1N4MA

Structure of rb tumor suppressor bound to the transactivation domain of e2f-2
Total Genus 134
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
134
sequence length
345
structure length
345
Chain Sequence
NTIQQLMMILNSASDQPSENLISYFNNCTVNPKESILKRVKDIGYIFKEKFAKAVGAGCVAIGSQRYKLGVRLYYRVMESMLKSEEERLSIQNFSKLLNDNIFHMSLLACALEVVMATYSRSTSQNLDSGTDLSFPWILNVLNLKAFDFYKVIESFIKAEGNLTREMIKHLERCEHRIMESLAWLSDSPLFDLIKQSKTREGKSTSLSLFYKKVYRLAYLRLNTLCERLLSEHPELEHIIWTLFQHTLQNEYELMRDRHLDQIMMCSMYGICKVKNIDLKFKIIVTAYKDLPHAVQETFKRVLIKEEEYDSIIVFYNSVFMQRLKTNILQYASTRPPTLSPIPHI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Retinoblastoma Pocket
publication title Structural basis for the recognition of the E2F transactivation domain by the retinoblastoma tumor suppressor
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell cycle
total genus 134
structure length 345
sequence length 345
chains with identical sequence B
ec nomenclature
pdb deposition date 2002-10-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01857 RB_B Retinoblastoma-associated protein B domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.472.10 Mainly Alpha Orthogonal Bundle Cyclin A; domain 1 Cyclin-like 1n4mA02
1.10.472.10 Mainly Alpha Orthogonal Bundle Cyclin A; domain 1 Cyclin-like 1n4mA01
1H1PB 4CXAB 4F7NB 4YOSA 1AISB 1H24B 1OIUB 4CFVB 4F7JB 1OI9B 2WHBB 2I40B 1H27B 2W99A 2WMBB 5IDPB 1JOWA 1OL2B 1ZP2A 4BCIB 2UZDB 4YOOA 2X1NB 2EUFA 1C9BA 3H4CA 3G33B 1H1RB 4YOZA 1H4LD 4BCQD 2R7GA 3K7AM 2B9RA 3F5XB 3QHWB 5ACBA 4BCND 1H25B 4IMYB 3BLHB 2IW6B 1H1SB 1OIYB 2PMIB 4NSTB 1KXUA 2C5NB 2PHGA 1F5QB 4CFUB 1O9KA 3TNHB 1O9KB 2UZBB 1VINA 1UNGD 5HQ0B 2W9ZA 1H28B 4EOLB 1OKVB 1VYWB 4CFWB 2I53A 3TNWB 1UNHD 2WIPB 2F2CA 1E9HB 2V22B 5CEIB 2WMAB 4CFXB 2WXVB 1XO2A 5HBHB 1JSTB 4BCKB 2CCIB 3EJ1B 2C6TB 4OR5B 1OGUB 4BCQB 4EOJB 1AD6A 4F6WB 3POMA 2BKZB 3DDPB 4TTHA 1JSUB 4F7LB 2WEVB 2BPMB 2C5OB 4BCNB 3EIDB 3M03A 3O0GD 4FX3B 3MY5B 1TFBA 5HBJB 1FINB 5LQFB 3BLQB 1PKDB 4KRCB 4BCOB 3TNIB 2JGZB 4Y72B 5EFQB 2IW8B 4OGRB 1G3NC 4ELLA 5ICPB 3MY1B 3BLRB 3TN8B 5IF1B 4EOKB 5LMKB 5HNBB 4BCJB 2C5VB 2PK2A 4KRDB 1JKWA 1QMZB 2QDJA 4BCMD 1URCB 1GUXA 4F7SB 1GUXB 5HVYB 4II5B 1GH6B 4F6SB 4YC3B 4RODA 4ROCA 4BCHB 2WPAB 5CYIB 5I5ZB 2PK9B 1W98B 2C4GB 3DOGB 1FVVB 2W9FA 4BCFB 4ROEA 4EOSB 1H26B 4CRLB 4G6LB 3MI9B 5FGKB 4F70B 3BHTB 4EOMB 3MIAB 2UUEB 5L2WB 1N4MA 2CJMB 2W2HA 4BCGB 4EORB 2WFYB 1GY3B 4EOQB 2UZEB 2G9XB 1OKWB 2UZLB 4I3ZB 5HBEB 4EOOB 3BHVB 1UNLD 2W96A 1OL1B 4ELJA 2C5XB 3LQ5B 4CFMB 1H1QB 3QHRB 3RGFB 3DDQB 4EC9B 4EONB 4BCMB 1VOLA 2IW9B 4EOPB 4F6UB 1P5EB 4EOIB 5IDNB 4BCPB 1D3UB 3EOCB 5BNJB 1BU2A 2IVXA 2WIHB 4EC8B 3BHUB 4CFNB 4UN0A 4CFUD 2CCHB
chains in the Genus database with same CATH superfamily
1AISB 1H24B 1OIUB 2ZPGB 2UZDB 3VKHA 3G33B 1H4LD 3F5XB 3VYHB 3BLHB 1OIYB 4NSTB 2C5NB 1F5QB 2AHJB 3TNHB 3DTOA 4EOLB 1VYWB 4CFWB 1AHJB 1UNHD 2F2CA 1E9HB 5CEIB 2DPPB 2WMAB 2IN3A 3VYGB 3EJ1B 2C6TB 4BCQB 1QLBA 1AD6A 3GTMS 4TTHA 2BPMB 4ZGJB 4BCNB 3X25B 4FX3B 1FINB 3BLQB 1PKDB 4BCOB 2WJ9A 4ELLA 3BLRB 5IHYA 4EOKB 5LMKB 4KRDB 1QMZB 4F7SB 1URCB 5HVYB 4II5B 4BCHB 5CYIB 3DOGB 2W9FA 3MI9B 3MIAB 2CJMB 2CZ7B 4EORB 2WFYB 2QFZA 4OB1B 2DMEA 3QHRB 4EC9B 4BCMB 1VOLA 4F6UB 4BBSM 3X20B 4EOIB 4CFNB 4UN0A 2CCHB 1H1PB 2G77A 4YOSA 2I40B 1H27B 2W99A 5IDPB 4YOOA 3QYHB 2BS4A 3A8GB 4AKGA 1H25B 4IMYB 1H1SB 3QYEA 2PMIB 4CFUB 2PHGA 1O9KA 1O9KB 2UZBB 1UGQB 2ZPEB 5HQ0B 2DXCB 2W9ZA 1H28B 4LOCA 2WIPB 2BS3A 4JX4A 1XO2A 5HBHB 4BCKB 4OR5B 2ZPIB 2KR6A 3POMA 2BKZB 2WEVB 3BG3A 3WVEB 2C5OB 2ZPBB 3O0GD 3DJBA 3MY5B 3HZJA 4Y72B 3TW6A 4BY1X 2CYZB 4BCJB 2C5VB 4MFDA 1GUXA 1GUXB 1GH6B 4F6SB 4YC3B 4RODA 2CZ6B 4Z6YA 5I5ZB 3VKGA 2C4GB 1FVVB 3PO3S 1H26B 3KHIA 4OB2B 4CRLB 1FKMA 5L2WB 3X24B 1GY3B 2DD4B 4EOOB 3BHVB 4JX5A 2C5XB 4CFMB 1H1QB 3RGFB 3DDQB 3QZ9B 4EOPB 2ZCFB 5DQVA 4HNUA 4BCPB 3EOCB 2KMGA 3BHUB 4BY7X 1UGPB 4CXAB 4F7NB 1E7PA 2QGSA 1ENWA 1UGSB 2ZPFB 4CFVB 4F7JB 2WHBB 1JOWA 3X26B 1OL2B 2QQ8A 1ZP2A 4AKHA 2EUFA 1C9BA 4HLQA 3H4CA 1H1RB 4YOZA 3A8LB 4BCQD 3K7AM 3HHTB 5DQWA 5EJCA 5ACBA 4BCND 2IW6B 2ZZDB 3NDQA 1KXUA 1TD6A 1VINA 4MIMA 1UNGD 2I53A 2V22B 1IREB 2WXVB 1JSTB 2CCIB 1OGUB 3B57A 4EOJB 3A8MB 1JSUB 4OB0B 3M03A 5HBJB 5LQFB 3HO8A 4KRCB 3TNIB 2JGZB 5EFQB 2IW8B 4NC6A 3QZ5B 1G3NC 5ICPB 5IF1B 2DD5B 2PK2A 1JKWA 4BCMD 3QYGB 4BCFB 1W98B 4ROEA 4F70B 3BHTB 4EOMB 4OB3B 2UZEB 2G9XB 2UZLB 5HBEB 2PJQA 1OL1B 2W96A 3LQ5B 4HL4A 1P5EB 2LW4A 4QSHA 4FM4B 1V29B 3HB9A 4ZGEB 3A8OB 4CFUD 1OI9B 2WMBB 2QDYB 3BG9A 4BCIB 2X1NB 2ZPHB 2R7GA 2B9RA 3QHWB 4M6VA 4HNVA 2D0QB 1OKVB 3TNWB 4CFXB 3WVDB 3QWLA 4F6WB 3DDPB 4F7LB 1UGRB 3EIDB 3QXEB 4MFEA 1TFBA 3BG5A 3DL1A 4OGRB 3MY1B 3TN8B 5HNBB 2QDJA 4ROCA 2WPAB 4JX6A 4HNTA 2PK9B 2BS2A 4EOSB 4G6LB 5FGKB 3X28B 2UUEB 1N4MA 3QYBA 4ZGDB 2W2HA 4BCGB 3A8HB 2QF7A 4EOQB 3TW7A 1OKWB 4I3ZB 2DXBB 1UNLD 4BBRM 4ELJA 4EONB 4AI6A 2IW9B 5IDNB 1D3UB 2CZ1B 5BNJB 4AKIA 1BU2A 2IVXA 2WIHB 4BXXX 3HBLA 4EC8B 2CZ0B
chains in the Genus database with same CATH topology
1H1PB 4CXAB 4F7NB 4YOSA 1AISB 1H24B 1OIUB 4CFVB 4F7JB 1OI9B 2WHBB 2I40B 1H27B 2W99A 2WMBB 5IDPB 1JOWA 1OL2B 1ZP2A 4BCIB 2UZDB 4YOOA 2X1NB 2EUFA 1C9BA 3H4CA 3G33B 1H1RB 4YOZA 1H4LD 4BCQD 2R7GA 3K7AM 2B9RA 3F5XB 3QHWB 5ACBA 4BCND 1H25B 4IMYB 3BLHB 2IW6B 1H1SB 1OIYB 2PMIB 4NSTB 1KXUA 2C5NB 2PHGA 1F5QB 4CFUB 1O9KA 3TNHB 1O9KB 2UZBB 1VINA 1UNGD 5HQ0B 2W9ZA 1H28B 4EOLB 1OKVB 1VYWB 4CFWB 2I53A 3TNWB 1UNHD 2WIPB 2F2CA 1E9HB 2V22B 5CEIB 2WMAB 4CFXB 2WXVB 1XO2A 5HBHB 1JSTB 4BCKB 2CCIB 3EJ1B 2C6TB 4OR5B 1OGUB 4BCQB 4EOJB 1AD6A 4F6WB 3POMA 2BKZB 3DDPB 4TTHA 1JSUB 4F7LB 2WEVB 2BPMB 2C5OB 4BCNB 3EIDB 3M03A 3O0GD 4FX3B 3MY5B 1TFBA 5HBJB 1FINB 5LQFB 3BLQB 1PKDB 4KRCB 4BCOB 3TNIB 2JGZB 4Y72B 5EFQB 2IW8B 4OGRB 1G3NC 4ELLA 5ICPB 3MY1B 3BLRB 3TN8B 5IF1B 4EOKB 5LMKB 5HNBB 4BCJB 2C5VB 2PK2A 4KRDB 1JKWA 1QMZB 2QDJA 4BCMD 1URCB 1GUXA 4F7SB 1GUXB 5HVYB 4II5B 1GH6B 4F6SB 4YC3B 4RODA 4ROCA 4BCHB 2WPAB 5CYIB 5I5ZB 2PK9B 1W98B 2C4GB 3DOGB 1FVVB 2W9FA 4BCFB 4ROEA 4EOSB 1H26B 4CRLB 4G6LB 3MI9B 5FGKB 4F70B 3BHTB 4EOMB 3MIAB 2UUEB 5L2WB 1N4MA 2CJMB 2W2HA 4BCGB 4EORB 2WFYB 1GY3B 4EOQB 2UZEB 2G9XB 1OKWB 2UZLB 4I3ZB 5HBEB 4EOOB 3BHVB 1UNLD 2W96A 1OL1B 4ELJA 2C5XB 3LQ5B 4CFMB 1H1QB 3QHRB 3RGFB 3DDQB 4EC9B 4EONB 4BCMB 1VOLA 2IW9B 4EOPB 4F6UB 1P5EB 4EOIB 5IDNB 4BCPB 1D3UB 3EOCB 5BNJB 1BU2A 2IVXA 2WIHB 4EC8B 3BHUB 4CFNB 4UN0A 4CFUD 2CCHB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1H1P B;  4CXA B;  4F7N B;  4YOS A;  1AIS B;  1H24 B;  1OIU B;  4CFV B;  4F7J B;  1OI9 B;  2WHB B;  2I40 B;  1H27 B;  2W99 A;  2WMB B;  5IDP B;  1JOW A;  1OL2 B;  1ZP2 A;  4BCI B;  2UZD B;  4YOO A;  2X1N B;  2EUF A;  1C9B A;  3H4C A;  3G33 B;  1H1R B;  4YOZ A;  1H4L D;  4BCQ D;  2R7G A;  3K7A M;  2B9R A;  3F5X B;  3QHW B;  5ACB A;  4BCN D;  1H25 B;  4IMY B;  3BLH B;  2IW6 B;  1H1S B;  1OIY B;  2PMI B;  4NST B;  1KXU A;  2C5N B;  2PHG A;  1F5Q B;  4CFU B;  1O9K A;  3TNH B;  1O9K B;  2UZB B;  1VIN A;  1UNG D;  5HQ0 B;  2W9Z A;  1H28 B;  4EOL B;  1OKV B;  1VYW B;  4CFW B;  2I53 A;  3TNW B;  1UNH D;  2WIP B;  2F2C A;  1E9H B;  2V22 B;  5CEI B;  2WMA B;  4CFX B;  2WXV B;  1XO2 A;  5HBH B;  1JST B;  4BCK B;  2CCI B;  3EJ1 B;  2C6T B;  4OR5 B;  1OGU B;  4BCQ B;  4EOJ B;  1AD6 A;  4F6W B;  3POM A;  2BKZ B;  3DDP B;  4TTH A;  1JSU B;  4F7L B;  2WEV B;  2BPM B;  2C5O B;  4BCN B;  3EID B;  3M03 A;  3O0G D;  4FX3 B;  3MY5 B;  1TFB A;  5HBJ B;  1FIN B;  5LQF B;  3BLQ B;  1PKD B;  4KRC B;  4BCO B;  3TNI B;  2JGZ B;  4Y72 B;  5EFQ B;  2IW8 B;  4OGR B;  1G3N C;  4ELL A;  5ICP B;  3MY1 B;  3BLR B;  3TN8 B;  5IF1 B;  4EOK B;  5LMK B;  5HNB B;  4BCJ B;  2C5V B;  2PK2 A;  4KRD B;  1JKW A;  1QMZ B;  2QDJ A;  4BCM D;  1URC B;  1GUX A;  4F7S B;  1GUX B;  5HVY B;  4II5 B;  1GH6 B;  4F6S B;  4YC3 B;  4ROD A;  4ROC A;  4BCH B;  2WPA B;  5CYI B;  5I5Z B;  2PK9 B;  1W98 B;  2C4G B;  3DOG B;  1FVV B;  2W9F A;  4BCF B;  4ROE A;  4EOS B;  1H26 B;  4CRL B;  4G6L B;  3MI9 B;  5FGK B;  4F70 B;  3BHT B;  4EOM B;  3MIA B;  2UUE B;  5L2W B;  1N4M A;  2CJM B;  2W2H A;  4BCG B;  4EOR B;  2WFY B;  1GY3 B;  4EOQ B;  2UZE B;  2G9X B;  1OKW B;  2UZL B;  4I3Z B;  5HBE B;  4EOO B;  3BHV B;  1UNL D;  2W96 A;  1OL1 B;  4ELJ A;  2C5X B;  3LQ5 B;  4CFM B;  1H1Q B;  3QHR B;  3RGF B;  3DDQ B;  4EC9 B;  4EON B;  4BCM B;  1VOL A;  2IW9 B;  4EOP B;  4F6U B;  1P5E B;  4EOI B;  5IDN B;  4BCP B;  1D3U B;  3EOC B;  5BNJ B;  1BU2 A;  2IVX A;  2WIH B;  4EC8 B;  3BHU B;  4CFN B;  4UN0 A;  4CFU D;  2CCH B; 
#chains in the Genus database with same CATH topology
 1AIS B;  1H24 B;  1OIU B;  2ZPG B;  2UZD B;  3VKH A;  3G33 B;  1H4L D;  3F5X B;  3VYH B;  3BLH B;  1OIY B;  4NST B;  2C5N B;  1F5Q B;  2AHJ B;  3TNH B;  3DTO A;  4EOL B;  1VYW B;  4CFW B;  1AHJ B;  1UNH D;  2F2C A;  1E9H B;  5CEI B;  2DPP B;  2WMA B;  2IN3 A;  3VYG B;  3EJ1 B;  2C6T B;  4BCQ B;  1QLB A;  1AD6 A;  3GTM S;  4TTH A;  2BPM B;  4ZGJ B;  4BCN B;  3X25 B;  4FX3 B;  1FIN B;  3BLQ B;  1PKD B;  4BCO B;  2WJ9 A;  4ELL A;  3BLR B;  5IHY A;  4EOK B;  5LMK B;  4KRD B;  1QMZ B;  4F7S B;  1URC B;  5HVY B;  4II5 B;  4BCH B;  5CYI B;  3DOG B;  2W9F A;  3MI9 B;  3MIA B;  2CJM B;  2CZ7 B;  4EOR B;  2WFY B;  2QFZ A;  4OB1 B;  2DME A;  3QHR B;  4EC9 B;  4BCM B;  1VOL A;  4F6U B;  4BBS M;  3X20 B;  4EOI B;  4CFN B;  4UN0 A;  2CCH B;  1H1P B;  2G77 A;  4YOS A;  2I40 B;  1H27 B;  2W99 A;  5IDP B;  4YOO A;  3QYH B;  2BS4 A;  3A8G B;  4AKG A;  1H25 B;  4IMY B;  1H1S B;  3QYE A;  2PMI B;  4CFU B;  2PHG A;  1O9K A;  1O9K B;  2UZB B;  1UGQ B;  2ZPE B;  5HQ0 B;  2DXC B;  2W9Z A;  1H28 B;  4LOC A;  2WIP B;  2BS3 A;  4JX4 A;  1XO2 A;  5HBH B;  4BCK B;  4OR5 B;  2ZPI B;  2KR6 A;  3POM A;  2BKZ B;  2WEV B;  3BG3 A;  3WVE B;  2C5O B;  2ZPB B;  3O0G D;  3DJB A;  3MY5 B;  3HZJ A;  4Y72 B;  3TW6 A;  4BY1 X;  2CYZ B;  4BCJ B;  2C5V B;  4MFD A;  1GUX A;  1GUX B;  1GH6 B;  4F6S B;  4YC3 B;  4ROD A;  2CZ6 B;  4Z6Y A;  5I5Z B;  3VKG A;  2C4G B;  1FVV B;  3PO3 S;  1H26 B;  3KHI A;  4OB2 B;  4CRL B;  1FKM A;  5L2W B;  3X24 B;  1GY3 B;  2DD4 B;  4EOO B;  3BHV B;  4JX5 A;  2C5X B;  4CFM B;  1H1Q B;  3RGF B;  3DDQ B;  3QZ9 B;  4EOP B;  2ZCF B;  5DQV A;  4HNU A;  4BCP B;  3EOC B;  2KMG A;  3BHU B;  4BY7 X;  1UGP B;  4CXA B;  4F7N B;  1E7P A;  2QGS A;  1ENW A;  1UGS B;  2ZPF B;  4CFV B;  4F7J B;  2WHB B;  1JOW A;  3X26 B;  1OL2 B;  2QQ8 A;  1ZP2 A;  4AKH A;  2EUF A;  1C9B A;  4HLQ A;  3H4C A;  1H1R B;  4YOZ A;  3A8L B;  4BCQ D;  3K7A M;  3HHT B;  5DQW A;  5EJC A;  5ACB A;  4BCN D;  2IW6 B;  2ZZD B;  3NDQ A;  1KXU A;  1TD6 A;  1VIN A;  4MIM A;  1UNG D;  2I53 A;  2V22 B;  1IRE B;  2WXV B;  1JST B;  2CCI B;  1OGU B;  3B57 A;  4EOJ B;  3A8M B;  1JSU B;  4OB0 B;  3M03 A;  5HBJ B;  5LQF B;  3HO8 A;  4KRC B;  3TNI B;  2JGZ B;  5EFQ B;  2IW8 B;  4NC6 A;  3QZ5 B;  1G3N C;  5ICP B;  5IF1 B;  2DD5 B;  2PK2 A;  1JKW A;  4BCM D;  3QYG B;  4BCF B;  1W98 B;  4ROE A;  4F70 B;  3BHT B;  4EOM B;  4OB3 B;  2UZE B;  2G9X B;  2UZL B;  5HBE B;  2PJQ A;  1OL1 B;  2W96 A;  3LQ5 B;  4HL4 A;  1P5E B;  2LW4 A;  4QSH A;  4FM4 B;  1V29 B;  3HB9 A;  4ZGE B;  3A8O B;  4CFU D;  1OI9 B;  2WMB B;  2QDY B;  3BG9 A;  4BCI B;  2X1N B;  2ZPH B;  2R7G A;  2B9R A;  3QHW B;  4M6V A;  4HNV A;  2D0Q B;  1OKV B;  3TNW B;  4CFX B;  3WVD B;  3QWL A;  4F6W B;  3DDP B;  4F7L B;  1UGR B;  3EID B;  3QXE B;  4MFE A;  1TFB A;  3BG5 A;  3DL1 A;  4OGR B;  3MY1 B;  3TN8 B;  5HNB B;  2QDJ A;  4ROC A;  2WPA B;  4JX6 A;  4HNT A;  2PK9 B;  2BS2 A;  4EOS B;  4G6L B;  5FGK B;  3X28 B;  2UUE B;  1N4M A;  3QYB A;  4ZGD B;  2W2H A;  4BCG B;  3A8H B;  2QF7 A;  4EOQ B;  3TW7 A;  1OKW B;  4I3Z B;  2DXB B;  1UNL D;  4BBR M;  4ELJ A;  4EON B;  4AI6 A;  2IW9 B;  5IDN B;  1D3U B;  2CZ1 B;  5BNJ B;  4AKI A;  1BU2 A;  2IVX A;  2WIH B;  4BXX X;  3HBL A;  4EC8 B;  2CZ0 B; 
#chains in the Genus database with same CATH homology
 1H1P B;  4CXA B;  4F7N B;  4YOS A;  1AIS B;  1H24 B;  1OIU B;  4CFV B;  4F7J B;  1OI9 B;  2WHB B;  2I40 B;  1H27 B;  2W99 A;  2WMB B;  5IDP B;  1JOW A;  1OL2 B;  1ZP2 A;  4BCI B;  2UZD B;  4YOO A;  2X1N B;  2EUF A;  1C9B A;  3H4C A;  3G33 B;  1H1R B;  4YOZ A;  1H4L D;  4BCQ D;  2R7G A;  3K7A M;  2B9R A;  3F5X B;  3QHW B;  5ACB A;  4BCN D;  1H25 B;  4IMY B;  3BLH B;  2IW6 B;  1H1S B;  1OIY B;  2PMI B;  4NST B;  1KXU A;  2C5N B;  2PHG A;  1F5Q B;  4CFU B;  1O9K A;  3TNH B;  1O9K B;  2UZB B;  1VIN A;  1UNG D;  5HQ0 B;  2W9Z A;  1H28 B;  4EOL B;  1OKV B;  1VYW B;  4CFW B;  2I53 A;  3TNW B;  1UNH D;  2WIP B;  2F2C A;  1E9H B;  2V22 B;  5CEI B;  2WMA B;  4CFX B;  2WXV B;  1XO2 A;  5HBH B;  1JST B;  4BCK B;  2CCI B;  3EJ1 B;  2C6T B;  4OR5 B;  1OGU B;  4BCQ B;  4EOJ B;  1AD6 A;  4F6W B;  3POM A;  2BKZ B;  3DDP B;  4TTH A;  1JSU B;  4F7L B;  2WEV B;  2BPM B;  2C5O B;  4BCN B;  3EID B;  3M03 A;  3O0G D;  4FX3 B;  3MY5 B;  1TFB A;  5HBJ B;  1FIN B;  5LQF B;  3BLQ B;  1PKD B;  4KRC B;  4BCO B;  3TNI B;  2JGZ B;  4Y72 B;  5EFQ B;  2IW8 B;  4OGR B;  1G3N C;  4ELL A;  5ICP B;  3MY1 B;  3BLR B;  3TN8 B;  5IF1 B;  4EOK B;  5LMK B;  5HNB B;  4BCJ B;  2C5V B;  2PK2 A;  4KRD B;  1JKW A;  1QMZ B;  2QDJ A;  4BCM D;  1URC B;  1GUX A;  4F7S B;  1GUX B;  5HVY B;  4II5 B;  1GH6 B;  4F6S B;  4YC3 B;  4ROD A;  4ROC A;  4BCH B;  2WPA B;  5CYI B;  5I5Z B;  2PK9 B;  1W98 B;  2C4G B;  3DOG B;  1FVV B;  2W9F A;  4BCF B;  4ROE A;  4EOS B;  1H26 B;  4CRL B;  4G6L B;  3MI9 B;  5FGK B;  4F70 B;  3BHT B;  4EOM B;  3MIA B;  2UUE B;  5L2W B;  1N4M A;  2CJM B;  2W2H A;  4BCG B;  4EOR B;  2WFY B;  1GY3 B;  4EOQ B;  2UZE B;  2G9X B;  1OKW B;  2UZL B;  4I3Z B;  5HBE B;  4EOO B;  3BHV B;  1UNL D;  2W96 A;  1OL1 B;  4ELJ A;  2C5X B;  3LQ5 B;  4CFM B;  1H1Q B;  3QHR B;  3RGF B;  3DDQ B;  4EC9 B;  4EON B;  4BCM B;  1VOL A;  2IW9 B;  4EOP B;  4F6U B;  1P5E B;  4EOI B;  5IDN B;  4BCP B;  1D3U B;  3EOC B;  5BNJ B;  1BU2 A;  2IVX A;  2WIH B;  4EC8 B;  3BHU B;  4CFN B;  4UN0 A;  4CFU D;  2CCH B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...