1N4XH

Structure of scfv 1696 at acidic ph
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
120
structure length
120
Chain Sequence
EVQLQQSGPELKKPGETVKISCKATNYAFTDYSMHWVKQAPGGDLKYVGWINTETDEPTFADDFKGRFAFSLDTSTSTAFLQINNLKNEDTATYFCVRDRHDYGEIFTYWGQGTTVTVSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords immunoglobulin kappa chain variable region
publication title Structure of a single-chain Fv fragment of an antibody that inhibits the HIV-1 and HIV-2 proteases.
pubmed doi rcsb
source organism Mus musculus
total genus 27
structure length 120
sequence length 120
chains with identical sequence I
ec nomenclature
pdb deposition date 2002-11-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1n4xH00
3CFDA 2EDJA 1T83A 4P5MB 2Y6SD 3N85L 3C08H 5IIEB 2P24B 1FVCB 1YMMB 1VPOL 2YZ1A 3THMH 5ADOH 1JRHH 1YMME 5D8JH 1R6VA 3ZTNH 1A1OA 5IMOB 2E9JA 3WHXA 3QUZB 2F9BT 1GYAA 2A83B 2P8PB 1X5GA 3PWLB 1NBVL 1P84K 5F7EL 2FBJH 4OZFG 1HDMA 1CGWA 4LEXL 4ODVH 1DUYB 2EEAA 3FB5B 4WCYL 5DD5L 2FYYA 4F80A 2HMID 3WLWC 4XVSL 2DTML 2X4OB 2Y36H 4LSPL 4TYUA 2AW2A 4JFZH 1S5HA 3KPOB 5D2NA 2WBJB 1KCUL 1YNTB 2PETA 5AWNH 4PYGA 3AM8A 1QRNA 1MCBA 5DHVB 3VFWA 2ZSVA 2J4WH 4TTGA 1EEYA 3SEPA 2B20A 1A0QL 3DMMB 3CAFA 3PL6A 2YMXL 3TJHC 3K80A 4DTGH 5BQ7A 1FORH 3CC5B 4M6OH 3V52H 3AMKA 4LSVH 4XI5C 1TENA 4YO0A 5IJKA 1K5NA 3V7AG 4PB9H 4BH7B 4F57L 2WWKT 1WBXA 1WGOA 3W81A 3SO3C 4NNPH 1R3LB 5HD8D 4EN3C 5IHZB 2ATKA 1YQVH 4N90D 3S96A 2HG5A 3FFCA 3D3VD 5HYSG 3U0PA 1T66D 3AMLA 3H2WA 1FL5A 5CAYB 3OKNB 2Z91B 5K9OB 2XG4A 1UVQA 4KQ4L 3IAGC 4PGBB 3IDUA 3CPLA 2VN7A 1XIWA 1INDH 1YMMD 1Q9KB 4KAQH 1EUTA 4E42A 3E1F1 3TNMA 4XH2B 5F6HI 1HH6B 3QUZD 1ZVSA 1MCJA 1AI1H 2DQFA 2YA2A 3K8KA 4W6WB 1WFOA 3TFKD 5ENWA 3ALPA 4YNYB 1RULL 2NZIA 3G6AA 4RIRB 4R4BB 1E4JA 1IAOB 4L5FL 1FZKA 1U3HA 1YQ2A 4QHNB 4MB4A 4MDIB 4M7KH 2WBJD 4O4YH 1B0GB 3I3DA 3QEGL 3ZT6A 1QSFA 2E27H 4Q0XL 3S3JA 1X4YA 3BP4A 3DMMD 4LAJH 2F54B 4MAUH 5JHLL 2BOBA 1S9WA 1F5WA 4U1KA 2F54E 5ECJE 3L6FB 2H32H 3VFUB 5C0JB 1F4XH 5K9JL 5CSZA 3ZDZE 1KPVA 4DN4H 1DSFL 1SYVB 5H94A 3SGDI 3KS0J 5JW4M 5C71A 5F89A 1JMXA 1MHHA 1A7QH 3B9KC 4ERSL 1HOCB 3OTTA 5J13C 1EVUA 4XXCA 5LGHH 4UILH 5EZLB 4NUJB 5EFIB 1C7SA 5F1KC 5DA0B 3QIBC 3BWAA 3TO4A 1T83C 1FZOA 3QQNA 2CO6B 3KGRA 1NEZG 5IVNA 2ZUSA 2A38A 5I1DA 2J8UA 2GK0B 2ADGA 3ARDA 3VXOB 5F3BA 3BEWA 5C07A 3GSWA 1NJ9A 5AAMA 4HJJH 4P9HC 5E0QA 3IDIA 3TVMA 2DTSA 5D7KE 4R7DB 5FK9B 5EU5B 2W0LA 3BX7C 1J1OL 5D4QA 5E6ZA 4M62L 1WIOA 3QWOB 2W60A 3C60B 3GSQB 3LV3B 4ZOEA 5IF0A 3O45A 3UCRA 1SEQL 2YR3A 4DEPB 3PWNA 1GGBL 4YHLH 3ARWA 2Y7QA 4LLQA 3VGBA 1TVHB 4OLZL 3EDEA 4WJ5A 4P5TA 2FL5A 3EHBD 2F54D 1MCSA 3U4EB 4Y19A 3CFKB 1LDSA 2NCMA 4K3EL 4Y5VA 5ITFA 3CX5K 2RCSL 3F7VB 4JRXB 2F8VA 3G6JF 4YH6A 2MKLC 3RKPA 3O2WH 1CT8B 1RZ7L 5SWZB 3DSFH 4JRXE 4RMTA 2NTFB 5SWZE 3SO3B 4PJ9B 1U3ZA 4Q6YA 1RPQA 4MJ2A 4CJ0A 1DN2A 3MNZB 2A6DB 1EUUA 3QNXB 4JFXA 4R4NC 4ZFOL 4MMXC 2ARJB 2VLLA 2WQRA 3SGEI 1EXUB 3P9LB 1WAAE 2R1XA 4U1IB 4UT9H 3MMEB 5HGHB 2VO5A 1OL0A 1CYGA 3I85A 1KEGL 1B2WL 1RJCA 2XZQH 1VACB 4NQDE 3PWUB 4XTRC 5CP7A 5EZOL 3OG6B 5IUSA 5F7UA 5TE6H 4UB0L 4XAWH 5ESVB 5I1LB 3X12B 3GSVA 5AG8A 3KYMA 4R4FH 4XCFL 4F7EB 1MRCH 3WLWD 2X10A 3PDOA 3LQMA 4TSAL 1XEDA 1U3HC 2I9TA 3GSRB 3VH8B 3LRGA 1QZ1A 1GVIA 2DQCL 3TZVA 2GJJA 3UYRH 1IKFL 4H25B 1SJXA 1H3GA 1C12A 4F8TA 4FQLL 1JCKA 4IEFB 3U4BH 1FHGA 5J6HA 4L8CB 1VHPA 5KVFH 4XP1H 3TJHD 1J10A 4DN3H 2E3VA 2G75B 1NAMB 4XI5D 1J7VR 4ZUTA 4L4VA 1S7UB 5SWZD 1YY9C 4YLQT 4XP4L 1H3PH 4M3JA 5FYLH 1S7XB 4ZTOH 4Y4KA 3RKDC 4EN3D 4K94H 4IMLB 2DM2A 2Q20A 1HZHH 4XXCC 1M71B 3JTTB 2AEWA 3QIBB 1J8HB 2QKIA 4NM4L 5LGJA 3CFDB 1J8HE 3TO4C 4NQDD 1G7IA 3NCCB 5J06A 3VXSB 3S36H 1VGEL 2V9RA 4WW1A 3G5YA 3VXSE 2X41A 1X5YA 4J4PA 4RMSA 4N1EA 2GIYA 3P4NA 4LCWD 3U6RA 2DWDA 1PG7X 4L4TE 1YA5A 4LPVA 1EJOH 5D72L 3S5LA 3N9GL 2HKHL 2CKBH 5CEZH 1AQDB 4HX1A 5CINH 3V0WH 4PJCA 4WGWB 3DVGA 2GKIA 5JOFB 4PTUA 1ETZA 3LZFL 1CDBA 4C83A 1JE6A 5HHQB 2G9HA 1I9JL 2BJML 2BNQA 2EIZB 1FO0L 1QRNB 4P5TC 1T0MB 2ZSVB 2I26N 4Z8FH 1EHXA 5I73C 4Y5VC 5MENE 1HCVA 4J3VA 3CCHA 3HC4H 3QO1A 4RDQF 3VGAB 4PG9B 2BOCB 1ZTXL 1RJZB 1L0QA 3NFSH 3B9KD 4N9GB 5DSCB 4X80H 3T04D 5IR1A 5KG9A 2XA8H 1BQHG 5CKAA 5JMOC 3A0OA 2ATKB 3GJFA 3S96B 4Z76A 1NSNL 2HG5B 3FFCB 1OY3B 3IVKA 4S11A 3EOBA 1IJ9A 2BDNL 3QIBD 1J8HD 3QUKA 3L5IA 2OR9L 3FFCE 3KPLA 1NC2A 1CK0H 4EI5C 2W0PA 1ZLSH 4XCYA 3LRSB 4GRWH 1UVQB 3VXSD 1C5CH 3T1FA 2I5YL 4HD9A 3BPCA 4NDMB 5C8JB 5CJ8A 4EXKA 1CF8L 4L4TD 4F9PC 2KKQA 1E6JL 2VXUH 2SEBA 1PG7W 3TNMB 4NN5C 4JPKH 5T33H 3HR6A 4L3CB 5HVHC 5ENWB 4X6EA 4FP8L 5BVPH 3PP4L 4GRMA 5I1AA 1PQZB 4OIIH 1FPTL 1P7KB 1FZKB 3OAYK 1P6AB 1U3HB 3QIUA 5KN5B 1LO4H 2PYED 4HWZB 3W2DH 3E3QC 5K9QI 1WWWX 4OZHA 3TZVC 2HN7A 1YEIH 5TDNB 3NABL 1MLCB 4MJ4A 2E9WA 4RFNC 1X44A 5MEND 2VXQL 1EGJA 4K3HA 1F13A 5CGYC 3QPXL 4U1KB 2R0KH 4H1LH 4NO0A 5IHBA 3I2CH 4PB0L 4ZFOA 1OWRM 3MA9H 5CSZB 1KPVB 5LWYH 1L6ZA 1NL0L 3SCMC 4KI5D 4Y2OA 1MHHB 4Y4KC 4GUPA 4K23L 2CMRL 2CUIA 1MRFH 1L9MA 2Y1VA 3TM6A 5IWLC 2FD6L 1CGTA 4R4ND 1AY1L 1MQKH 4MQTB 2QQNL 1N6UA 4O9HH 1JWSB 3PQYA 4HIXH 5FCSH 2DJUA 3TO4B 4XPTL 1FZOB 4ZXBD 1QFUH 1A7NL 1FIGH 2R15A 1GAFL 1UADC 3FFDB 3FT2A 4XTRD 5C0NC 1A6ZA 2ADGB 3SGJC 2P7TA 3ZKQD 5C0DB 4Q97A 3BEWB 3R4DA 5C07B 1A4JB 1XH3A 1WK0A 4KZDL 3MGOB 1NJ9B 3SKJL 3P0YH 3K7UA 2IFGA 5L88L 1FLRH 1CGUA 2DQHL 3IDIB 2V6HA 2FB4H 3MRKB 2IBZY 2M1KA 2Y5TA 4I4WA 1F4HA 1NMAH 4G80A 1KEML 2FX9H 1UWGH 4JO1H 4XPAL 2R8SL 2Y72A 1FBIL 4MJ5B 2QL1A 3O45B 2DM4A 2DBJA 3L7EA 3PWNB 4ZO9A 2D7OA 4PJGF 5FUOL 2E6PA 4I48A 2VZUA 5FB8B 2YD8A 3UTOA 4P5TB 2FL5B 2MCPH 3ZHKA 3O2VH 4TQEH 3HZMB 5DGQA 1LMKA 3O3AB 4Y19B 5ELIA 1YN7B 5I73B 2KBGA 4HHAA 4Y5VB 2R69L 3HI1A 4RAUA 4W4OA 5ITFB 1YY9D 3WKML 3IB4A 4U1NA 4QRRA 3RVVC 1RIVH 4MMZC 1HK6A 4AIZA 2EDTA 3RKDD 1J11A 1OCWL 5ESAB 5DJDA 5H2BA 2EYSA 2QTEA 3PGDA 1WWCA 5GSVA 2HFGH 4AYFA 1KLGB 3SDDC 4XNZC 1RIUL 5IMMB 1F3DH 2A9MH 2W0FA 3ARXA 4L9LA 3IGAA 4XP5L 1PAMA 2YD6A 3EDFA 3G5ZB 2WAHA 2FECI 4NN5B 3ZKNC 4GSDH 1IQWH 1WFUA 3EYUH 1A7PL 4LPUA 4PUBL 5HVHB 4OFVA 1FO0A 4D9LL 4RA0C 3HFML 3KYMB 3NCYS 4KDTA 1KACB 3PDOB 4RAVB 5E8PA 4AG4H 5FM5M 3SDCA 2O5YH 2I9TB 3B43A 2DRUA 4NO3A 3QRFM 4S0TD 3TZVB 3E3QE 1UCTA 3T0VA 2I24N 3G04A 4P2QA 4P5TD 3GRWH 4RFNB 2ZJSH 3QWRA 5J6HB 5IROC 5FUZH 3GJFK 4OCRH 1A7RH 3SBWC 4H1LG 3OAZK 4AEFA 4DVRH 3P77A 4ZUTB 4OGAD 4LRNL 4XPFH 3VE0B 5DYOA 1A3LH 1UM6H 1QQDA 3QEUB 2HJFA 4Y4KB 3DVNA 1UB5B 4NPYA 1NFDB 2OXHA 3BD5A 4HS6A 1NFDE 1NDMB 1TZHA 5CJOH 4EI5D 2C3WA 3QFJB 1SMOA 1NDGB 3ALXA 2QKIB 3QFJE 2X9WA 1XGQB 1M7IB 5LGJB 1KB5H 4PY8I 2Z4QA 3HC0A 4OFKA 5IB2A 1P4IL 4WW1B 5I1IH 1MAMH 4OQTL 1K3IA 4DKDC 5DHYA 3RWHA 3U6RB 5IMKB 4G6FB 2QADC 3GM8A 4KRNA 2GEEA 1GZPB 2XKSA 5DVMA 4KHTL 2BCKA 1WBYB 5HDQH 3MZTA 2IADA 5HI3C 4YX2H 1F4YH 4OF5A 4L3EA 1WBZA 3TZVD 1JZ5A 3SGKC 1DQLL 4PTUB 2DD8L 1ETZB 3U7YH 2XIDA 4XNUH 3TYFA 3T3PE 3FN0H 1JRHI 2G9HB 5J1TC 2BNQB 5DJCA 3DXAB 1UB6A 2Z8WC 5I2IB 4LDOB 3RPIB 2A73A 2O93L 1Q94A 2BNQE 3AY4A 3DXAE 4MCZB 3FHQA 2XZAL 1M6OB 3KYNB 3FMGH 3SCMD 5JW5A 1V7MH 2ZPKL 3O8XA 5BS0E 4Y4KD 5IR1B 2ZSWB 5KG9B 1SEBB 2F15A 1MUJA 1IM9A 4TUKH 4X0KA 1MHPH 2ICEA 3CIQA 4Z76B 3QFJD 1M1SA 2ZOKB 3IVKB 3SDDB 3EOBB 2OX5A 4XNZB 1QSVA 3QUKB 4LHQB 3WHE1 3KPLB 3M1BB 4UOW1 3NACL 1H8SA 5C6WH 5KSAA 1NCWL 1JHTA 4CADA 4EDWL 3ZSTA 4MNQD 5ABDE 2F19H 2HRPH 1CBVL 3CZFA 3BT2H 5C0ND 3T4YB 3V5DB 3BPCB 1D6VL 4UT6H 1HKFA 1HSAB 1DUZA 4KUZH 5E9DD 2SEBB 4NZJA 5EO0B 3UJIH 5GGUB 4U0QB 1Q72H 1QFOA 4LF3B 3H9ZA 4X6EB 1GGCH 4R9HA 1R3HB 4IS6B 3O41A 4GRMB 1WCBA 3RIAF 5MERB 5HHVH 3FRPG 4AEHH 2RQ8A 3SDCC 4Z0BH 1QFHA 2IFFH 4NFBA 4TOYL 1Y6KR 3BKYH 3SDAA 5E4EC 3O6KH 4J6RL 5E6IA 43CAA 1REIA 2BNQD 3RZCC 3DXAD 5GS1A 4IRJA 3NTCL 3OL2A 3N1FC 5EOQH 4CJ1A 1RZGA 3CU7A 1I9EA 3HPLB 3NFNB 5BS0D 1FZJB 3HMXH 4NO0B 3RVVD 2W9EH 3E8UH 2O26U 4PGJA 3MRNA 3SE3A 4U2YA 1U8JA 3PHQA 3UTTB 3O6LL 5B3JF 3BDXA 3UTTE 4Q9QH 5DVKA 4CL7A 3RBGA 1YEFL 1C1EH 4LSTL 4Y5XA 3SDDD 4OGXH 4MXWL 1ZGLM 2FECL 2XXMB 3IKCA 2WQ8A 1GGTA 1CFQA 4HBCH 4NJ9L 3OWEA 4PJHA 1IC1A 5SWQA 1BQLL 3U82B 3PDDA 4I5BA 4KY1H 1A6ZB 4HH9A 1AQKH 1KN2L 3ZKND 5JW4Q 3KJ6H 3V4UL 4GBXC 4LPXA 5E08L 2QADB 2ZG2A 1JFQL 5FHBL 1JWUA 4XT1C 3JTSB 3IDMA 3HC3L 2WSKA 3IYLW 1AE6L 5IFAH 1T5WA 4KQ3H 4W4NA 4YFLF 1XR8A 2NXZC 1YJDL 1DLHB 4Y2DA 4PRPB 1OF2A 2NNAA 2DQTH 2ED9A 1IC4H 1FL6B 4PRPE 1ZXQA 4I48B 2WBKA 4WWKA 4ZUSA 1ADQL 5A2KH 2H8PA 3C09C 1NCAL 3VFVB 1FAIH 1H5BC 1T03H 4LSRH 3B5TA 3CSBA 3TCXA 1JV5A 5E2TH 4U1NB 1GOHA 1UEYA 4K3DL 5LKNA 3UTTD 4AIZB 3TC9A 5C6PB 1RZFL 5DJDB 4XP6L 2EYSB 3GGWA 4NM8L 4KKBC 3WD5L 4J3XA 2ADFH 1Q38A 5A43C 1TVBA 2YD5A 4HPYL 3VRIB 4WU7A 2W0FB 2PXYC 3ULVL 2CIIB 3PE9A 5TE7H 2AXFA 3IGAB 2DI9A 3BESR 3WIFA 3OXSA 1UENA 2EDWA 3T77A 2AXJA 4IRSA 4CVZA 1I7UA 2VDLL 1KCRL 1S9KC 2QADD 1RHHA 2ZUYA 3I9GH 1H8NA 1EDQA 1XF5A 2J88H 3THML 1QACA 4JO3L 1JI1A 5D7SL 1JRHL 2FRGP 5ADOL 2ZKHH 1G7LA 1JF5A 3V6FA 1OD7A 1FO0B 3PJSA 5D8JL 5J8OA 3UXFA 1G6RH 3LS5H 2BNRA 5CILL 5E8PB 3SDCB 4JAMA 5KJRL 4NO3B 4PG2C 4PRPD 1F6AA 4NKMA 4ODVL 3DVIA 3UYOD 1ZS8B 5E4EB 5E6IC 1FRGH 3RZCB 1V05A 3H9SA 1MF2H 1WUNT 3WYRA 9CGTA 3GJEA 2ED8A 2NZ9C 3MODL 4G7VH 2VMFA 4IRJC 4P48A 1N3NA 3VXMB 3VXME 1IGFL 4M43L 2J4WL 3FL7A 1WT5C 3QZWG 4KZEH 3DBXA 2AJZB 3P77B 1CGYA 3GSNB 4NUGH 5DRXA 3SE3C 5FKPA 4DTGL 1F11B 1ZKAA 3V52L 1QQDB 5I1JL 4LSVL 2HJFB 3ULUH 3DVNB 1QR1A 3C6SA 3A67L 3IDJA 4HS6B 4XC3H 4Y8AA 3RTQA 4MNHA 5L9DH 4JFYA 4NNPL 4OT1H 1JL8A 2V17H 1MCKA 3ZKMC 2CGRH 4IDJH 3M07A 2H1PL 5DK0A 1SBSH 5B22A 1NC4A 1KN4H 4R2GC 2H9GA 4G5ZH 1WIPA 2VDQH 3IU3A 1YC8A 4OFIA 1QFWH 2HFTA 2VH5H 4X83A 4CMHC 3HNVH 1JGVH 2VDRL 4ZOAA 4S1RL 2BSRA 4R96A 3BN9C 3K1KC 4GBXB 4KAQL 4G7YL 1OPGH 1TJGH 4MA7H 2R2BA 1G9NH 5GIRB 3H7BA 4OLYL 5B39G 3BP7B 4EUPG 1T2JA 3SDCD 5ID1A 2IADB 1BEYL 3S3PA 2F58H 1WBZB 2PW2A 3O2DL 5ETUB 4KKAC 1O7VA 2CRYA 2NXZB 3NFPA 5I8EA 3RZCD 1A64A 1FG2B 4HJ0C 2OTPA 5GS0H 3TYFB 4OUUA 1H3WM 3DX6A 4O5LH 4FQCH 3VXMD 4JDVB 4WWKC 1UB6B 2QQKH 3C09B 2A73B 1LP9F 4F7CA 5DLMH 4HSQA 3N1MC 4Z0XB 1H5BB 5JPMA 2E27L 3MLPA 5DC4B 3DTXB 1UYWH 2WNGA 2CR3A 5JW5B 5GJTL 1S5IL 2A6KA 5HYSA 3BVNA 1R0AH 3ARFC 3P11H 1ORQA 5L2KB 3P9MB 4BKLA 4PS4H 4Y5YA 5L2KE 4X0KB 5CHNB 4KUCD 2R2EA 2CK0H 5T1KA 1UQSA 4AZ8A 4G3YL 3Q0HA 4G8EA 2UY7A 4MHHG 2PXYB 5EBMA 4NCC2 5IVXB 1OW0C 1JHTB 4EDXA 4ZS6C 2NW2A 5IVXE 3CZFB 1A6PA 3SN6N 1J0JA 1DUZB 4UNTA 4IRSC 1F4WH 4GBXD 4GAFB 5FYKH 2IH3A 2X70A 3RGVA 3HNSH 3Q6GL 3WS3B 4WI8A 1ADQA 3O41B 5GRWA 4TSCL 1D5ZA 5I16A 3S35L 4HJJL 4KJWC 1WCQA 4M7JL 2NXZD 4I0KA 3F7PC 5DMYA 2WIMA 3SDXA 1YEJH 3AXLA 4ODHH 4YDVA 1QNZL 5E6IB 43CAB 4MAYA 4U33A 1OGTB 1DQJA 3BPOC 1HILA 3HB3D 1ZSDB 3P4OA 4IRJB 3BP5A 3ZHLA 3IFOA 1MWAH 2JIXB 4LSSH 1WZMA 1DR9A 4JZNA 4X7CC 3VD5A 3BZ4A 4WFHE 4FFYH 3F12B 4KDWA 1YEKH 1DVFA 3MRNB 3O4LA 1U6AL 1S9XB 5L2KD 5IEHB 2DS4A 3ZKXC 4YPJA 4KKBD 1J0HA 3F7YA 2EH7H 3TLRA 2F53B 3DSFL 5HJ3A 2F53E 4AQ1B 1R3JB 3IKCB 1DBML 2DLEA 1FP5A 2CKNA 2PXYD 2CQVA 3TIDB 3TBVA 3WFCH 1ZOXA 4J3TA 2UYLA 2OTWB 4I5BB 5LCVH 4UT9L 3MYJB 4CMHB 3L5XH 2DQUL 4YAQA 1LO5A 3OAUH 2XZQL 1OGAE 1ZHLA 3LVEA 4OGZA 3OJVC 2BVYA 4JGMA 3IDMB 5I8KH 3MLWL 4FMKA 5KAQG 3WFBL 1A3QA 1UEMA 4GXUN 3V8OA 5J6GB 1OF2B 2NZ9D 1T89A 2DIAA 3ZE2F 1X5AA 1WEJH 2J7LA 4WWKB 2JIXD 4AL8H 4WFHD 4NZRH 3LDBC 3UYRL 1YZZA 2AJSH 5T3ZE 4J12A 1T2QH 2EKSB 3DOSA 3U4BL 2VERN 3EYVB 4XP1L 5IEKA 4H26B 4KK6C 3IDXL 4DN3L 2E7MA 3DHMA 4GAGH 3GFUA 3ARFB 3LY6A 2OZ4H 2BVTA 1ZHKA 1YNLH 1Q8MA 3MLRH 2F53D 2YSSB 1H3PL 1WFNA 4K9EH 3ZDZF 3ZKMD 2D9CA 2OTUA 3WFEH 1HZHL 3LKNA 4WU7B 1G7JB 2AXFB 4R2GD 2P4AB 2VDPH 3OXSB 2BFVH 3AGVA 1OGAD 4IRSB 3OR6A 3O2DA 4WW2A 4P57B 3ROLA 4PRBA 2V5MA 1P1ZA 4YBQC 3B9AA 1G7LB 2LABA 1FC1A 2X89A 2BNRB 2R2HB 2DQIL 4KKAD 2BMKB 3BKCL 3K4AA 1PKQB 4HJ0D 2CKBL 2JB6B 4NKMB 3ZDYE 1PKQE 3V0WL 1C08A 3PGCA 1BBDH 2D03L 5T3ZD 3BPOB 5JMRA 3T0XA 1N3NB 3QNZA 5C3LD 3RWEA 5ID0A 2VUOA 4JCMA 4Z8FL 3DBXB 1BX2A 3ARFD 4WEMB 3WFHB 5DRXB 4LHUG 5FYJL 5KS9B 5GQBA 5FKPB 3ULVC 4GRLA 3U4AA 5KS9E 4EI6A 4K7FA 3MR9A 5HPMA 2F8OA 4E9LA 3C6SB 3NA4A 3OMZA 1J0KA 2DMCA 2VQUA 3ZYZA 4X80L 4MNHB 2QSTA 2XA8L 4GKZB 4Z7UB 1ZVHA 1MNUL 4KH2A 4HT1H 1MCNA 4Z7UE 4L8DA 4Z9KB 4WNQA 3S37X 3BRFA 4ZS6D 4HXBH 2KZWA 1CS6A 1NC4B 4U6VH 3QULB 2W1NA 2CH8A 3DX8A 4XX1G 2I07A 1C5CL 4OD1H 4WVRA 3UMTA 4OZFB 4DKFH 5I1GH 1DANU 4J2XA 4LVOC 3OQ3B 2R2BB 3HE6C 1JHLH 2VUYA 5T33L 4KJWD 3H7BB 1AC0A 1FL3A 1K3ZA 4XVTL 5HSFA 2GUOA 4Z7WB 4G6MH 4Z7WE 3MO1A 3NFPB 2P5WA 3J7HA 3L5JA 4ZAKA 3ZE1F 4OUUB 1T89C 3W2DL 3VG0H 2R0LH 1XF3A 2AK4B 2GHWB 4YEEA 5GJSH 4D94A 1AGBB 1U8NA 2CJUL 1YEIL 2AK4E 2MPAH 3LDBB 1JGDA 3QUYA 4F7CB 3GBMH 1QYGH 3GMNA 4CMMA 4EOWH 5DD3L 3GKWH 4HWBL 1FZMA 1K8IB 2N7AA 3LEXA 2UUDH 5TJWK 5HYSB 2FWOB 3I2CL 4MVBD 1LILA 3FQXB 3MA9L 2BSSB 4BKLB 5LWYL 3OHXB 3TPUB 4P99A 2A77H 3TP4A 2R2EB 2JJVA 1NGXA 4P2CG 1UQSB 5B3NA 5JIIA 3VI3F 4PJXA 1A7OH 2E5EA 4G8EB 3SPVA 4LHJB 1MQKL 2NY3C 5FOJA 2BXZA 4O02L 5C0IA 4HLZH 3LH2L 1AGDA 5B4MC 1R5WA 4FA8A 1LWRA 4P2OA 2IH3B 3R06B 5F3HB 3ARBA 1KNOA 1IVLA 2ICCA 4G9FA 4G43A 3EGSA 4LCCA 4QRPA 5E6YA 3VXUA 2VLRB 3P0YL 2DLHA 2RIKA 2VLRE 2PF6A 4UU9A 3OSKA 1NMAL 5MP6H 1UWGL 1MCRA 2AJYH 2AK4D 3SKNA 3SDXB 3EFDH 5KVMC 2OL3L 4OIAA 1RMFH 4X6CF 1DQJB 3K4DA 1HILB 4C4KO 3BP5B 4X8XA 4JFDA 2CR6A 4J1UA 1VFAB 1XF1A 1PYWB 5EWIH 4AIOA 3BZ4B 3GUTB 2JK5A 4KK6D 4WTZG 2IANA 1ACZA 1DVFB 1UM4L 4HWUA 4R90H 4MD0B 1J88A 3ULVE 1QPXA 2EC8A 1RIVL 3GBNH 5EUKA 4PLOB 3RJQB 2Y9RT 8CGTA 5HJ3B 1MCLA 5A16B 1NEZB 4YEFA 4H8WH 1JN6A 1EZVY 2GT9A 2HFGL 4ZD3H 4LKXB 4LDEB 3TBVB 1DBJL 1H8OA 4HPOH 5F96L 1JVKA 5D1QA 2EECA 3B5GA 1A1MA 5F9AC 1F45A 3WE6A 1NUDA 5IB1A 5LBSH 4FS0A 4Y89A 3FOLB 2CKBA 1LO5B 4JY6A 4OF0A 3CSGA 1O5DT 4YBQD 4LVOB 5L8KB 4LVNC 1ZHLB 1KIQA 2BHYA 3B6SA 3HE6B 1EFXB 2VLRD 1IQWL 4P3CH 1T1YB 4X9HA 3EYUL 1CDUA 4XHJC 1XGPA 3WFZA 3HI5L 3FT4A 1FGVL 5IFHH 5DFVC 5ICYA 4QHUB 4XMKL 4ZAKC 3IFPA 2O5YL 4FFZL 3MLXL 2C3XA 3IJHA 4LSUH 3TIEA 3RWCB 5IOPB 1V5JA 5F7HA 3L7FA 2ATPB 5I1CH 5CJQL 1AGEA 1F00I 1I7RB 2ZJSL 5DK2A 4JFQA 1D9KA 3CVIH 4LMQI 5FUZL 3KPPB 3ULVD 1D6EB 4OCRL 1A7RL 3T0EA 2N7BA 4FZ8H 1HIML 3DGGA 4LPWA 2GSIB 5EIIA 4DVRL 1ZHKB 2DLGA 4XPFL 1A3LL 1UM6L 4NQEA 2FSEA 2HVKB 1DP0A 1GGIH 1U0QA 3RUGB 3MRLA 4I0PC 4QF1A 4KK5C 4PJEB 3RUGE 2OTUB 2F74A 4PJEE 3LKNB 4G8FA 4WUUE 2NY3B 3WJLA 1G0DA 3SE9H 2UUDK 5BOZG 4HUXA 4HLZG 3UO1H 1J18A 3IJSB 1H3XA 3OR6B 2VTFA 4L8SA 4WW2B 3ROLB 4RA3A 1RZJL 4Z7VA 5I1IL 1GZQB 1X6NA 3HE6D 1EFXD 4F7PA 3IETB 5TQ0L 2AEQH 5F93C 5F9DC 4X4YA 2J8UF 4LIQH 3RWFA 5F9WB 4U6HB 1OAKH 1HEZB 2X4QA 4JANA 3JWDL 2AVGA 1LVEA 2YD1A 4HWBA 4KGJA 1HYRC 5HDQL 1YPZA 4NP4H 3K2MC 1NGPH 2IPKB 1U41A 3V79C 3O11A 4PYHA 2VZSA 5JTWA 3QNZB 2WP3O 1L9NA 3Q2CA 5D1ZC 3NIFF 3FN0L 3CFEB 4HC1H 4K94C 1TJHH 3F6IA 1T20A 2Z35B 1BX2B 1Y18B 1JYNA 2WUBL 1BFVL 3IU4H 4HS8H 4OLWH 5K59E 3MR9B 3OKMB 5HPMB 2R56L 4JG0H 4X5XA 4YR6A 3RNKA 1YDPB 5EH1A 2VLKA 4WUUD 4UTBL 1AJ7L 3L3IA 4L8DB 4OV5A 2NY3D 2GJ6A 1IKNA 3T2OA 4JGUA 2XWJA 5DWUH 1LO0L 3CMOH 3P2TA 5B4MD 4GAJH 3VFMA 3DX8B 4YGVB 5KANG 5IG7A 3TT3H 3JV6A 1RD6A 5EIQA 4UT6L 4LVNB 4KUZL 5GRZA 2OL3A 3MV8A 1RUAH 4HWEH 3QQ3B 4BSVB 3EO0B 4V1DA 1FL3B 4D0BB 5BRZA 2GUOB 4WI3A 1GGCL 1OT2A 3PABA 3V9FA 4BFBD 4FQJL 2P42B 1N5YL 4ZAKB 3DWTA 1QFWI 4Z0BL 3FT3A 2IFFL 3MNVB 1XF3B 5CGMA 2R4SH 4LLDB 1UXSB 5TFSH 5DURD 3BKYL 1BZ9B 2EICA 4TUOB 3O6KL 2DL9A 1JGDB 1T7ZA 4XRCB 3MGAA 1SYSA 1BQHB 3G5XB 1UGNA 2O61B 1E4WH 1D9KC 5DEZA 3BDBA 1FZMB 2OQJA 5MI0C 2BERA 2W9EL 3DUHA 4ORGA 3TN0D 3ULSA 2VR9A 4NJAL 3UDWC 2VKWA 2D9QB 1R3IL 4BZ2H 1P69B 1NGXB 4I0PB 4Q9RH 4JY4B 5ACLA 1A14H 5E00A 4G8GB 4PJXB 1PLGL 2EDNA 1T2XA 2PCPA 4G8GE 1RUQH 4PJXE 1WC7B 5C0IB 1XF4A 2D31A 2VRAA 4BZYA 4YUEH 3IRPX 4M1GH 1OVZA 4B7LA 2Z8VC 4Z7QE 3NIDF 5D7JC 4KY1L 2EE2A 1KNOB 1AQKL 3NZHH 4G9FB 3KJ6L 3G6DH 1BAFL 3EGSB 3LN4A 4OTXL 3PP3H 4LCCB 5CIPH 4G9FE 2JJUA 2FH6A 5LQBL 3U7AA 5DFVD 4ZUWA 4MNGE 1HH9A 4UU9B 4MYWB 4OCLC 4NO5A 1J86A 4WIQA 4ZAKD 5CSGA 5CGTA 2IPUG 3CVHH 5IFAL 4KQ3L 4JDZA 3WXVH 5INDB 2BY1A 5J11C 2VITA 3AS0A 2DQTL 3JVGA 5D1ZB 4F9LC 1IC4L 4J1UB 4PJCF 5DMIH 3WO4B 4TNWK 4ZUVA 5FYLE 4LLYA 1T5XA 4AT6A 2IANB 1I1FA 2E6JA 4U0RB 1T1ZB 5EO1A 2IANE 2FGZA 3TNNA 4HCRH 4YZFE 3P0VH 4MB3A 5E2TL 1BOGA 5I1HL 4GG6A 2BNUA 5JDSA 4DVBA 1EHAA 4I0PD 2L7UA 4KK5D 3RA7H 5GGRA 4G8GD 3AU1B 5KSBF 1PEWA 5FYKU 2GT9B 3AS3A 2ADFL 2APVA 3WLBA 3OJMB 4NRXA 4QXUH 1GCFA 5IKCA 2EO1A 4PJ7A 1R5IA 4P4KA 1Q9OB 1U91A 3B83A 5EOTB 2CKBB 3UBXG 4JY6B 3TEUA 2ED7A 2IGFH 3AFLA 4HJGB 5CEZE 4OJFH 4QGYA 1KIQB 4MLSA 4PRAA 4YXKL 3B6SB 4ZQKA 1S3KL 4X8JA 2UY6A 5FM4A 1BFOB 5HDOA 1XGPB 7CGTA 3GBLA 3IFLH 1LNUA 5ICYB 1G6RL 4MQXC 5KTEL 4M48H 1ZLWH 2NX5A 3BKMH 5JQHC 4FG6C 5C0CA 3IFPB 2YS4A 4U3CA 1GC1H 2MQ3A 2AV1B 5D1ZD 5FYLD 2XY2A 4OM0H 5CEXB 1MF2L 3L7FB 1AGEB 2IAND 4OZHF 3CH8A 4JFQB 1IZKA 1D9KB 1LEGA 2Q76B 5MI0B 3NGBB 1ODAA 4GXVH 4KZEL 3CUPA 5EIIB 35C8H 1KTRL 1E0OB 2ESVB 1IGIH 1J87A 1J1PH 2ESVE 4MJ6B 1IGYA 4Z7OE 3CXDH 4GRWE 4F7MA 4XC3L 4ZNEE 1EEUA 5L9DL 5CMAB 3GMOB 3MUGB 5D6DA 3L5WA 2V17L 3MNWA 1NEUA 1SBSL 5CEZD 1KN4L 4L8SB 5FDYA 1QLEH 5FGBA 3OJDB 4ALAH 4QO1A 4G5ZL 2CLRA 2VDQL 3QHZH 4Z7VB 3DV4A 2GITA 1QFWL 1JGVL 5EORL 2VAAA 3L3JA 3OKLA 3WHE0 4X4YB 4OB5L 3WS6A 4UOW0 1TJGL 1I8LC 4PLKC 1CU4H 4LVHC 4H5SA 1G9NL 1HE7A 1FNGB 3S36X 2YKLL 1AD9A 3CLEH 25C8L 5ESQB 2B2XH 4X6DA 1YPZB 5FAAA 4ZSOE 2FX8H 5F1NA 4H1LB 1YPZE 1JGLH 3BIAX 5J11B 4MCYA 3CLFH 2GTZB 3L1OL 1OQXA 4CAGA 3PP3K 4TNVF 4XAKE 4WHDA 3C5JA 1Z9LA 5EZJB 3L5HA 5E5MA 4HXAH 5DLML 5ISZA 3QUMH 1LEKB 1S78C 4DOHB 4NCC1 3FB6A 1ZMYA 4ZO7A 1TPXC 3QHTC 1UYWL 2ESVD 3QJHA 4DOHE 2JB5L 2QR0A 3PWJB 1RU9L 3P11L 4X5XB 2VXTL 1OP5H 2VLKB 1A6TA 1OARH 3L3IB 5DQDH 3RY6C 3S4SA 1NFKA 2VLKE 5CJBA 5CLTA 1RZJC 1QBLH 4NBXB 3MLVL 5J56B 3KDMA 1FE8L 2XWJB 4K8RH 4WUKL 5DUML 4G42A 2VXVH 4YHYC 1PX3A 2DQDH 3S3SA 5I17A 4YHPB 4PP2B 4KTEL 3EDJA 4GW1A 5IG7B 5LJYH 4EUPA 3JV6B 5D7JD 3K8MA 4F37K 1N5AA 4IOSD 2V5RA 2OL3B 2V9QA 4N1HB 4YE4L 4XNQA 2QV2A 4I2XA 5FYKL 3QSKB 3GKZA 2Z8SA 3H8NA 3MCKB 2CLVA 4V1DB 1GPOL 1S8DA 4GQ9L 5DC0A 5F21B 1CWVA 3QR2A 4V1DE 2X4SA 1YC7A 1DQQA 5L8LB 3GIVA 4K7PX 1IGJB 2XYCA 4XAKD 3TWCH 5FO9A 4FOMA 3K2UH 1HINH 5GRUL 1YEJL 4ODHL 3LS4L 2K1MA 3BZEA 3N06B 3CFBB 3PF2A 1SYSB 3OG4B 3V6BR 5DQJB 4LSSL 2OQJB 3HE7A 4NGHH 5TE4H 1ZLWK 5D7LB 1B6UA 4ZS7H 5CD3A 4ORGB 5D7LE 1MEXH 2C1PB 3MLSH 5IM7B 4WFFE 3I02A 2VLKD 2GTWA 3V2AR 5CEYA 4M6MH 2EH7L 5E00B 5H37H 3DI3B 2PCPB 1IL1B 3MV9A 5D6DC 4PRNA 2P5EA 4JRYA 1MRDH 4JPVL 1P9MA 3V6OA 3MRGA 3VA6A 3RWJA 3UTZA 1CR9L 2ZOLA 4YHKL 1G6RA 2R29H 1BHGA 3AROA 1ZGLP 2XTJB 1NLDH 4WV1C 1N8ZB 4GMSL 5JLZB 3ZO0A 3QEHA 4C58B 3L5XL 4NRZA 5F1OB 1U8OA 3DGCR 3TV3H 4FMFA 3UPRA 4V2BA 5CBAB 1ITBB 3ESVF 4LKCA 3ZT7A 3WS6C 2G5RA 3W9DA 1LQSR 3D39A 3OKOB 4N8CH 4MQXD 4NQTA 3RNQA 1HH9B 1VEPA 3DYMA 1Q0YL 4FG6D 3ESUF 4P5KA 1I1AA 5FXCH 4JDZB 3KPQB 2LAGB 1IMHC 1D5XA 4XWOC 3O3UN 4ZUVB 2NYYD 1WEJL 2N56A 3HG1A 4NZRL 1T5XB 2EDRA 4PJDB 2ZCLH 5CP3H 1I1FB 5D7LD 4PJDE 2XOTA 5EO1B 1CTOA 1T2QL 4JM2C 3TNNB 4WFFD 4ZPVA 3KNBB 2DL2A 1EAPA 2XQYK 4B0MM 4GG6B 4GAGL 2BNUB 5JDSB 4DVBB 1MCOH 4ODTH 2OZ4L 1UH4A 4Q7DA 5KSVA 5CFHA 3C8KB 2KUTA 4MB5A 1IT9H 1LE5A 1W0VB 4FZEH 5JO5B 4PJIB 3VXRA 4F3FA 4P46C 1S7TB 3B2VH 3WKNA 4PJIE 3WLBB 3WFEL 1XCTA 3DV6B 1UC6A 5IKCB 2B0SH 2DJSA 2VSCA 3VRJB 5F7KC 4PJ7B 3DUSA 3F5WA 4PJBA 2I9LA 4MWFA 4P4KB 5EULV 2OS7A 4PJ7E 2BFVL 3STZB 3HKFA 1OP5K 3AUVA 4DW2H 4RDQG 1KTDA 15C8L 1ZA3B 4PRAB 2X42A 1VERA 4ZQKB 3KLHC 3CH1B 5F71A 1ONQB 4PLKD 3C6LA 2OJEA 4KTYA 5JR1L 1FV1A 4YDIH 5F9JA 3H9HA 4WI5A 2IALB 3VD4A 5KANI 4MXVF 1YEDA 1YUHA 4RMUA 4PV8B 4NSKB 4F33A 4RAHA 5IW6A 4PGZA 1EHLL 1ZWIA 3NAAH 4DKAA 3FAWA 3MV7A 1BBDL 4HS3B 5E2WL 1FVEA 4H0GA 1CLYL 2P47B 5HI5D 1LEGB 5DJ8A 2YXFA 3HE7C 1S78D 3VFRA 1CL7H 3UC0H 1IGMH 3ZTJH 3EOAA 3EUUA 3HN3A 3INUH 5JIHA 1TNNA 4WEUD 5EUOA 3K74B 2X1PA 1N64H 3V0VA 1JTPA 4XBGA 1OAUH 1DL7H 3L5WB 3MNWB 4RGMC 5IFJB 4JVWA 3PIQB 4HIEA 3GSUB 4HXBL 4LGRB 2MHAA 4U6VL 2B8OT 4DCQB 3QAZC 2F5BH 1K85A 4LLMB 4MA8H 2CLRB 2PTTA 4PJHF 2DMKA 5BZDA 4WV1B 2OP4H 3DV4B 2GITB 1WTGT 4OD1L 1JGEB 2VAAB 5I1GL 2FH8A 2RJMA 3L3JB 3R0NA 1INQB 3SO5A 4YHOH 5D9SA 4M7LT 1QSEA 4OI8A 4GW4A 4QTHA 1CXKA 1G7QB 2WWKO 3VMPA 1X7QA 1QHOA 4G6ML 4KK9C 3QZWB 4APQC 4RSVA 1AR1C 3LIZH 1A1NA 4MCYB 2BVEA 4DZ8A 1ZT1A 2WMPA 3VG0L 5I1KL 3HZVA 1KC5H 3ULUC 1EH9A 2JCCA 2MPAL 4RWYH 5EU3A 5E95B 1A6AB 3GBML 3QCVL 4G6KH 1QYGL 4EOWL 4RGOL 4EJ1C 4R3SA 4JM2B 5HHXL 3FB6B 2NY2C 2XI9A 3QJHB 3KPRA 2CRZA 2QR0B 3VW3H 4PRHE 4JN1L 4KU1A 4LARL 1A6TB 1J0YA 1U9KA 1B4JL 5TF1L 1AP2B 1A4KA 2MSPA 5BXFA 4P46B 2DKSA 1CGSH 1MFNA 2APWA 3QDJA 4XCEA 1A7OL 2OJZL 3FB7A 4XBEL 5GISH 5BZWA 2BY2A 3F58L 5T5FH 3FAXA 1G9NC 4XNYH 4EUPB 5B39B 1KTLA 4XMLH 1WJ3A 1T3FA 2DQEL 1NMBH 4LMQE 3CFCL 4AJ0A 1N6VA 5C7XL 2VB5A 4I2XB 2VDML 3MBEC 2NY5H 2OR7A 5ICXA 5FHAL 4I2XE 5HHNB 5GS0C 2CLVB 1RZKH 2G2RB 4G8IB 3RWDB 1H0DA 4OZ4B 2WANA 4H20H 4RNRA 4AY0A 4OLXL 5SV3A 2X4SB 2P8LA 1DQQB 4LU5H 5GGTL 5EU4B 1QFPA 1I8KA 4XMPL 1OB1A 3UBXI 4XWOD 2CRIA 3HI6H 1SY6H 2JTDA 4TSBL 5MP6L 5DTFA 4LSQL 4QXTA 4J3SA 3FOMA 3ZDYF 3BZEB 4QRQA 2IC2A 4LBEB 3V5KB 3STBA 5EOCJ 3QBTB 3BO8B 2VDOH 3HE7B 4JM2D 3TBTB 2C7UA 3REWA 2ITDB 5E5UB 1CTNA 4PRHD 1JYVA 3WBDA 4LLVB 1MCPH 3ZTJG 1F8TL 1KSRA 3I02B 4R90L 5CEYB 3GBNL 4P46D 3RX5A 1J12A 1IGTB 1Z0MA 1CFTB 2YPVH 5CWSA 4DKEH 1XR9A 1M7DA 3MV9B 4H8WL 4ONOA 4PRNB 5FFLA 1EERB 2P5EB 4RGMB 4DQOH 3MV9E 2NY1C 3MRGB 3MRQA 3UJTL 3VCLA 3RWJB 5E8NB 3L3HB 1F2XK 5CBEA 4FQQA 3UTZB 4HPOL 4DGYH 2ZOLB 1JPGA 3QAZB 1G6RB 3GEWB 4R8WL 4I3SH 2JELL 1G0XA 4YXLH 2VL5A 3KLHD 3ARGA 3QEHB 4NRZB 2CDEA 4JZOA 2JJWA 3W9DB 4HKJA 5CS7A 5IT2H 3IF1A 4M9OA 1K8DB 3QEQB 2JLLA 4QNPF 4JO4L 2YEZA 4C56A 1MOEA 4P5KB 1I1AB 4K55A 3QEQE 4PV9A 5IFHL 1AXTL 3A6BH 4APQB 1JMZA 2CLZA 1MY5A 1D5XB 2OSLA 5AG9A 1P2CB 1UZ6F 4CW1A 2BVOA 4QRUA 4IMKC 1E28A 1A6VL 3HE7D 1ORSB 1H3VA 3ULUE 4ZMAT 1A3RH 1LEIB 1KENH 4Z78A 3DNKA 4WO4A 5TQ2L 4J3WA 2NY2B 3QRGL 4OSUL 3WIIH 2M8XA 3DYOA 4QHLB 1T6WA 4NKDA 1DQDH 3RIFF 1OAXH 2B4CH 4OCXH 2ZUUA 5MEOB 1FLTX 5EBLA 5MHSE 3DURB 1LDPH 2LTQC 3MV9D 3STLB 5HDBF 3VXRB 2W59A 4F3FB 1AFVH 3BAEL 4PJFF 3VXRE 1Y0LA 4QCIB 1NGZA 3H42L 1D7FA 1CICA 1WITA 1P5UA 4KROC 4PJBB 2I9LB 4CN1A 4MWFB 4ZO8A 2CDFB 1HNGA 3FQWB 1AO7A 4TPRL 1KTDB 4RX4A 1N4XL 5ACMA 4BZ1H 5HYJA 2AGJH 3FO9A 1WQVT 3JV4A 3MBEB 1PY4A 3MXVH 4QEGA 4JHBA 5A1AA 3C6LB 2OJEB 4A6YL 1JIBA 2DBLL 3KXFE 1TETL 3QEQD 5F9JB 3H9HB 3U36A 4KK9D 1OAKL 5E94A 1YUHB 5EC1A 4JZJC 4APQD 3KWWA 1AR1D 3RVXC 1NUGA 5GRVK 2V2WB 4NP4L 4NWTL 1NGPL 3T65A 1VFBA 1EPFA 3ULUD 4PJ5A 1FVEB 4NZDA 4OF3A 2APTA 4UQ3A 3TBWB 1FN4B 3SDXF 4BUGA 4K9EC 5EA0H 1BGXL 1TJHL 3VFNB 3H7LA 2X1OA 4UIMB 3EOAB 5J89A 2IAMD 5E56A 3I75B 2IQAA 3EDDA 3IXAB 5MHSD 3IU4L 4OLWL 2DKMA 1IC5L 3OKKA 2R4RH 1MIEH 2EDQA 2O5ZH 3VXRD 5E24E 3N0PB 5IQ9A 4UINH 1R3KA 1SBBA 4YDKH 3BXNB 4OLVH 3GMRA 4M00A 2NY1B 4S2SB 5FYKE 1BVKB 5EOCH 1P4LA 3ZYOA 3CMOL 4FNLH 2MHAB 4G9DB 4PBVC 4X9IA 4NZTL 3U1SH 4IHOA 5JHDB 4GAJL 2Y06H 2PTTB 4HKZB 5GGTA 4HK3J 5JHDE 3TT3L 5DJXA 3MBED 3KXFD 5GS0D 3MZGB 4W6YB 1CQYA 5ACZA 5D9SB 5JXAH 5A40E 4U1JA 4JQXA 2A6IA 4M8QA 4NQCA 4R0LC 1MWAB 4JG1H 2VL4A 1BECA 1I7ZB 1YN6B 3O3EB 2Z92A 1PZ5A 2WIIB 1KOAA 5EC2A 4LHUB 3QHFH 1E4XH 4DZ8B 4JLRB 3BJLA 1CLZL 1UH2A 3VFSA 1UM5H 3HZVB 3H0TA 3Q3GA 3ZYIA 3EYSH 2XY1A 4QHMA 3IT8D 3MJ9L 3HA0A 4IDLA 3TH2T 1XGRB 1U58A 1FVDA 3QXDB 4R3SB 1E4WL 4XNXH 5BO1L 5TPWH 4A2MA 3HAEH 4L1HA 3KPRB 3FQTA 4LP5A 4GAYA 3KPRE 3OX8B 1CZ8H 2X7LA 4M6AA 3CD4A 5JW3H 1NGWB 5L6YH 1A4KB 2LTQB 5FYKD 4XX1E 1RZIB 2UWEB 4Q9RL 2NY1D 4U6XA 3VXNA 2UWEE 1ZGLA 4CBPA 1BD2B 1CICC 1RUQL 3ROOA 4CUCA 1BD2E 4KROB 1GIGH 4JB9H 1GGYA 2B1HH 4D0DA 5JHDD 2X4UA 1T3FB 4HG4K 4OAWB 2PO6D 3D3VA 4YDJA 4KPHL 1KBGH 2VLME 4UOJA 5IFJA 3V4VH 1PG7L 5ADPL 4P5MA 5ICXB 1W8NA 3RDTC 3D5OF 4UTAH 2K9UA 4WW2F 1QO3A 1RVFH 2P24A 4RNRB 1IILE 1YMMA 2P8LB 1NKRA 2JJTC 1I8KB 2GY7B 1OB1B 4HMDA 4LHUD 2A83A 1Z3GH 2EDYA 5DTFB 4F2MA 1A6UL 3CVHL 4QXTB 5EDXA 2MCG1 4H88L 3WXVL 2EXWC 5JQ6L 3FOMB 5DRZA 5D70H 4QRQB 2R9HC 1DUYA 2WM0A 4U3XA 5DMIL 1IEAA 1PZUB 2X4OA 4MZ3A 3BDYH 5T1DH 2WBJA 4OGYL 5C2BL 4P3WA 4JFOA 5FDWA 2YN3A 3LB6C 1G1YA 3DMMA 4RMWA 4XBPB 1JPSL 1MLBA 3CC5A 4JE4B 2OMBA 3U83A 1I4FA 3RA7L 1MFDH 1MCWW 5CWSB 1XR9B 1CFSA 1M7DB 3GSXA 1BD2D 3EJJX 3O4OC 5HXMA 3IS1X 4BH7A 4OCSL 3MRQB 3VCLB 4A6YA 4KROD 2AI0H 2AJUL 1R3LA 5IHZA 1JUFB 1Z9MA 3WUZA 1JPGB 2VDKL 1JF1B 4QXUL 3UTSB 4HF5H 1NAML 1KJ2H 2VL5B 4DGVL 3EOTH 3MQIA 1Q1JH 1BWWA 4NKOA 3UTSE 1CCZA 1SJEB 2Q1EA 1SJHB 5DHVH 4JZOB 1HWGB 1IRAY 4OJFL 1KJ3H 1MJUH 4HKJB 1TQBC 3S9DB 1Q9KA 5DT1H 1A9EA 4R0LB 4XH2A 1VESA 3RVXD 2DLIA 2QHRH 3IFLL 2H26A 2CDGB 4M48L 2CLZB 4D0CA 5ALBH 4KV5E 2OSLB 2OXGA 4YNYA 5EO9B 4JHZA 2W38A 3HUJB 5IB5A 4K3GA 4R4BA 3MREB 2DN7A 1GC1L 3HUJE 1IAOA 1E28B 4FFVC 4Z5RA 1RFDH 4QHNA 4OM0L 4MDIA 4TUJA 2HMIC 2E7LC 1B0GA 4Z78B 5H35B 3GMLA 4H8WC 2WUCH 1IC7H 3QA3B 3HAEG 1OQOA 4X5WA 4NKDB 3LRHA 3U0TA 3FQRB 4YQXH 35C8L 4EKXA 4LPYA 1XF2B 3I50H 5EBLB 1IGIL 1EMTH 2VC2L 2HH0H 1BIIA 4DUXA 3VFUA 5C0JA 2DI8A 4ZNCD 4O00A 3CXDL 3UBXA 4RFOL 1MCFA 3O81A 4CKVX 1HWHB 1SYVA 4HQQL 3V6ZA 1K9TA 2Y07H 4D9RE 1T1XA 1CICB 2MJWA 5C2UB 4YK4C 1RJLA 3UTSD 1CE1L 3SE4A 5C9KA 5EZLA 1AO7B 2LQRA 4PJAF 3D0VA 5EFIA 1X5ZA 1X5KA 1MJ8H 1AO7E 4ALAL 5HYJB 1DQTA 4HZAA 3K8LA 4NWUL 3RDTB 2Q8BH 3MLYH 4JJHA 1JPST 2GK0A 4QT5A 3MJ9A 4KKLC 1JNLH 2BZDA 4KC3B 4I8DA 1CU4L 5E94B 2YRZA 5EC1B 4MZ2A 3KWWB 1AKJB 3R1GL 4WY7H 3L3OB 3PHSA 5AYUH 5D5MB 3ZDXE 4MD4B 5D5ME 3T65B 2NXYC 1VFBB 1AXSA 1JGLL 3D9AL 5FK9A 5JUEH 5I8OH 12E8L 4UQ3B 3LV3A 4N68A 4RRPG 1BJ8A 1TVHA 4GG8A 4HXAL 3QUML 4Z18A 4OCYH 3U4EA 3CFKA 3OKKB 3AS1A 1QKZL 1ZT7B 4NIKB 1CLCA 3EYOB 3NN8B 4D9RD 5IQ9B 2QEJA 3BH9A 3OJ2C 1R3KB 4JKPH 1OARL 5DJ6A 2FX7H 3O4OB 3GMRB 2NTFA 1U8LA 5C0BE 1A2YB 4EN3A 5KVEL 2YPKB 3HNTH 1AO7D 3D69A 5GGVL 5GRJL 4IHOB 2A6DA 5ANMA 3WJJC 5DD6B 1J9CT 4HFUL 1WAAA 3UYPA 3LKSB 3RDTD 1F02I 3RY5A 2B7DT 1EXUA 3P9LA 1XMWA 4BFGA 3CVHA 4LCIL 3VWJA 3MMEA 5HGHA 1UACL 4NQDA 5ACZB 2WBWB 1EJ6A 3DRTA 4UV4H 1KJMB 4U1JB 4JKWA 4NQCB 5JOPE 1H3TA 3PWUA 3QPQC 2QSCH 5I30H 4NQCE 1AKJD 5CLWA 4WTWA 3NCJL 1FNHA 1HN1A 2Z92B 3KPSB 1PZ5B 4LCWA 5ESVA 3KPSE 2CUHA 4PBXA 5HY9A 1U8PA 2FR4A 3BP6A 2R9HD 3WUWG 4P59H 4RMVA 4ZODA 3Q3GB 3TWCL 4QY8B 3K2UL 1F58L 4QLRA 2D7PA 4QHMB 1HINL 3GSRA 2VLJB 1XGTA 1FFQA 4I77H 4U7KA 4M1CC 2VLJE 3BPLC 1U58B 4PTTB 3WIHH 4PGCB 4H25A 5AD0B 1ACYH 1PSKH 3LB6D 2ORBL 5DO2C 4GAYB 5B8CA 4L8CA 4ZS7L 4N0UA 2X7LB 3MLSL 1MI5D 1HI6A 1NAMA 4NBYB 4LAQH 1J05A 5E03A 3UP1A 3ZE0E 4M6ML 3CDCA 4KRMB 5C0BD 3VXNB 4MQSB 3B9KA 4YK4B 4JPWL 3ROOB 2ZCKL 3T3ME 1N6QH 1MRDL 1X5HA 4D0DB 4HUNB 4FQIL 2ZUWA 2GAZB 2J6EA 2X4UB 1MFAL 2Z31D 3JTTA 5TGBB 1I7TA 3QIBA 5GXBB 4UIKL 4BQCA 3ZZ1A 3K4ZA 2V7NA 4JO2H 1L0XA 3L95B 5JOPD 3HZKA 1UFUA 3GNMH 3VXSA 4NQCD 4X7DC 5B38G 1JGUH 1QO3B 4Y7MA 4GKOA 4Z7VF 1MFEH 5CUSL 1FNSH 4QRTB 1X5JA 3KPSD 3E2HC 4L4TA 3NIGF 1CLOL 2EC9U 1NCCH 2VISA 4F2MB 3HRPA 3CFJA 3QXAB 3WNLA 2AEPL 2NXYB 4FFVD 2BVPA 2APXA 3RGHA 3X13A 5DRZB 1AQDA 4XVJH 3BE1H 2VLJD 2ZCHH 3SE8H 4O2FB 1IEHA 5FKAB 5JDJA 5F9OH 4DFHA 1CIUA 1IEAB 5JOFA 4HKBB 2FCBA 2PYEA 2YBRA 2R0ZH 2D3VA 4KK8C 4OCWH 1MIMH 4JFOB 5HHQA 4X6BB 2EIZA 4P4RA 5FDWB 5D2LE 1HQ4B 3RL1A 3EO9H 4JQVC 1T0MA 5JXEC 5MENA 4OLUL 5C86A 1W72H 4OZIB 1MCOL 1MLBB 5E2VH 4ODTL 4NT6B 1I4FB 4OZIE 2P1YA 2P43B 4PG9A 2B1AH 1CFSB 2BOCA 1RJZA 3GSXB 4GQPH 3WXWH 1IT9L 1BREA 4N9GA 5DSCA 2DDQL 4FZEL 2LAAA 4A6YB 4K71B 1YEGH 1KIPA 1V3JA 5GSRB 2HT3D 3S88H 5IVOA 3SDYH 5IV2A 3LQZB 2B0SL 3IDGB 4LIQE 5DD0H 5DD1H 4NKOB 3E0GA 4JHWL 5KZCB 2VQTA 4KMTL 3EJYC 3MBXL 1N0XH 1CDJA 4MXQC 3LRSA 5CSBA 3VWJC 2PYFA 1XT5A 4ZXBA 4NDMA 5C0FB 2AXGA 4KKLD 1X5FA 5C8JA 1U3JA 2J8HA 3I6KA 3F7RA 1A9EB 4HKXB 3ORJA 2JF1A 4YDIL 2H26B 2YXMA 2NXYD 4L3CA 4D0CB 2X1XR 1X6LA 3MLTB 5IB5B 4M9PA 4RISH 4Z5RB 2YHGA 1PQZA 2H41A 1P7KA 5KN5A 2ZNXA 3B8SA 5I9QB 4HWZA 4TRPL 3MRJB 3C2AH 4TUJB 3BPLB 3QH3B 5TDNA 3GMLB 1MLCA 3VFGH 3ZYJA 5DQ9B 1U93B 4X5WB 4FABH 3UC0L 3T4AB 5B8CC 1YECH 3U0TB 3INUL 4NHCH 3P40A 3QXTA 5ICZB 1BIIB 3UBXB 1KF9B 3V6ZB 3WFDH 1CFNB 4W6XB 1T1XB 2YC1B 1IFHL 1RJLB 1OAUL 3M17B 4OF8A 4JPIA 2W9LA 3VH8G 4JKMA 4B41A 4FXLA 4QXGH 5KZCD 5C6TH 1G7PB 1HHKB 1JWSA 1KXQE 3D0VB 1W0WB 2MWCA 4U1LA 2F5BL 3OGCB 4XNMB 4MA8L 5DJ2A 4YFLI 4Z7NF 3MUY1 2IG2L 2OP4L 1A7BA 3V8CA 3DYPA 3GMPB 5IHUH 1GC1C 2YD2A 3FFDA 3QPQD 2XZCL 4QT5B 4YC2C 5C0DA 1QLFA 2FBOJ 3E2HB 1A4JA 1DTUA 3T1WA 3MGOA 1GSMA 3ILQC 2HFFB 5EU6B 3MRKA 1AXSB 2FIRT 3VDCA 5EU6E 4R26H 3WNPA 4F37F 3ARSA 4M1CD 4MJ5A 5JA8B 3QCTH 2Q6WA 4AEIL 3MUZ1 4GG8B 5DO2D 5AZEH 4X7TB 5FB8A 4B50A 3JWNC 3HZMA 1HSBA 3O3AA 2G60H 1YN7A 3VXPB 4NCDA 5IGXH 1ZLVH 4FQXC 4Y88A 3BISA 3BH9B 4GG6F 4KHXL 5DJ6B 1HNFA 5ESAA 2HWZL 3OBAA 2EEDA 4KI5C 1U8LB 1FFOA 1NFIB 4NZUL 4EN3B 3VDAA 5CIPB 4HIIB 3D69B 4HV8B 5GISL 1CD0A 1KLGA 5ANMB 5T5FL 4XPHL 2A6JA 5EB9A 3U9PH 2IMMA 2Z0BA 4I9WE 1QA9B 5ANME 3TA3A 4EI5A 5IMMA 3P0GB 3CVHB 3VWJB 4NQDB 5E1AA 3DRTB 4ZXBC 3OAYH 3HMWH 1FAKT 3O3BA 1A5FL 1J1XH 3G5ZA 4F9PA 2IQ9H 5LXGH 3K0WA 1XGYL 1N7MH 3H3PL 1RQ5A 5E2JA 4OFPA 1YYMH 1NLBL 4OZGA 2E7BA 1ZAGA 4H20L 1O0VA 2X40A 3VI4F 4YDLC 4LCWB 5TF0A 3C8HA 4Q6IC 3QNYB 4LU5L 4BK5A 5EU6D 3KAAA 1T7VA 4LCWE 3H3KA 4WEBL 5DJZA 5LVEA 5HY9B 4UDTA 1U8PB 2FR4B 1BFTA 3BP6B 1VPOH 3D25A 3HI6L 1SY6L 1YEHL 4RAVA 2ZZUT 1XGTB 2AV7A 4WU5A 3FQNA 3PUCA 2E9BA 4KK8D 5FV2A 1IARB 4NKIH 1FNEB 2VDOL 2OR8A 1NBVH 3ILPA 5JXED 4HMCA 4LEXH 4K8RC 5B8CB 3P73B 4N0UB 1MCPL 2DTMH 1E4XI 4N0UE 1HI6B 3TJEL 1YYLL 4GLRH 1ES0B 1KCUH 2R1YB 1BVLB 1J05B 3GSOB 3VE0A 2AJVL 3SCMA 3QEUA 5KVDL 2COQA 2YPVL 4JR9H 5DMKB 3VGGA 3B9KB 1UB5A 4JQIH 1NFDA 3G6JB 3JWOL 2YMXH 1QFWM 5J13B 4DQOL 4I9WD 5IWLA 3G6JE 1NDMA 2E7CA 1KPRA 3QFJA 3EJYD 1I7TB 1NDGA 4DGYL 4MXQD 1XGQA 5DK3A 2V7NB 1M7IA 4F57H 5HTSA 3VWJD 4YXLL 4XCCL 5GS2H 3HZKB 1CD8A 4MNQA 5F7DB 3VJ6B 1WVZA 5T1LD 2Y23A 1VEOA 4JFPB 3MXWH 3SGJA 4YC2B 3KS0H 4L4TB 1JK8A 5E9DA 5IMKA 4MD5B 4GMTH 2VISB 4QHKI 5A2FA 3MOBH 5DUBA 1GZPA 3CFJB 2YPLB 1EIBA 2K7QA 3MRPB 2BVPB 1U36A 5EIVA 4S1DC 4AIXA 3X13B 2YPLE 1WBYA 4ZFZA 4XWGL 3RI5K 3OGOE 4X6DF 3NH7H 3BEVB 1YMHA 5JW4N 3RL2A 1MCWM 3D85B 3MTRA 3OV6A 2PYEB 3Q1SH 4KVCL 2YBRB 2ERJC 1RULH 2PYEE 1A3RL 4HBQA 4CNIB 4P4RB 3DXAA 3RL1B 5I2IA 4L5FH 3DX9A 3RPIA 2EDKA 4QTIH 3R8QA 4MCZA 3WIIL 5MENB 2LU7A 4YIQB 2YD4A 1M6OA 5DFWH 3OR7B 3W11C 5BS0A 1DN0A 1KCVH 2B4CL 3KYNA 3T0AA 4YGAB 4OGAC 2ZSWA 1G7HB 1SEBA 4U6YA 1AFVL 5JHLH 4HDIA 1KIPB 4KI5E 2DJ4A 2ZOKA 1UH3A 4ONGL 5IV2B 3SDDA 4QOKA 4TULH 1DSFH 3DHJA 3TA3C 3GSNL 1I3GL 4ZFGH 3M1BA 1JZ8A 1ZLVK 4ERSH 4LLWA 1S7RA 2PYFB 3CK0L 3T4YA 3V5DA 4ZXBB 5SWSE 2AGJL 2AXGB 1HSAA 3MXVL 3I6KB 4A2LA 5AUMB 4K7PH 4PPTA 5EO0A 2GYSA 3ILQD 5GGUA 5C0AE 5D71L 4YDLB 1JBJA 4YBLC 2YPLD 5DEFA 4LF3A 3QUMB 1R3HA 4IS6A 1MELA 3GJFH 3VFOA 5MERA 3VFTB 1SVZA 3D85D 3OAZH 4XZUB 1RIHL 2QQQA 4F7TB 3MV01 2X4RB 4G6JH 3N50A 4XVUC 4M62H 3W9EB 1NAKL 5IROA 2XT1B 2QQLL 1SEQH 4U7SA 1GGBH 4FQXD 3HPLA 3NFNA 4O58H 1FZJA 3SBWA 3UTPE 1TLKA 1OSPL 2BX5A 1VFOA 2ADJA 4R7NB 1DZBA 1LD9B 1MIEL 4YJZL 5C9JB 3BIKA 2X1QA 3UTTA 1J8KA 1J5OL 2BSTB 3FO2B 1DQMH 5KW9H 4YDKL 4JPIB 1UA6H 2RHEA 4OLVL 1OTUC 4HAGA 5EOCL 1MH5B 5H8DA 1TTUA 2J3SA 1MJ7L 4GFTB 1RZ7H 3K46A 3Q6FB 6FABL 4Z95L 3N1GC 4Y16A 3AAZB 4U1LB 2WINA 5SWSD 2Y06L 5DJ2B 1PKOA 1V7NL 1EGJH 1DLFH 3TBYB 1TJIL 1SY6A 5C0AD 3DX7B 1QLFB 3DROA 3C5ZA 1DBBH 2HYMA 3JTSA 1KEGH 4IOIA 1B2WH 5I18L 3AB0C 3QI9C 4EEEA 3QHFL 1E4XL 1ZA6A 3SGKA 4UB0H 1UM5L 3EYSL 3PGFL 1DLHA 2ERJB 4FXGA 4PRPA 2Q6WB 5HYEA 2D0GA 3BRGC 1BFSA 1FL6A 4K8RD 1QOKA 4K7PY 2HVJA 4XNXL 3VFVA 5TPWL 1HSBB 1QEWA 3UTPD 1BM3L 2DQCH 4U7MA 1IKFH 1ZHBB 4P3DB 4FQLH 4M7ZC 4OD3L 1LO3H 3NCFB 3S5LG 3QYCA 5D7IA 4AH2B 1FFOB 2E6QA 1MFCH 1T0PB 4YBHA 4ODXA 1BJMA 2A6JB 4JB9L 3TF7C 3KG5A 4IIQA 2YUZA 3TA3B 1VKXA 4EI5B 2VZ1A 3VRIA 1RJYB 5EBGA 2HA1A 4ORZC 2CIIA 1KIRB 3ZT5A 3RP1A 4FQPA 2FHCA 4PJBF 3P9WB 5E1AB 4NN7C 3O3BB 4ETQB 1ERNA 4UTAL 2W9DL 4NM4H 4OZGB 1P7HL 4FQ1H 3RU8L 4OZGE 4YBLB 1FJ1B 4I18C 4UV7L 4S1DD 5DJZB 3OXRB 4UDTB 2AK1L 3R8BB 3FN9A 1AGFB 3D25B 3QDGB 1ND0B 3GMMB 1Z9SA 4L9DA 3QDGE 2VQ1B 4LOUC 2AV7B 4WU5B 3FQNB 2P8MA 1ZS8A 4KXZH 5DR5L 1EV2E 3HS0A 5D72H 3RZCA 3K81A 1Y6NR 2QLVB 3ILPB 3GHBL 4FTVA 4PY7A 3VXMA 4PJGB 4U1SB 4PJGE 3W11D 5J4MA 3LZFH 1BJ1J 2AJZA 3GSNA 3V4PL 5HGBB 1I9JH 2BJMH 2NMSA 1FO0H 1BMGA 1F11A 1U3YA 3SCMB 3S37L 2HKFL 4Y4HA 5T3ZL 1MCEA 1MCDA 2AJXH 5EUOF 2VABB 2NY5C 5FO8B 5IESL 1T7WA 3HLAB 1KPRB 2CRMA 1RZKC 3TA3D 4LQFL 2UVEA 4JDTL 1QBML 1K4CB 4Y16C 3S97C 4HF5L 4PIRF 1KJ2L 3KYOA 3EOTL 4CDGC 2HAZA 5GHWL 1NPUA 1IQDA 4MNQB 3F6LA 2BDNH 5LAXA 1ZV5A 2OR9H 2I60L 4MNQE 2NY6D 2FLBT 1FNLA 3SHSA 2PN5A 5TH2B 1JK8B 5E9DB 3VGEA 4EBQL 3ECBA 4GBXA 1WF5A 4K3JL 4U49A 5DT1L 3C5ZC 3NCYP 5E9DE 2I5YH 5DUBB 5KVGL 3FB8A 3QDGD 5GIRA 3BP7A 3AB0B 4ZFZB 1E6JH 5J12C 3O0RL 1EEZB 1YMHB 4D9QE 5ETUA 3RL2B 2NY7L 2ID5A 3KYKL 3CJJA 2FZ3B 1FG2A 5F7YC 4FP8H 4XVUD 4JRWA 4G6AC 3WNNA 4JDVA 1T7YA 1FPTH 3DX9B 3JWOC 2WUCL 2JCCF 4RFEB 5HBBA 1IC7L 3BN3B 1TXKA 4Z0XA 1TITA 1H5BA 3VRLF 1DDHB 3DTXA 3NABH 5BS0B 1DN0B 2FJFA 4M7ZB 3U9UA 1EMTL 2VXQH 2HH0L 4DUWA 1FC2D 5L2KA 1IZJA 3P9MA 1OTUD 4U6YB 4HDIB 3MCLL 5CHNA 2Y07L 4PB0H 3PDGA 1MPAL 4QOKB 3P30H 4WHYH 1NL0H 4IIQC 4QOKE 3TH3T 1HYSC 1DFBL 4LK4A 3VGFA 5F88B 2PXYA 3SKOB 5IVXA 4LLWB 3FZUC 2CMRH 4J7RA 1S7RB 5SX4H 3ZHDA 1BBJB 3I6LE 4NN7B 3IDYC 4DJMA 1AY1H 4OKVB 2Q8BL 1QLRA 4TNVK 2X4TA 1ROWA 4DWHA 2ICWI 4GKSB 1KYOJ 4UUJB 1JNLL 3VXQB 5DEFB 4I18B 1MJJB 1A7NH 3G08A 1GAFH 3WS3A 3QI9D 4D9QD 3VFOB 2BHUA 2HLAA 3U7WL 2QBWA 4KZDH 4PG2A 3UJJL 2B4CC 5L88H 1EBAA 2DQHH 5I8OL 2DYPB 3MACL 4Y1AB 1E6OH 1OGTA 4Y1AE 1EO8H 1ZSDA 3QCUL 1KEMH 1KELH 4MA3A 4Y4FC 4H0HB 5DJAB 4D3CL 3LHPL 2R8SH 2JIXA 5HPOA 1WT5A 3F12A 1LP9A 3IFNL 3JZ7A 1BOYA 2ADJB 8FABA 1S9XA 1ZHNB 4HUKB 5IEHA 3BIKB 1EAJA 2YZ8A 4MDJA 4Y4HC 4JKPL 2F53A 2UZIL 4QOKD 1F6FB 3WKMH 5DJ0A 4OFYD 4UMGA 1R3JA 1FFPB 2YK1L 1OCWH 3TIDA 1EX0A 3I6LD 4Y16B 2WINB 5HHPA 4TTDD 2EDOA 2GI7A 4KVNH 5L2JA 3QDMB 1BJ1H 2OTWA 3IDNB 5IQ7L 3QDME 5E5RB 2V2XB 4X4XA 1UKSA 3MYJA 1OGAA 4BFIA 4LGSB 5EN2B 3I6GB 4NNYA 3DROB 4XP5H 3C5ZB 4I3RL 4RRPA 2C4FU 1D5BB 1GHFH 4JFFB 4IOIB 3X14A 2OLDA 4JFFE 2FGWL 1U8IB 1IBGH 5J12B 4LOUD 1ZA6B 3BZDA 1MHEB 4YFEA 1UCBH 1A7PH 4P59L 2DYPD 4Y1AD 4PUBH 4FXGB 5J6GA 1HKLH 2YUVA 2AQ3A 3GHEL 4WHCA 5ILTL 1RUML 3OB0H 2HVJB 3HB3C 3ARUA 1QEWB 5BCAA 2EDFA 3FONA 4YHZH 1PSKL 4HH8A 5DA4A 2DB8A 2EKSA 3RRQA 4I13B 3EYVA 5D6CA 3WN5C 1IGCH 3BKJH 4H26A 2H6PA 4GOSA 2C26A 3ARFA 2PKDA 3K1DA 1KJ2A 5D7IB 4MS8D 1K2DA 1QHPA 1X4XA 4UNUA 4PGDA 5DXWA 2DAVA 4RWHA 3BMVA 5D7IE 5FCUH 2YSSA 4BH8A 1WFTA 3T2PA 5SV4A 1TQCC 1ULVA 2V2TA 4LASL 4OQTA 4PREB 2ZNWA 4ODXB 1N6QL 4Y16D 1VKXB 4IIQB 5B3JE 2D7TH 3FO1A 1G7JA 3QDMD 1OW0A 3SJVA 4NYLA 4JO2L 3LN5A 1OTTC 1V3LA 2NW3B 3C08L 2H2SC 4P57A 3C5ZD 3U2SA 1JGUL 1JWMA 4LGPB 4JFFD 5IVZA 1FNSL 1JPFB 5IBUG 1P4IH 3ZTNL 4PD4K 3CDGB 1NCCL 2R2HA 2X4PA 2BMKA 4OUOA 1PKQA 4XVJL 2FBJL 2JB6A 3MRMB 2BY0A 5IW3A 5INCA 2P8MB 3QO0B 1CGXA 4G6AD 2GQHA 3HS0B 4KHTH 1CDHA 2Y36L 3QDAA 4JFZL 4NFDA 4FTVB 4PY7B 4Y4FB 3U30C 1C5BH 4FTVE 4NBZB 1E4KA 1DQLH 5AWNL 3FQUA 4E5XA 1X5LA 1W72L 4N0FB 3WFHA 5KS9A 4IRZH 2CPCA 4WFGE 5E2VL 1FORL 3AREA 4M6OL 4WFEE 1G84A 3NOIA 2D7QA 4OCMC 4Y4HB 5C0RH 2PW1A 2CSPA 4PB9L 4GKZA 4Z7UA 4LVEA 4UAOC 1YEGL 1HYSD 5B38A 1YQVL 3AC0A 2Q8AH 3FZUD 3SDYL 1L7TH 3FO0H 5DD0L 5DD1L 3KYOB 4GLRI 3MCG1 3QULA 5T5NF 4ZYKB 1IQDB 1N0XL 1TZIA 1Z6JT 2GFBA 5LAXB 1Q9LA 1A47A 3LPFA 1RAMA 4JN2A 2A74B 3JV5A 3NACH 4OZFA 1INDL 1TVDA 5FUCC 1IE5A 1OD9A 3ECBB 4EDWH 1CBVH 5HGDA 1D6VH 1JYWA 3FB8B 1AI1L 4Z7WA 4Q9CA 4RISL 4QKXB 2ADIA 3E6FA 4R97C 2AK4A 4KDVA 4FTVD 4NN6C 4Y4FD 4M7KL 3C2AL 1AGBA 3EFFB 1YY8B 4O4YL 2VXSH 4HUWB 3CNKA 4TOYH 5JORA 1KB9J 3ZLQC 2C1OB 4WFGD 5C08B 4J6RH 1K8IA 1YECL 4QGTA 4WFED 3WN5B 2FJFB 4MAUL 5C08E 3U9UB 1LHZA 2FWOA 1AHWC 3NTCH 4Y4HD 3FQXA 3MOQA 4CRPA 2BSSA 1F4XL 2FJHA 4JFHE 3OHXA 3TPUA 3VGHA 4DN4L 2D4DA 3OB0K 3WFDL 1TQCB 3GO1H 1A7QL 2HLFC 3U46B 1ZK9A 1Q9WB 1FNFA 5LGHL 4UILL 2YD9A 1XZ0A 1N0LA 1ZEAH 1MCQA 1OT1A 1YEFH 4LSTH 2M2DA 5DMGC 1JP5A 1WZLA 3HTLX 4J8RA 4MSWB 1QLRB 1PBYA 2H2PC 2X4TB 4NJ9H 3R06A 4NC0B 1VENA 5E8DH 5F3HA 5C0EA 1XCQB 1BQLH 3G08B 1CGVA 3EW3B 4J3UA 3NA9H 2VLRA 3W5MA 1FYTB 1KN2H 3HAEB 2HLAB 1MCHA 1FYTE 43C9A 3V4UH 2DLTA 4HZLB 3VU2A 5E08H 2GJZA 3VD9A 1JFQH 1HXYA 5FHBH 2C4XA 4R26L 3ARPA 3GK8H 3LKQA 3RJDA 3HC3H 2MQ0A 3BQUC 4YHLL 4MA3B 1I1YB 2P49B 4JJ5B 3U30B 4Z77A 3QQ4A 1VFAA 1E4KC 4KJPC 1N26A 1PYWA 5C08D 1I8MA 3B3IB 3GUTA 1YJDH 1OWWA 5GZNC 1LP9B 5IGXL 1LP9E 1VGKA 4JFHD 8FABB 1PD6A 3AREC 4MD0A 4MVBC 1QBBA 4MDJB 4KRLB 3O2WL 2LU4A 3LKOA 1ED3A 5DJ0B 4RZCB 5DDHA 5A16A 1KYOK 1NEZA 3BMWA 4K3DH 4UAOB 3S7GA 2L4OA 4YHMH 1JZ6A 4LKXA 1I85A 2XTLA 4XP6H 5HHPB 2W91A 1P7QB 3U9PL 4OQ1A 5L2JB 2X09A 4HUMB 4R2GB 1OTTD 4LFHG 3KYAA 2H2SD 4X4XB 3FOLA 1OGAB 1UXWA 4HPYH 4BFIB 1N59A 4O2EB 4L1DA 3BZFB 4NNYB 2G5BB 1J1XL 4KMQA 5FUCE 4X98A 3CFIC 1YYML 1EFXA 1P53A 3A6OA 1IM3B 3HE6A 1FYTD 3X14B 1T1YA 5TE6L 4XAWL 2XACC 2VDLH 1KCRH 1MREH 3OB8A 4QHUA 4R4FL 1MRCL 4JO3H 4R97B 5D7SH 1W72A 5HVGB 2MOVA 1ZLUH 4LCUA 3QJFA 3KR3H 4NN6B 4ELKA 3HHRB 5CILH 3RWCA 5IOPA 4NKIL 3IJYB 3LKRA 2Q3AA 2ATPA 4X6CA 5KJRH 3FONB 1RSFA 1I7RA 5JZ7C 2ICWA 5TDPB 3C60C 5D6CB 4ZFFA 5KVFL 3KPPA 4NQSA 1D6EA 2JJSC 2H6PB 3T8XB 3MODH 5TDOB 4DEPC 1AHWB 1KJ2B 2GSIA 3RZWA 1A6WH 1K2DB 2ITCB 4PGDB 1MY7A 1IGFH 4M43H 4BH8B 5FYLL 5JPNB 4UQ2A 2HVKA 4JR9L 1T0NA 4ZTOL 3RUGA 4JQIL 2V2TB 4K94L 3BD3A 1L0YA 4PJEA 4WUUA 2HJKA 5I1JH 1AD0B 3FO1B 1KT2A 1P7QD 1IEBA 1DEDA 2YWZA 1I3RB 1B88A 3QFDB 3A67H 2NY0C 3SJVB 1HQRA 4NYLB 1IAKB 5F7FA 4M5YH 1GRWA 4ISVB 4PRDB 3SJVE 4PJ9C 3LN5B 3BUYA 1KPUB 3IJSA 1WZKA 2XKNB 3PHOA 1U8HB 3WUWB 3S36L 2H1PH 3U2SB 4BELD 1JWMB 3MXWL 5FA3A 1GZQA 1NQBA 2ZP0T 4RQQB 5IVZB 3IETA 1GL4B 3BSZH 3O9WC 1MSPA 5I1EH 4GMTL 3LPGA 1TZGH 2D4FA 1CQKA 4JFEB 3MOBL 4U6HA 4OIBA 2VDRH 5C92A 1HEZA 2X4PB 4JFEE 1EJOL 4JHAH 4S1RH 1OLLA 3RIFK 4L8BB 2ICES 4Z6AT 4G7YH 5CEZL 1U92B 3NH7L 5INCB 5CINL 2IPKA 1NH6A 4EQ2A 4OLYH 2H32A 3FN3A 4IOFC 1RV6X 2VAJA 3Q1SL 3BQUB 2ZUQC 1BEYH 3KPNB 2FDBP 3O2DH 3OF6D 5E99H 1FQ9C 1UJ3C 3CFEA 5F8QC 1F3JB 2VE6B 3FQUB 1QUNA 3ZE2E 5KSUB 4QTIL 4GKNA 4E5XB 2BRRH 1RZ8A 2Z35A 1Y18A 1BLNA 4MX7A 3AREB 3ARZA 3HC4L 4HIJA 3ZKXB 1OM3H 1KCVL 3OKMA 4KXZI 3TN0A 2PW1B 3VXTA 3NFSL 2HLFD 2OK0H 3NZ8B 2F5AH 1YDPA 3RX7A 5I76A 5GJTH 3BFOA 1S5IH 5EPMA 5B38B 1P4BH 3IXTA 4AM0B 2FNBA 4XPBH 5D93C 1I85C 1G6VK 3SJVD 4TULL 3OKEB 5DMGD 3MUJA 1CK0L 1EHNA 5F97E 4ZFGL 4U1MB 1TZIB 1ZLSL 2H2PD 2GFBB 4YGVA 1Q9LB 5FV1L 4G3YH 4FFWD 4FQ2H 4JN2B 1MQ8A 1WAAF 4TVPH 5DRNB 1JYXA 4CU6A 4U6TA 2VXUL 4ODWB 5HGDB 4K7PL 1FH5H 3QQ3A 4JPKL 4BSVA 4JFED 3VWKA 3MGTB 3EO0A 5EG6C 1G9MH 2FO4A 4D0BA 3W82A 1VB9A 3GI9H 5BVPL 2WLZA 5C0GA 2DLFH 2ADIB 1T22B 3E6FB 4OIIL 1LK2B 1T1WB 3HPJB 3Q6GH 1LO4L 3BQUD 3MNVA 4TSCH 4LLDA 4YHNA 1UXSA 5I66B 1KCSH 3G9AB 3S35H 4O51A 5F70A 1BZ9A 4KJQC 4TUOA 4KJPD 4PBWD 4M7JH 3NVQA 4XRCA 1DE4A 5JORB 4G6JL 1BQHA 3G5XA 5GZND 2O61A 3TBSA 1QNZH 1BP3B 3ARED 4JEGB 4O58L 1X5XA 2R0KL 7FABH 5D2NC 5IBLC 1ZLUK 4NRYA 2FJHB 1CXLA 3AM8C 2BC4A 4H0IA 3NCEB 3OKDA 1DQML 4I0PA 5D1XA 5KW9L 4JY4A 3PL6C 1UA6L 1U6AH 4G8GA 1MRFL 2D2OA 3VGAC 4X7SH 1XZ0B 2NY0B 3QXWA 1WC7A 4O9HL 4XCNB 5IJKC 4HIXL 4OD2A 3BYYA 4J8RB 4WI2A 1DBMH 1EGJL 1DLFL 1U8QB 3DIFB 4HFWB 1QR4A 1QFUL 1FIGL 5C0EB 2AS5M 1HHGA 1AGCB 3LAFA 3UPCA 3O9WB 3B9EA 3C5SA 1KB9K 4MNGA 1DBBL 1K6QH 1VDGA 1QP1A 2DQUH 1FLRL 4HGKC 2UVFA 2XXCB 1XIWC 1FFNB 2W65A 2OCFD 43C9B 5SX4I 1BVZA 2FB4L 1BPVA 4TN9A 1JI2A 2GJZB 2FLRT 2XQBH 1HXYB 2FX9L 3UZVB 4JO1L 4MGXA 5INDA 4CVUA 3MLWH 3LKQB 5D7KD 2ZUQB 4OM1H 3WFBH 1II4E 1A9BA 4Z77B 5D1ZA 3DRQB 3QQ4B 3ZE1E 3NMEA 5JZ7D 1G0YR 3VDBA 1I8MB 3C60D 1UJ3B 2MCPL 3O2VL 3DVFA 4TQEL 3U79A 4M4RA 4UNVA 5FO7A 1T1ZA 1VGKB 3W0WB 3D2UB 3LQAH 3MRFA 3LCYA 3W0WE 3BPNC 4JVUA 3S34H 3TN0C 1LO3L 3LKOB 3LOWA 5LGKA 1ED3B 5DDHB 3AU1A 3IDXH 4P2RB 1T4KB 3WCYA 5MEQA 4JRXD 3B8YA 4P2RE 5D93B 1MFCL 2NY0D 4KI5F 3WDHA 1GJIA 2P44B 3F8UB 5IW1B 5GGSY 2A9ML 4PJ9D 3VI3E 1X5IA 4RGNC 5I0DA 1Q9OA 1H15B 1UXWB 5EOTA 5C1MB 1N59B 5DVOA 4HJGA 2WWMC 3O9WD 1RK0A 5FECA 4X98B 4FQ1L 4GSDL 1L6XA 2QSVA 3VWKC 5EZIH 1BFOA 5GZOC 4PR5A 3MRRA 4S1SH 2PR4H 3M45A 5HYIA 2K3TA 3ARDC 2KH2B 1W72B 4AG4L 4IOFD 1A1OB 4LCUB 2XPGA 3QJFB 4ELKB 3WHXB 2AV1A 5FM5O 2DQIH 4KRPC 3BKCH 5CEXA 3LKRB 4X6CB 3TVMC 3GRWL 1HDMB 4X6CE 2ICWB 2Q76A 2FYYB 2HTKC 4ZFFB 3W0WD 3D2UD 2D03H 4NQSB 4NC1C 4P9MH 4NOBA 1S5HB 5D2NB 3RI5F 3UDWA 5D2NE 1G1CA 2XG5A 2ESVA 2XWTA 3VFWB 4UQ2B 1EEYB 1F3DJ 1T0NB 4MJ6A 4P2RD 1QRNE 3B9DA 5D1XC 4ZNEA 3PL6B 5FYJH 5KOMC 2AJXL 5BQ7B 4WUUB 2HJKB 3RAJH 5CJOL 1KT2B 5CMAA 3GMOA 1IEBB 1BZ7A 3MUGA 5KSBA 4YO0B 4KMLB 4UT7H 1K5NB 1HQRB 1N2RA 4URTB 1WBXB 1KB5L 3BUYB 1MNUH 2H45A 3PHOB 3OJDA 3EKCA 3MLZH 5D7JA 5FA3B 3U0PB 1IAIH 1MAML 1F6LL 1FL5B 3CPLB 4FQHA 2GSGA 1XIWB 1FNGA 3Q5TA 4ZSOA 5ESQA 3PV7A 3EJZC 4E42B 2HT2C 1CI5A 4YX2L 4DK6A 1F4YL 1ZVSB 4H1LA 5HI4C 4NOFA 2DQFB 4KJQD 2X9YA 2H32B 3AVEA 4XVTH 3U7YL 4DFIA 2GTZA 4XNUL 5DURB 4F9LA 3G6AB 5I75C 5EZJA 5BOPA 4GKNB 3T2NH 3PWPA 1RZ8B 3TGXA 1LEKA 5DFTA 5IBLD 1BLNB 5F7WC 2CJUH 4MX7B