1N51A

Aminopeptidase p in complex with the inhibitor apstatin
Total Genus 167
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
167
sequence length
440
structure length
440
Chain Sequence
SEISRQEFQRRRQALVEQMQPGSAALIFAAPEVTRSADSEYPYRQNSDFWYFTGFNEPEAVLVLIKSDDTHNHSVLFNRVRDLTAEIWFGRRLGQDAAPEKLGVDRALAFSEINQQLYQLLNGLDVVYHAQGEYAYADVIVNSALEKLRKGSRQNLTAPATMIDWRPVVHEMRLFKSPEEIAVLRRAGEITAMAHTRAMEKCRPGMFEYHLEGEIHHEFNRHGARYPSYNTIVGSGENGCILHYTENECEMRDGDLVLIDAGCEYKGYAGDITRTFPVNGKFTQAQREIYDIVLESLETSLRLYRPGTSILEVTGEVVRIMVSGLVKLGILKGDVDELIAQNAHRPFFMHGLSHWLGLDVHDVGVYGQDRSRILEPGMVLTVEPGLYIAPDAEVPEQYRGIGIRIEDDIVITETGNENLTASVVKKPEEIEALMVAARKQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Xaa-Pro aminopeptidase
publication title Structure of Escherichia coli aminopeptidase P in complex with the inhibitor apstatin.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase/hydrolase inhibitor
total genus 167
structure length 440
sequence length 440
ec nomenclature ec 3.4.11.9: Xaa-Pro aminopeptidase.
pdb deposition date 2002-11-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00557 Peptidase_M24 Metallopeptidase family M24
A PF05195 AMP_N Aminopeptidase P, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.350.10 Alpha Beta 3-Layer(aba) Sandwich Creatine Amidinohydrolase; Chain A, domain 1 Creatinase/prolidase N-terminal domain 1n51A01
3.90.230.10 Alpha Beta Alpha-Beta Complex Creatine Amidinohydrolase Creatinase/methionine aminopeptidase superfamily 1n51A02
5JFRA 1JAWA 2GZ5A 4U6WA 1B6AA 3BIQA 2GA2A 1KQ9A 2BWUA 3PKDA 4U73A 3FM3A 3CB6A 2GG2A 3IU9A 4U1BA 1M35A 3L7GA 4S01A 4IF7A 3TAVA 1XNZA 4FKCA 3FMRA 1XGNA 4S00A 2DFIA 1WY2A 2GU7A 3BITA 2GG7A 1QXYA 2EVMA 2P9AA 1WL9A 2BN7A 2B3LA 2P99A 2GU6A 4FLLA 1KP0A 1B59A 4U6ZA 3PKEA 4HXXA 1R5HA 5CDLA 3D27A 3FMQA 4U6CA 4S2RP 2NQ7A 1XGOA 2V3XA 4U69A 2BWYA 2V3ZA 1QXWA 2MATA 4IDYA 2Q8KA 5CDEA 1XGMA 4IU6A 4U6EA 2V6CA 4S2TP 5JHUA 3TB5A 4RZYA 2BWTA 4FLKA 1W2MA 2ZSGA 2BHCA 2GGCA 3RVAA 2Q93A 1C21A 5E5BA 4IKRA 4ZNGA 1QZYA 1R5GA 3OVKA 2BH3A 1YW8A 2OAZA 5CLSA 4ZWUA 1O0XA 4ZWPA 2Q96A 1XGSA 2GTXA 4Z7MA 5CE6A 2GGBA 5FCHA 3IL0A 4KM3A 3PKBA 5D6EA 2Q92A 4IPAA 2BHDA 2Q94A 5FCFA 2B3KA 3S6BA 3MATA 5JI6A 3O5VA 1C27A 2GU4A 3PKCA 2BWXA 2HOWA 3MX6A 3Q6DA 5D6FA 2IW2A 2EA4A 2B3HA 4B28A 4QR8A 4IKSA 1Y1NA 4U6JA 2BWVA 1QXZA 1C22A 2Q95A 1KQ0A 3MR1A 1CHMA 1WBQA 2GG3A 4FUKA 4FLIA 2BWWA 3I7MA 2EVCA 4PNCA 3CB5A 2BB7A 3IU8A 1N51A 4ZWOA 2V3YA 4R60A 2GG8A 1BOAA 1WL6A 1YJ3A 2NQ6A 1C24A 3PEBA 4U75A 1A16A 4U76A 2OKNA 4EGEA 4JUQA 1C23A 3IU7A 2EA2A 3L24A 4FO7A 4IECA 1YW7A 1WKMA 2ADUA 4MATA 1YW9A 2GG5A 4IKUA 2GU5A 4FO8A 2BHBA 2G6PA 5E2CA 1BN5A 1W7VA 2P98A 1WN1A 3CTZA 4OOKA 1R58A 4U71A 4PV4A 5CIKA 4A6VA 1MATA 2BHAA 1YVMA 3PN9A 3BIPA 2BWSA 2GG0A 3RORA 4A6WA 3IG4A 4U70A 2GG9A 5CDVA 4RGZ1 2EVOA 4FLJA 1WLRA 5CNXA 4RZZA 3QOCA 3OOOA 1PV9A 4IKTA 3PKAA
chains in the Genus database with same CATH superfamily
5JFRA 1JAWA 2GZ5A 4U6WA 1B6AA 3BIQA 2GA2A 1KQ9A 2BWUA 3PKDA 4U73A 3FM3A 3CB6A 2GG2A 3IU9A 4U1BA 1M35A 3L7GA 4S01A 4IF7A 3TAVA 1XNZA 4FKCA 3FMRA 1XGNA 4S00A 2DFIA 1WY2A 2GU7A 3BITA 2GG7A 1QXYA 2EVMA 2P9AA 1WL9A 2BN7A 2B3LA 2P99A 2GU6A 4FLLA 1KP0A 1B59A 4U6ZA 3PKEA 4HXXA 1R5HA 5CDLA 3D27A 3FMQA 4U6CA 4S2RP 2NQ7A 1XGOA 2V3XA 4U69A 2BWYA 2V3ZA 1QXWA 2MATA 4IDYA 2Q8KA 5CDEA 1XGMA 4IU6A 4U6EA 2V6CA 4S2TP 5JHUA 3TB5A 4RZYA 2BWTA 4FLKA 1W2MA 2ZSGA 2BHCA 2GGCA 3RVAA 2Q93A 1C21A 5E5BA 4IKRA 4ZNGA 1QZYA 1R5GA 3OVKA 2BH3A 1YW8A 2OAZA 5CLSA 4ZWUA 1O0XA 4ZWPA 2Q96A 1XGSA 2GTXA 4Z7MA 5CE6A 2GGBA 5FCHA 3IL0A 4KM3A 3PKBA 5D6EA 2Q92A 4IPAA 2BHDA 2Q94A 5FCFA 2B3KA 3S6BA 3MATA 5JI6A 3O5VA 1C27A 2GU4A 3PKCA 2BWXA 2HOWA 3MX6A 3Q6DA 5D6FA 2IW2A 2EA4A 2B3HA 4B28A 4QR8A 4IKSA 1Y1NA 4U6JA 2BWVA 1QXZA 1C22A 2Q95A 1KQ0A 3MR1A 1CHMA 1WBQA 2GG3A 4FUKA 4FLIA 2BWWA 3I7MA 2EVCA 4PNCA 3CB5A 2BB7A 3IU8A 1N51A 4ZWOA 2V3YA 4R60A 2GG8A 1BOAA 1WL6A 1YJ3A 2NQ6A 1C24A 3PEBA 4U75A 1A16A 4U76A 2OKNA 4EGEA 4JUQA 1C23A 3IU7A 2EA2A 3L24A 4FO7A 4IECA 1YW7A 1WKMA 2ADUA 4MATA 1YW9A 2GG5A 4IKUA 2GU5A 4FO8A 2BHBA 2G6PA 5E2CA 1BN5A 1W7VA 2P98A 1WN1A 3CTZA 4OOKA 1R58A 4U71A 4PV4A 5CIKA 4A6VA 1MATA 2BHAA 1YVMA 3PN9A 3BIPA 2BWSA 2GG0A 3RORA 4A6WA 3IG4A 4U70A 2GG9A 5CDVA 4RGZ1 2EVOA 4FLJA 1WLRA 5CNXA 4RZZA 3QOCA 3OOOA 1PV9A 4IKTA 3PKAA
chains in the Genus database with same CATH topology
5JFRA 1JAWA 2GZ5A 4U6WA 1B6AA 3BIQA 2GA2A 1KQ9A 2BWUA 3PKDA 4U73A 3FM3A 3CB6A 2GG2A 3IU9A 4U1BA 1M35A 3L7GA 4S01A 4IF7A 3TAVA 1XNZA 4FKCA 3FMRA 1XGNA 4S00A 2DFIA 1WY2A 2GU7A 3BITA 2GG7A 1QXYA 2EVMA 2P9AA 1WL9A 2BN7A 2B3LA 2P99A 2GU6A 4FLLA 1KP0A 1B59A 4U6ZA 3PKEA 4HXXA 1R5HA 5CDLA 3D27A 3FMQA 4U6CA 4S2RP 2NQ7A 1XGOA 2V3XA 4U69A 2BWYA 2V3ZA 1QXWA 2MATA 4IDYA 2Q8KA 5CDEA 1XGMA 4IU6A 4U6EA 2V6CA 4S2TP 5JHUA 3TB5A 4RZYA 2BWTA 4FLKA 1W2MA 2ZSGA 2BHCA 2GGCA 3RVAA 2Q93A 1C21A 5E5BA 4IKRA 4ZNGA 1QZYA 1R5GA 3OVKA 2BH3A 1YW8A 2OAZA 5CLSA 4ZWUA 1O0XA 4ZWPA 2Q96A 1XGSA 2GTXA 4Z7MA 5CE6A 2GGBA 5FCHA 3IL0A 4KM3A 3PKBA 5D6EA 2Q92A 4IPAA 2BHDA 2Q94A 5FCFA 2B3KA 3S6BA 3MATA 5JI6A 3O5VA 1C27A 2GU4A 3PKCA 2BWXA 2HOWA 3MX6A 3Q6DA 5D6FA 2IW2A 2EA4A 2B3HA 4B28A 4QR8A 4IKSA 1Y1NA 4U6JA 2BWVA 1QXZA 1C22A 2Q95A 1KQ0A 3MR1A 1CHMA 1WBQA 2GG3A 4FUKA 4FLIA 2BWWA 3I7MA 2EVCA 4PNCA 3CB5A 2BB7A 3IU8A 1N51A 4ZWOA 2V3YA 4R60A 2GG8A 1BOAA 1WL6A 1YJ3A 2NQ6A 1C24A 3PEBA 4U75A 1A16A 4U76A 2OKNA 4EGEA 4JUQA 1C23A 3IU7A 2EA2A 3L24A 4FO7A 4IECA 1YW7A 1WKMA 2ADUA 4MATA 1YW9A 2GG5A 4IKUA 2GU5A 4FO8A 2BHBA 2G6PA 5E2CA 1BN5A 1W7VA 2P98A 1WN1A 3CTZA 4OOKA 1R58A 4U71A 4PV4A 5CIKA 4A6VA 1MATA 2BHAA 1YVMA 3PN9A 3BIPA 2BWSA 2GG0A 3RORA 4A6WA 3IG4A 4U70A 2GG9A 5CDVA 4RGZ1 2EVOA 4FLJA 1WLRA 5CNXA 4RZZA 3QOCA 3OOOA 1PV9A 4IKTA 3PKAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5JFR A;  1JAW A;  2GZ5 A;  4U6W A;  1B6A A;  3BIQ A;  2GA2 A;  1KQ9 A;  2BWU A;  3PKD A;  4U73 A;  3FM3 A;  3CB6 A;  2GG2 A;  3IU9 A;  4U1B A;  1M35 A;  3L7G A;  4S01 A;  4IF7 A;  3TAV A;  1XNZ A;  4FKC A;  3FMR A;  1XGN A;  4S00 A;  2DFI A;  1WY2 A;  2GU7 A;  3BIT A;  2GG7 A;  1QXY A;  2EVM A;  2P9A A;  1WL9 A;  2BN7 A;  2B3L A;  2P99 A;  2GU6 A;  4FLL A;  1KP0 A;  1B59 A;  4U6Z A;  3PKE A;  4HXX A;  1R5H A;  5CDL A;  3D27 A;  3FMQ A;  4U6C A;  4S2R P;  2NQ7 A;  1XGO A;  2V3X A;  4U69 A;  2BWY A;  2V3Z A;  1QXW A;  2MAT A;  4IDY A;  2Q8K A;  5CDE A;  1XGM A;  4IU6 A;  4U6E A;  2V6C A;  4S2T P;  5JHU A;  3TB5 A;  4RZY A;  2BWT A;  4FLK A;  1W2M A;  2ZSG A;  2BHC A;  2GGC A;  3RVA A;  2Q93 A;  1C21 A;  5E5B A;  4IKR A;  4ZNG A;  1QZY A;  1R5G A;  3OVK A;  2BH3 A;  1YW8 A;  2OAZ A;  5CLS A;  4ZWU A;  1O0X A;  4ZWP A;  2Q96 A;  1XGS A;  2GTX A;  4Z7M A;  5CE6 A;  2GGB A;  5FCH A;  3IL0 A;  4KM3 A;  3PKB A;  5D6E A;  2Q92 A;  4IPA A;  2BHD A;  2Q94 A;  5FCF A;  2B3K A;  3S6B A;  3MAT A;  5JI6 A;  3O5V A;  1C27 A;  2GU4 A;  3PKC A;  2BWX A;  2HOW A;  3MX6 A;  3Q6D A;  5D6F A;  2IW2 A;  2EA4 A;  2B3H A;  4B28 A;  4QR8 A;  4IKS A;  1Y1N A;  4U6J A;  2BWV A;  1QXZ A;  1C22 A;  2Q95 A;  1KQ0 A;  3MR1 A;  1CHM A;  1WBQ A;  2GG3 A;  4FUK A;  4FLI A;  2BWW A;  3I7M A;  2EVC A;  4PNC A;  3CB5 A;  2BB7 A;  3IU8 A;  1N51 A;  4ZWO A;  2V3Y A;  4R60 A;  2GG8 A;  1BOA A;  1WL6 A;  1YJ3 A;  2NQ6 A;  1C24 A;  3PEB A;  4U75 A;  1A16 A;  4U76 A;  2OKN A;  4EGE A;  4JUQ A;  1C23 A;  3IU7 A;  2EA2 A;  3L24 A;  4FO7 A;  4IEC A;  1YW7 A;  1WKM A;  2ADU A;  4MAT A;  1YW9 A;  2GG5 A;  4IKU A;  2GU5 A;  4FO8 A;  2BHB A;  2G6P A;  5E2C A;  1BN5 A;  1W7V A;  2P98 A;  1WN1 A;  3CTZ A;  4OOK A;  1R58 A;  4U71 A;  4PV4 A;  5CIK A;  4A6V A;  1MAT A;  2BHA A;  1YVM A;  3PN9 A;  3BIP A;  2BWS A;  2GG0 A;  3ROR A;  4A6W A;  3IG4 A;  4U70 A;  2GG9 A;  5CDV A;  4RGZ 1;  2EVO A;  4FLJ A;  1WLR A;  5CNX A;  4RZZ A;  3QOC A;  3OOO A;  1PV9 A;  4IKT A;  3PKA A; 
#chains in the Genus database with same CATH topology
 5JFR A;  1JAW A;  2GZ5 A;  4U6W A;  1B6A A;  3BIQ A;  2GA2 A;  1KQ9 A;  2BWU A;  3PKD A;  4U73 A;  3FM3 A;  3CB6 A;  2GG2 A;  3IU9 A;  4U1B A;  1M35 A;  3L7G A;  4S01 A;  4IF7 A;  3TAV A;  1XNZ A;  4FKC A;  3FMR A;  1XGN A;  4S00 A;  2DFI A;  1WY2 A;  2GU7 A;  3BIT A;  2GG7 A;  1QXY A;  2EVM A;  2P9A A;  1WL9 A;  2BN7 A;  2B3L A;  2P99 A;  2GU6 A;  4FLL A;  1KP0 A;  1B59 A;  4U6Z A;  3PKE A;  4HXX A;  1R5H A;  5CDL A;  3D27 A;  3FMQ A;  4U6C A;  4S2R P;  2NQ7 A;  1XGO A;  2V3X A;  4U69 A;  2BWY A;  2V3Z A;  1QXW A;  2MAT A;  4IDY A;  2Q8K A;  5CDE A;  1XGM A;  4IU6 A;  4U6E A;  2V6C A;  4S2T P;  5JHU A;  3TB5 A;  4RZY A;  2BWT A;  4FLK A;  1W2M A;  2ZSG A;  2BHC A;  2GGC A;  3RVA A;  2Q93 A;  1C21 A;  5E5B A;  4IKR A;  4ZNG A;  1QZY A;  1R5G A;  3OVK A;  2BH3 A;  1YW8 A;  2OAZ A;  5CLS A;  4ZWU A;  1O0X A;  4ZWP A;  2Q96 A;  1XGS A;  2GTX A;  4Z7M A;  5CE6 A;  2GGB A;  5FCH A;  3IL0 A;  4KM3 A;  3PKB A;  5D6E A;  2Q92 A;  4IPA A;  2BHD A;  2Q94 A;  5FCF A;  2B3K A;  3S6B A;  3MAT A;  5JI6 A;  3O5V A;  1C27 A;  2GU4 A;  3PKC A;  2BWX A;  2HOW A;  3MX6 A;  3Q6D A;  5D6F A;  2IW2 A;  2EA4 A;  2B3H A;  4B28 A;  4QR8 A;  4IKS A;  1Y1N A;  4U6J A;  2BWV A;  1QXZ A;  1C22 A;  2Q95 A;  1KQ0 A;  3MR1 A;  1CHM A;  1WBQ A;  2GG3 A;  4FUK A;  4FLI A;  2BWW A;  3I7M A;  2EVC A;  4PNC A;  3CB5 A;  2BB7 A;  3IU8 A;  1N51 A;  4ZWO A;  2V3Y A;  4R60 A;  2GG8 A;  1BOA A;  1WL6 A;  1YJ3 A;  2NQ6 A;  1C24 A;  3PEB A;  4U75 A;  1A16 A;  4U76 A;  2OKN A;  4EGE A;  4JUQ A;  1C23 A;  3IU7 A;  2EA2 A;  3L24 A;  4FO7 A;  4IEC A;  1YW7 A;  1WKM A;  2ADU A;  4MAT A;  1YW9 A;  2GG5 A;  4IKU A;  2GU5 A;  4FO8 A;  2BHB A;  2G6P A;  5E2C A;  1BN5 A;  1W7V A;  2P98 A;  1WN1 A;  3CTZ A;  4OOK A;  1R58 A;  4U71 A;  4PV4 A;  5CIK A;  4A6V A;  1MAT A;  2BHA A;  1YVM A;  3PN9 A;  3BIP A;  2BWS A;  2GG0 A;  3ROR A;  4A6W A;  3IG4 A;  4U70 A;  2GG9 A;  5CDV A;  4RGZ 1;  2EVO A;  4FLJ A;  1WLR A;  5CNX A;  4RZZ A;  3QOC A;  3OOO A;  1PV9 A;  4IKT A;  3PKA A; 
#chains in the Genus database with same CATH homology
 5JFR A;  1JAW A;  2GZ5 A;  4U6W A;  1B6A A;  3BIQ A;  2GA2 A;  1KQ9 A;  2BWU A;  3PKD A;  4U73 A;  3FM3 A;  3CB6 A;  2GG2 A;  3IU9 A;  4U1B A;  1M35 A;  3L7G A;  4S01 A;  4IF7 A;  3TAV A;  1XNZ A;  4FKC A;  3FMR A;  1XGN A;  4S00 A;  2DFI A;  1WY2 A;  2GU7 A;  3BIT A;  2GG7 A;  1QXY A;  2EVM A;  2P9A A;  1WL9 A;  2BN7 A;  2B3L A;  2P99 A;  2GU6 A;  4FLL A;  1KP0 A;  1B59 A;  4U6Z A;  3PKE A;  4HXX A;  1R5H A;  5CDL A;  3D27 A;  3FMQ A;  4U6C A;  4S2R P;  2NQ7 A;  1XGO A;  2V3X A;  4U69 A;  2BWY A;  2V3Z A;  1QXW A;  2MAT A;  4IDY A;  2Q8K A;  5CDE A;  1XGM A;  4IU6 A;  4U6E A;  2V6C A;  4S2T P;  5JHU A;  3TB5 A;  4RZY A;  2BWT A;  4FLK A;  1W2M A;  2ZSG A;  2BHC A;  2GGC A;  3RVA A;  2Q93 A;  1C21 A;  5E5B A;  4IKR A;  4ZNG A;  1QZY A;  1R5G A;  3OVK A;  2BH3 A;  1YW8 A;  2OAZ A;  5CLS A;  4ZWU A;  1O0X A;  4ZWP A;  2Q96 A;  1XGS A;  2GTX A;  4Z7M A;  5CE6 A;  2GGB A;  5FCH A;  3IL0 A;  4KM3 A;  3PKB A;  5D6E A;  2Q92 A;  4IPA A;  2BHD A;  2Q94 A;  5FCF A;  2B3K A;  3S6B A;  3MAT A;  5JI6 A;  3O5V A;  1C27 A;  2GU4 A;  3PKC A;  2BWX A;  2HOW A;  3MX6 A;  3Q6D A;  5D6F A;  2IW2 A;  2EA4 A;  2B3H A;  4B28 A;  4QR8 A;  4IKS A;  1Y1N A;  4U6J A;  2BWV A;  1QXZ A;  1C22 A;  2Q95 A;  1KQ0 A;  3MR1 A;  1CHM A;  1WBQ A;  2GG3 A;  4FUK A;  4FLI A;  2BWW A;  3I7M A;  2EVC A;  4PNC A;  3CB5 A;  2BB7 A;  3IU8 A;  1N51 A;  4ZWO A;  2V3Y A;  4R60 A;  2GG8 A;  1BOA A;  1WL6 A;  1YJ3 A;  2NQ6 A;  1C24 A;  3PEB A;  4U75 A;  1A16 A;  4U76 A;  2OKN A;  4EGE A;  4JUQ A;  1C23 A;  3IU7 A;  2EA2 A;  3L24 A;  4FO7 A;  4IEC A;  1YW7 A;  1WKM A;  2ADU A;  4MAT A;  1YW9 A;  2GG5 A;  4IKU A;  2GU5 A;  4FO8 A;  2BHB A;  2G6P A;  5E2C A;  1BN5 A;  1W7V A;  2P98 A;  1WN1 A;  3CTZ A;  4OOK A;  1R58 A;  4U71 A;  4PV4 A;  5CIK A;  4A6V A;  1MAT A;  2BHA A;  1YVM A;  3PN9 A;  3BIP A;  2BWS A;  2GG0 A;  3ROR A;  4A6W A;  3IG4 A;  4U70 A;  2GG9 A;  5CDV A;  4RGZ 1;  2EVO A;  4FLJ A;  1WLR A;  5CNX A;  4RZZ A;  3QOC A;  3OOO A;  1PV9 A;  4IKT A;  3PKA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...