1N4IA

Solution structure of spruce budworm antifreeze protein at 5 degrees celsius
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
90
structure length
90
Chain Sequence
b'DGSCTNTNSQLSANSKCEKSTLTNCYVDKSEVYGTTCTGSRFDGVTITTSTSTGSRISGPGCKISTCIITGGVPAPSAACKISGCTFSAN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords thermal hysteresis protein
publication title Spruce Budworm Antifreeze Protein: Changes in Structure and Dynamics at Low Temperature
pubmed doi rcsb
source organism Choristoneura fumiferana
molecule tags Antifreeze protein
total genus 10
structure length 90
sequence length 90
ec nomenclature
pdb deposition date 2002-10-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05264 CfAFP Choristoneura fumiferana antifreeze protein (CfAFP)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.160.10.20 Mainly Beta 3 Solenoid UDP N-Acetylglucosamine Acyltransferase; domain 1 Insect antifreeze protein 1n4iA00
3GQ7A 1EWWA 1Z2FA 1M8NA 3GQ9A 3GQAA 1L0SA 1N4IA 3SUCA 3GQ8A
chains in the Genus database with same CATH superfamily
1THJA 1KRUA 3BSYA 4J09A 5L6SA 4EAAA 4EABA 3FSYA 3R5DA 3I3AA 3R5AA 3R5CA 3NZ2A 1KGTA 3EH0A 3Q1XA 2W0VA 4M2BA 3VBIA 4EA9A 2ICXA 3R2WA 4KQLA 4IHGA 3DK5A 4G3PA 3VBLA 4K6RA 3OH0A 3D98A 3OH1A 3DHOA 3IGJA 4N27A 4R7PA 5DEPA 3TDTA 2TDTA 5ADXV 4N6AA 1KGQA 3VBJA 3D8VA 3FSCA 3TK8A 2JF3A 4G3QA 2QIVX 3BSSA 2V0KA 2RIJA 3MC4A 1XATA 1KK4A 3ST8A 2IU9A 3HJJA 1KRVA 3V4EA 3PMOA 3GUEA 1HM9A 3GQAA 4EA7A 1SSQA 3TV0A 3SUCA 1V3WA 2W0WA 1QQ0A 1S80A 2OEFA 3BSWA 3SPTA 4E6TA 4KNXA 3VNPA 3TISA 1Z2FA 3F1XA 2V0HA 1KRRA 3BRKX 3C8VA 3DJ4A 4IHHA 1KK5A 2V0LA 2V0IA 3GVDA 2XATA 3TIOA 5E3PA 3VBPA 1QRLA 3OUPA 3OW5A 5E3QA 3HSQA 4E75A 1Z90A 2IU8A 3R0SA 5U2KA 3OTZA 3I3XA 4E6UA 2WLEA 3MQHA 1TDTA 4R37A 3JQYA 4M9CA 3GQ7A 3OTMA 4AAWA 5E3RA 2OI6A 1M8NA 1YP3A 4G3SA 1L0SA 3BXYA 1MRLA 3TWDA 2FKOA 4HCQA 3GQ8A 1HM8A 2I5KA 2P2OA 1QRMA 2IUAA 3FSXA 3OU9A 3FWWA 3P47A 3FOQA 4ISXA 2GGOA 4MYOA 4M98A 3GOSA 3KWDA 3R5BA 3R3IA 1FWYA 2WLDA 3R8YA 3SRTA 5DEMA 4MFGA 5AFUU 3OGZA 1SSTA 4IHFA 1N4IA 2JF2A 2QIAA 3GQ9A 4HZDA 1YP2A 1OCXA 3P1BA 4EQYA 4R36A 4E79A 2VD4A 1XHDA 1SSMA 1YP4A 4AC3A 1QRGA 1T3DA 3FSBA 1HV9A 4N69A 4HUSA 4HURA 1V67A 2WLCA 3BFPA 1QREA 2Q4JA 3MQGA 2OEGA 1LXAA 3ECTA 4EGGA 4FCEA 4M2AA 3R3RA 1J2ZA 2OI7A 3T57A 5L6VA 5F42A 4H7OA 4MZUA 2WLFA 5ADXU 3VBNA 1KQAA 2GGQA 4HZCA 4KPXA 3CJ8A 1G97A 2VHEA 2AQ9A 2ICYA 1G95A 1QRFA 1KK6A 1KHRA 3OH2A 1MR7A 4N6BA 3FTTA 1FXJA 3FS8A 4J18A 1EWWA 4M28A 5DG3A 3OH3A 3KWEA 2OI5A 4M99A 2WLGA 4AA7A 4DCLA 3VBKA 3EEVA 4KNRA 3VBMA 4EA8A 3EG4A 4KPZA 2NPOA 2V0JA 1MR9A 5AFUV 1HM0A 3R1WA 2IC7A 3KWCA 3OH4A 4G87A 2QKXA 3IXCA 4E1KA
chains in the Genus database with same CATH topology
3GQ7A 1EWWA 1L1IA 1Z2FA 1M8NA 3GQ9A 3GQAA 1L0SA 1N4IA 3SUCA 3GQ8A 1EZGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3GQ7 A;  1EWW A;  1Z2F A;  1M8N A;  3GQ9 A;  3GQA A;  1L0S A;  1N4I A;  3SUC A;  3GQ8 A; 
#chains in the Genus database with same CATH topology
 1THJ A;  1KRU A;  3BSY A;  4J09 A;  5L6S A;  4EAA A;  4EAB A;  3FSY A;  3R5D A;  3I3A A;  3R5A A;  3R5C A;  3NZ2 A;  1KGT A;  3EH0 A;  3Q1X A;  2W0V A;  4M2B A;  3VBI A;  4EA9 A;  2ICX A;  3R2W A;  4KQL A;  4IHG A;  3DK5 A;  4G3P A;  3VBL A;  4K6R A;  3OH0 A;  3D98 A;  3OH1 A;  3DHO A;  3IGJ A;  4N27 A;  4R7P A;  5DEP A;  3TDT A;  2TDT A;  5ADX V;  4N6A A;  1KGQ A;  3VBJ A;  3D8V A;  3FSC A;  3TK8 A;  2JF3 A;  4G3Q A;  2QIV X;  3BSS A;  2V0K A;  2RIJ A;  3MC4 A;  1XAT A;  1KK4 A;  3ST8 A;  2IU9 A;  3HJJ A;  1KRV A;  3V4E A;  3PMO A;  3GUE A;  1HM9 A;  3GQA A;  4EA7 A;  1SSQ A;  3TV0 A;  3SUC A;  1V3W A;  2W0W A;  1QQ0 A;  1S80 A;  2OEF A;  3BSW A;  3SPT A;  4E6T A;  4KNX A;  3VNP A;  3TIS A;  1Z2F A;  3F1X A;  2V0H A;  1KRR A;  3BRK X;  3C8V A;  3DJ4 A;  4IHH A;  1KK5 A;  2V0L A;  2V0I A;  3GVD A;  2XAT A;  3TIO A;  5E3P A;  3VBP A;  1QRL A;  3OUP A;  3OW5 A;  5E3Q A;  3HSQ A;  4E75 A;  1Z90 A;  2IU8 A;  3R0S A;  5U2K A;  3OTZ A;  3I3X A;  4E6U A;  2WLE A;  3MQH A;  1TDT A;  4R37 A;  3JQY A;  4M9C A;  3GQ7 A;  3OTM A;  4AAW A;  5E3R A;  2OI6 A;  1M8N A;  1YP3 A;  4G3S A;  1L0S A;  3BXY A;  1MRL A;  3TWD A;  2FKO A;  4HCQ A;  3GQ8 A;  1HM8 A;  2I5K A;  2P2O A;  1QRM A;  2IUA A;  3FSX A;  3OU9 A;  3FWW A;  3P47 A;  3FOQ A;  4ISX A;  2GGO A;  4MYO A;  4M98 A;  3GOS A;  3KWD A;  3R5B A;  3R3I A;  1FWY A;  2WLD A;  3R8Y A;  3SRT A;  5DEM A;  4MFG A;  5AFU U;  3OGZ A;  1SST A;  4IHF A;  1N4I A;  2JF2 A;  2QIA A;  3GQ9 A;  4HZD A;  1YP2 A;  1OCX A;  3P1B A;  4EQY A;  4R36 A;  4E79 A;  2VD4 A;  1XHD A;  1SSM A;  1YP4 A;  4AC3 A;  1QRG A;  1T3D A;  3FSB A;  1HV9 A;  4N69 A;  4HUS A;  4HUR A;  1V67 A;  2WLC A;  3BFP A;  1QRE A;  2Q4J A;  3MQG A;  2OEG A;  1LXA A;  3ECT A;  4EGG A;  4FCE A;  4M2A A;  3R3R A;  1J2Z A;  2OI7 A;  3T57 A;  5L6V A;  5F42 A;  4H7O A;  4MZU A;  2WLF A;  5ADX U;  3VBN A;  1KQA A;  2GGQ A;  4HZC A;  4KPX A;  3CJ8 A;  1G97 A;  2VHE A;  2AQ9 A;  2ICY A;  1G95 A;  1QRF A;  1KK6 A;  1KHR A;  3OH2 A;  1MR7 A;  4N6B A;  3FTT A;  1FXJ A;  3FS8 A;  4J18 A;  1EWW A;  4M28 A;  5DG3 A;  3OH3 A;  3KWE A;  2OI5 A;  4M99 A;  2WLG A;  4AA7 A;  4DCL A;  3VBK A;  3EEV A;  4KNR A;  3VBM A;  4EA8 A;  3EG4 A;  4KPZ A;  2NPO A;  2V0J A;  1MR9 A;  5AFU V;  1HM0 A;  3R1W A;  2IC7 A;  3KWC A;  3OH4 A;  4G87 A;  2QKX A;  3IXC A;  4E1K A; 
#chains in the Genus database with same CATH homology
 3GQ7 A;  1EWW A;  1L1I A;  1Z2F A;  1M8N A;  3GQ9 A;  3GQA A;  1L0S A;  1N4I A;  3SUC A;  3GQ8 A;  1EZG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...