1N51A

Aminopeptidase p in complex with the inhibitor apstatin
Total Genus 167
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
167
sequence length
440
structure length
440
Chain Sequence
b'SEISRQEFQRRRQALVEQMQPGSAALIFAAPEVTRSADSEYPYRQNSDFWYFTGFNEPEAVLVLIKSDDTHNHSVLFNRVRDLTAEIWFGRRLGQDAAPEKLGVDRALAFSEINQQLYQLLNGLDVVYHAQGEYAYADVIVNSALEKLRKGSRQNLTAPATMIDWRPVVHEMRLFKSPEEIAVLRRAGEITAMAHTRAMEKCRPGMFEYHLEGEIHHEFNRHGARYPSYNTIVGSGENGCILHYTENECEMRDGDLVLIDAGCEYKGYAGDITRTFPVNGKFTQAQREIYDIVLESLETSLRLYRPGTSILEVTGEVVRIMVSGLVKLGILKGDVDELIAQNAHRPFFMHGLSHWLGLDVHDVGVYGQDRSRILEPGMVLTVEPGLYIAPDAEVPEQYRGIGIRIEDDIVITETGNENLTASVVKKPEEIEALMVAARKQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Xaa-Pro aminopeptidase
publication title Structure of Escherichia coli aminopeptidase P in complex with the inhibitor apstatin.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase/hydrolase inhibitor
total genus 167
structure length 440
sequence length 440
ec nomenclature ec 3.4.11.9: Xaa-Pro aminopeptidase.
pdb deposition date 2002-11-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00557 Peptidase_M24 Metallopeptidase family M24
A PF05195 AMP_N Aminopeptidase P, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.350.10 Alpha Beta 3-Layer(aba) Sandwich Creatine Amidinohydrolase; Chain A, domain 1 Creatinase/prolidase N-terminal domain 1n51A01
3.90.230.10 Alpha Beta Alpha-Beta Complex Creatine Amidinohydrolase Creatinase/methionine aminopeptidase superfamily 1n51A02
1QXZA 3CB5A 2Q92A 5CDEA 3IL0A 3BIPA 4B28A 2BH3A 2EA4A 1WL9A 2GU5A 3QOCA 3FMRA 4ZNGA 2BB7A 2BN7A 1C27A 2Q93A 4IKUA 5D6EA 2B3KA 4MATA 2BHDA 1XGMA 3RVAA 1B6AA 4A6VA 1R5HA 1WLRA 3S6BA 5E5BA 1W2MA 4IF7A 2EVCA 3PKDA 1B59A 2NQ7A 4IPAA 5CDLA 4U76A 2DFIA 2BWSA 1C22A 2V3ZA 3IU9A 4FO7A 1WBQA 1WN1A 2GG8A 4U69A 1O0XA 2GG7A 4RZYA 1KP0A 2MATA 2Q94A 4EGEA 2ZSGA 2GU7A 2BWTA 3IU7A 4QR8A 1XNZA 2B3LA 1M35A 4U6WA 1WL6A 1QXWA 3IU8A 4R60A 4ZWUA 4FLLA 4IKRA 4U6CA 3RORA 5JFRA 4U6EA 5E2CA 3OVKA 1XGOA 3CB6A 4ZWPA 2V6CA 3MX6A 4U71A 2OAZA 3PKEA 4RZZA 1YVMA 1C23A 4PNCA 2IW2A 2P9AA 4IECA 1XGSA 1R5GA 2BWWA 2BHBA 2GGCA 2Q8KA 2OKNA 4A6WA 2BWXA 3PKAA 5FCFA 2B3HA 4S2TP 5JI6A 1YJ3A 2BWYA 1Y1NA 1XGNA 5D6FA 4IKTA 2BWUA 4KM3A 2GG2A 2GTXA 1BOAA 2P99A 4U6JA 3L7GA 2Q95A 3TAVA 1YW8A 4FUKA 2GG5A 1YW9A 1WKMA 2BHCA 5CDVA 1KQ0A 1PV9A 1QZYA 2EA2A 3FMQA 2P98A 4U1BA 2Q96A 3I7MA 3CTZA 4S2RP 3FM3A 1JAWA 4FLIA 1KQ9A 3OOOA 1BN5A 1A16A 5FCHA 3IG4A 4RGZ1 3MATA 2V3YA 4ZWOA 4U70A 5JHUA 1W7VA 4PV4A 2GA2A 1R58A 1WY2A 3O5VA 3BIQA 4S00A 3TB5A 4IU6A 2V3XA 4U6ZA 4Z7MA 3MR1A 2ADUA 4IKSA 1N51A 1C21A 2HOWA 2GZ5A 2GGBA 1YW7A 3L24A 2GG3A 2GU4A 3BITA 5CE6A 1MATA 2NQ6A 4JUQA 3PKCA 4FKCA 4FO8A 4IDYA 4OOKA 2GU6A 1CHMA 5CNXA 3D27A 4U73A 3PKBA 2GG9A 4U75A 2GG0A 5CIKA 2EVMA 4FLJA 3PEBA 2G6PA 5CLSA 4HXXA 2BHAA 2EVOA 1C24A 3PN9A 3Q6DA 4S01A 1QXYA 4FLKA 2BWVA
chains in the Genus database with same CATH superfamily
1QXZA 3CB5A 2Q92A 5CDEA 3IL0A 3BIPA 4B28A 2BH3A 2EA4A 1WL9A 2GU5A 3QOCA 3FMRA 4ZNGA 2BB7A 2BN7A 1C27A 2Q93A 4IKUA 5D6EA 2B3KA 4MATA 2BHDA 1XGMA 3RVAA 1B6AA 4A6VA 1R5HA 1WLRA 3S6BA 5E5BA 1W2MA 4IF7A 2EVCA 3PKDA 1B59A 2NQ7A 4IPAA 5CDLA 4U76A 2DFIA 2BWSA 1C22A 2V3ZA 3IU9A 4FO7A 1WBQA 1WN1A 2GG8A 4U69A 1O0XA 2GG7A 4RZYA 1KP0A 2MATA 2Q94A 4EGEA 2ZSGA 2GU7A 2BWTA 3IU7A 4QR8A 1XNZA 2B3LA 1M35A 4U6WA 1WL6A 1QXWA 3IU8A 4R60A 4ZWUA 4FLLA 4IKRA 4U6CA 3RORA 5JFRA 4U6EA 5E2CA 3OVKA 1XGOA 3CB6A 4ZWPA 2V6CA 3MX6A 4U71A 2OAZA 3PKEA 4RZZA 1YVMA 1C23A 4PNCA 2IW2A 2P9AA 4IECA 1XGSA 1R5GA 2BWWA 2BHBA 2GGCA 2Q8KA 2OKNA 4A6WA 2BWXA 3PKAA 5FCFA 2B3HA 4S2TP 5JI6A 1YJ3A 2BWYA 1Y1NA 1XGNA 5D6FA 4IKTA 2BWUA 4KM3A 2GG2A 2GTXA 1BOAA 2P99A 4U6JA 3L7GA 2Q95A 3TAVA 1YW8A 4FUKA 2GG5A 1YW9A 1WKMA 2BHCA 5CDVA 1KQ0A 1PV9A 1QZYA 2EA2A 3FMQA 2P98A 4U1BA 2Q96A 3I7MA 3CTZA 4S2RP 3FM3A 1JAWA 4FLIA 1KQ9A 3OOOA 1BN5A 1A16A 5FCHA 3IG4A 4RGZ1 3MATA 2V3YA 4ZWOA 4U70A 5JHUA 1W7VA 4PV4A 2GA2A 1R58A 1WY2A 3O5VA 3BIQA 4S00A 3TB5A 4IU6A 2V3XA 4U6ZA 4Z7MA 3MR1A 2ADUA 4IKSA 1N51A 1C21A 2HOWA 2GZ5A 2GGBA 1YW7A 3L24A 2GG3A 2GU4A 3BITA 5CE6A 1MATA 2NQ6A 4JUQA 3PKCA 4FKCA 4FO8A 4IDYA 4OOKA 2GU6A 1CHMA 5CNXA 3D27A 4U73A 3PKBA 2GG9A 4U75A 2GG0A 5CIKA 2EVMA 4FLJA 3PEBA 2G6PA 5CLSA 4HXXA 2BHAA 2EVOA 1C24A 3PN9A 3Q6DA 4S01A 1QXYA 4FLKA 2BWVA
chains in the Genus database with same CATH topology
1QXZA 3CB5A 2Q92A 5CDEA 3IL0A 3BIPA 4B28A 2BH3A 2EA4A 1WL9A 2GU5A 3QOCA 3FMRA 4ZNGA 2BB7A 2BN7A 1C27A 2Q93A 4IKUA 5D6EA 2B3KA 4MATA 2BHDA 1XGMA 3RVAA 1B6AA 4A6VA 1R5HA 1WLRA 3S6BA 5E5BA 1W2MA 4IF7A 2EVCA 3PKDA 1B59A 2NQ7A 4IPAA 5CDLA 4U76A 2DFIA 2BWSA 1C22A 2V3ZA 3IU9A 4FO7A 1WBQA 1WN1A 2GG8A 4U69A 1O0XA 2GG7A 4RZYA 1KP0A 2MATA 2Q94A 4EGEA 2ZSGA 2GU7A 2BWTA 3IU7A 4QR8A 1XNZA 2B3LA 1M35A 4U6WA 1WL6A 1QXWA 3IU8A 4R60A 4ZWUA 4FLLA 4IKRA 4U6CA 3RORA 5JFRA 4U6EA 5E2CA 3OVKA 1XGOA 3CB6A 4ZWPA 2V6CA 3MX6A 4U71A 2OAZA 3PKEA 4RZZA 1YVMA 1C23A 4PNCA 2IW2A 2P9AA 4IECA 1XGSA 1R5GA 2BWWA 2BHBA 2GGCA 2Q8KA 2OKNA 4A6WA 2BWXA 3PKAA 5FCFA 2B3HA 4S2TP 5JI6A 1YJ3A 2BWYA 1Y1NA 1XGNA 5D6FA 4IKTA 2BWUA 4KM3A 2GG2A 2GTXA 1BOAA 2P99A 4U6JA 3L7GA 2Q95A 3TAVA 1YW8A 4FUKA 2GG5A 1YW9A 1WKMA 2BHCA 5CDVA 1KQ0A 1PV9A 1QZYA 2EA2A 3FMQA 2P98A 4U1BA 2Q96A 3I7MA 3CTZA 4S2RP 3FM3A 1JAWA 4FLIA 1KQ9A 3OOOA 1BN5A 1A16A 5FCHA 3IG4A 4RGZ1 3MATA 2V3YA 4ZWOA 4U70A 5JHUA 1W7VA 4PV4A 2GA2A 1R58A 1WY2A 3O5VA 3BIQA 4S00A 3TB5A 4IU6A 2V3XA 4U6ZA 4Z7MA 3MR1A 2ADUA 4IKSA 1N51A 1C21A 2HOWA 2GZ5A 2GGBA 1YW7A 3L24A 2GG3A 2GU4A 3BITA 5CE6A 1MATA 2NQ6A 4JUQA 3PKCA 4FKCA 4FO8A 4IDYA 4OOKA 2GU6A 1CHMA 5CNXA 3D27A 4U73A 3PKBA 2GG9A 4U75A 2GG0A 5CIKA 2EVMA 4FLJA 3PEBA 2G6PA 5CLSA 4HXXA 2BHAA 2EVOA 1C24A 3PN9A 3Q6DA 4S01A 1QXYA 4FLKA 2BWVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1QXZ A;  3CB5 A;  2Q92 A;  5CDE A;  3IL0 A;  3BIP A;  4B28 A;  2BH3 A;  2EA4 A;  1WL9 A;  2GU5 A;  3QOC A;  3FMR A;  4ZNG A;  2BB7 A;  2BN7 A;  1C27 A;  2Q93 A;  4IKU A;  5D6E A;  2B3K A;  4MAT A;  2BHD A;  1XGM A;  3RVA A;  1B6A A;  4A6V A;  1R5H A;  1WLR A;  3S6B A;  5E5B A;  1W2M A;  4IF7 A;  2EVC A;  3PKD A;  1B59 A;  2NQ7 A;  4IPA A;  5CDL A;  4U76 A;  2DFI A;  2BWS A;  1C22 A;  2V3Z A;  3IU9 A;  4FO7 A;  1WBQ A;  1WN1 A;  2GG8 A;  4U69 A;  1O0X A;  2GG7 A;  4RZY A;  1KP0 A;  2MAT A;  2Q94 A;  4EGE A;  2ZSG A;  2GU7 A;  2BWT A;  3IU7 A;  4QR8 A;  1XNZ A;  2B3L A;  1M35 A;  4U6W A;  1WL6 A;  1QXW A;  3IU8 A;  4R60 A;  4ZWU A;  4FLL A;  4IKR A;  4U6C A;  3ROR A;  5JFR A;  4U6E A;  5E2C A;  3OVK A;  1XGO A;  3CB6 A;  4ZWP A;  2V6C A;  3MX6 A;  4U71 A;  2OAZ A;  3PKE A;  4RZZ A;  1YVM A;  1C23 A;  4PNC A;  2IW2 A;  2P9A A;  4IEC A;  1XGS A;  1R5G A;  2BWW A;  2BHB A;  2GGC A;  2Q8K A;  2OKN A;  4A6W A;  2BWX A;  3PKA A;  5FCF A;  2B3H A;  4S2T P;  5JI6 A;  1YJ3 A;  2BWY A;  1Y1N A;  1XGN A;  5D6F A;  4IKT A;  2BWU A;  4KM3 A;  2GG2 A;  2GTX A;  1BOA A;  2P99 A;  4U6J A;  3L7G A;  2Q95 A;  3TAV A;  1YW8 A;  4FUK A;  2GG5 A;  1YW9 A;  1WKM A;  2BHC A;  5CDV A;  1KQ0 A;  1PV9 A;  1QZY A;  2EA2 A;  3FMQ A;  2P98 A;  4U1B A;  2Q96 A;  3I7M A;  3CTZ A;  4S2R P;  3FM3 A;  1JAW A;  4FLI A;  1KQ9 A;  3OOO A;  1BN5 A;  1A16 A;  5FCH A;  3IG4 A;  4RGZ 1;  3MAT A;  2V3Y A;  4ZWO A;  4U70 A;  5JHU A;  1W7V A;  4PV4 A;  2GA2 A;  1R58 A;  1WY2 A;  3O5V A;  3BIQ A;  4S00 A;  3TB5 A;  4IU6 A;  2V3X A;  4U6Z A;  4Z7M A;  3MR1 A;  2ADU A;  4IKS A;  1N51 A;  1C21 A;  2HOW A;  2GZ5 A;  2GGB A;  1YW7 A;  3L24 A;  2GG3 A;  2GU4 A;  3BIT A;  5CE6 A;  1MAT A;  2NQ6 A;  4JUQ A;  3PKC A;  4FKC A;  4FO8 A;  4IDY A;  4OOK A;  2GU6 A;  1CHM A;  5CNX A;  3D27 A;  4U73 A;  3PKB A;  2GG9 A;  4U75 A;  2GG0 A;  5CIK A;  2EVM A;  4FLJ A;  3PEB A;  2G6P A;  5CLS A;  4HXX A;  2BHA A;  2EVO A;  1C24 A;  3PN9 A;  3Q6D A;  4S01 A;  1QXY A;  4FLK A;  2BWV A; 
#chains in the Genus database with same CATH topology
 1QXZ A;  3CB5 A;  2Q92 A;  5CDE A;  3IL0 A;  3BIP A;  4B28 A;  2BH3 A;  2EA4 A;  1WL9 A;  2GU5 A;  3QOC A;  3FMR A;  4ZNG A;  2BB7 A;  2BN7 A;  1C27 A;  2Q93 A;  4IKU A;  5D6E A;  2B3K A;  4MAT A;  2BHD A;  1XGM A;  3RVA A;  1B6A A;  4A6V A;  1R5H A;  1WLR A;  3S6B A;  5E5B A;  1W2M A;  4IF7 A;  2EVC A;  3PKD A;  1B59 A;  2NQ7 A;  4IPA A;  5CDL A;  4U76 A;  2DFI A;  2BWS A;  1C22 A;  2V3Z A;  3IU9 A;  4FO7 A;  1WBQ A;  1WN1 A;  2GG8 A;  4U69 A;  1O0X A;  2GG7 A;  4RZY A;  1KP0 A;  2MAT A;  2Q94 A;  4EGE A;  2ZSG A;  2GU7 A;  2BWT A;  3IU7 A;  4QR8 A;  1XNZ A;  2B3L A;  1M35 A;  4U6W A;  1WL6 A;  1QXW A;  3IU8 A;  4R60 A;  4ZWU A;  4FLL A;  4IKR A;  4U6C A;  3ROR A;  5JFR A;  4U6E A;  5E2C A;  3OVK A;  1XGO A;  3CB6 A;  4ZWP A;  2V6C A;  3MX6 A;  4U71 A;  2OAZ A;  3PKE A;  4RZZ A;  1YVM A;  1C23 A;  4PNC A;  2IW2 A;  2P9A A;  4IEC A;  1XGS A;  1R5G A;  2BWW A;  2BHB A;  2GGC A;  2Q8K A;  2OKN A;  4A6W A;  2BWX A;  3PKA A;  5FCF A;  2B3H A;  4S2T P;  5JI6 A;  1YJ3 A;  2BWY A;  1Y1N A;  1XGN A;  5D6F A;  4IKT A;  2BWU A;  4KM3 A;  2GG2 A;  2GTX A;  1BOA A;  2P99 A;  4U6J A;  3L7G A;  2Q95 A;  3TAV A;  1YW8 A;  4FUK A;  2GG5 A;  1YW9 A;  1WKM A;  2BHC A;  5CDV A;  1KQ0 A;  1PV9 A;  1QZY A;  2EA2 A;  3FMQ A;  2P98 A;  4U1B A;  2Q96 A;  3I7M A;  3CTZ A;  4S2R P;  3FM3 A;  1JAW A;  4FLI A;  1KQ9 A;  3OOO A;  1BN5 A;  1A16 A;  5FCH A;  3IG4 A;  4RGZ 1;  3MAT A;  2V3Y A;  4ZWO A;  4U70 A;  5JHU A;  1W7V A;  4PV4 A;  2GA2 A;  1R58 A;  1WY2 A;  3O5V A;  3BIQ A;  4S00 A;  3TB5 A;  4IU6 A;  2V3X A;  4U6Z A;  4Z7M A;  3MR1 A;  2ADU A;  4IKS A;  1N51 A;  1C21 A;  2HOW A;  2GZ5 A;  2GGB A;  1YW7 A;  3L24 A;  2GG3 A;  2GU4 A;  3BIT A;  5CE6 A;  1MAT A;  2NQ6 A;  4JUQ A;  3PKC A;  4FKC A;  4FO8 A;  4IDY A;  4OOK A;  2GU6 A;  1CHM A;  5CNX A;  3D27 A;  4U73 A;  3PKB A;  2GG9 A;  4U75 A;  2GG0 A;  5CIK A;  2EVM A;  4FLJ A;  3PEB A;  2G6P A;  5CLS A;  4HXX A;  2BHA A;  2EVO A;  1C24 A;  3PN9 A;  3Q6D A;  4S01 A;  1QXY A;  4FLK A;  2BWV A; 
#chains in the Genus database with same CATH homology
 1QXZ A;  3CB5 A;  2Q92 A;  5CDE A;  3IL0 A;  3BIP A;  4B28 A;  2BH3 A;  2EA4 A;  1WL9 A;  2GU5 A;  3QOC A;  3FMR A;  4ZNG A;  2BB7 A;  2BN7 A;  1C27 A;  2Q93 A;  4IKU A;  5D6E A;  2B3K A;  4MAT A;  2BHD A;  1XGM A;  3RVA A;  1B6A A;  4A6V A;  1R5H A;  1WLR A;  3S6B A;  5E5B A;  1W2M A;  4IF7 A;  2EVC A;  3PKD A;  1B59 A;  2NQ7 A;  4IPA A;  5CDL A;  4U76 A;  2DFI A;  2BWS A;  1C22 A;  2V3Z A;  3IU9 A;  4FO7 A;  1WBQ A;  1WN1 A;  2GG8 A;  4U69 A;  1O0X A;  2GG7 A;  4RZY A;  1KP0 A;  2MAT A;  2Q94 A;  4EGE A;  2ZSG A;  2GU7 A;  2BWT A;  3IU7 A;  4QR8 A;  1XNZ A;  2B3L A;  1M35 A;  4U6W A;  1WL6 A;  1QXW A;  3IU8 A;  4R60 A;  4ZWU A;  4FLL A;  4IKR A;  4U6C A;  3ROR A;  5JFR A;  4U6E A;  5E2C A;  3OVK A;  1XGO A;  3CB6 A;  4ZWP A;  2V6C A;  3MX6 A;  4U71 A;  2OAZ A;  3PKE A;  4RZZ A;  1YVM A;  1C23 A;  4PNC A;  2IW2 A;  2P9A A;  4IEC A;  1XGS A;  1R5G A;  2BWW A;  2BHB A;  2GGC A;  2Q8K A;  2OKN A;  4A6W A;  2BWX A;  3PKA A;  5FCF A;  2B3H A;  4S2T P;  5JI6 A;  1YJ3 A;  2BWY A;  1Y1N A;  1XGN A;  5D6F A;  4IKT A;  2BWU A;  4KM3 A;  2GG2 A;  2GTX A;  1BOA A;  2P99 A;  4U6J A;  3L7G A;  2Q95 A;  3TAV A;  1YW8 A;  4FUK A;  2GG5 A;  1YW9 A;  1WKM A;  2BHC A;  5CDV A;  1KQ0 A;  1PV9 A;  1QZY A;  2EA2 A;  3FMQ A;  2P98 A;  4U1B A;  2Q96 A;  3I7M A;  3CTZ A;  4S2R P;  3FM3 A;  1JAW A;  4FLI A;  1KQ9 A;  3OOO A;  1BN5 A;  1A16 A;  5FCH A;  3IG4 A;  4RGZ 1;  3MAT A;  2V3Y A;  4ZWO A;  4U70 A;  5JHU A;  1W7V A;  4PV4 A;  2GA2 A;  1R58 A;  1WY2 A;  3O5V A;  3BIQ A;  4S00 A;  3TB5 A;  4IU6 A;  2V3X A;  4U6Z A;  4Z7M A;  3MR1 A;  2ADU A;  4IKS A;  1N51 A;  1C21 A;  2HOW A;  2GZ5 A;  2GGB A;  1YW7 A;  3L24 A;  2GG3 A;  2GU4 A;  3BIT A;  5CE6 A;  1MAT A;  2NQ6 A;  4JUQ A;  3PKC A;  4FKC A;  4FO8 A;  4IDY A;  4OOK A;  2GU6 A;  1CHM A;  5CNX A;  3D27 A;  4U73 A;  3PKB A;  2GG9 A;  4U75 A;  2GG0 A;  5CIK A;  2EVM A;  4FLJ A;  3PEB A;  2G6P A;  5CLS A;  4HXX A;  2BHA A;  2EVO A;  1C24 A;  3PN9 A;  3Q6D A;  4S01 A;  1QXY A;  4FLK A;  2BWV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...