA 4C0HA 1I33A 1QFYA 1AHNA 3ONDA 5JZVA 4H60A 4IOJA 5IJ9A 5CXSA 1N34B 1FUYB 2C9OA 2W83A 4R31A 5AXDA 1HM5A 4HO1X 5AW3A 2KM1A 3GGGA 1HL7A 4PTZA 5AOVA 4ZI7A 2J32A 3QKSB 4JI0B 2V54A 3GY0A 2HRZA 2FRDA 4DLTA 4RL6A 2ILVA 3ECSA 4QFBA 4EG7A 5ED4A 4M8KA 2ZSFA 4DCVA 4N0EA 4UC0A 2NO7A 2NYVA 4KQ6A 4S04A 4IIHA 2NUPB 1Y6ZA 1F8UA 1RMTA 4UXHA 2NVBA 2X8LA 3E81A 4DSTA 2VUTA 3VSBA 4I55A 5BSEA 1TIPA 1V25A 3C6MA 3E4DA 4Q7JB 4REMA 3LBHA 4NSNA 3WRYC 4QHSA 4B82A 4A5OA 1VBMA 3P8ZA 5K09A 4JBXA 1PS9A 2ZB4A 1MX1A 3HZOA 3QVUA 5AM4A 5FRDA 5E7MA 4B7UA 1HZZC 1RRPA 2FX3A 2DQYA 3C4JA 4J0QA 2X1HA 3LXRA 2Q2NA 5EP1A 4B6SA 3G6KA 4QBGB 1N0IA 2XX3A 3I42A 2FJPA 4GUAA 4KLZA 4WZBA 4M9UA 5ALWA 5ALXA 4I1VA 4H3HB 5BOVA 1U2SA 4IDBA 2BEWA 2X4GA 1X7HA 3EW9A 1DJQA 4CHTA 1PL8A 2A7XA 4GOND 5EIWA 4DVJA 4FTWA 1E1KA 4HZIA 3ZY6A 3PGMA 4R6XA 1J5XA 1ISHA 4A8PA 1EUDB 1IOWA 2CKMA 4WEOA 1PI3A 4IX9A 5JJIA 2AEEA 1UZAA 1Z2DA 1L8QA 2V4UA 3P0HA 3M0EA 5LDGA 2A5DA 2WFLA 3DVRX 3WY9A 4A2CA 4FZVA 3FYUC 4RH3A 1TGYA 1W30A 2OHJA 3G89A 4YMHA 3TD9A 2SKDA 1VP9A 3EOBI 1BC5A 1ZA2A 5C51B 3LO8A 1XV5A 4FPXA 3Q9LA 1L1EA 4RY9A 4UJ3A 4Z0NA 2FEAA 4H18A 4K2HA 5K0TA 2ZIFA 5JD4A 4L28A 2P4SA 4HDKA 4HQKA 2GJ4A 1XB2A 3VHLB 2FDCA 2ID8A 3CH7A 2PU5A 4LDRA 4MR7B 1E9DA 4QXQA 4PPQA 4AW9A 1ZD3A 5EE0A 2ZBUA 5AW4A 3LZCA 4V39A 2RBGA 3S68A 4D42A 3G02A 1HFKA 1YKSA 2G5CA 2VPQA 1W85B 3NHYA 4I4CA 4QOJA 2YZGA 2ONJA 5AKHA 1ZUNB 1W4AA 3GRFA 2G1KA 5HTOA 2R25B 1NQTA 4ZCIA 1WETA 1YB1A 2Y76A 5CXQA 3C5WP 2CL0X 2CXQA 1VLHA 1GSHA 3UHFA 4J1TC 1T8PA 2WFMA 2YY5A 5G1OA 5JTUA 1L7DA 2WPDA 1XZIA 5K0SA 2VK8A 5ESRA 1Q95A 1Q16A 2F1RA 2W2VA 1NZFA 1HKHA 1Z5PA 4D9MA 2Q4TA 4B3MB 4KDFA 1EFDN 3AF4A 3RS4A 1FDTA 3LE8A 3O83A 5ITZA 4ZYTA 2IPNA 1L4MA 3JQFA 5ICFA 1Y0BA 3WO1A 3DKIA 3P2IA 2NUAB 2QG6A 4N9QA 3PF9A 1UAYA 3THYB 3JYNA 3WWOA 4CG3A 3ZVMA 5IASA 1RHUA 1YU6A 1PJAA 2A9RA 2GPWA 1RKBA 2ZSKA 2ANCA 4QYXA 4YALA 2NYUA 2O2ZA 1S4MA 1Y9AA 4RLFA 4YLEA 2YIMA 5HQTA 1XDGA 3JQ9C 2H1CA 5GM1A 2E49A 2KMLA 3OMXA 4JBWA 1G3QA 1JDVA 3SXJA 3VPGA 5KNDH 5JI3E 2V9PA 4JJKA 3LCUA 2H5EA 2VP4A 4IJKA 4RVOA 1XF9A 3IO5A 5I6DA 1CP3A 1WHSB 3ZOZA 1T4CA 2BMVA 5BN5A 3BAZA 2BEUB 2M32A 4BNGA 3GH1A 2PG3A 3HI4A 2F43B 3AUXA 4G0QA 4UOQA 3WGLA 3Q8WA 1E3IA 2FK7A 1S3SA 1VLLA 3GDHA 2NU6A 1EE2A 4L74A 3BEDA 4YDQA 4U7FA 3FF4A 1FLAA 5A5EA 2IPAB 5T7BA 1E5TA 4YV1A 3Q8LA 1HNXB 1UDAA 3PC3A 4L5BA 4QQKA 1Y4UA 1WNFA 1UUFA 2YWGA 4K6OA 2FSIA 2RB4A 3IVMA 4Q3KA 3SHWA 3ZHOA 1IUPA 3EEQA 2WM3A 3MTEA 4I9NA 4GLFA 3WGJA 1AJEA 1WXFA 3GA0A 5LCXA 4DUZB 3AVWA 4JU9A 2DLCX 2OXIA 3QEKA 4J03A 4QGHA 3IB3A 3VISA 1H5UA 4B3XA 4IF4A 1P1JA 1CF4A 2NAFA 1F1JA 1CB0A 4ITVA 5GJCA 2GZHA 3T15A 3MGAA 4Z99A 2B21A 4GO1A 2PY6A 1E7SA 3L5KA 5LDHA 5CEEA 1KOJA 2C2KA 4QLBA 3EPPA 1KQOA 3WBBA 1YCDA 3ANSA 1W9MA 1N1DA 1MC4A 2WT9A 4LPKA 1Z7EA 4NK4A 4N7JA 3JQRA 5D7NA 3V00A 5CA0B 5TQ0A 3D3WB 1KI1A 1MQSA 721PA 2AJLI 2FRXA 1AD2A 2VUUA 4AYXA 1SPBS 1Q83A 4XAQA 1M2WA 4G4GA 1V11B 2FSGA 2IOHA 3Q7IA 1M2VB 1YFKA 2O0JA 3BTVA 2VP5A 3BVPA 3G2JA 3TX2A 1BD4A 2GUWA 2Q3BA 3WJ2A 2GAFA 4XIFA 2WWGA 4P82A 2YIJA 4Q1AA 5KTKA 5DDIP 3CUEF 4DSOA 3PGKA 2BGIA 4I1YA 3K16A 4QDJA 3WB2A 5LKRA 2ZYAA 3GNQA 3PK0A 3IELA 2CJWB 4M9RA 3RI3A 3RQSA 2G9RA 2DU8A 4M2LA 3ZCUA 5MN6A 4EHDA 1QCZA 4ER7A 5JCZA 1UINA 1T3HA 1M2EA 1TW3A 4IDHA 4NXNB 1N6PA 2QQ0A 3CQ9A 2OG2A 3FPEA 4YQZA 3U7EB 4JLDA 4B17A 2WM8A 3EXG2 1GTG1 2ODTX 4HB2A 4OBBA 3TLMA 1VJGA 2HN9A 3K2BA 3FJOA 4ADSG 2BGTA 3KT0A 4F3RA 4EBFA 2W0SA 3DXYA 1W1WA 4ZREA 1UBHS 4C4TA 1J42A 4CUJA 1U1GA 5TNXA 3VR4A 3N2KB 1RLMA 2QA5A 3NHMA 2I54A 3OM9A 4OHBA 3SNHA 2C2ZA 1RJ9A 3LQYA 1Y63A 2GF2A 4Y9UA 1BDMA 3N2LA 4YDRA 4YO7A 3PS9A 4KE8A 3E27A 2ZJ5A 3HVIA 2V7WA 3IV6A 2FMTA 1RVDA 5JZOA 4MYHA 5A0FA 4DDKA 1KORA 4M7PA 1PEYA 2EZ4A 3WNQA 2H1FA 3IOCA 4JI5B 1P73A 2Q3EA 4KAAA 5HTKA 1OVMA 4IVRA 1TYCA 3TRJA 4D9IA 4OLHA