1N51A

Aminopeptidase p in complex with the inhibitor apstatin
Total Genus 167
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
167
sequence length
440
structure length
440
Chain Sequence
SEISRQEFQRRRQALVEQMQPGSAALIFAAPEVTRSADSEYPYRQNSDFWYFTGFNEPEAVLVLIKSDDTHNHSVLFNRVRDLTAEIWFGRRLGQDAAPEKLGVDRALAFSEINQQLYQLLNGLDVVYHAQGEYAYADVIVNSALEKLRKGSRQNLTAPATMIDWRPVVHEMRLFKSPEEIAVLRRAGEITAMAHTRAMEKCRPGMFEYHLEGEIHHEFNRHGARYPSYNTIVGSGENGCILHYTENECEMRDGDLVLIDAGCEYKGYAGDITRTFPVNGKFTQAQREIYDIVLESLETSLRLYRPGTSILEVTGEVVRIMVSGLVKLGILKGDVDELIAQNAHRPFFMHGLSHWLGLDVHDVGVYGQDRSRILEPGMVLTVEPGLYIAPDAEVPEQYRGIGIRIEDDIVITETGNENLTASVVKKPEEIEALMVAARKQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Xaa-Pro aminopeptidase
publication title Structure of Escherichia coli aminopeptidase P in complex with the inhibitor apstatin.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase/hydrolase inhibitor
total genus 167
structure length 440
sequence length 440
ec nomenclature ec 3.4.11.9: Xaa-Pro aminopeptidase.
pdb deposition date 2002-11-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00557 Peptidase_M24 Metallopeptidase family M24
A PF05195 AMP_N Aminopeptidase P, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.350.10 Alpha Beta 3-Layer(aba) Sandwich Creatine Amidinohydrolase; Chain A, domain 1 Creatinase/prolidase N-terminal domain 1n51A01
3.90.230.10 Alpha Beta Alpha-Beta Complex Creatine Amidinohydrolase Creatinase/methionine aminopeptidase superfamily 1n51A02
1W7VA 3BIQA 3QOCA 4ZWOA 1B6AA 1WKMA 3PKBA 4IKSA 4U6EA 4R60A 2GTXA 2MATA 4S2TP 2GG8A 4FO8A 4IKTA 3TAVA 3Q6DA 1KQ0A 4PV4A 5JFRA 1YJ3A 3FMQA 1XGOA 4IKRA 2V3ZA 3CTZA 5E5BA 1Y1NA 5CE6A 1QXYA 3PKAA 4IECA 5CLSA 4ZWPA 3I7MA 1WBQA 1QXWA 2Q93A 3MATA 4FLLA 3S6BA 2OAZA 1C23A 1BN5A 2V3XA 1KQ9A 2BWVA 2HOWA 2BWXA 3PEBA 2EA2A 3IG4A 4IDYA 4FLJA 2NQ6A 3L7GA 4S2RP 2IW2A 1W2MA 2GG0A 2BWYA 4RGZ1 2EVOA 3FM3A 2Q92A 1PV9A 2P98A 2EA4A 1R5HA 4JUQA 2BWWA 2BH3A 4HXXA 4Z7MA 1A16A 2GG5A 1XGNA 5FCFA 4ZNGA 2ADUA 4U1BA 5D6EA 1YW8A 5CDVA 4FLKA 2ZSGA 3OVKA 4EGEA 3O5VA 2BWUA 4U6CA 4RZYA 5CDEA 2GU6A 4B28A 3L24A 2G6PA 1CHMA 4QR8A 2GG2A 1N51A 3IL0A 3TB5A 4A6VA 1B59A 2BHAA 3RORA 1M35A 5E2CA 4U6JA 1JAWA 2V6CA 4U6ZA 4IU6A 4OOKA 2P99A 4IKUA 2V3YA 1YVMA 1MATA 3MR1A 3IU7A 1O0XA 1WL6A 4IF7A 4U76A 2BN7A 2Q96A 4FLIA 2Q8KA 4RZZA 3RVAA 3BITA 2P9AA 4IPAA 2GG9A 1BOAA 1WN1A 1C22A 2GA2A 2GU5A 2OKNA 3BIPA 1XNZA 2NQ7A 2GGCA 4U73A 4PNCA 1QXZA 2GG3A 4A6WA 1R58A 3FMRA 2B3KA 2BHDA 2GU7A 3CB6A 4S00A 1WLRA 4FKCA 5CIKA 4U71A 4MATA 3PKCA 1XGSA 1WY2A 2B3LA 5JHUA 2GZ5A 1YW9A 5CDLA 4U70A 5JI6A 2BHBA 5D6FA 4FUKA 2DFIA 3CB5A 3PKDA 3IU8A 1C27A 4U69A 2B3HA 4U6WA 2BB7A 1C21A 2EVMA 3PKEA 3PN9A 4KM3A 2Q94A 3IU9A 1XGMA 3MX6A 4U75A 2BHCA 4ZWUA 1QZYA 4S01A 2Q95A 5CNXA 3OOOA 2BWTA 2EVCA 1WL9A 1YW7A 1C24A 1KP0A 4FO7A 1R5GA 3D27A 2GGBA 2GU4A 2GG7A 2BWSA 5FCHA
chains in the Genus database with same CATH superfamily
1W7VA 3BIQA 3QOCA 4ZWOA 1B6AA 1WKMA 3PKBA 4IKSA 4U6EA 4R60A 2GTXA 2MATA 4S2TP 2GG8A 4FO8A 4IKTA 3TAVA 3Q6DA 1KQ0A 4PV4A 5JFRA 1YJ3A 3FMQA 1XGOA 4IKRA 2V3ZA 3CTZA 5E5BA 1Y1NA 5CE6A 1QXYA 3PKAA 4IECA 5CLSA 4ZWPA 3I7MA 1WBQA 1QXWA 2Q93A 3MATA 4FLLA 3S6BA 2OAZA 1C23A 1BN5A 2V3XA 1KQ9A 2BWVA 2HOWA 2BWXA 3PEBA 2EA2A 3IG4A 4IDYA 4FLJA 2NQ6A 3L7GA 4S2RP 2IW2A 1W2MA 2GG0A 2BWYA 4RGZ1 2EVOA 3FM3A 2Q92A 1PV9A 2P98A 2EA4A 1R5HA 4JUQA 2BWWA 2BH3A 4HXXA 4Z7MA 1A16A 2GG5A 1XGNA 5FCFA 4ZNGA 2ADUA 4U1BA 5D6EA 1YW8A 5CDVA 4FLKA 2ZSGA 3OVKA 4EGEA 3O5VA 2BWUA 4U6CA 4RZYA 5CDEA 2GU6A 4B28A 3L24A 2G6PA 1CHMA 4QR8A 2GG2A 1N51A 3IL0A 3TB5A 4A6VA 1B59A 2BHAA 3RORA 1M35A 5E2CA 4U6JA 1JAWA 2V6CA 4U6ZA 4IU6A 4OOKA 2P99A 4IKUA 2V3YA 1YVMA 1MATA 3MR1A 3IU7A 1O0XA 1WL6A 4IF7A 4U76A 2BN7A 2Q96A 4FLIA 2Q8KA 4RZZA 3RVAA 3BITA 2P9AA 4IPAA 2GG9A 1BOAA 1WN1A 1C22A 2GA2A 2GU5A 2OKNA 3BIPA 1XNZA 2NQ7A 2GGCA 4U73A 4PNCA 1QXZA 2GG3A 4A6WA 1R58A 3FMRA 2B3KA 2BHDA 2GU7A 3CB6A 4S00A 1WLRA 4FKCA 5CIKA 4U71A 4MATA 3PKCA 1XGSA 1WY2A 2B3LA 5JHUA 2GZ5A 1YW9A 5CDLA 4U70A 5JI6A 2BHBA 5D6FA 4FUKA 2DFIA 3CB5A 3PKDA 3IU8A 1C27A 4U69A 2B3HA 4U6WA 2BB7A 1C21A 2EVMA 3PKEA 3PN9A 4KM3A 2Q94A 3IU9A 1XGMA 3MX6A 4U75A 2BHCA 4ZWUA 1QZYA 4S01A 2Q95A 5CNXA 3OOOA 2BWTA 2EVCA 1WL9A 1YW7A 1C24A 1KP0A 4FO7A 1R5GA 3D27A 2GGBA 2GU4A 2GG7A 2BWSA 5FCHA
chains in the Genus database with same CATH topology
1W7VA 3BIQA 3QOCA 4ZWOA 1B6AA 1WKMA 3PKBA 4IKSA 4U6EA 4R60A 2GTXA 2MATA 4S2TP 2GG8A 4FO8A 4IKTA 3TAVA 3Q6DA 1KQ0A 4PV4A 5JFRA 1YJ3A 3FMQA 1XGOA 4IKRA 2V3ZA 3CTZA 5E5BA 1Y1NA 5CE6A 1QXYA 3PKAA 4IECA 5CLSA 4ZWPA 3I7MA 1WBQA 1QXWA 2Q93A 3MATA 4FLLA 3S6BA 2OAZA 1C23A 1BN5A 2V3XA 1KQ9A 2BWVA 2HOWA 2BWXA 3PEBA 2EA2A 3IG4A 4IDYA 4FLJA 2NQ6A 3L7GA 4S2RP 2IW2A 1W2MA 2GG0A 2BWYA 4RGZ1 2EVOA 3FM3A 2Q92A 1PV9A 2P98A 2EA4A 1R5HA 4JUQA 2BWWA 2BH3A 4HXXA 4Z7MA 1A16A 2GG5A 1XGNA 5FCFA 4ZNGA 2ADUA 4U1BA 5D6EA 1YW8A 5CDVA 4FLKA 2ZSGA 3OVKA 4EGEA 3O5VA 2BWUA 4U6CA 4RZYA 5CDEA 2GU6A 4B28A 3L24A 2G6PA 1CHMA 4QR8A 2GG2A 1N51A 3IL0A 3TB5A 4A6VA 1B59A 2BHAA 3RORA 1M35A 5E2CA 4U6JA 1JAWA 2V6CA 4U6ZA 4IU6A 4OOKA 2P99A 4IKUA 2V3YA 1YVMA 1MATA 3MR1A 3IU7A 1O0XA 1WL6A 4IF7A 4U76A 2BN7A 2Q96A 4FLIA 2Q8KA 4RZZA 3RVAA 3BITA 2P9AA 4IPAA 2GG9A 1BOAA 1WN1A 1C22A 2GA2A 2GU5A 2OKNA 3BIPA 1XNZA 2NQ7A 2GGCA 4U73A 4PNCA 1QXZA 2GG3A 4A6WA 1R58A 3FMRA 2B3KA 2BHDA 2GU7A 3CB6A 4S00A 1WLRA 4FKCA 5CIKA 4U71A 4MATA 3PKCA 1XGSA 1WY2A 2B3LA 5JHUA 2GZ5A 1YW9A 5CDLA 4U70A 5JI6A 2BHBA 5D6FA 4FUKA 2DFIA 3CB5A 3PKDA 3IU8A 1C27A 4U69A 2B3HA 4U6WA 2BB7A 1C21A 2EVMA 3PKEA 3PN9A 4KM3A 2Q94A 3IU9A 1XGMA 3MX6A 4U75A 2BHCA 4ZWUA 1QZYA 4S01A 2Q95A 5CNXA 3OOOA 2BWTA 2EVCA 1WL9A 1YW7A 1C24A 1KP0A 4FO7A 1R5GA 3D27A 2GGBA 2GU4A 2GG7A 2BWSA 5FCHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1W7V A;  3BIQ A;  3QOC A;  4ZWO A;  1B6A A;  1WKM A;  3PKB A;  4IKS A;  4U6E A;  4R60 A;  2GTX A;  2MAT A;  4S2T P;  2GG8 A;  4FO8 A;  4IKT A;  3TAV A;  3Q6D A;  1KQ0 A;  4PV4 A;  5JFR A;  1YJ3 A;  3FMQ A;  1XGO A;  4IKR A;  2V3Z A;  3CTZ A;  5E5B A;  1Y1N A;  5CE6 A;  1QXY A;  3PKA A;  4IEC A;  5CLS A;  4ZWP A;  3I7M A;  1WBQ A;  1QXW A;  2Q93 A;  3MAT A;  4FLL A;  3S6B A;  2OAZ A;  1C23 A;  1BN5 A;  2V3X A;  1KQ9 A;  2BWV A;  2HOW A;  2BWX A;  3PEB A;  2EA2 A;  3IG4 A;  4IDY A;  4FLJ A;  2NQ6 A;  3L7G A;  4S2R P;  2IW2 A;  1W2M A;  2GG0 A;  2BWY A;  4RGZ 1;  2EVO A;  3FM3 A;  2Q92 A;  1PV9 A;  2P98 A;  2EA4 A;  1R5H A;  4JUQ A;  2BWW A;  2BH3 A;  4HXX A;  4Z7M A;  1A16 A;  2GG5 A;  1XGN A;  5FCF A;  4ZNG A;  2ADU A;  4U1B A;  5D6E A;  1YW8 A;  5CDV A;  4FLK A;  2ZSG A;  3OVK A;  4EGE A;  3O5V A;  2BWU A;  4U6C A;  4RZY A;  5CDE A;  2GU6 A;  4B28 A;  3L24 A;  2G6P A;  1CHM A;  4QR8 A;  2GG2 A;  1N51 A;  3IL0 A;  3TB5 A;  4A6V A;  1B59 A;  2BHA A;  3ROR A;  1M35 A;  5E2C A;  4U6J A;  1JAW A;  2V6C A;  4U6Z A;  4IU6 A;  4OOK A;  2P99 A;  4IKU A;  2V3Y A;  1YVM A;  1MAT A;  3MR1 A;  3IU7 A;  1O0X A;  1WL6 A;  4IF7 A;  4U76 A;  2BN7 A;  2Q96 A;  4FLI A;  2Q8K A;  4RZZ A;  3RVA A;  3BIT A;  2P9A A;  4IPA A;  2GG9 A;  1BOA A;  1WN1 A;  1C22 A;  2GA2 A;  2GU5 A;  2OKN A;  3BIP A;  1XNZ A;  2NQ7 A;  2GGC A;  4U73 A;  4PNC A;  1QXZ A;  2GG3 A;  4A6W A;  1R58 A;  3FMR A;  2B3K A;  2BHD A;  2GU7 A;  3CB6 A;  4S00 A;  1WLR A;  4FKC A;  5CIK A;  4U71 A;  4MAT A;  3PKC A;  1XGS A;  1WY2 A;  2B3L A;  5JHU A;  2GZ5 A;  1YW9 A;  5CDL A;  4U70 A;  5JI6 A;  2BHB A;  5D6F A;  4FUK A;  2DFI A;  3CB5 A;  3PKD A;  3IU8 A;  1C27 A;  4U69 A;  2B3H A;  4U6W A;  2BB7 A;  1C21 A;  2EVM A;  3PKE A;  3PN9 A;  4KM3 A;  2Q94 A;  3IU9 A;  1XGM A;  3MX6 A;  4U75 A;  2BHC A;  4ZWU A;  1QZY A;  4S01 A;  2Q95 A;  5CNX A;  3OOO A;  2BWT A;  2EVC A;  1WL9 A;  1YW7 A;  1C24 A;  1KP0 A;  4FO7 A;  1R5G A;  3D27 A;  2GGB A;  2GU4 A;  2GG7 A;  2BWS A;  5FCH A; 
#chains in the Genus database with same CATH topology
 1W7V A;  3BIQ A;  3QOC A;  4ZWO A;  1B6A A;  1WKM A;  3PKB A;  4IKS A;  4U6E A;  4R60 A;  2GTX A;  2MAT A;  4S2T P;  2GG8 A;  4FO8 A;  4IKT A;  3TAV A;  3Q6D A;  1KQ0 A;  4PV4 A;  5JFR A;  1YJ3 A;  3FMQ A;  1XGO A;  4IKR A;  2V3Z A;  3CTZ A;  5E5B A;  1Y1N A;  5CE6 A;  1QXY A;  3PKA A;  4IEC A;  5CLS A;  4ZWP A;  3I7M A;  1WBQ A;  1QXW A;  2Q93 A;  3MAT A;  4FLL A;  3S6B A;  2OAZ A;  1C23 A;  1BN5 A;  2V3X A;  1KQ9 A;  2BWV A;  2HOW A;  2BWX A;  3PEB A;  2EA2 A;  3IG4 A;  4IDY A;  4FLJ A;  2NQ6 A;  3L7G A;  4S2R P;  2IW2 A;  1W2M A;  2GG0 A;  2BWY A;  4RGZ 1;  2EVO A;  3FM3 A;  2Q92 A;  1PV9 A;  2P98 A;  2EA4 A;  1R5H A;  4JUQ A;  2BWW A;  2BH3 A;  4HXX A;  4Z7M A;  1A16 A;  2GG5 A;  1XGN A;  5FCF A;  4ZNG A;  2ADU A;  4U1B A;  5D6E A;  1YW8 A;  5CDV A;  4FLK A;  2ZSG A;  3OVK A;  4EGE A;  3O5V A;  2BWU A;  4U6C A;  4RZY A;  5CDE A;  2GU6 A;  4B28 A;  3L24 A;  2G6P A;  1CHM A;  4QR8 A;  2GG2 A;  1N51 A;  3IL0 A;  3TB5 A;  4A6V A;  1B59 A;  2BHA A;  3ROR A;  1M35 A;  5E2C A;  4U6J A;  1JAW A;  2V6C A;  4U6Z A;  4IU6 A;  4OOK A;  2P99 A;  4IKU A;  2V3Y A;  1YVM A;  1MAT A;  3MR1 A;  3IU7 A;  1O0X A;  1WL6 A;  4IF7 A;  4U76 A;  2BN7 A;  2Q96 A;  4FLI A;  2Q8K A;  4RZZ A;  3RVA A;  3BIT A;  2P9A A;  4IPA A;  2GG9 A;  1BOA A;  1WN1 A;  1C22 A;  2GA2 A;  2GU5 A;  2OKN A;  3BIP A;  1XNZ A;  2NQ7 A;  2GGC A;  4U73 A;  4PNC A;  1QXZ A;  2GG3 A;  4A6W A;  1R58 A;  3FMR A;  2B3K A;  2BHD A;  2GU7 A;  3CB6 A;  4S00 A;  1WLR A;  4FKC A;  5CIK A;  4U71 A;  4MAT A;  3PKC A;  1XGS A;  1WY2 A;  2B3L A;  5JHU A;  2GZ5 A;  1YW9 A;  5CDL A;  4U70 A;  5JI6 A;  2BHB A;  5D6F A;  4FUK A;  2DFI A;  3CB5 A;  3PKD A;  3IU8 A;  1C27 A;  4U69 A;  2B3H A;  4U6W A;  2BB7 A;  1C21 A;  2EVM A;  3PKE A;  3PN9 A;  4KM3 A;  2Q94 A;  3IU9 A;  1XGM A;  3MX6 A;  4U75 A;  2BHC A;  4ZWU A;  1QZY A;  4S01 A;  2Q95 A;  5CNX A;  3OOO A;  2BWT A;  2EVC A;  1WL9 A;  1YW7 A;  1C24 A;  1KP0 A;  4FO7 A;  1R5G A;  3D27 A;  2GGB A;  2GU4 A;  2GG7 A;  2BWS A;  5FCH A; 
#chains in the Genus database with same CATH homology
 1W7V A;  3BIQ A;  3QOC A;  4ZWO A;  1B6A A;  1WKM A;  3PKB A;  4IKS A;  4U6E A;  4R60 A;  2GTX A;  2MAT A;  4S2T P;  2GG8 A;  4FO8 A;  4IKT A;  3TAV A;  3Q6D A;  1KQ0 A;  4PV4 A;  5JFR A;  1YJ3 A;  3FMQ A;  1XGO A;  4IKR A;  2V3Z A;  3CTZ A;  5E5B A;  1Y1N A;  5CE6 A;  1QXY A;  3PKA A;  4IEC A;  5CLS A;  4ZWP A;  3I7M A;  1WBQ A;  1QXW A;  2Q93 A;  3MAT A;  4FLL A;  3S6B A;  2OAZ A;  1C23 A;  1BN5 A;  2V3X A;  1KQ9 A;  2BWV A;  2HOW A;  2BWX A;  3PEB A;  2EA2 A;  3IG4 A;  4IDY A;  4FLJ A;  2NQ6 A;  3L7G A;  4S2R P;  2IW2 A;  1W2M A;  2GG0 A;  2BWY A;  4RGZ 1;  2EVO A;  3FM3 A;  2Q92 A;  1PV9 A;  2P98 A;  2EA4 A;  1R5H A;  4JUQ A;  2BWW A;  2BH3 A;  4HXX A;  4Z7M A;  1A16 A;  2GG5 A;  1XGN A;  5FCF A;  4ZNG A;  2ADU A;  4U1B A;  5D6E A;  1YW8 A;  5CDV A;  4FLK A;  2ZSG A;  3OVK A;  4EGE A;  3O5V A;  2BWU A;  4U6C A;  4RZY A;  5CDE A;  2GU6 A;  4B28 A;  3L24 A;  2G6P A;  1CHM A;  4QR8 A;  2GG2 A;  1N51 A;  3IL0 A;  3TB5 A;  4A6V A;  1B59 A;  2BHA A;  3ROR A;  1M35 A;  5E2C A;  4U6J A;  1JAW A;  2V6C A;  4U6Z A;  4IU6 A;  4OOK A;  2P99 A;  4IKU A;  2V3Y A;  1YVM A;  1MAT A;  3MR1 A;  3IU7 A;  1O0X A;  1WL6 A;  4IF7 A;  4U76 A;  2BN7 A;  2Q96 A;  4FLI A;  2Q8K A;  4RZZ A;  3RVA A;  3BIT A;  2P9A A;  4IPA A;  2GG9 A;  1BOA A;  1WN1 A;  1C22 A;  2GA2 A;  2GU5 A;  2OKN A;  3BIP A;  1XNZ A;  2NQ7 A;  2GGC A;  4U73 A;  4PNC A;  1QXZ A;  2GG3 A;  4A6W A;  1R58 A;  3FMR A;  2B3K A;  2BHD A;  2GU7 A;  3CB6 A;  4S00 A;  1WLR A;  4FKC A;  5CIK A;  4U71 A;  4MAT A;  3PKC A;  1XGS A;  1WY2 A;  2B3L A;  5JHU A;  2GZ5 A;  1YW9 A;  5CDL A;  4U70 A;  5JI6 A;  2BHB A;  5D6F A;  4FUK A;  2DFI A;  3CB5 A;  3PKD A;  3IU8 A;  1C27 A;  4U69 A;  2B3H A;  4U6W A;  2BB7 A;  1C21 A;  2EVM A;  3PKE A;  3PN9 A;  4KM3 A;  2Q94 A;  3IU9 A;  1XGM A;  3MX6 A;  4U75 A;  2BHC A;  4ZWU A;  1QZY A;  4S01 A;  2Q95 A;  5CNX A;  3OOO A;  2BWT A;  2EVC A;  1WL9 A;  1YW7 A;  1C24 A;  1KP0 A;  4FO7 A;  1R5G A;  3D27 A;  2GGB A;  2GU4 A;  2GG7 A;  2BWS A;  5FCH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...