1N4IA

Solution structure of spruce budworm antifreeze protein at 5 degrees celsius
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
90
structure length
90
Chain Sequence
DGSCTNTNSQLSANSKCEKSTLTNCYVDKSEVYGTTCTGSRFDGVTITTSTSTGSRISGPGCKISTCIITGGVPAPSAACKISGCTFSAN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords thermal hysteresis protein
publication title Spruce Budworm Antifreeze Protein: Changes in Structure and Dynamics at Low Temperature
pubmed doi rcsb
source organism Choristoneura fumiferana
molecule tags Antifreeze protein
total genus 10
structure length 90
sequence length 90
ec nomenclature
pdb deposition date 2002-10-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05264 CfAFP Choristoneura fumiferana antifreeze protein (CfAFP)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.160.10.20 Mainly Beta 3 Solenoid UDP N-Acetylglucosamine Acyltransferase; domain 1 Insect antifreeze protein 1n4iA00
1N4IA 3GQ9A 3GQ8A 1Z2FA 1M8NA 3GQ7A 1L0SA 3GQAA 1EWWA 3SUCA
chains in the Genus database with same CATH superfamily
2NPOA 3OGZA 2IU9A 4KNXA 3VBKA 4M98A 4HCQA 1XHDA 2ICXA 1Z2FA 2OEGA 3C8VA 3MC4A 4M9CA 3R3IA 3TK8A 1MR7A 2OI7A 3SUCA 1KRRA 5L6SA 1KRVA 4IHHA 4J09A 3FS8A 3OH1A 3R3RA 1G95A 3R5CA 5E3PA 3GQ9A 5DEMA 5AFUU 4MZUA 4N69A 1KQAA 3VBLA 3NZ2A 3GQAA 3MQHA 1T3DA 4HUSA 3OH3A 3FOQA 4HURA 3VBIA 2GGOA 3GQ7A 1TDTA 3R1WA 4R36A 2I5KA 3HJJA 4AAWA 2TDTA 3EG4A 1MRLA 1SSQA 4HZCA 3SRTA 1THJA 3I3AA 1QRMA 2WLCA 3BSYA 4G3SA 4EAAA 3DK5A 2V0IA 3OW5A 3KWCA 3ST8A 4E6UA 3IXCA 3GUEA 3D98A 3BSSA 1S80A 3HSQA 1SSTA 3IGJA 3SPTA 2P2OA 4E75A 3KWDA 3GVDA 2IU8A 2ICYA 1MR9A 3OTMA 3P1BA 4KPZA 4MFGA 4HZDA 4H7OA 5DEPA 5E3RA 2XATA 3MQGA 3R5BA 3TWDA 3VBMA 1HM8A 4N6AA 2WLEA 2VHEA 2FKOA 3GOSA 2RIJA 4ISXA 4IHGA 5AFUV 2V0LA 3BSWA 3OH4A 1YP3A 4N27A 2W0WA 4R7PA 1N4IA 4KQLA 4EGGA 1QQ0A 5ADXU 2IUAA 4EA7A 2V0HA 1QRLA 5U2KA 3VNPA 3I3XA 1XATA 1L0SA 3OH2A 3EEVA 3DHOA 1LXAA 1FWYA 1SSMA 3DJ4A 3GQ8A 3OTZA 3VBPA 2V0KA 4E6TA 1YP4A 3BXYA 2JF3A 3Q1XA 3FSCA 4N6BA 4M2BA 1FXJA 1M8NA 3KWEA 1KGQA 4EABA 2WLFA 4M99A 3TIOA 4EQYA 3FSXA 4KNRA 4E79A 3TV0A 1Z90A 3CJ8A 3R2WA 4AC3A 3TDTA 2OEFA 4R37A 2JF2A 3R5DA 1YP2A 4MYOA 4EA8A 2QKXA 3FWWA 2V0JA 2OI6A 4G3QA 4AA7A 2W0VA 3OUPA 3EH0A 3P47A 4EA9A 1KK5A 4G3PA 3R8YA 1KK6A 2AQ9A 1HM9A 3VBJA 4E1KA 4M28A 5DG3A 5ADXV 5L6VA 1OCXA 1QRFA 3PMOA 3R5AA 4DCLA 1V3WA 2WLDA 5E3QA 3BFPA 2IC7A 2WLGA 3FTTA 3R0SA 4IHFA 1V67A 3FSYA 3TISA 1HV9A 1QRGA 2GGQA 2VD4A 3VBNA 1KRUA 4K6RA 1HM0A 2Q4JA 1G97A 1KHRA 3V4EA 1QREA 3ECTA 4G87A 3JQYA 2QIVX 3F1XA 4FCEA 3FSBA 4KPXA 1KK4A 3OH0A 3OU9A 3D8VA 4J18A 3T57A 1KGTA 2QIAA 3BRKX 1EWWA 5F42A 1J2ZA 4M2AA 2OI5A
chains in the Genus database with same CATH topology
1EZGA 1N4IA 3GQ9A 3GQ8A 1M8NA 1Z2FA 3GQ7A 1L1IA 1L0SA 3GQAA 1EWWA 3SUCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1N4I A;  3GQ9 A;  3GQ8 A;  1Z2F A;  1M8N A;  3GQ7 A;  1L0S A;  3GQA A;  1EWW A;  3SUC A; 
#chains in the Genus database with same CATH topology
 2NPO A;  3OGZ A;  2IU9 A;  4KNX A;  3VBK A;  4M98 A;  4HCQ A;  1XHD A;  2ICX A;  1Z2F A;  2OEG A;  3C8V A;  3MC4 A;  4M9C A;  3R3I A;  3TK8 A;  1MR7 A;  2OI7 A;  3SUC A;  1KRR A;  5L6S A;  1KRV A;  4IHH A;  4J09 A;  3FS8 A;  3OH1 A;  3R3R A;  1G95 A;  3R5C A;  5E3P A;  3GQ9 A;  5DEM A;  5AFU U;  4MZU A;  4N69 A;  1KQA A;  3VBL A;  3NZ2 A;  3GQA A;  3MQH A;  1T3D A;  4HUS A;  3OH3 A;  3FOQ A;  4HUR A;  3VBI A;  2GGO A;  3GQ7 A;  1TDT A;  3R1W A;  4R36 A;  2I5K A;  3HJJ A;  4AAW A;  2TDT A;  3EG4 A;  1MRL A;  1SSQ A;  4HZC A;  3SRT A;  1THJ A;  3I3A A;  1QRM A;  2WLC A;  3BSY A;  4G3S A;  4EAA A;  3DK5 A;  2V0I A;  3OW5 A;  3KWC A;  3ST8 A;  4E6U A;  3IXC A;  3GUE A;  3D98 A;  3BSS A;  1S80 A;  3HSQ A;  1SST A;  3IGJ A;  3SPT A;  2P2O A;  4E75 A;  3KWD A;  3GVD A;  2IU8 A;  2ICY A;  1MR9 A;  3OTM A;  3P1B A;  4KPZ A;  4MFG A;  4HZD A;  4H7O A;  5DEP A;  5E3R A;  2XAT A;  3MQG A;  3R5B A;  3TWD A;  3VBM A;  1HM8 A;  4N6A A;  2WLE A;  2VHE A;  2FKO A;  3GOS A;  2RIJ A;  4ISX A;  4IHG A;  5AFU V;  2V0L A;  3BSW A;  3OH4 A;  1YP3 A;  4N27 A;  2W0W A;  4R7P A;  1N4I A;  4KQL A;  4EGG A;  1QQ0 A;  5ADX U;  2IUA A;  4EA7 A;  2V0H A;  1QRL A;  5U2K A;  3VNP A;  3I3X A;  1XAT A;  1L0S A;  3OH2 A;  3EEV A;  3DHO A;  1LXA A;  1FWY A;  1SSM A;  3DJ4 A;  3GQ8 A;  3OTZ A;  3VBP A;  2V0K A;  4E6T A;  1YP4 A;  3BXY A;  2JF3 A;  3Q1X A;  3FSC A;  4N6B A;  4M2B A;  1FXJ A;  1M8N A;  3KWE A;  1KGQ A;  4EAB A;  2WLF A;  4M99 A;  3TIO A;  4EQY A;  3FSX A;  4KNR A;  4E79 A;  3TV0 A;  1Z90 A;  3CJ8 A;  3R2W A;  4AC3 A;  3TDT A;  2OEF A;  4R37 A;  2JF2 A;  3R5D A;  1YP2 A;  4MYO A;  4EA8 A;  2QKX A;  3FWW A;  2V0J A;  2OI6 A;  4G3Q A;  4AA7 A;  2W0V A;  3OUP A;  3EH0 A;  3P47 A;  4EA9 A;  1KK5 A;  4G3P A;  3R8Y A;  1KK6 A;  2AQ9 A;  1HM9 A;  3VBJ A;  4E1K A;  4M28 A;  5DG3 A;  5ADX V;  5L6V A;  1OCX A;  1QRF A;  3PMO A;  3R5A A;  4DCL A;  1V3W A;  2WLD A;  5E3Q A;  3BFP A;  2IC7 A;  2WLG A;  3FTT A;  3R0S A;  4IHF A;  1V67 A;  3FSY A;  3TIS A;  1HV9 A;  1QRG A;  2GGQ A;  2VD4 A;  3VBN A;  1KRU A;  4K6R A;  1HM0 A;  2Q4J A;  1G97 A;  1KHR A;  3V4E A;  1QRE A;  3ECT A;  4G87 A;  3JQY A;  2QIV X;  3F1X A;  4FCE A;  3FSB A;  4KPX A;  1KK4 A;  3OH0 A;  3OU9 A;  3D8V A;  4J18 A;  3T57 A;  1KGT A;  2QIA A;  3BRK X;  1EWW A;  5F42 A;  1J2Z A;  4M2A A;  2OI5 A; 
#chains in the Genus database with same CATH homology
 1EZG A;  1N4I A;  3GQ9 A;  3GQ8 A;  1M8N A;  1Z2F A;  3GQ7 A;  1L1I A;  1L0S A;  3GQA A;  1EWW A;  3SUC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...