1N4MA

Structure of rb tumor suppressor bound to the transactivation domain of e2f-2
Total Genus 134
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
134
sequence length
345
structure length
345
Chain Sequence
b'NTIQQLMMILNSASDQPSENLISYFNNCTVNPKESILKRVKDIGYIFKEKFAKAVGAGCVAIGSQRYKLGVRLYYRVMESMLKSEEERLSIQNFSKLLNDNIFHMSLLACALEVVMATYSRSTSQNLDSGTDLSFPWILNVLNLKAFDFYKVIESFIKAEGNLTREMIKHLERCEHRIMESLAWLSDSPLFDLIKQSKTREGKSTSLSLFYKKVYRLAYLRLNTLCERLLSEHPELEHIIWTLFQHTLQNEYELMRDRHLDQIMMCSMYGICKVKNIDLKFKIIVTAYKDLPHAVQETFKRVLIKEEEYDSIIVFYNSVFMQRLKTNILQYASTRPPTLSPIPHI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Retinoblastoma Pocket
publication title Structural basis for the recognition of the E2F transactivation domain by the retinoblastoma tumor suppressor
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell cycle
total genus 134
structure length 345
sequence length 345
chains with identical sequence B
ec nomenclature
pdb deposition date 2002-10-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01857 RB_B Retinoblastoma-associated protein B domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.472.10 Mainly Alpha Orthogonal Bundle Cyclin A; domain 1 Cyclin-like 1n4mA02
1.10.472.10 Mainly Alpha Orthogonal Bundle Cyclin A; domain 1 Cyclin-like 1n4mA01
2W9FA 1GUXB 3EIDB 4EOJB 2BKZB 4F7LB 2UUEB 1H1SB 5CEIB 1OL1B 1G3NC 4EOSB 1PKDB 4EC9B 4NSTB 2V22B 3MIAB 2W96A 4EOPB 2WMBB 1H26B 1W98B 2W9ZA 3BLQB 4Y72B 4KRDB 3BLRB 2QDJA 4CFXB 3O0GD 5BNJB 3DOGB 3F5XB 2G9XB 5IDNB 4CFNB 2WEVB 2R7GA 4CFWB 1TFBA 2PMIB 2UZDB 1GH6B 2UZEB 1VINA 5HNBB 5EFQB 3TNIB 1OL2B 2PHGA 2C4GB 1OKVB 3EJ1B 3MI9B 5I5ZB 4ROCA 2C6TB 1JKWA 2B9RA 1F5QB 4II5B 4IMYB 2UZLB 2WHBB 5LQFB 3DDPB 4BCQB 1BU2A 1D3UB 4YOZA 4BCFB 3BHTB 3MY1B 3RGFB 5IF1B 4CFMB 5HVYB 4EOMB 3MY5B 1URCB 4F70B 4BCMB 1FINB 1H1RB 2CCHB 1OIYB 1AD6A 3POMA 1VYWB 2WIHB 2W99A 4EOQB 1OGUB 2WIPB 2X1NB 4EOIB 4BCKB 2JGZB 1KXUA 3BHUB 3TNWB 3QHRB 4BCOB 1JOWA 2WFYB 4EORB 5HBJB 2PK9B 2I40B 2I53A 4F6UB 1C9BA 1VOLA 3LQ5B 1UNGD 4YOOA 4CFUB 1OKWB 1QMZB 1E9HB 5LMKB 2IW8B 4EC8B 2C5OB 1H25B 1H1QB 4F6WB 4G6LB 2UZBB 2BPMB 5HBEB 4RODA 4F7SB 4BCNB 5ICPB 2IW9B 1OIUB 4YOSA 1H4LD 4OGRB 4FX3B 5FGKB 3H4CA 2C5VB 3EOCB 4F6SB 1ZP2A 4ROEA 4BCIB 1GY3B 4CXAB 2WMAB 2WPAB 4ELLA 3TN8B 4F7JB 4EOKB 4BCHB 1O9KA 5HQ0B 2C5NB 4BCJB 4YC3B 2CCIB 4TTHA 5L2WB 2IW6B 3M03A 1GUXA 4ELJA 1H28B 2CJMB 1FVVB 4OR5B 4CFVB 2IVXA 5IDPB 4BCGB 4EONB 1H24B 1AISB 4EOLB 1UNHD 2WXVB 4CFUD 1H27B 1H1PB 5CYIB 1XO2A 2EUFA 2PK2A 1JSTB 1OI9B 3G33B 2W2HA 4BCND 3BLHB 1P5EB 4BCQD 4UN0A 4BCPB 3QHWB 3BHVB 1O9KB 3DDQB 4EOOB 4CRLB 5ACBA 3K7AM 5HBHB 1UNLD 1JSUB 2F2CA 3TNHB 4BCMD 4F7NB 1N4MA 4KRCB 2C5XB 4I3ZB
chains in the Genus database with same CATH superfamily
3NDQA 3PO3S 3X28B 1UGPB 2ZZDB 5CEIB 4EOSB 3MIAB 1QLBA 5DQVA 3DTOA 4ZGEB 1H26B 1W98B 2W9ZA 4BY1X 2KR6A 5BNJB 2G9XB 2R7GA 4OB1B 1GH6B 5HNBB 3TNIB 1V29B 3QZ5B 1OKVB 4ROCA 1F5QB 2WHBB 3HHTB 4BCQB 3QYHB 4YOZA 4CFMB 4EOQB 2DMEA 3BHUB 2WFYB 4ZGDB 2BS3A 4F6UB 2I53A 1C9BA 4JX5A 3DJBA 3X26B 2IW8B 4EC8B 1H25B 4MFDA 2ZPHB 3TW7A 4YOSA 2DXCB 3EOCB 3HB9A 3VYHB 3GTMS 4F7JB 4EOKB 5HQ0B 2C5NB 3HO8A 2CCIB 3BG9A 4OR5B 4CFVB 1H24B 4EOLB 3A8GB 4OB2B 1H27B 1H1PB 1XO2A 4NC6A 1OI9B 1AHJB 3A8HB 2D0QB 3DDQB 4EOOB 4CRLB 3K7AM 3A8MB 3TNHB 4F7NB 2C5XB 4I3ZB 3EIDB 4CFXB 2BKZB 2G77A 4AKHA 4NSTB 3DL1A 3WVEB 2QDYB 3BLQB 4BBSM 5IDNB 4CFWB 4MFEA 2PMIB 1VINA 2CZ7B 5I5ZB 4FM4B 4II5B 4BXXX 1BU2A 1D3UB 3BG5A 4AI6A 5IF1B 1URCB 1FINB 1OIYB 2BS4A 3POMA 2W99A 1OGUB 2WIPB 4EOIB 4BCKB 1KXUA 4BCOB 3A8LB 2PK9B 2I40B 1QMZB 3B57A 5LMKB 2QQ8A 1H1QB 4G6LB 4RODA 4BCNB 4JX4A 2IW9B 2QF7A 4FX3B 5FGKB 3H4CA 1ENWA 2ZPGB 4ROEA 2WMAB 4ELLA 4HNVA 4BCHB 5L2WB 2ZPIB 5DQWA 3A8OB 2IVXA 5IDPB 4EONB 3HBLA 2IN3A 2PK2A 2WJ9A 3BLHB 1P5EB 2DXBB 5ACBA 2F2CA 3QYEA 4BCMD 4KRCB 2W9FA 1GUXB 2UUEB 1TD6A 1OL1B 1G3NC 1PKDB 4EC9B 3BG3A 2WMBB 4Y72B 4BY7X 3BLRB 2QDJA 3O0GD 4BBRM 3F5XB 2WEVB 2ZPBB 1TFBA 2UZDB 2C4GB 3EJ1B 2C6TB 4HNTA 3QZ9B 4BCFB 3BHTB 3RGFB 4EOMB 1FKMA 1H1RB 2CCHB 4AKGA 2X1NB 2QFZA 3QHRB 3TNWB 1JOWA 5HBJB 1UNGD 4MIMA 2LW4A 4CFUB 1OKWB 2ZPFB 4OB3B 2BPMB 3HZJA 4F7SB 5ICPB 2CZ6B 2CYZB 1H4LD 4OGRB 2C5VB 4BCIB 1GY3B 4CXAB 4BCJB 4TTHA 2DD5B 4AKIA 4HLQA 2IW6B 3M03A 1GUXA 2QGSA 3X25B 2CJMB 1UGSB 2KMGA 1UNHD 2WXVB 2EUFA 3TW6A 1JSTB 3VKGA 4BCND 4BCQD 2DPPB 2AHJB 1IREB 1O9KB 3VYGB 5IHYA 1UNLD 1N4MA 3KHIA 4F7LB 4EOJB 2PJQA 3QYGB 4OB0B 1H1SB 2V22B 2W96A 4EOPB 1UGQB 5EJCA 4KRDB 3X20B 3DOGB 4CFNB 2DD4B 4HNUA 2UZEB 5EFQB 1OL2B 2PHGA 2BS2A 3WVDB 3MI9B 3QYBA 1JKWA 2B9RA 4IMYB 2UZLB 5LQFB 3DDPB 3MY1B 5HVYB 3MY5B 2ZCFB 4F70B 4LOCA 3QWLA 4BCMB 1AD6A 1VYWB 2WIHB 2JGZB 4EORB 1VOLA 3LQ5B 1E7PA 4YOOA 1E9HB 4JX6A 2C5OB 4F6WB 2UZBB 5HBEB 4HL4A 3VKHA 1OIUB 4F6SB 1ZP2A 2WPAB 2CZ1B 3TN8B 2CZ0B 1O9KA 4YC3B 4ELJA 1H28B 1FVVB 2ZPEB 3QXEB 4BCGB 4M6VA 4ZGJB 1AISB 4QSHA 4CFUD 4Z6YA 5CYIB 3G33B 1UGRB 2W2HA 4UN0A 4BCPB 3QHWB 3BHVB 5HBHB 1JSUB 3X24B
chains in the Genus database with same CATH topology
2W9FA 1GUXB 3EIDB 4EOJB 2BKZB 4F7LB 2UUEB 1H1SB 5CEIB 1OL1B 1G3NC 4EOSB 1PKDB 4EC9B 4NSTB 2V22B 3MIAB 2W96A 4EOPB 2WMBB 1H26B 1W98B 2W9ZA 3BLQB 4Y72B 4KRDB 3BLRB 2QDJA 4CFXB 3O0GD 5BNJB 3DOGB 3F5XB 2G9XB 5IDNB 4CFNB 2WEVB 2R7GA 4CFWB 1TFBA 2PMIB 2UZDB 1GH6B 2UZEB 1VINA 5HNBB 5EFQB 3TNIB 1OL2B 2PHGA 2C4GB 1OKVB 3EJ1B 3MI9B 5I5ZB 4ROCA 2C6TB 1JKWA 2B9RA 1F5QB 4II5B 4IMYB 2UZLB 2WHBB 5LQFB 3DDPB 4BCQB 1BU2A 1D3UB 4YOZA 4BCFB 3BHTB 3MY1B 3RGFB 5IF1B 4CFMB 5HVYB 4EOMB 3MY5B 1URCB 4F70B 4BCMB 1FINB 1H1RB 2CCHB 1OIYB 1AD6A 3POMA 1VYWB 2WIHB 2W99A 4EOQB 1OGUB 2WIPB 2X1NB 4EOIB 4BCKB 2JGZB 1KXUA 3BHUB 3TNWB 3QHRB 4BCOB 1JOWA 2WFYB 4EORB 5HBJB 2PK9B 2I40B 2I53A 4F6UB 1C9BA 1VOLA 3LQ5B 1UNGD 4YOOA 4CFUB 1OKWB 1QMZB 1E9HB 5LMKB 2IW8B 4EC8B 2C5OB 1H25B 1H1QB 4F6WB 4G6LB 2UZBB 2BPMB 5HBEB 4RODA 4F7SB 4BCNB 5ICPB 2IW9B 1OIUB 4YOSA 1H4LD 4OGRB 4FX3B 5FGKB 3H4CA 2C5VB 3EOCB 4F6SB 1ZP2A 4ROEA 4BCIB 1GY3B 4CXAB 2WMAB 2WPAB 4ELLA 3TN8B 4F7JB 4EOKB 4BCHB 1O9KA 5HQ0B 2C5NB 4BCJB 4YC3B 2CCIB 4TTHA 5L2WB 2IW6B 3M03A 1GUXA 4ELJA 1H28B 2CJMB 1FVVB 4OR5B 4CFVB 2IVXA 5IDPB 4BCGB 4EONB 1H24B 1AISB 4EOLB 1UNHD 2WXVB 4CFUD 1H27B 1H1PB 5CYIB 1XO2A 2EUFA 2PK2A 1JSTB 1OI9B 3G33B 2W2HA 4BCND 3BLHB 1P5EB 4BCQD 4UN0A 4BCPB 3QHWB 3BHVB 1O9KB 3DDQB 4EOOB 4CRLB 5ACBA 3K7AM 5HBHB 1UNLD 1JSUB 2F2CA 3TNHB 4BCMD 4F7NB 1N4MA 4KRCB 2C5XB 4I3ZB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2W9F A;  1GUX B;  3EID B;  4EOJ B;  2BKZ B;  4F7L B;  2UUE B;  1H1S B;  5CEI B;  1OL1 B;  1G3N C;  4EOS B;  1PKD B;  4EC9 B;  4NST B;  2V22 B;  3MIA B;  2W96 A;  4EOP B;  2WMB B;  1H26 B;  1W98 B;  2W9Z A;  3BLQ B;  4Y72 B;  4KRD B;  3BLR B;  2QDJ A;  4CFX B;  3O0G D;  5BNJ B;  3DOG B;  3F5X B;  2G9X B;  5IDN B;  4CFN B;  2WEV B;  2R7G A;  4CFW B;  1TFB A;  2PMI B;  2UZD B;  1GH6 B;  2UZE B;  1VIN A;  5HNB B;  5EFQ B;  3TNI B;  1OL2 B;  2PHG A;  2C4G B;  1OKV B;  3EJ1 B;  3MI9 B;  5I5Z B;  4ROC A;  2C6T B;  1JKW A;  2B9R A;  1F5Q B;  4II5 B;  4IMY B;  2UZL B;  2WHB B;  5LQF B;  3DDP B;  4BCQ B;  1BU2 A;  1D3U B;  4YOZ A;  4BCF B;  3BHT B;  3MY1 B;  3RGF B;  5IF1 B;  4CFM B;  5HVY B;  4EOM B;  3MY5 B;  1URC B;  4F70 B;  4BCM B;  1FIN B;  1H1R B;  2CCH B;  1OIY B;  1AD6 A;  3POM A;  1VYW B;  2WIH B;  2W99 A;  4EOQ B;  1OGU B;  2WIP B;  2X1N B;  4EOI B;  4BCK B;  2JGZ B;  1KXU A;  3BHU B;  3TNW B;  3QHR B;  4BCO B;  1JOW A;  2WFY B;  4EOR B;  5HBJ B;  2PK9 B;  2I40 B;  2I53 A;  4F6U B;  1C9B A;  1VOL A;  3LQ5 B;  1UNG D;  4YOO A;  4CFU B;  1OKW B;  1QMZ B;  1E9H B;  5LMK B;  2IW8 B;  4EC8 B;  2C5O B;  1H25 B;  1H1Q B;  4F6W B;  4G6L B;  2UZB B;  2BPM B;  5HBE B;  4ROD A;  4F7S B;  4BCN B;  5ICP B;  2IW9 B;  1OIU B;  4YOS A;  1H4L D;  4OGR B;  4FX3 B;  5FGK B;  3H4C A;  2C5V B;  3EOC B;  4F6S B;  1ZP2 A;  4ROE A;  4BCI B;  1GY3 B;  4CXA B;  2WMA B;  2WPA B;  4ELL A;  3TN8 B;  4F7J B;  4EOK B;  4BCH B;  1O9K A;  5HQ0 B;  2C5N B;  4BCJ B;  4YC3 B;  2CCI B;  4TTH A;  5L2W B;  2IW6 B;  3M03 A;  1GUX A;  4ELJ A;  1H28 B;  2CJM B;  1FVV B;  4OR5 B;  4CFV B;  2IVX A;  5IDP B;  4BCG B;  4EON B;  1H24 B;  1AIS B;  4EOL B;  1UNH D;  2WXV B;  4CFU D;  1H27 B;  1H1P B;  5CYI B;  1XO2 A;  2EUF A;  2PK2 A;  1JST B;  1OI9 B;  3G33 B;  2W2H A;  4BCN D;  3BLH B;  1P5E B;  4BCQ D;  4UN0 A;  4BCP B;  3QHW B;  3BHV B;  1O9K B;  3DDQ B;  4EOO B;  4CRL B;  5ACB A;  3K7A M;  5HBH B;  1UNL D;  1JSU B;  2F2C A;  3TNH B;  4BCM D;  4F7N B;  1N4M A;  4KRC B;  2C5X B;  4I3Z B; 
#chains in the Genus database with same CATH topology
 3NDQ A;  3PO3 S;  3X28 B;  1UGP B;  2ZZD B;  5CEI B;  4EOS B;  3MIA B;  1QLB A;  5DQV A;  3DTO A;  4ZGE B;  1H26 B;  1W98 B;  2W9Z A;  4BY1 X;  2KR6 A;  5BNJ B;  2G9X B;  2R7G A;  4OB1 B;  1GH6 B;  5HNB B;  3TNI B;  1V29 B;  3QZ5 B;  1OKV B;  4ROC A;  1F5Q B;  2WHB B;  3HHT B;  4BCQ B;  3QYH B;  4YOZ A;  4CFM B;  4EOQ B;  2DME A;  3BHU B;  2WFY B;  4ZGD B;  2BS3 A;  4F6U B;  2I53 A;  1C9B A;  4JX5 A;  3DJB A;  3X26 B;  2IW8 B;  4EC8 B;  1H25 B;  4MFD A;  2ZPH B;  3TW7 A;  4YOS A;  2DXC B;  3EOC B;  3HB9 A;  3VYH B;  3GTM S;  4F7J B;  4EOK B;  5HQ0 B;  2C5N B;  3HO8 A;  2CCI B;  3BG9 A;  4OR5 B;  4CFV B;  1H24 B;  4EOL B;  3A8G B;  4OB2 B;  1H27 B;  1H1P B;  1XO2 A;  4NC6 A;  1OI9 B;  1AHJ B;  3A8H B;  2D0Q B;  3DDQ B;  4EOO B;  4CRL B;  3K7A M;  3A8M B;  3TNH B;  4F7N B;  2C5X B;  4I3Z B;  3EID B;  4CFX B;  2BKZ B;  2G77 A;  4AKH A;  4NST B;  3DL1 A;  3WVE B;  2QDY B;  3BLQ B;  4BBS M;  5IDN B;  4CFW B;  4MFE A;  2PMI B;  1VIN A;  2CZ7 B;  5I5Z B;  4FM4 B;  4II5 B;  4BXX X;  1BU2 A;  1D3U B;  3BG5 A;  4AI6 A;  5IF1 B;  1URC B;  1FIN B;  1OIY B;  2BS4 A;  3POM A;  2W99 A;  1OGU B;  2WIP B;  4EOI B;  4BCK B;  1KXU A;  4BCO B;  3A8L B;  2PK9 B;  2I40 B;  1QMZ B;  3B57 A;  5LMK B;  2QQ8 A;  1H1Q B;  4G6L B;  4ROD A;  4BCN B;  4JX4 A;  2IW9 B;  2QF7 A;  4FX3 B;  5FGK B;  3H4C A;  1ENW A;  2ZPG B;  4ROE A;  2WMA B;  4ELL A;  4HNV A;  4BCH B;  5L2W B;  2ZPI B;  5DQW A;  3A8O B;  2IVX A;  5IDP B;  4EON B;  3HBL A;  2IN3 A;  2PK2 A;  2WJ9 A;  3BLH B;  1P5E B;  2DXB B;  5ACB A;  2F2C A;  3QYE A;  4BCM D;  4KRC B;  2W9F A;  1GUX B;  2UUE B;  1TD6 A;  1OL1 B;  1G3N C;  1PKD B;  4EC9 B;  3BG3 A;  2WMB B;  4Y72 B;  4BY7 X;  3BLR B;  2QDJ A;  3O0G D;  4BBR M;  3F5X B;  2WEV B;  2ZPB B;  1TFB A;  2UZD B;  2C4G B;  3EJ1 B;  2C6T B;  4HNT A;  3QZ9 B;  4BCF B;  3BHT B;  3RGF B;  4EOM B;  1FKM A;  1H1R B;  2CCH B;  4AKG A;  2X1N B;  2QFZ A;  3QHR B;  3TNW B;  1JOW A;  5HBJ B;  1UNG D;  4MIM A;  2LW4 A;  4CFU B;  1OKW B;  2ZPF B;  4OB3 B;  2BPM B;  3HZJ A;  4F7S B;  5ICP B;  2CZ6 B;  2CYZ B;  1H4L D;  4OGR B;  2C5V B;  4BCI B;  1GY3 B;  4CXA B;  4BCJ B;  4TTH A;  2DD5 B;  4AKI A;  4HLQ A;  2IW6 B;  3M03 A;  1GUX A;  2QGS A;  3X25 B;  2CJM B;  1UGS B;  2KMG A;  1UNH D;  2WXV B;  2EUF A;  3TW6 A;  1JST B;  3VKG A;  4BCN D;  4BCQ D;  2DPP B;  2AHJ B;  1IRE B;  1O9K B;  3VYG B;  5IHY A;  1UNL D;  1N4M A;  3KHI A;  4F7L B;  4EOJ B;  2PJQ A;  3QYG B;  4OB0 B;  1H1S B;  2V22 B;  2W96 A;  4EOP B;  1UGQ B;  5EJC A;  4KRD B;  3X20 B;  3DOG B;  4CFN B;  2DD4 B;  4HNU A;  2UZE B;  5EFQ B;  1OL2 B;  2PHG A;  2BS2 A;  3WVD B;  3MI9 B;  3QYB A;  1JKW A;  2B9R A;  4IMY B;  2UZL B;  5LQF B;  3DDP B;  3MY1 B;  5HVY B;  3MY5 B;  2ZCF B;  4F70 B;  4LOC A;  3QWL A;  4BCM B;  1AD6 A;  1VYW B;  2WIH B;  2JGZ B;  4EOR B;  1VOL A;  3LQ5 B;  1E7P A;  4YOO A;  1E9H B;  4JX6 A;  2C5O B;  4F6W B;  2UZB B;  5HBE B;  4HL4 A;  3VKH A;  1OIU B;  4F6S B;  1ZP2 A;  2WPA B;  2CZ1 B;  3TN8 B;  2CZ0 B;  1O9K A;  4YC3 B;  4ELJ A;  1H28 B;  1FVV B;  2ZPE B;  3QXE B;  4BCG B;  4M6V A;  4ZGJ B;  1AIS B;  4QSH A;  4CFU D;  4Z6Y A;  5CYI B;  3G33 B;  1UGR B;  2W2H A;  4UN0 A;  4BCP B;  3QHW B;  3BHV B;  5HBH B;  1JSU B;  3X24 B; 
#chains in the Genus database with same CATH homology
 2W9F A;  1GUX B;  3EID B;  4EOJ B;  2BKZ B;  4F7L B;  2UUE B;  1H1S B;  5CEI B;  1OL1 B;  1G3N C;  4EOS B;  1PKD B;  4EC9 B;  4NST B;  2V22 B;  3MIA B;  2W96 A;  4EOP B;  2WMB B;  1H26 B;  1W98 B;  2W9Z A;  3BLQ B;  4Y72 B;  4KRD B;  3BLR B;  2QDJ A;  4CFX B;  3O0G D;  5BNJ B;  3DOG B;  3F5X B;  2G9X B;  5IDN B;  4CFN B;  2WEV B;  2R7G A;  4CFW B;  1TFB A;  2PMI B;  2UZD B;  1GH6 B;  2UZE B;  1VIN A;  5HNB B;  5EFQ B;  3TNI B;  1OL2 B;  2PHG A;  2C4G B;  1OKV B;  3EJ1 B;  3MI9 B;  5I5Z B;  4ROC A;  2C6T B;  1JKW A;  2B9R A;  1F5Q B;  4II5 B;  4IMY B;  2UZL B;  2WHB B;  5LQF B;  3DDP B;  4BCQ B;  1BU2 A;  1D3U B;  4YOZ A;  4BCF B;  3BHT B;  3MY1 B;  3RGF B;  5IF1 B;  4CFM B;  5HVY B;  4EOM B;  3MY5 B;  1URC B;  4F70 B;  4BCM B;  1FIN B;  1H1R B;  2CCH B;  1OIY B;  1AD6 A;  3POM A;  1VYW B;  2WIH B;  2W99 A;  4EOQ B;  1OGU B;  2WIP B;  2X1N B;  4EOI B;  4BCK B;  2JGZ B;  1KXU A;  3BHU B;  3TNW B;  3QHR B;  4BCO B;  1JOW A;  2WFY B;  4EOR B;  5HBJ B;  2PK9 B;  2I40 B;  2I53 A;  4F6U B;  1C9B A;  1VOL A;  3LQ5 B;  1UNG D;  4YOO A;  4CFU B;  1OKW B;  1QMZ B;  1E9H B;  5LMK B;  2IW8 B;  4EC8 B;  2C5O B;  1H25 B;  1H1Q B;  4F6W B;  4G6L B;  2UZB B;  2BPM B;  5HBE B;  4ROD A;  4F7S B;  4BCN B;  5ICP B;  2IW9 B;  1OIU B;  4YOS A;  1H4L D;  4OGR B;  4FX3 B;  5FGK B;  3H4C A;  2C5V B;  3EOC B;  4F6S B;  1ZP2 A;  4ROE A;  4BCI B;  1GY3 B;  4CXA B;  2WMA B;  2WPA B;  4ELL A;  3TN8 B;  4F7J B;  4EOK B;  4BCH B;  1O9K A;  5HQ0 B;  2C5N B;  4BCJ B;  4YC3 B;  2CCI B;  4TTH A;  5L2W B;  2IW6 B;  3M03 A;  1GUX A;  4ELJ A;  1H28 B;  2CJM B;  1FVV B;  4OR5 B;  4CFV B;  2IVX A;  5IDP B;  4BCG B;  4EON B;  1H24 B;  1AIS B;  4EOL B;  1UNH D;  2WXV B;  4CFU D;  1H27 B;  1H1P B;  5CYI B;  1XO2 A;  2EUF A;  2PK2 A;  1JST B;  1OI9 B;  3G33 B;  2W2H A;  4BCN D;  3BLH B;  1P5E B;  4BCQ D;  4UN0 A;  4BCP B;  3QHW B;  3BHV B;  1O9K B;  3DDQ B;  4EOO B;  4CRL B;  5ACB A;  3K7A M;  5HBH B;  1UNL D;  1JSU B;  2F2C A;  3TNH B;  4BCM D;  4F7N B;  1N4M A;  4KRC B;  2C5X B;  4I3Z B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...