1N51A

Aminopeptidase p in complex with the inhibitor apstatin
Total Genus 167
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
167
sequence length
440
structure length
440
Chain Sequence
SEISRQEFQRRRQALVEQMQPGSAALIFAAPEVTRSADSEYPYRQNSDFWYFTGFNEPEAVLVLIKSDDTHNHSVLFNRVRDLTAEIWFGRRLGQDAAPEKLGVDRALAFSEINQQLYQLLNGLDVVYHAQGEYAYADVIVNSALEKLRKGSRQNLTAPATMIDWRPVVHEMRLFKSPEEIAVLRRAGEITAMAHTRAMEKCRPGMFEYHLEGEIHHEFNRHGARYPSYNTIVGSGENGCILHYTENECEMRDGDLVLIDAGCEYKGYAGDITRTFPVNGKFTQAQREIYDIVLESLETSLRLYRPGTSILEVTGEVVRIMVSGLVKLGILKGDVDELIAQNAHRPFFMHGLSHWLGLDVHDVGVYGQDRSRILEPGMVLTVEPGLYIAPDAEVPEQYRGIGIRIEDDIVITETGNENLTASVVKKPEEIEALMVAARKQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of Escherichia coli aminopeptidase P in complex with the inhibitor apstatin.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords Xaa-Pro aminopeptidase
total genus 167
structure length 440
sequence length 440
ec nomenclature ec 3.4.11.9: Xaa-Pro aminopeptidase.
pdb deposition date 2002-11-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00557 Peptidase_M24 Metallopeptidase family M24
A PF05195 AMP_N Aminopeptidase P, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.350.10 Alpha Beta 3-Layer(aba) Sandwich Creatine Amidinohydrolase; Chain A, domain 1 Creatinase/prolidase N-terminal domain 1n51A01
3.90.230.10 Alpha Beta Alpha-Beta Complex Creatine Amidinohydrolase Creatinase/methionine aminopeptidase superfamily 1n51A02
5E5BA 3PEBA 5CE6A 3IU8A 2Q94A 4HXXA 5FCHA 2GZ5A 3D27A 2BWWA 4OOKA 1YW7A 2P9AA 5E2CA 3TB5A 1QZYA 2P98A 1Y1NA 3FM3A 2Q92A 1PV9A 2BWVA 4U75A 5D6EA 1KP0A 5JHUA 3IU9A 4PNCA 4S00A 4FLKA 2BHCA 5JI6A 2GG2A 4IECA 2EA2A 3L24A 2BWTA 3BIQA 4RZYA 5D6FA 3I7MA 4IPAA 4ZWOA 1B59A 2GG8A 3FMRA 4U73A 4A6VA 1WN1A 3PKBA 1W2MA 2BWYA 2B3KA 2V6CA 2B3LA 1BOAA 1YW8A 2Q8KA 2IW2A 3IG4A 1QXWA 2EVCA 3MX6A 4IDYA 3OOOA 1C23A 2Q96A 1WBQA 3OVKA 4R60A 1C21A 1XGOA 4IKUA 4IKTA 2MATA 2GU6A 2BB7A 2BHDA 2GU5A 5CNXA 2OKNA 3O5VA 4KM3A 1R5GA 3QOCA 4U69A 4RGZ1 2GG5A 2Q95A 1A16A 1MATA 2DFIA 4U1BA 2BH3A 3RORA 3PKCA 2EA4A 3BIPA 4U6CA 2G6PA 3Q6DA 1B6AA 4S01A 1XNZA 3MR1A 3PKEA 2GTXA 2V3ZA 4FO7A 3TAVA 3L7GA 1R58A 2GA2A 2ADUA 5CDVA 1O0XA 2BWXA 4U6ZA 2B3HA 4S2RP 2BHAA 4JUQA 2BWSA 2EVMA 4QR8A 2GG7A 1YVMA 1WKMA 3CB5A 4FKCA 3RVAA 5CLSA 5FCFA 1QXZA 2EVOA 3PKAA 1M35A 4IF7A 1WY2A 2V3YA 2BN7A 4B28A 1W7VA 4IKSA 4U70A 1XGNA 1JAWA 2GG3A 1CHMA 4U6JA 1YJ3A 4U6EA 2OAZA 4U76A 5CIKA 4A6WA 2GG0A 4IU6A 3IL0A 4EGEA 3PN9A 1XGMA 3MATA 2BWUA 1KQ9A 2P99A 3FMQA 4FUKA 4IKRA 1KQ0A 1N51A 2NQ6A 1WL9A 5CDLA 1C22A 4FLJA 2GU4A 4PV4A 2Q93A 2V3XA 1C24A 4MATA 2GG9A 3BITA 2GU7A 4ZNGA 3IU7A 3CTZA 2NQ7A 4U71A 3S6BA 4FLIA 1BN5A 4RZZA 1YW9A 1WLRA 1QXYA 4ZWUA 1WL6A 2BHBA 2HOWA 2ZSGA 5CDEA 1C27A 2GGBA 2GGCA 5JFRA 4S2TP 4FO8A 4ZWPA 3CB6A 4U6WA 1R5HA 4Z7MA 1XGSA 3PKDA 4FLLA
chains in the Genus database with same CATH superfamily
5E5BA 3PEBA 5CE6A 3IU8A 2Q94A 4HXXA 5FCHA 2GZ5A 3D27A 2BWWA 4OOKA 1YW7A 2P9AA 5E2CA 3TB5A 1QZYA 2P98A 1Y1NA 3FM3A 2Q92A 1PV9A 2BWVA 4U75A 5D6EA 1KP0A 5JHUA 3IU9A 4PNCA 4S00A 4FLKA 2BHCA 5JI6A 2GG2A 4IECA 2EA2A 3L24A 2BWTA 3BIQA 4RZYA 5D6FA 3I7MA 4IPAA 4ZWOA 1B59A 2GG8A 3FMRA 4U73A 4A6VA 1WN1A 3PKBA 1W2MA 2BWYA 2B3KA 2V6CA 2B3LA 1BOAA 1YW8A 2Q8KA 2IW2A 3IG4A 1QXWA 2EVCA 3MX6A 4IDYA 3OOOA 1C23A 2Q96A 1WBQA 3OVKA 4R60A 1C21A 1XGOA 4IKUA 4IKTA 2MATA 2GU6A 2BB7A 2BHDA 2GU5A 5CNXA 2OKNA 3O5VA 4KM3A 1R5GA 3QOCA 4U69A 4RGZ1 2GG5A 2Q95A 1A16A 1MATA 2DFIA 4U1BA 2BH3A 3RORA 3PKCA 2EA4A 3BIPA 4U6CA 2G6PA 3Q6DA 1B6AA 4S01A 1XNZA 3MR1A 3PKEA 2GTXA 2V3ZA 4FO7A 3TAVA 3L7GA 1R58A 2GA2A 2ADUA 5CDVA 1O0XA 2BWXA 4U6ZA 2B3HA 4S2RP 2BHAA 4JUQA 2BWSA 2EVMA 4QR8A 2GG7A 1YVMA 1WKMA 3CB5A 4FKCA 3RVAA 5CLSA 5FCFA 1QXZA 2EVOA 3PKAA 1M35A 4IF7A 1WY2A 2V3YA 2BN7A 4B28A 1W7VA 4IKSA 4U70A 1XGNA 1JAWA 2GG3A 1CHMA 4U6JA 1YJ3A 4U6EA 2OAZA 4U76A 5CIKA 4A6WA 2GG0A 4IU6A 3IL0A 4EGEA 3PN9A 1XGMA 3MATA 2BWUA 1KQ9A 2P99A 3FMQA 4FUKA 4IKRA 1KQ0A 1N51A 2NQ6A 1WL9A 5CDLA 1C22A 4FLJA 2GU4A 4PV4A 2Q93A 2V3XA 1C24A 4MATA 2GG9A 3BITA 2GU7A 4ZNGA 3IU7A 3CTZA 2NQ7A 4U71A 3S6BA 4FLIA 1BN5A 4RZZA 1YW9A 1WLRA 1QXYA 4ZWUA 1WL6A 2BHBA 2HOWA 2ZSGA 5CDEA 1C27A 2GGBA 2GGCA 5JFRA 4S2TP 4FO8A 4ZWPA 3CB6A 4U6WA 1R5HA 4Z7MA 1XGSA 3PKDA 4FLLA
chains in the Genus database with same CATH topology
5E5BA 3PEBA 5CE6A 3IU8A 2Q94A 4HXXA 5FCHA 2GZ5A 3D27A 2BWWA 4OOKA 1YW7A 2P9AA 5E2CA 3TB5A 1QZYA 2P98A 1Y1NA 3FM3A 2Q92A 1PV9A 2BWVA 4U75A 5D6EA 1KP0A 5JHUA 3IU9A 4PNCA 4S00A 4FLKA 2BHCA 5JI6A 2GG2A 4IECA 2EA2A 3L24A 2BWTA 3BIQA 4RZYA 5D6FA 3I7MA 4IPAA 4ZWOA 1B59A 2GG8A 3FMRA 4U73A 4A6VA 1WN1A 3PKBA 1W2MA 2BWYA 2B3KA 2V6CA 2B3LA 1BOAA 1YW8A 2Q8KA 2IW2A 3IG4A 1QXWA 2EVCA 3MX6A 4IDYA 3OOOA 1C23A 2Q96A 1WBQA 3OVKA 4R60A 1C21A 1XGOA 4IKUA 4IKTA 2MATA 2GU6A 2BB7A 2BHDA 2GU5A 5CNXA 2OKNA 3O5VA 4KM3A 1R5GA 3QOCA 4U69A 4RGZ1 2GG5A 2Q95A 1A16A 1MATA 2DFIA 4U1BA 2BH3A 3RORA 3PKCA 2EA4A 3BIPA 4U6CA 2G6PA 3Q6DA 1B6AA 4S01A 1XNZA 3MR1A 3PKEA 2GTXA 2V3ZA 4FO7A 3TAVA 3L7GA 1R58A 2GA2A 2ADUA 5CDVA 1O0XA 2BWXA 4U6ZA 2B3HA 4S2RP 2BHAA 4JUQA 2BWSA 2EVMA 4QR8A 2GG7A 1YVMA 1WKMA 3CB5A 4FKCA 3RVAA 5CLSA 5FCFA 1QXZA 2EVOA 3PKAA 1M35A 4IF7A 1WY2A 2V3YA 2BN7A 4B28A 1W7VA 4IKSA 4U70A 1XGNA 1JAWA 2GG3A 1CHMA 4U6JA 1YJ3A 4U6EA 2OAZA 4U76A 5CIKA 4A6WA 2GG0A 4IU6A 3IL0A 4EGEA 3PN9A 1XGMA 3MATA 2BWUA 1KQ9A 2P99A 3FMQA 4FUKA 4IKRA 1KQ0A 1N51A 2NQ6A 1WL9A 5CDLA 1C22A 4FLJA 2GU4A 4PV4A 2Q93A 2V3XA 1C24A 4MATA 2GG9A 3BITA 2GU7A 4ZNGA 3IU7A 3CTZA 2NQ7A 4U71A 3S6BA 4FLIA 1BN5A 4RZZA 1YW9A 1WLRA 1QXYA 4ZWUA 1WL6A 2BHBA 2HOWA 2ZSGA 5CDEA 1C27A 2GGBA 2GGCA 5JFRA 4S2TP 4FO8A 4ZWPA 3CB6A 4U6WA 1R5HA 4Z7MA 1XGSA 3PKDA 4FLLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5E5B A;  3PEB A;  5CE6 A;  3IU8 A;  2Q94 A;  4HXX A;  5FCH A;  2GZ5 A;  3D27 A;  2BWW A;  4OOK A;  1YW7 A;  2P9A A;  5E2C A;  3TB5 A;  1QZY A;  2P98 A;  1Y1N A;  3FM3 A;  2Q92 A;  1PV9 A;  2BWV A;  4U75 A;  5D6E A;  1KP0 A;  5JHU A;  3IU9 A;  4PNC A;  4S00 A;  4FLK A;  2BHC A;  5JI6 A;  2GG2 A;  4IEC A;  2EA2 A;  3L24 A;  2BWT A;  3BIQ A;  4RZY A;  5D6F A;  3I7M A;  4IPA A;  4ZWO A;  1B59 A;  2GG8 A;  3FMR A;  4U73 A;  4A6V A;  1WN1 A;  3PKB A;  1W2M A;  2BWY A;  2B3K A;  2V6C A;  2B3L A;  1BOA A;  1YW8 A;  2Q8K A;  2IW2 A;  3IG4 A;  1QXW A;  2EVC A;  3MX6 A;  4IDY A;  3OOO A;  1C23 A;  2Q96 A;  1WBQ A;  3OVK A;  4R60 A;  1C21 A;  1XGO A;  4IKU A;  4IKT A;  2MAT A;  2GU6 A;  2BB7 A;  2BHD A;  2GU5 A;  5CNX A;  2OKN A;  3O5V A;  4KM3 A;  1R5G A;  3QOC A;  4U69 A;  4RGZ 1;  2GG5 A;  2Q95 A;  1A16 A;  1MAT A;  2DFI A;  4U1B A;  2BH3 A;  3ROR A;  3PKC A;  2EA4 A;  3BIP A;  4U6C A;  2G6P A;  3Q6D A;  1B6A A;  4S01 A;  1XNZ A;  3MR1 A;  3PKE A;  2GTX A;  2V3Z A;  4FO7 A;  3TAV A;  3L7G A;  1R58 A;  2GA2 A;  2ADU A;  5CDV A;  1O0X A;  2BWX A;  4U6Z A;  2B3H A;  4S2R P;  2BHA A;  4JUQ A;  2BWS A;  2EVM A;  4QR8 A;  2GG7 A;  1YVM A;  1WKM A;  3CB5 A;  4FKC A;  3RVA A;  5CLS A;  5FCF A;  1QXZ A;  2EVO A;  3PKA A;  1M35 A;  4IF7 A;  1WY2 A;  2V3Y A;  2BN7 A;  4B28 A;  1W7V A;  4IKS A;  4U70 A;  1XGN A;  1JAW A;  2GG3 A;  1CHM A;  4U6J A;  1YJ3 A;  4U6E A;  2OAZ A;  4U76 A;  5CIK A;  4A6W A;  2GG0 A;  4IU6 A;  3IL0 A;  4EGE A;  3PN9 A;  1XGM A;  3MAT A;  2BWU A;  1KQ9 A;  2P99 A;  3FMQ A;  4FUK A;  4IKR A;  1KQ0 A;  1N51 A;  2NQ6 A;  1WL9 A;  5CDL A;  1C22 A;  4FLJ A;  2GU4 A;  4PV4 A;  2Q93 A;  2V3X A;  1C24 A;  4MAT A;  2GG9 A;  3BIT A;  2GU7 A;  4ZNG A;  3IU7 A;  3CTZ A;  2NQ7 A;  4U71 A;  3S6B A;  4FLI A;  1BN5 A;  4RZZ A;  1YW9 A;  1WLR A;  1QXY A;  4ZWU A;  1WL6 A;  2BHB A;  2HOW A;  2ZSG A;  5CDE A;  1C27 A;  2GGB A;  2GGC A;  5JFR A;  4S2T P;  4FO8 A;  4ZWP A;  3CB6 A;  4U6W A;  1R5H A;  4Z7M A;  1XGS A;  3PKD A;  4FLL A; 
#chains in the Genus database with same CATH topology
 5E5B A;  3PEB A;  5CE6 A;  3IU8 A;  2Q94 A;  4HXX A;  5FCH A;  2GZ5 A;  3D27 A;  2BWW A;  4OOK A;  1YW7 A;  2P9A A;  5E2C A;  3TB5 A;  1QZY A;  2P98 A;  1Y1N A;  3FM3 A;  2Q92 A;  1PV9 A;  2BWV A;  4U75 A;  5D6E A;  1KP0 A;  5JHU A;  3IU9 A;  4PNC A;  4S00 A;  4FLK A;  2BHC A;  5JI6 A;  2GG2 A;  4IEC A;  2EA2 A;  3L24 A;  2BWT A;  3BIQ A;  4RZY A;  5D6F A;  3I7M A;  4IPA A;  4ZWO A;  1B59 A;  2GG8 A;  3FMR A;  4U73 A;  4A6V A;  1WN1 A;  3PKB A;  1W2M A;  2BWY A;  2B3K A;  2V6C A;  2B3L A;  1BOA A;  1YW8 A;  2Q8K A;  2IW2 A;  3IG4 A;  1QXW A;  2EVC A;  3MX6 A;  4IDY A;  3OOO A;  1C23 A;  2Q96 A;  1WBQ A;  3OVK A;  4R60 A;  1C21 A;  1XGO A;  4IKU A;  4IKT A;  2MAT A;  2GU6 A;  2BB7 A;  2BHD A;  2GU5 A;  5CNX A;  2OKN A;  3O5V A;  4KM3 A;  1R5G A;  3QOC A;  4U69 A;  4RGZ 1;  2GG5 A;  2Q95 A;  1A16 A;  1MAT A;  2DFI A;  4U1B A;  2BH3 A;  3ROR A;  3PKC A;  2EA4 A;  3BIP A;  4U6C A;  2G6P A;  3Q6D A;  1B6A A;  4S01 A;  1XNZ A;  3MR1 A;  3PKE A;  2GTX A;  2V3Z A;  4FO7 A;  3TAV A;  3L7G A;  1R58 A;  2GA2 A;  2ADU A;  5CDV A;  1O0X A;  2BWX A;  4U6Z A;  2B3H A;  4S2R P;  2BHA A;  4JUQ A;  2BWS A;  2EVM A;  4QR8 A;  2GG7 A;  1YVM A;  1WKM A;  3CB5 A;  4FKC A;  3RVA A;  5CLS A;  5FCF A;  1QXZ A;  2EVO A;  3PKA A;  1M35 A;  4IF7 A;  1WY2 A;  2V3Y A;  2BN7 A;  4B28 A;  1W7V A;  4IKS A;  4U70 A;  1XGN A;  1JAW A;  2GG3 A;  1CHM A;  4U6J A;  1YJ3 A;  4U6E A;  2OAZ A;  4U76 A;  5CIK A;  4A6W A;  2GG0 A;  4IU6 A;  3IL0 A;  4EGE A;  3PN9 A;  1XGM A;  3MAT A;  2BWU A;  1KQ9 A;  2P99 A;  3FMQ A;  4FUK A;  4IKR A;  1KQ0 A;  1N51 A;  2NQ6 A;  1WL9 A;  5CDL A;  1C22 A;  4FLJ A;  2GU4 A;  4PV4 A;  2Q93 A;  2V3X A;  1C24 A;  4MAT A;  2GG9 A;  3BIT A;  2GU7 A;  4ZNG A;  3IU7 A;  3CTZ A;  2NQ7 A;  4U71 A;  3S6B A;  4FLI A;  1BN5 A;  4RZZ A;  1YW9 A;  1WLR A;  1QXY A;  4ZWU A;  1WL6 A;  2BHB A;  2HOW A;  2ZSG A;  5CDE A;  1C27 A;  2GGB A;  2GGC A;  5JFR A;  4S2T P;  4FO8 A;  4ZWP A;  3CB6 A;  4U6W A;  1R5H A;  4Z7M A;  1XGS A;  3PKD A;  4FLL A; 
#chains in the Genus database with same CATH homology
 5E5B A;  3PEB A;  5CE6 A;  3IU8 A;  2Q94 A;  4HXX A;  5FCH A;  2GZ5 A;  3D27 A;  2BWW A;  4OOK A;  1YW7 A;  2P9A A;  5E2C A;  3TB5 A;  1QZY A;  2P98 A;  1Y1N A;  3FM3 A;  2Q92 A;  1PV9 A;  2BWV A;  4U75 A;  5D6E A;  1KP0 A;  5JHU A;  3IU9 A;  4PNC A;  4S00 A;  4FLK A;  2BHC A;  5JI6 A;  2GG2 A;  4IEC A;  2EA2 A;  3L24 A;  2BWT A;  3BIQ A;  4RZY A;  5D6F A;  3I7M A;  4IPA A;  4ZWO A;  1B59 A;  2GG8 A;  3FMR A;  4U73 A;  4A6V A;  1WN1 A;  3PKB A;  1W2M A;  2BWY A;  2B3K A;  2V6C A;  2B3L A;  1BOA A;  1YW8 A;  2Q8K A;  2IW2 A;  3IG4 A;  1QXW A;  2EVC A;  3MX6 A;  4IDY A;  3OOO A;  1C23 A;  2Q96 A;  1WBQ A;  3OVK A;  4R60 A;  1C21 A;  1XGO A;  4IKU A;  4IKT A;  2MAT A;  2GU6 A;  2BB7 A;  2BHD A;  2GU5 A;  5CNX A;  2OKN A;  3O5V A;  4KM3 A;  1R5G A;  3QOC A;  4U69 A;  4RGZ 1;  2GG5 A;  2Q95 A;  1A16 A;  1MAT A;  2DFI A;  4U1B A;  2BH3 A;  3ROR A;  3PKC A;  2EA4 A;  3BIP A;  4U6C A;  2G6P A;  3Q6D A;  1B6A A;  4S01 A;  1XNZ A;  3MR1 A;  3PKE A;  2GTX A;  2V3Z A;  4FO7 A;  3TAV A;  3L7G A;  1R58 A;  2GA2 A;  2ADU A;  5CDV A;  1O0X A;  2BWX A;  4U6Z A;  2B3H A;  4S2R P;  2BHA A;  4JUQ A;  2BWS A;  2EVM A;  4QR8 A;  2GG7 A;  1YVM A;  1WKM A;  3CB5 A;  4FKC A;  3RVA A;  5CLS A;  5FCF A;  1QXZ A;  2EVO A;  3PKA A;  1M35 A;  4IF7 A;  1WY2 A;  2V3Y A;  2BN7 A;  4B28 A;  1W7V A;  4IKS A;  4U70 A;  1XGN A;  1JAW A;  2GG3 A;  1CHM A;  4U6J A;  1YJ3 A;  4U6E A;  2OAZ A;  4U76 A;  5CIK A;  4A6W A;  2GG0 A;  4IU6 A;  3IL0 A;  4EGE A;  3PN9 A;  1XGM A;  3MAT A;  2BWU A;  1KQ9 A;  2P99 A;  3FMQ A;  4FUK A;  4IKR A;  1KQ0 A;  1N51 A;  2NQ6 A;  1WL9 A;  5CDL A;  1C22 A;  4FLJ A;  2GU4 A;  4PV4 A;  2Q93 A;  2V3X A;  1C24 A;  4MAT A;  2GG9 A;  3BIT A;  2GU7 A;  4ZNG A;  3IU7 A;  3CTZ A;  2NQ7 A;  4U71 A;  3S6B A;  4FLI A;  1BN5 A;  4RZZ A;  1YW9 A;  1WLR A;  1QXY A;  4ZWU A;  1WL6 A;  2BHB A;  2HOW A;  2ZSG A;  5CDE A;  1C27 A;  2GGB A;  2GGC A;  5JFR A;  4S2T P;  4FO8 A;  4ZWP A;  3CB6 A;  4U6W A;  1R5H A;  4Z7M A;  1XGS A;  3PKD A;  4FLL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...