1N5AA

Crystal structure of the murine class i major histocompatibility complex of h-2db, b2-microglobulin, and a 9-residue immunodominant peptide epitope gp33 derived from lcmv
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
276
structure length
276
Chain Sequence
GPHSMRYFETAVSRPGLEEPRYISVGYVDNKEFVRFDSDAENPRYEPRAPWMEQEGPEYWERETQKAKGQEQWFRVSLRNLLGYYNQSAGGSHTLQQMSGCDLGSDWRLLRGYLQFAYEGRDYIALNEDLKTWTAADMAAQITRRKWEQSGAAEHYKAYLEGECVEWLHRYLKNGNATLLRTDSPKAHVTHHPRSKGEVTLRCWALGFYPADITLTWQLNGEELTQDMELVETRPAGDGTFQKWASVVVPLGKEQNYTCRVYHEGLPEPLTLRWEP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords H-2 class I histocompatibility antigen, D-B alpha chain
publication title A Structural Basis for LCMV Immune Evasion. Subversion of H-2D(b) and H-2K(b) Presentation of gp33 Revealed by Comparative Crystal Structure Analyses.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
total genus 65
structure length 276
sequence length 276
chains with identical sequence D, G, J
ec nomenclature
pdb deposition date 2002-11-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00129 MHC_I Class I Histocompatibility antigen, domains alpha 1 and 2
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1n5aA02
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 1n5aA01
1L9MA 2NY2C 5IVNA 4LRIC 4GW4A 4N8VG 2F58L 4PJCA 1BF8A 2NY7H 2MPAH 4G8IA 4YX2H 3AUVA 1BAFH 3P73B 3MC0A 4C58B 4PB0H 2WUCH 5IV2A 4P5TA 5J89A 4ZD3L 5H35A 4N0CC 4XNUH 4TUKL 2DQJH 3STZA 4TSBL 3JV6A 3MV01 5C3LD 4FQJL 2RGSA 3CFJA 1YYMH 4M7JL 1KEML 1P9MC 4WRLA 2NTFA 4G8GA 2O61A 1KCUL 3CX5J 5HHOE 1KULA 2AK1H 1CD0A 3L5WB 3EHBC 2VSCA 4V2BA 15C8L 1EMTL 1I1AB 3QIBB 1NGXA 3N1QC 1S7VB 1OW0A 4MJIB 2F19H 1A7RL 3T65B 3CVIH 1ZANH 4XPBL 3RVXC 3MLRL 1EO7A 4L4TA 4XCYA 1ZGLB 4XPTL 5GGRA 2WWKT 1JWUA 3MRLB 4ZAKC 1B0GB 4Q9RL 2DYPD 4O51B 1IE5A 3QJHA 3C60B 3UTTB 3JWOL 4OM0H 3EYQD 3H7BA 2E7CA 5JORB 2PYED 2J8UE 3FO2B 3UYOD 2FBOJ 2NMSA 3H0TB 3P4LA 5TDOA 3BYTA 4P59L 2DWEA 2BDNL 5CSBA 1GGYA 1NCCL 4HLZH 4HMDA 2E7MA 4WWKC 1W2KT 2APWA 2JJSC 1OARL 2FRGP 4YE4L 1KLGA 2Q20A 3MJ9H 2MWCA 5DD6B 3GK8L 1LK3H 3ULVE 4JM4L 3I9GL 5CHNB 4AM0A 1AQDA 4BQ9A 3MV8B 4TNWF 5BQ7B 1BVZA 3WFZA 3NPZB 1WAAA 5GIRB 2H8PA 3WFDL 3OMZA 4DKEL 3AM8C 5DLMH 3QPQC 4JO2H 4XWGL 5J6GB 3AMKA 1R24A 1TIUA 5ALBL 3FOLB 1QSEB 4WHTA 4YBQC 1DBAH 3FFCD 5EC1A 1S9XA 5HVFB 4PRPD 2ZJSH 3V6BR 3SE9H 4HWEH 4R4BA 2AERT 1LDSA 1OCWL 1TZIA 2A74B 5FGCB 2I9TB 2AK4A 5JO5B 3VXUB 4UTAL 5CJXC 1BHGA 4PTUA 1KLFA 2FATH 4QY8A 4HFUH 3SDCD 2XZCL 4RBPK 2FD6L 1ZHNB 4JN2A 5CP3H 1E4WL 5HVGB 3UCRA 1JWSA 1U8MA 4L9LC 3RJQB 3H2WA 4UIKH 1TMCA 2DAVA 4NQUA 1DLFH 2VDOH 3ULUF 2IF7A 3MMEB 3F7VB 2H9GA 4ZUVA 5E4EC 3MUGA 2V9QA 3DVFA 4CAGA 1KC5H 3MNVA 1TPXC 2C1OB 1QRND 1OM3L 3MV7B 3PWPE 2D03H 4OGYH 4YUEL 2V5RA 4X7TA 2VDRL 5GS2H 4M43L 1BD2A 1Q72L 2ZSWA 3OJVC 1DEEB 4UU9B 4NHUE 1KLUB 1FNGB 2ZCLL 5BRZA 4L8CA 4QRRD 1KTKE 1ZE3C 4OFYA 4TYUA 4OUUB 4ZS6D 4Z76B 1EVTC 2FL5A 3CFBA 2QR0B 1BEYH 4RGOH 3MYZA 2NY1D 4OD1L 3RWCA 1YEKH 4QGTA 4Y4KD 2DMBA 3H3KA 4U1JB 3TWCH 2OCFD 4UI2A 5HGBB 2AV7B 2MQ0A 5SX5K 1PFCA 3KPLA 1N26A 4GW1B 1A6VL 3GO1H 1NGQL 5CEXA 5L9DL 1HNFA 5LWYL 5EU7C 2DN7A 2HAZA 3CD4A 4YDVB 3A67H 4U1IB 1KFAL 4OFPA 3U46A 1F3JB 5ID1B 5I74C 4XCFH 3T08A 3Q6FB 3KPOA 1IC4H 4XNYH 3TBYB 1NAMB 3H6JA 4JJ5B 1CT8A 5J06A 2VXTL 5F3BA 1U2HA 3TIEA 1F00I 1J87A 1PZ5A 2R1YB 2EICA 4M7ZC 2QQKH 1TITA 2QSCH 4L3ED 5K9JL 1NDGB 3HMXA 1SMOA 1NBZA 2AVGA 1MJJB 1ZS8A 3F65A 5FGBC 5F1IB 1YY8B 4Y1AA 3W2DL 1I3VA 4JM2F 3TJEH 2WIIA 3U6RB 5ALCL 1C5CH 2GSIA 2P44B 2YSSA 2YUZA 3ROLA 3RTQD 2P5WB 5CJOL 3BPNC 3FO0H 3N0PB 3DNKA 4PBVC 5D6CB 1KPUB 5T33H 4F2MA 4K7PH 4XPGH 1A7PL 4Z5RA 1O7SA 5D93C 5F89A 5FM8A 5C09A 4U1HA 3K0WA 1DQLH 1X5LA 4LPTA 1CDUA 2HFTA 1T1XB 2YEZA 2UZIH 1A64A 3LPGA 3PWUB 4LQFL 5I1AA 2LU3A 2F74A 3BIAX 3ZKXC 4EN3C 3D85A 12E8L 4NQVB 3KPSD 1B3JA 3DX6A 4E0RA 4XPFH 5ANME 3UTSD 2QEJA 3TBWA 1G9NC 1BQSA 3OJDA 1JTTA 5TPWH 1TQBB 4GSDL 4XNMB 5GRXG 5C2BL 2PW1B 1U42A 1NFDB 1VERA 3D39A 4R8WH 4AZ8A 1T7XA 2BSSB 2JCCF 2VLRB 4OKVA 4JPVL 3PL6C 4PJIE 1I9IL 2ERJC 2NXZC 3GMLB 4RISL 2Y9RT 3VFOA 1Q9KA 3KYAA 4GMTH 5E7FA 4NO5A 4HJGA 5GS1A 4HJJH 3UAJC 1M05B 3NPSC 1J05A 2PYFA 5CBEB 4QHKI 4U1SA 5CGYC 4IRSC 3M8OH 4K7PX 4X7SH 4DN3L 1W0WA 5ADOL 5I66B 5FUCE 2LQRA 5GZOD 3ZYZA 4OTXL 3QDJE 3BMWA 3U36A 2Y1VA 1U6AH 5DFWH 1Z9OA 1DQJB 4OFVA 4PB9L 4RFNC 5DURD 4EI6A 2M26A 4KJQD 3MXVL 4AMKL 4OZFH 1ORQA 4UV4L 2HT4D 4MAYC 2Y6SD 5HYJB 3GB7B 2WY3A 3C5SA 1FRGH 5I75C 2RQ8A 1V5JA 4OM1H 1RUAH 2E7HA 2OTWB 1T0NA 3NZ8B 1DQMH 3CLEH 4HMEA 4F7TB 1HQRA 1JGDA 4FQLH 3RGVA 1MFBL 3OB0K 4BSWA 4JFDB 3MJ9A 1M71B 1CK0L 2OBGA 5D9SB 4YBHA 1W72H 1DL7H 2VLKD 3NABH 1D3CA 3L3KB 43C9B 3FT4B 1SMAA 5FCUH 3BSZH 1QA9B 1IAII 3BP7A 4UT9H 4BZ2L 1IC1A 1XGPA 3VXMD 4KKBD 2F53B 5LGKA 1ZLSL 3P4MB 1GZPB 1WEJL 5EU6E 5C6TH 4CU7A 2ZOLB 3RX8A 1AJ7L 5DQDL 4V3DB 4HH9A 2R4SL 2FCBA 4M48L 3STLA 4HX1A 2VDLH 2VXUH 1KT2B 3ARDB 4IRZH 4A6YH 5HHVH 4QXWA 5EB9A 4XP1L 4XRCB 3L1OH 1CGYA 5DJ2B 1I1FB 4R4FL 3VDBA 3B8YA 1YNTB 2OXHA 4NKMA 4ZFOA 4XNZB 5DWUH 3ZTJG 3U9UB 3JWOC 4QRPE 3W9EB 3REWA 2ZG2A 2GFBB 2OR9L 2ZSVA 3CVHL 3B5GA 5D1ZC 2ICCA 1AI1L 5CKGA 3PGCA 1J9CT 3QPXH 5F1NB 2DQEL 3BXNA 4RRPG 4LCCA 1IQWL 4J3VA 1AD0B 3ARGC 5C6WH 4XVUD 4HDIB 1S7WA 4IRJA 1Q9LA 5BW7C 3IFOB 3VG0H 2J5LB 1VFOA 4X9BA 1OT2A 1U58A 3CX2A 1ADQA 1OGAB 3MO1B 2GTWA 4F37F 5C0RL 5JOPD 3L9RB 1RPQA 4Y2DA 4JLRA 1T2QL 4ZUUA 3QG7H 3GGWA 5DDHB 3SGEI 1XGYH 3BKCH 4ETQB 3H3BC 1A4KA 5H2BB 4OUOA 4OZIF 2P24A 3UZQA 2ID5A 1EEZA 1MH5B 3EYVB 2CR6A 2K7QA 3ARSA 3CFDB 5E1HB 3W5NA 5IBLD 5AG9A 3FQRA 3OR7A 2B39A 1U92B 4LU5H 4F9LA 3QCTL 1U3JA 1QFWH 2DM4A 1R5WA 1OSPL 2QJDA 3OPZL 2G60L 3TBTA 2VQ1B 1V3MA 4PJ9D 3E8UH 3QRGH 4I5BA 4LSSL 4Z7VE 1MRCH 3KGRA 4MVBC 5I1IH 5FDWA 3O8XC 3MR9A 1M7IA 2EKSB 4ZNCD 4APQB 3O2DH 3OAUH 3TBSA 1VB9A 2HFEB 5ICYB 3OKEA 4LHUG 2A77H 3SJVA 2ICEB 2MPAL 4J3UA 3VXRB 3LN4B 4YX2L 3EZ8A 3JV0A 4HAGA 4WFHD 3P4NA 1U91B 4ELMA 4UDUA 2Z93A 2WUCL 3I85A 4HQQH 3QFJB 2F54B 3VXSB 5CLWA 4U6VL 4XNUL 5FK9B 4WO4D 4PJHA 2DQJL 3VXQB 1DFBH 3A6BH 4YIQB 1JNNH 4Z18A 3U79A 1YYML 1TLKA 4HWZA 1OWWA 4OQTL 3ZHKA 4KY1H 4I2XB 2D4FA 1G0DA 1FFRA 4JRYB 5ESAA 1TQCB 1PAMA 3LPFA 3ARBC 1KUMA 4Z0BL 1EAPB 3O6FA 3RI5K 1NANH 5BVJA 2HJFB 3NCEB 4YH6A 3CVIL 4E42B 3WN5A 3FRUB 5MEOA 4Z78B 3C8DA 3MLYH 4QNPF 4LDLB 1KB5A 3C87A 4MCYB 1CZ8H 4UTBH 2JE8A 2OP4H 5E9DD 3QEQB 4N5UA 3PDOA 4X80H 5SV3A 2O26U 1FE8H 1RHHB 3DUUB 4OM0L 2AQ3A 3L95B 1B4JH 4RGMB 3ZE1E 3VRJA 4PUBH 4S1DD 3T1FB 4JPKL 3NH7H 3TA3B 1CYGA 3IVKB 4XZUB 4ONGH 3KPPB 4I4WA 3QUZB 2CRYA 2LFGA 4R2GD 4JFFE 1I3RB 2AEPL 2ICWJ 1T5WB 1F11A 1CR9H 1DUYA 3KAAA 5GJSL 1J0KA 4JQIH 5E56A 1XGUB 5IIEA 5BMFH 4PP8C 1RZIA 3VMPA 1J1XL 1EEUA 1A3LH 1PSKH 3DBXB 3DYPA 5KOMC 2O93L 4H0IA 4U7MA 5T1KB 3RL2B 1PX4A 1HCVA 1P1ZB 3LS4H 3V7MA 1CD8A 4YAQB 1TTGA 4HPYL 4J6RH 1MFEH 5KN5B 5EFIA 1QPPA 1XCQB 4ALAH 2Z92B 1GYAA 1A21A 4TRPL 1HSBB 4NQSA 2CSPA 4NKQB 4YEFA 4DZ8A 4JO2L 4DTGH 4PLJC 4OFDA 5GHWH 2JF1A 3LHPH 3F7PC 3VH8G 3UX9B 1UXSB 4QXTB 4W81A 1DBAL 4O00A 1GH7A 4EXKA 5C0GB 2Z35B 3NCBB 3QT2A 1FYTA 5E8NA 4NIKB 4Z95H 3VI3F 4DCQA 2VLJE 4W6YB 3S4SG 5SWZB 4TSAL 5FYJH 4HWEL 4QRQA 4UUJB 4JFQA 2HVKB 1Q1JH 4D0CB 1W72A 5F44A 5DHVB 3EYQC 3RPIB 1HKLL 4N8VA 5FA3B 4J1UA 4BSJA 1XEDA 2HWZH 2HN7A 2OS7A 4X6FB 3SKJH 5F7NC 1P84J 2X4UA 2FATL 5HJ3A 1BBJB 4DVBA 1YDPB 2HJLB 2ESVD 3L6FA 1DLFL 3VCLA 1N5AA 4HIIB 3MUJA 3F7QA 3J8F7 3IJYA 4ISVB 4BSVA 1ZWIB 1KC5L 3I3BA 2YN5A 3KPTA 1XMWA 4MAUH 2Q76A 3HE6B 4HC1H 1UM4L 1S9WB 2OTUB 2ZCHH 3SGJA 4TVSa 4NHCL 5B39G 4A6YA 1SYSB 5D96B 3ZE2E 4C56E 4PJBF 2AEWA 3K1KC 1NUNB 1A6TB 2HLAB 2ICES 3DUSA 3DOSA 3G08B 4MZ2A 1AD9B 2D7MA 3JV4B 2A9ML 5BJTB 5EG6C 4LCYB 2X1WL 3U4BL 1D5XB 4G42A 4KAQH 3GSUA 2UWEF 4ZTPL 1RZKL 1WC7A 2Z0BA 2IQAB 4X9IA 5F9DC 4EDWH 4MSWB 1ZA3B 4PG2C 5C08E 3RL1B 5DRXB 1V7ML 5GRWA 3GO1L 5J57B 2ED8A 2XZZA 4PRID 5T5NF 2VIRB 3SDCC 1RIHH 1G6RH 4PJEE 5IK3A 4Z7UA 3MLUH 1B6DA 3RVWD 2YA1A 3OKDB 3NBNA 3MNWA 5DRNB 3RZCA 3EO9H 4XNYL 3NIGF 1AXTL 4HKBB 2C4FT 4FFEX 4FN0A 1N6QL 2XNAA 2R0WH 3SDDA 3ARTA 1TCRB 4LLVB 4DUWA 3BVNB 2FR4B 4EVNB 2C3GA 2KL6A 3HNSH 35C8H 2QSCL 3V4VL 4POYA 1IC5H 1LEGA 2BNRD 2AJVH 4KGLA 4F57H 1BIIB 2WBJA 2PXYD 4KKLD 3QDGA 3A6CH 4MA1B 3GMPA 5DD1H 5KSBE 3TJEL 1E27A 3PWNA 3TFKA 1C5CL 1T20B 1X5ZA 3MCG1 3BDBA 4K3JL 4OGZA 1NPUA 1RJYA 5DVKA 1NBVL 2Q1EA 1CGTA 2YPLD 4RDQG 4PIRF 3GNMH 1J0IA 1WBZB 4XPGL 1AGBA 3DX7A 4HWNA 2CDEA 5LCVH 4Y4KC 4M6AA 1XIWA 1NDMA 1KELH 2UZIL 5BV7C 1DQDH 4N90D 1YEDB 4WW2A 5JOEA 3LS5H 4BYHA 3O2DA 3K4ZA 5D2NE 1F45A 1OQOA 3C8KA 5FO8A 3SE3C 2LU7A 5IESH 1ND0B 3B4NA 4YEEA 5I19H 1FZOB 4WV1C 3C6SB 1EBAA 3UTQB 3QUXA 4G43B 3SCMD 1J8HB 2B5IB 1FNEA 3V6ZB 2EIEA 5TPWL 4FP8L 2VDQL 3S3SA 3U30B 4FQHA 5HYFA 4JFPB 4R8WL 3MYJB 2C3WA 3MGOA 2JB5H 4MD4B 5DQ9A 3ZLQC 5E5MA 3QG6A 4FXGB 5T3XH 1R3JB 5L0QC 2ARWA 4XVTL 4HXBH 2IFGA 4K71C 1BOGB 4HJJL 8FABB 5T1LD 4YPGA 3RTQC 2R29L 4Y89A 4DKAA 1HQ4A 4DGIH 3BP5A 2ZUSA 5C9KA 1B4RA 4LLMA 1D5MB 3B3IB 4IDLA 1UJTA 3AY4A 4WU5A 5E70A 2EYSA 5DJXA 5E2VH 4NKOB 5C7XH 4ZXBB 5FYLD 2DRUA 3ZTNH 5DHYA 4UIMA 1AO7A 4G8EB 2Y7QA 1HHHB 1R5VA 2DJ4A 3OAZH 2CUMA 1AP2B 4BH8B 2P42B 4JCLA 3G5XA 1DBKL 4YDIL 1UM5H 3C09C 4JFOB 4XHQA 3OKKA 4U6TA 1B2WL 5EA0H 5TDNB 1FLRH 3O3EA 3DO7A 3S7GA 1KGCE 1MCWM 3AREB 2AP2A 5MHSE 2AJSH 1Y6NR 4PY7A 3U0WH 2YD9A 4DKFH 4N0UE 3BP4B 3FQWA 1QPXA 3FN9A 3OZ9L 5IJKC 1IGFH 4R96B 1UJ3A 1DL7L 3TV3L 3T0VA 3BE1H 3EOTH 3NABL 3PV6B 2ENSA 3B9DA 3ZDZE 3OG4B 4FQXA 5ANMB 5FCUL 4Y4HA 3BSZL 4NQXB 2OYPA 5IHZB 2OSLA 4PJGF 3RP1A 1I8IB 5EDXA 4HS6B 2W92A 4UT9L 5HHMD 3W0WE 1A6WL 4JREB 3OF6A 5CWSB 2DWDA 5IKCB 5EWIL 1XGQB 1ERNA 3D3VD 5GZOC 5K9QI 3ZDXF 4PR5A 3CDFA 1K4DB 1MCQA 4PJIB 5C6TL 1PLGH 3V5KB 2Z31B 2ZUVA 5CBAB 1YN7B 1MCRA 4OCNC 4KJQC 1UH3A 3PF2A 1Q0YL 3HZMA 2CDGA 5KOVC 2R4RH 1EERB 4LFHG 5HHVL 2Y6SC 4IJ3B 4XNQB 4EDXA 3C2AL 2ORBL 3D87B 3L1OL 3D0LA 5FFLA 2WANA 1A9EB 1P4LB 5TF0A 1MFCH 3QO0A 2N7BA 4M62L 3K2UL 4H26B 5HVHB 1QR1B 4J4PA 5FYJD 2G5RA 4D9LH 3DHJA 2OJZH 1SJHA 3IDYB 1HOCB 1U8KA 3DVIA 4KQ4H 1Z5LB 3DROA 1Q94B 1VKXB 3P11L 1R0AH 2CKNA 4YGAB 5FKPA 4P4KB 5L2KD 3QJFB 5C0CD 3T4AA 3KR3H 1A6UL 4F7MB 3PUCA 3NA4A 3DGCR 4KKBC 5JHDA 4XVJH 1GGIH 1QSFE 1R3LB 5E94A 4ZPVB 5KSAB 1BZQK 4U1MA 1Z6JT 1WT5C 5AYQA 2F8VA 3VG0L 2A6KA 2DBLH 2XWBB 3QO1B 4P4RA 5EIIA 2P5EB 2K9UA 3FKUS 3QIUB 4ESKA 1BFVL 1ZLUH 4NSKA 1ACYH 4NZJA 4UNUA 3D0VA 2FDBP 4UOJA 1PBYA 3ZKMD 2JB6A 2HKFL 2NX5B 3BKCL 1MJ8H 3V0AC 3O2VH 3KXFE 1G6RA 2B1AL 3HKFA 3HHRB 2ZWLT 3C60D 5JNYB 3HN3A 3BX7C 4K9EH 1BF2A 1FO0B 4S2SB 4M93C 1OSZB 2Q6WA 3VWKA 4RFEB 5C0AB 3HS0B 2BHYA 3BISA 4OI8A 3MBXH 4OIIH 1E4KA 1JI2A 3E8UL 1RK0A 3QRGL 4UB0H 1MRCL 1T04B 2EDTA 4ZFFB 3G5VB 5C0EB 4F15C 4N8CL 1EX0A 4UAOC 4JZNA 4RSVA 5KANG 2A77L 4I77L 2QSQA 5EZJA 1G1YA 5D1QB 5F7KC 5I8OL 2DQGL 3QEHB 4XVUC 3BZEA 5D7IE 3QDME 3PG2A 4HQQL 3CMOH 4GAYB 4TUOA 2APXA 1C16B 1FGNH 2OM5A 1GJIA 2YBRA 3VFSA 1MHEA 3FQUB 3IF1B 3DECA 4H20L 1VACB 4RZCB 1HH6B 2D31B 4F7PB 3EYUL 4I3GA 3DRQA 5FYLL 3KLDA 4IRJC 1EZVY 4JGMA 1JNLH 1U8OB 3ZE0E 4NNYA 5IBLC 4HUUA 4MQTB 1RZKC 4LHQB 3VXUD 3NTCH 1QZ1A 4OGXL 3R06A 4JO4L 4Y2DC 2IADB 3FONB 43CAB 1BX2B 1FVEA 4GQPH 5FO7A 2GITA 4HBCH 3HRZB 4HUWA 4K07A 3MLYL 5AZ2H 1K5NA 2DQFB 1GXEA 1UKSA 3OR6B 1EH9A 1BLNB 4PJ9C 1CZ8L 2YHGA 2OP4L 4J8RB 5DD5H 1ZLVH 3SKNA 2FJHA 1FE8L 2R2BA 1B4JL 3M1BA 3BQUB 5I1LA 2OR7A 4U4BA 3D2UB 4RRPA 4YJZL 5IM7B 4E5XA 3QQNA 4LGRB 4P2RA 4XAKD 2EDOA 3E1F1 4AK1A 3VRLF 5B38B 1CCZA 4HGKC 1U8JA 4MNGB 1C5DB 1CR9L 5DTFA 3MV7D 2N4IA 4R26H 2I60H 1N0XL 2AQ1A 5IVZB 3WV0A 3TF7A 1UEMA 5EU5B 5FHBH 5LAXB 4XPAL 2JLLA 3D18A 4KUZL 3QBTB 2MHAA 4POUB 4XI5D 4NRXA 4GXVL 2EYTA 4WO4C 2EH7L 3I6LE 3JUZA 1WF5A 1T22B 5T3XD 3QIWA 1XGRA 5DUBA 2X6MA 1CICA 3D69A 1RZ8B 5EBGA 4GFTB 3GMRA 1JUFB 3M17A 5DMKB 2J3SA 4IMKC 3HZVA 2WP3T 3QCUH 4DUVA 1EUTA 3K4AA 5CAYB 3RDTA 5L88L 3C5ZD 3GRWH 1S78D 2V2TA 5GHWL 5FEBA 3LHPL 1BJ8A 2IH1B 4MQ7B 3MOBH 1A9BA 1XZ0A 3IFLH 4X4YB 1JZ4A 3MBEB 5JQ6H 1YEIH 4GRMA 1AGFA 2AXFB 5SWQB 4DGYH 3WHXA 3OWEA 5FYJL 2CUIA 4QNPE 1Q1JL 3WXWL 2FGWL 2Y5TA 4NJAL 3PV7A 4S1DC 2Q86A 1NCNA 2XQBL 4HIXH 4LHUA 3L5JA 2NY3D 3V5HA 4BZ1H 4R2GC 4EQ3A 1V05A 1T0MB 4L1HA 1A8JH 3W9DB 3DRTA 3KS0H 3WUZA 3BEVB 3K7UA 4PTTA 1N3NB 4ERSL 1BGXL 4LSPH 5JW4M 5F72S 3T8XB 4V1DA 1MQKH 1ONQA 2ADFL 4OLUH 4Z0XA 4XBGB 3WJJA 2RR3A 4GAJL 4D9RE 1JCKA 2BJMH 3KPRD 1IEAA 4HKZB 3X12B 4PP1D 4MAUL 3UYPA 2I26N 1NL0H 4HC1L 4XTRD 5HGGS 2ZCHL 1I3UA 1RZFH 1WQVT 1H15B 1GGUA 1IAMA 5KAQF 5TE4H 3KNBA 2IPTH 3O0RL 4OAWA 2ICWI 5LBSL 2RB8A 4P2QB 4PRHE 4E41E 1FPTH 4K23H 3OAZK 4H5SB 1NLDH 3VI3E 1U93B 3AU1B 5F7WC 4QOKA 5T1DL 4AIXA 1QLFA 1UA6H 2VO5A 3LKRB 4H1LH 1FBIH 5D7JA 3MZGB 1JL8A 4H8WH 1YMMB 4FMFA 4JHWL 3X14B 3F12A 4IOIB 2VLRD 4HS8H 5GGUB 4OCXL 1QQDB 5M95B 3V5DB 2DLFH 5I1GL 4AH2B 4CVWA 1PGRB 3DV6A 1CGVA 5D70L 3ET9F 2NXYB 1KJ3H 1IC5L 2AJYH 3NCYS 4MDJA 1UM6L 4JFEB 2C3VB 4F57L 2X4QB 5TGBA 4BUGA 5D2LA 5LGJB 4DWHA 4UILH 3A6CL 2B0SH 5D1XB 5DD1L 5DD0L 4Y5YC 1HHGB 3Q6GL 5CEZD 3IB4A 2H2SD 5EZOH 3VH8A 4QHNB 2QQNH 2YD5A 3QXWA 4YC2C 3O9WD 1S8DA 3PE9A 1LO0L 3H8NA 3S4SA 2CLRB 1T2JA 3VMNA 2BC4B 4XMKL 3NIDF 4OD2A 4Z7WF 1XCTA 2NY0D 5FO9A 1G7MA 1UACH 4JDVA 4LCUB 1KELL 4O02H 2CMRH 3FAXA 1BWMA 3B8SA 1BZ7A 3LS5L 2XZAH 2BHUA 3RVWC 2BHZA 3MRIA 4NC0B 4JY4B 1NGZB 5IESL 4BKLA 1AGCB 2BNQD 3DJ9A 3HE7D 1F2XK 5CMAB 5F6HJ 1MI5E 2QQLL 3HG1E 2H32B 3IDIB 1FVCB 3G5ZA 3S35H 1Y18A 1NGYB 2QKIB 3L5IA 1JF1A 4OLWH 2E9WA 5F9AC 5HDQH 1T89C 2G75B 5B39A 4MXWH 5ICXB 4LSRH 5IMMA 2PXYC 4KKLC 4LGPB 4D8PB 3JTSB 5KSUB 3BW9B 5T3XL 4M61A 3SDDC 5C07E 1IGML 2O5YH 1ZLWH 3ULVH 2X7LA 5E6IA 3L3DB 4QHUA 5F9JA 4MB4A 3SDAB 4ZO8A 3EDEA 3K81A 4JO1H 1AQKH 3CSYA 5E2VL 1YPZA 1DJSA 5IHUH 3DMMD 2J4WL 4FFWC 2ZZUT 2R0KH 3ZTNL 1GGCH 2X2YA 1DUZA 5DMIL 5GS0H 4NN6C 1AFVL 3OKLA 4PV8B 1LMKA 1ZEAL 5BCAA 1U3YA 3FFDA 1ZVYA 1NAML 1UM5L 4Y5XB 4AG4H 4MB3A 1U95A 4WJ5B 1HXMA 1LQVA 2VDKL 2R23B 2VDMH 4MX7B 3T3ME 2LE9A 3SCMC 4F7CA 1U8HA 3MLPA 1AR1D 4G9FD 5IGXH 4WW2C 3WIIL 4P23A 5HGAA 2YD7A 3GEWB 1UC6A 1IGFL 2W65B 4EIGB 1L6ZA 3BE1L 5C6PB 3EOTL 1SVZA 1A7QH 1TVHA 1LILA 3WIFA 1A0QH 3VFVA 3PWJB 3S37H 1F5WA 4QXUH 3OQ3B 2Y07H 5A1AA 2AV1B 1OGAD 2IAMB 4ODVH 5GXBB 2NY2B 2BCKA 2H6PB 4NQCA 4PJCE 2XRAH 1NCAH 1KPVA 1R5IB 3U0TB 1N64L 3O45B 2ADJA 4UOW0 4ZNEA 3FMGL 5IEHB 1FFQA 4HSQA 1PD6A 2X70B 1CD9B 3WNNA 1P7KA 1PLGL 5ETUA 3L3GA 1D6VH 2PTTB 5LJYH 2R4RL 4X4XA 3VXNB 1WSST 1JMXA 1FZMB 3QCVH 3LSOB 1D7FA 4G8GE 3U7WL 5HHPA 3IDMB 1ZSDB 4GKSB 1P4IH 1FN4A 4LKCB 4EEEA 1T7YA 3REVA 3ILPB 5IF0B 3GSVA 5DJYA 4CRPA 1H0DB 4APQD 1DDHB 5F7EH 3ARYA 3BDXA 2HT2D 4L4TE 3EGSA 4RX4A 3KYOA 3VXRD 3PP4H 4XBPA 3T77B 5KBNC 2FO4B 4JGJA 4ZAKB 3QFJD 1FQ9C 3S36L 3T0EA 4P2YA 3HNTL 5AD0A 5DJ8B 4R6UA 3SDXB 2ZNWA 1UWXH 1MF2H 2KUTA 4HFWB 5C86A 3LKOB 4B41A 1BFTA 4N0UB 3IJSA 2P8LB 4JDZA 1P6AB 3OJMB 1GGIL 4XVJL 3QB7C 4WWKB 4FQ2H 5CEZL 4HV8A 4MNQB 3QXDA 2AJ3B 4JRYD 4HWBA 1PYWB 4YFDB 1UKTA 4JGUA 1MCWW 2JCCB 4IIQC 2ZCKL 4CVXA 1RUQL 3QUKA 2YRLA 2X9XA 1WAAE 2HFFA 3FB6A 2BOCA 4NZDA 5DEGB 3QEQD 4YHLL 2Y23A 4K9EL 3BAEL 5I2IB 4O2EB 1ZHBB 3TA3D 4GG6A 4M8QB 1R3HA 5I1HL 3BKMH 1P6FA 4X7EC 2OXGA 2YMXH 3QUZD 4YK4C 3BT2H 2PW2B 5MEND 4NDMB 3QI9A 4OIIL 1EHAA 3PABA 4EUPB 4TNVK 3LEXB 2PUQT 1GZQB 2AK4E 2W59A 4Z7OF 1MWAB 2BNUB 4Z7UF 1YYLH 4ODXB 5A3ID 4PJXA 2YD4A 4KVNL 4JFYB 4L3CB 3E2HA 1BVKB 4XCEB 3O6LL 1X5FA 1B90A 1JZ5A 3WJLA 4YXLL 1NC2B 5CIPA 2UVEA 5CCKH 1X7QA 2GJZB 4L9LB 1A4JA 3PWVB 4QO1A 3VFPB 3CMOL 1OT1A 1AR2A 3PXJA 3S98A 1CFNA 3ZHLA 3FB5A 3HI1B 1FGNL 2F8XC 2YXMA 1OAKL 5GGQL 1G7HA 5E4EB 1NMAH 4PGCA 4FTVB 4WW1A 2DL2A 3W5MA 4NQDE 4RNRB 1TPXB 3ZKMC 1MCPH 1T83A 4RMUA 1EGJL 1BD2E 5SWZD 1T4KA 4U1KB 3C60C 3BKJH 1ZHLB 5HHXL 3D25A 5HHOD 4ZUTB 5BRZE 1U3HD 3UP1A 4NUGL 3U4EA 2BVUA 5C0DA 1JZ2A 1I8LA 3WS6A 2XPGB 1Z0NA 1FV1B 1F3DJ 4WW2F 4X5WA 5DD5L 3FCTB 4PJ5A 5I0ZA 1SJEB 2ED9A 5D7SH 1G7QA 4EOWH 4N1EA 1INDL 3TBVA 1LEIA 2Q3ZA 1B0RA 5D7KE 3HZYB 4HEME 4PRBB 1IGJB 3QXVA 2PN5A 1JPGA 3BH9B 1Q38A 1XF4B 3MRKB 1RZ7L 2V7NA 3HE6D 3GKZA 5I8KL 4RGNC 1FVDA 4O4YH 3ARRA 3BGMB 3IT8D 5I74B 1OQXA 4PD4K 2IALB 3QWRD 3SY0B 4HXAH 1EEQA 1A14H 3LKPB 4NZUL 3T2OA 2A38A 3PGDB 4M7ZB 2XG4A 5HYIA 3ULVD 4NKDA 4WFFE 2R0LH 1MCJA 1S7RA 2W9EH 2Y72A 1DBBH 1WFTA 4L8BB 4TULH 4Y1AE 2R56L 5L8KB 3SE4A 4X99A 2FO1A 1NGPH 4JRXB 2YD8A 5IFHL 3GBLA 1K6QL 4PJFF 3SKUD 4LSDA 1E4JA 4D3CH 3BPNB 3MOBL 5ACZA 3IFLL 4CW1B 1I9RH 5C09E 2FB4H 1RJLB 2AXGA 3I6KB 2PCPB 5D93B 2GW5A 1UFUA 4H88L 2H26B 3VXPA 3WDIA 5KS9A 4IHOB 4OZIB 5JW4Q 4JFZH 1JV5A 5CFHA 3MCKB 1AHWA 1IGCH 4NM8H 2PO6A 1VPOH 5IB2A 3SPVB 3ZKXB 4QXGL 3BIKA 3DWTA 4Q7DA 3FQTB 3WFBL 5E6ZA 4LSPL 5BZDA 1LD9A 4MNHB 2X1PA 4GXUM 4X6CA 4XI5C 1UT9A 5DVLA 2WZPD 3X11B 5JUEL 3VG9C 5BO1H 1WISA 3D39E 2BJML 2JK5A 4WI9A 3RWHB 1EV2E 1ZLWK 3A6OA 1NL0L 3AC0A 4LOUD 4NO2B 3UJTL 4R3SA 1JGLH 3PL6B 5JMOC 2NXZB 3PWPD 4KMQA 3MACH 3BKYL 4LF3A 5GSVA 3CAFA 1ZT4B 3GBMH 3MLTB 3C5ZC 1N2RA 1S78C 4Z8FH 5TE4L 5FF6A 3NPSB 3PP3K 3UDWA 1E0OB 4W6XB 4IRSB 4CJ0A 3ALPA 5IB1B 3CSGA 3SBWC 4MXQD 4PS4L 1IC7L 4O2FB 1WWBX 1DLHB 2E7BA 1MHPL 2JIXA 2A9NH 3G6JA 3QDAA 3LKNB 3VFNA 2MCPH 3RNQB 1UA6L 2NY3C 3MRPA 1U8PA 1FBIL 2VABB 4H8WL 1FCGA 1NMBH 5GSRA 3WD5H 4MAYB 4HS8L 2VKXA 5I75B 1FNSH 3ESVF 1G7PA 3MRCA 1BIHA 5L6YH 5DMGD 1YN6A 3LDBC 4MLSA 3JVGC 3AS3A 5I76B 4JPWH 2D0HA 5EO9A 4UQ3B 7CGTA 3S3PA 1QBLH 4PP2A 1A1MB 4ODWB 3HAEB 1UCTA 2DS4A 1M7DA 2D3VA 3FB7A 2VN7A 4DZBB 4KDTA 4JHBA 2IGFH 4W70A 1KEGL 4XTRC 2YZ8A 5I1CH 3GIZH 5JZ7D 5I30L 3TT1H 4UILL 2ARJQ 4ZXBD 1N59A 2B0SL 4NZTH 5DJAA 1L7TH 1MFAH 2SEBA 4NFBA 5EZOL 4D0BA 1AE6L 1HHKB 2DQDH 2VDNH 3VFRA 2AI0H 1FFOA 1MLBB 3BH8A 2B7DT 1I75A 4I18A 2BVPA 5D8JH 1MNUL 1QNZL 3TM6A 4IOFC 1RZGB 1D9KD 2D0GA 4Z77A 2NW2B 1NEUA 1UCBH 2XYCA 2FYYB 4WTWA 1YEEH 2EIDA 2CMRL 5F7MC 5DEZA 1TQBC 4P2OD 3VWJA 4YHOH 3CUPB 4ODUB 5EPMA 3QDHA 4NO3A 4HUVB 3UTZB 5EO0B 1RJCA 5HHQB 5ENWB 5C70A 2UYLA 3H9HA 3PQYA 4ACPA 1OB1A 4ODTL 5F7DB 4KI5D 4OCYL 1HWGB 4ONFH 2GT9A 4PRNA 4HUNB 4X6DA 4ZQKB 3S35L 3GMQA 2B8OT 5GGVH 4P3WA 2VUOA 4OLWL 5CJ5A 3LMJH 5HDQL 1UWXK 1HHJA 4JAMA 4LSRL 5D1ZB 3SE8H 1CXEA 3JV5A 3GBNH 3PHQB 1OGTB 5FGSA 4Q6IA 1N5YL 3QDJA 2Z31D 5TFSL 3ULVL 5FOBA 2H2SC 2ZOKB 5JHLH 4KK6D 2D4DA 5J12B 3HZKB 4L4VA 3O9WC 4FNLH 5IMKA 3RY6C 1S3KL 3TVMD 4O9HH 4OSUH 4YDKL 1DCLA 1I9EA 3QRFM 3ARGB 2UV3A 4GRLD 4OB5L 1RUKL 2NY0C 4H25A 4PJAA 2EC8A 2R2EA 3CJJA 5ACMA 3C8HA 1VA9A 2R0KL 3NIDE 1GGCL 2D7TH 3G9VA 4NFCA 3ZKQD 3FT2A 2IFFH 4K9EC 5DK0A 4GBXA 4N9GA 2GAZB 2HG5B 4K3EH 4X6BA 4PJBB 2V17H 3LN9A 1D5ZB 1BM3H 4MD5B 3U2SA 3GJFB 3HE7C 2AKRA 5TH2A 4PRAA 1DN0B 2AABL 1OF2B 3MRQA 4MA3A 1EO5A 4P4KD 3OKNA 2UWEB 4KZDH 2OX5A 1LO3H 2ICWB 3MUHL 1T1WB 4BH7B 1A6ZA 1H9VA 1I3GH 4WFEE 3I2CH 3SKMA 1QEWB 3WS3A 1LEKA 1EHXA 3DVGB 3RAJL 3GI8H 1JK8B 4FQIL 3VFTB 4IDJH 4IS6A 3QUMA 3K8LA 3O8XB 4P9HH 4RFOL 5TE7H 4HIEA 3SJVE 2DI8A 3OKYA 3QEUA 3HG1B 1S5IH 3NOIA 1BQHG 3VGEA 3LOWA 5ACLA 1KTLB 4ELME 2VWEE 4BFIA 3BWAB 5F70A 1CE6B 3IXAB 5DJ6A 3DMMC 1JPFB 2J8HA 4JKLA 4PJHE 3TN0B 5EU6D 1YMHB 4B7LA 5F6HI 1T3FB 4PGEB 5C07B 3R0NA 3D9AH 3DO3A 2VKWA 1A2YA 2ADGB 5C0AD 4G6ML 4QRPA 3FN0L 4QWWD 2VC2H 1MREL 4KJYA 4WNQB 1TVDA 1NUFA 1EFXA 3CZJA 4OZGA 3WE6B 4OF3A 4YGVB 3ARBB 4LSQH 1AXSA 2H3NB 5HPMB 2HVJA 1H5BA 3GSXB 1AR1C 4EZMA 5F7EL 3QHZL 1RVFH 3T2QA 5D1QD 4N0FA 3DX8A 3MRRA 3PP4L 4WVRA 3V0VB 3OHXB 4BQBA 5C3TA 3F6LA 5GJTL 2OK0H 1NUGA 4OBSA 4KRMB 2YD6A 1MF2L 5KSVB 4P23C 1Q9WB 4U3CA 3IKCA 4MCZB 2V5TA 2CIKB 1P5VA 4JR9H 4DW2L 1MHHB 3SO5A 3U9PL 1QO3B 4YDJB 5F88B 1CDYA 5C0ND 1WV7T 2VISA 1TJIH 1PKQA 1WZMA 1X5IA 4AQOA 2G2RA 2IANA 1QRKA 2MTPA 4HK3J 4BQ8A 5HPOA 3ARPA 5IV2B 3U7YL 3IS1X 5H35B 2ATKA 5TQ0H 1D5BA 3BQUD 4OLZH 2GK0A 4Z7VA 2HRPH 1MJ7H 3BKML 3STZB 3JV6B 3KLSA 2HT2C 3T4YA 5GRJL 1FYTE 3CFJB 4TTDD 2K1MA 2C3XA 1XR8A 1JYXA 1MRFL 2NTFB 1DE4B 4G8GB 1T6WA 4M6NH 5E2TL 3IS0X 3O81A 3GMMB 4LEOA 1CFVH 4K2UH 1OP9A 1YYLL 3VA6A 4QTHA 4JN1H 4U6XA 2IWGA 3WL9A 4WHCA 2XTLA 2PYEB 2ITDA 1MCLA 1S9VA 5IB3A 4ZTOH 3GJEB 4XCYB 4N5EA 5I18H 1ZT1B 4KZEL 5CCKL 4ZDHA 5GGRB 1SM3H 3H7BB 3CFKA 4K7FA 4CL7A 2RAMA 1JP5A 5D2LF 2RHEA 4F7EA 2OL3H 3P9MA 2Q8BL 1CLOH 1A47A 4WDIA 3RIAK 1ORSB 3CXHK 3HI6L 1MCPL 4Y5VC 4PJGB 1RIUH 1TTUA 1QBML 4XC1L 1QFWI 1KLGB 4RGMC 2VRAA 1NAKL 1MIEH 3TA3C 1QLRA 4O58L 3GDBA 4HK0B 3RVVD 5ITBL 1AQDB 1D5IH 3FFCB 1JHKH 4XXCA 3E3QA 2ARJA 4H8WC 2H8PB 4L1DA 4LP5A 2VE6A 1I1AA 1OD9A 3DI3B 3QIBA 3QUYA 3KDMA 3PDGA 4MJIA 5DJ0A 3RWIA 3T65A 4M1GH 1B6UA 3L7FB 4Z7OE 4WHTB 4Z7UE 5I6XC 4OJFH 1TNNA 2HA1A 5CUSH 3S34L 5EC1B 1B0GA 1TJGL 4JFFD 3UTTA 2C3HA 4W4NA 4XGZB 3HLAB 1JYNA 4BK5A 4LL9A 3GHBH 2AK4B 1FAIH 3H0TA 3KS0J 4LPCA 2Z8SA 4OLYH 5T5FH 3HCVA 2X1OA 3NCJH 4M6OH 3IDNA 1QRNB 1JWSB 1TMCB 1DBBL 2QHRH 4TULL 4NO0A 2ZUXA 1NANI 2NY5H 4Q2ZB 2VLJA 5LQBH 3MV9A 4LASH 1UWGL 5IG7B 4LPUA 1YPZF 1U3HC 4PGZA 1CXLA 5BS0A 3MUGB 5CHNA 4D9QE 3MV8A 5BQ7A 4Y16A 1F6FB 4QRRB 5GIRA 5I1JH 4EUPH 1I9RL 4LLWB 5I8CB 1HNGA 4X7TB 5E08L 3ARZA 1BD2B 2ZSWB 4Y4KB 1E28B 2YKLH 3TPUA 5KG9B 3FOLA 1QSEA 1H3UA 2PTUA 1CTOA 1BECA 1S5HA 5GGTA 5BV7B 1JZ8A 4L8CB 4X7CC 5BRZB 1A7OH 1RFDL 5I71C 3KJ6H 2P49B 3CFBB 3WS6C 3ARFD 3N50A 2I9TA 1R3KA 5JO5A 2VR9A 5HHNB 5JPNA 3NZHL 2EXYD 4JPIA 4WV1B 1IMHC 5D1XD 4U6HB 3UZVB 4PLOB 1M4KA 3KPLB 4YDLC 5D7LA 1ED3B 1ZHNA 3BI9X 5BO1L 2YD1A 1I8MA 5CEXB 3G9AB 3ULVC 5LXGL 4L3EB 5DUML 1IAIL 4F33B 1UEYA 2VL5B 5L8JB 3GSNH 1CGWA 1KJ2H 3ZO0A 4RDQF 1JGLL 3KPOB 3F7VA 3GBML 5FECB 1CT8B 3Q1SL 4PD4J 5FHAL 5L0QB 4U1LA 4C56D 4Z8FL 4K71B 1PZ5B 3S96A 3RTQB 5J8OA 1CI5A 1YECL 3TJHD 5GS0C 1JGEA 4M6MH 1NBZB 1U2CA 2YD3A 2R15A 5MEQB 3W82A 1LO2H 4UV7H 1XAUA 1ZS8B 1JTPA 2WINA 5I15H 1DEEA 1R3IH 3UJIH 4Y1AB 4UU9A 2R1WB 1AO7E 4JDTH 1P5UA 1UVQA 2YK1L 1KLUA 1FNGA 3O6ML 3CK0L 2GSIB 1UB6B 1IKNA 5C08D 1SY6H 1X4ZA 3ROLB 5SV4A 4Z76A 5HGHB 5JW5B 2QR0A 2EZ0D 4XVSL 2P47B 3BFOA 3C09B 3UTSB 5C09B 2AV7A 5C2UB 3NFSL 4JPWL 1FSKB 5KSBA 1GGTA 3DURA 4YDVA 1J1PH 5I1AB 2PO6C 3SDAD 5J9PB 1E6OH 1F3JA 3MRJB 5D6DA 5ID1A 3DX6B 2IGFL 3TBYA 4LOUC 2CXGA 4NGHL 1NAMA 3GIZL 5GPRA 4PGJA 3TBWB 4HUXA 3S97C 1MVUA 4QTIH 3HPJA 3E0GA 1NGWB 4WHYG 1KXTB 2VDNL 1NDGA 2AI0L 4MJ4A 4TNWK 4UINH 1MJJA 4KXZH 4OKVB 4MXQC 2A6DA 2HTLD 1LNUA 3ZZ1A 5F1IA 1YY8A 5CILH 3VFOB 3U6RA 4XMLH 4JG0L 5FM4A 5AAMA 1UCBL 4NO5B 2P5WA 2L4OA 4O5LL 1YEEL 2X4NB 5D6CA 4HULB 1KPUA 2PYFB 4G9DB 2KQMA 3UDWC 4U1SB 2DB8A 5HYSG 3EYFB 2VLME 4N9OB 3MLSH 5CZVL 5C0BA 1T1XA 1CVSC 1K85A 4NZRH 3U36B 1GAFL 4YZFE 5DMGC 1IM9B 4ONFL 3FTGA 3PWUA 4YLQT 5B21A 2IAMD 1GOFA 2OMBA 3RNKB 3QULB 1F4WH 3NCFB 3TZVC 5EU4B 3CU1A 1P7QA 3C5SB 4WTZG 1CLCA 2OL3A 2A6JB 2HKHH 5JZ7C 2DLTA 1NEZB 3SE8L 1T0NB 4YWGH 3CX5K 5AWNH 4ZXBC 3F5WA 4XNMA 7FABH 4YR6A 2PW1A 1JGDB 5DRWB 3VGDA 1ZGLP 1NFDA 4LVOC 4Y0GA 3IFNH 4BSWB 1WBYA 2BSSA 5JHDE 2PR4H 2X89A 3GMLA 4O9HL 4FZ8H 1IZKA 4JM2D 1DBJL 1IQDA 1P53A 2ATPB 5DXWA 1D9KC 4KPHH 1UYWH 3EHBD 1I7ZA 4OLEA 4TPRH 3TC9A 5I66A 3BP7B 4P2OC 1HEZA 1NBYB 3ALWA 2J88L 1F6AB 2V5SA 4I0PA 3RVXD 3L3HB 4LLQB 1DQJA 1RK1A 3MPCA 2J6EL 2FX8H 3ABZA 4HH9B 3VWJC 4M93B 3C5JB 1CXKA 4F8QA 4KZDL 4HIJA 5HYJA 3GB7A 1FGVH 1KGCD 4JREC 5MHSD 4HW6A 2YD2A 3I2CL 4DEPC 1AIFB 5TF1H 4DN4H 3NZ8A 4NWUH 4UDTB 1CFTB 1NFKA 1T6VN 4RA3A 4F8TA 4IDJL 2XICA 4F7TA 2DQTH 5DK3A 4NKMB 2VXQH 4JFDA 4F15B 4UAOB 1M71A 1N6VA 4KK6C 3K80A 4KHXL 3X3GH 4YHNA 3TVMC 4CN6A 4JVWA 2ZSVB 3MRBB 3GMOA 3FT4A 5FUCC 1QA9A 1FDLL 4GRLC 4B5EA 1VFBA 1OTUD 3PWLA 3HPLA 2YUXA 2BX5A 4U33A 2EE9A 2G5BB 3LRSA 2HJKB 3PGCB 5IJVB 3UEZA 1K2DB 1L0XA 5HVHC 3J7HA 4RMSA 4YBLC 3V79C 3G6AB 2F53A 4KQ3H 3R8BB 1RZJH 3LRGA 4I3SL 3P4MA 5H37H 1WCBB 2GI7A 2VC2L 2BMKA 2ZOLA 1S7WB 4IRJB 2VZOA 4R90L 3B6SB 4LSQL 2P8PB 1XF2B 4P4KC 3V4UH 3HMWL 3ARDA 3HB3C 3KYKH 4Y2DB 2WK2A 4Z7WB 4L8SC 4ZUUB 1KN4H 4XRCA 2D7PA 5DJ2A 1I1FA 1G9MH 5KS9F 1A4KB 3RIFK 4PJ9B 1EGJA 3RVUD 1YNTA 1EEZB 4AL8L 2LAGB 1WIOA 4P2RE 1Y6KR 1KJ2A 2B1HH 1OPGH 3RY4A 2GFBA 5K9OA 3BJLA 1R5WB 3ULUL 1F4AA 4JO3H 2GHWB 4FTVD 3V6OA 4JR9L 5FYKE 4I5BB 1HYSD 4ZYKB 4XXDA 2NLJA 1QSFD 3P9LB 1TJIL 1EO8L 4TOYL 5BVPL 2EYRA 1M7IB 3ZYIA 2IQ9H 1NUDA 2N7AA 5J1AA 3TBSB 4WO4B 5B38G 1E6JH 4LK4A 4JZJA 3SJVB 1Q0XH 1QBBA 1YQVH 1KIUA 3KG5A 1SY6A 4DVRH 4UDUB 2Z93B 1YZZA 1XR9A 4BJLA 3RVTD 3MO1A 3RA7H 4LMQI 1OAXH 4OCRH 2CK0H 4KUCF 3KXFD 5TQ0L 3L9RA 4OLZL 1L0YA 3I02B 4WY7H 3EOBA 3MGTB 3WKML 3WFEH 5DDHA 1LE9A 4UQ2B 1WIPA 5FM5O 4ETQA 1X6LA 5JIIA 4BK4A 2XKNA 4HWZB 1EHLH 5I1KL 5FDYA 1C8PA 3CFDA 9CGTA 5IQ7H 4ZPTA 4M6NL 5E9DB 5INCB 2VAAA 2B4CH 2HH0H 1U92A 3O6FB 4KHTH 4NUJA 2D7NA 2VQ1A 1BQHA 2DKUA 3N85H 1KCSH 5MEOB 3TYGL 4ZO9A 1KBGL 5I18L 2IH3B 4GLRH 1VADA 3MREB 5C0NC 2EKSA 1ZTXL 3IRZA 3QDMD 4V1DE 4HEPG 2HFEA 3VRJB 5ICYA 2ICEA 3H9SA 4I4WB 1DSFL 3LN4A 3QYCA 5FYJU 2IPUG 5F1SA 5JXED 4P57A 3PXHA 3QFJA 5T3ZH 2F54A 1IGTA 1RIUL 3VXSA 5ADPL 2E6PA 1JZ7A 5IIEB 2DQUH 1RV6X 1RZIB 2W9DL 1MIMH 4YIQA 5C0FA 1G1CA 1HZHH 4HK3N 1X9QA 1MCBA 4I2XA 3LPWA 1D5IL 4TTDC 1S9KC 3CNKA 1JHKL 4KJPD 2YS4A 2CKBH 4FFYL 4HCRA 4OZFB 1WJ3A 5EFIB 2CRZA 1MY7A 5D5MA 1L7IL 4QOKE 4DOHE 2HJFA 1LK2B 4M1GL 4X0KB 4E42A 1Z3GL 3FRUA 3O11B 3HUJB 4Z78A 1J0HA 4MCYA 3WSQH 4NCDA 1A1OB 3IU3B 4PREB 1CQKA 5E8NB 1FYTB 3MLWL 4PRDA 3MQIA 4RMWA 1RHHA 3L95A 5J1SC 5E8PB 2AEQH 4CVZB 4NQEA 4QRQB 2ESVB 4LCIH 1JFQL 1W72B 3GHBL 4XZUA 5JXAL 3KPPA 4V2CB 2O5ZL 2HN7B 3R0MA 1I3RA 1RQ5A 5T5FL 1FJ1B 3I6LD 1IT9H 3NCJL 2UUDK 3V0WH 5KJRH 5ILTH 4WHYH 2AS5M 1XGUA 4DVBB 5IMLB 3THML 3C6LD 2E27L 2QHRL 3NN8A 3L6FB 4F37K 3UTOA 1TNMA 3DBXA 5T1KA 1N5AB 4FHBD 4LASL 3RL2A 1NH6A 3MXWH 4Y5YB 1P1ZA 1I9JL 1KV3A 2UVFA 2VAJA 4BSVB 4YC2B 5IBUG 3RVVC 4C83B 5KN5A 2Q76B 3CXHJ 5GISH 1MWAL 5E00A 4A6YB 1I8KB 3IAQA 2YKLL 1I7RB 1T21B 1Y6MR 2AJZA 3QEGL 1UXSA 3O3AB 2IMMA 4ODHL 3V6FA 3GKWH 4B50A 1HK6A 3W81A 2Z35A 3MRDA 4PRIB 4G42B 1PZUB 3GSUB 4UUJA 4NJ9L 2Z8RA 5E4IA 1WC7B 4D0CA 1YNLH 5DHVA 3RPIA 2MQ3A 5FA3A 2HMID 3HFML 4MA8H 1FIEA 4X6FA 5ECJE 4F58H 3EFFB 1MJUL 4PGBB 2WAHA 3QHFL 1BBJA 3GFUA 2A0LD 4D9RD 1CQYA 4Z7UB 3GSNL 3K46A 3T3PE 1JNHB 2JTDA 4X5XA 1DVFD 2QSVA 2PXYB 4MD0B 3SDYL 2MSPA 1IKFH 2BOBB 2APTA 3SDDB 1ZWIA 3CC5B 4ORGB 4TVPH 2E7LA 1HSAB 1T5XB 4GQ9H 4NKIH 3IJHA 3PNWB 4LLYA 4F9PC 5AZEH 4MMXC 2EECA 2YPLB 2X44D 3MOAL 1S9WA 2OTUA 1LEGB 4WEMB 1F6LL 1YPZE 1SBBA 3U82B 4UV7L 1SYSA 4R7NB 2XY2A 1NSNL 2WBJB 2YUVA 5I15L 3QDGB 5F9WC 3GMPB 3UJIL 4PRHD 5ISZA 4JDTL 5I1DB 3G08A 4LEXH 3JV4A 1CG9B 4E41D 5BJTA 4DFHA 4LCYA 5DVMA 2XQYG 2A1WL 1KCVH 4OZGF 5D71H 4OF0A 1HCFX 2DJSA 3ARFC 2IQAA 4HD9A 4UT7H 5IP4A 3KHOA 3EYSH 4MSWA 1AGBB 1KCLA 3I50L 5D1ZD 3BD5A 2A83A 4LSVH 1UXWB 2JJTC 3RL1A 1XIWB 5D1XC 3F58L 2VIRA 4EI5A 1PEZA 6FABH 1J1PL 4WW2B 4GS7C 4P9HC 1CBVH 3OKDA 3B5HA 1JTOA 3PJSB 1N7MH 3C8KB 1KJMB 3RHWF 3SGKC 4JY5H 4QT5B 3DARA 4D2NA 3VGFA 4LLVA 1INQA 3QUXB 5A2KH 1FNEB 5EZIL 5T1LB 4ZNEE 1KACB 3TJHC 1BIIA 1AC0A 3MCLL 1I7TA 3Q2CA 5DC9B 3LEYH 5F3HB 4RWYH 3OX8A 3CXDH 5DQ9B 5E5MB 1CE1H 1TETH 3IETB 1QFUL 5DJZB 2AQ2A 3B9KA 2VZUA 4Z7NE 4YPGB 1OP5K 1IM3B 1H3PH 1WBZA 1KCRL 2EZ0C 4Z7VF 4WU5B 5HY9A 3HC0A 4PJFB 5INDA 1G9NL 1IJ9A 2CO6B 3SQOL 1YEDA 4UIMB 1IKNC 2R1XA 4JB9H 2APFA 1KB9J 2B2XH 2NNAB 2Y7QB 5I17B 1MI5D 2P8MB 3SO3C 3F6IA 5B8CA 4Z9KB 3HG1D 3SDAC 4PV9B 1ND0A 3G5XB 1FZOA 3RKPA 2ZPKL 4RQQA 3OKKB 3T0EE 3UTQA 3H42H 4G43A 4YWGL 1OAUH 4OCWL 1J8HA 2AAVA 4XX1E 1Q9OB 3TN0D 5DD3H 1IRAY 1ROWA 5D4QA 5C07D 3IFNL 3HMXH 1P4BH 3FQWB 1WIUA 3MYJA 5HHMB 2EIZB 3LQAH 5D6DC 1FZKB 1O7VA 4FZ8L 2OLDA 1UJ3B 4LLDB 4MD4A 2HTLC 2X4SB 4FXGA 3KPNB 3MRMA 1FYHB 4FQXB 4XP5H 4KPHL 1QBAA 8FABA 3GJFK 3VFGL 2OSLB 3ARBD 3CDYA 5EOQH 4IIQB 5FCSH 3B3IA 2DKMA 4HPOH 4JQVA 3DIFB 5DI8A 3ZE1F 4MS8D 5D2NC 5KVGH 5CJQH 4GG6E 2Z8WC 2IAMC 2LV4A 2EDXA 1U8LB 1AP2A 3PGFH 3HZMB 4BH8A 2CLZB 3MRNA 1VEMA 4YK4B 4JFOA 2BVQB 3IDXH 5TF1L 3WO3B 3D0LB 4NRZA 3MJ7B 3BO8B 2XIDA 3AREA 5DRZA 3SQBA 4PJXE 1KN2L 4WTXA 2AGJL 3BP4A 2VXQL 5L2KB 3VGBA 1WWWX 1SJHB 5EUOA 1DP0A 5C0CB 3CU7A 2Y06L 3X3GL 1F90H 2BSTB 4M9PA 3PV6A 1XF5A 1LP9A 3I84A 4JM2C 4NQXA 1GHFH 4X6EA 4XP6L 32C2A 4MYWB 3L5XL 4P5TD 3P0VL 3QQ4A 1I8IA 4U31A 2HLFD 4OF7A 4OD3H 4WCYL 2Q7YB 2FEEI 3UPRA 1WUNT 5HYSA 1J88A 1P84K 2LABA 4PLJD 4NPYB 4FXKA 1FL5B 3ZT7A 2LVCA 1RZJL 2FLRT 1K4DA 5DZOA 5JHDB 3B2VL 3MSPA 5FUZL 4U1MB 4G8GD 5I1EH 1KXQE 1JBJA 1X5YA 4TUJB 2I07B 4ONOA 3KYKL 4XNQA 4NSKB 1C1EH 5CD5D 2XTJE 2V2WA 2VXSH 4WTZA 1INEH 3CPLB 3D0VB 4NBYB 2NCMA 1A9EA 4L4TD 4B0MM 1P4LA 3NIFE 4PJ5E 1G6RB 5IVXA 4GJTB 1QR1A 4LBEA 3BGAA 2B1HL 5CP7B 4Y19A 4N1CA 1O5DT 5E03A 2Q6WB 2FWOA 3BJ91 1RURL 5K9QG 3KLHC 2BXYA 5F21B 1Z5LA 3ZE2F 1Q94A 1VKXA 4RGNB 3QZWB 1OTUC 5IW3A 2YPKB 3QJFA 2FX7L 1CF8H 2X9WA 3B9EA 3QNYA 2IQ9L 1NKOA 4F7MA 2R0ZH 2NY5C 4JZNB 5JR1H 1VFAA 4FFZL 1E6JL 1HDMB 1VHPA 1Q0XL 5EOCH 4MA7H 1YQVL 1R3LA 4ZPVA 3TYFB 5KSAA 3BZEB 5SWSA 2XWBA 3QO1A 1YA5A 2P5EA 1OAXL 1DANU 4PDCE 3QIUA 4Q9QH 2YBRB 4PJEF 4WY7L 4WU7B 3WFEL 4NM4L 5AAWA 5E24E 25C8L 2NX5A 1F2QA 3I3EA 1CDJA 3G04A 3JTTB 3DRQB 5IQ7L 3RVUC 1FO0A 2B4CL 1NJ9B 1HIMH 4RMTA 3FQXB 2AK4D 3VJ6B 1MRDH 5KS9E 4RFEA 2NYYD 5C0AA 3OL2A 3HS0A 5J6HB 1FVEB 2BP3A 3N85L 5FO7B 2GITB 1KCSL 4HUWB 3HA0A 4RAVB 1JRHH 4Y88A 4ELKA 3CLFH 2QADC 3QHTC 3MUY1 5KSBF 1HYSC 1CFQA 4NQDA 3SKNB 2DQHH 3DX9A 3QXUA 4X6CE 5C0EA 2FJHB 3M1BB 4IM8A 4G3YH 1A22B 4U1GC 4KK9D 1GIGH 4LCWA 4P2RB 3HR5B 1A02N 5C9JA 3DVNB 5D1QA 3MRHA 3ROOB 3VG9B 3TO2B 1FG9C 3KYNB 1U8JB 5DTFB 2FH6A 4GAYA 3LAFA 4HUMB 1BQLL 1QYGH 1ADQH 1UQSB 3QWOA 3RVTC 1J86A 1BD2D 3D18B 1U41A 3DV4B 3FQUA 3IF1A 5EORH 5TE6H 3VD5A 4Z6AT 1VACA 3C5ZB 4CJ1A 1HZHL 4JZJC 4HT1H 5BRZD 1OAQH 4LLUB 3D69B 4OFYD 2YWYA 3TNNA 1NLBL 4KTEH 3GMRB 2QL1A 1F8TH 2CKBL 4AQ1B 3HZVB 1V7NH 3G6JE 1KJVA 2EH8L 3RDTB 2IADA 43CAA 3O6KH 4CUCA 4DAGH 3HRZA 4X98B 2NY3B 3BHBB 4BFEA 5A16B 4HHAA 1BLNA 2P45B 3WCYA 5D7KD 2EC9T 1TZHB 3LH2H 1AGFB 2L7JA 3WHXB 1KF9B 3D2UA 5IM7A 3VFWB 4LCIL 5D72L 2Y5TB 3P0YH 5B38A 3LDBB 5CS7A 4LHUB 4HKXB 5E8EA 1FFPB 2DQIH 1IT9L 1CLZH 3WIHH 5IT2L 5JXEC 3V0WL 5KJRL 3KPRB 4PTTB 1NCWH 5IVZA 1EFQA 1YEJL 4WFFD 5EU5A 5LAXA 2DI7A 4JY6A 4XCNB 4P3CL 5ABDE 4IMLB 4Y1AD 1KG0B 4W4OC 3OKOA 5LVEA 1ONQB 5GS3A 2OZ4H 4HGMA 4Z0XB 3HAEG 1WBXB 4P5MB 4YHKH 4K94H 1IEAB 1JUFA 3C9NA 3BEWA 4YXHH 4DK6A 4KI1A 4KJPC 4LNRB 4G6JL 2DTML 2ZUQC 4NRYB 3IGAB 5C09D 3TO4A 1J11A 3RIFF 2IH1A 4LGSB 4MQ7A 1N0LA 3CDGA 3OJ2C 2V2XB 3SOBL 4X4YA 1KB5H 3MBEA 5SWQA 2LAAA 1HXYA 4A2MA 5BXFB 3ZDZF 3D85D 4QRUB 4OCSH 3PQYE 3EO1A 1TCMA 3MLVL 1CXHA 4GUPB 4U05A 3CIQA 3Q48A 4MA8L 1BBDH 1YEGH 4X6DE 3MJ6A 1F4XH 3W9DA 1T0MA 3BEVA 4OZ4B 5D7JB 1RUMH 5LGHL 1OTTD 1FFNA 1G7LA 4OCLC 2KBGA 2F8OA 1MCSA 3D39D 4U0RC 4QHMA 5E2UL 5E0QA 4WEBH 3C6LC 1TZGH 2YA2A 4U2ZA 3V52L 4JKPL 3V7AE 3DXAA 3EFDH 1TTFA 3F7YA 3H3PH 3MJ8B 2F5BH 4HKZA 4L4VE 4NKIL 3V8CA 5AZEL 3O9WB 1PQZB 2C5DC 2VZSA 2QBWA 2FIKB 3LKSA 4PJAE 2VDPL 4G6AD 5D2LB 5KW9H 4P0DA 4DQOH 2NY0B 4LEXL 4M7LL 4WUUA 1IM9D 1B0WA 2JELL 3VH8B 2BNRE 1KCVL 4XMPH 1HILB 5D71L 1K4CA 3R1GL 1S8DB 4HWUA 1PG7X 4H0GA 4P2QA 3S4SB 4UT7L 4CMMB 3EYSL 4H5SA 5ICZA 1XCTB 1CD1B 1U93A 3U1SH 4DGVL 5FO9B 2BNQB 3HE7B 2HMIC 4LSVL 5IWLA 1D6EA 5JW4N 1YMMA 1GRWA 3RGVD 1UZ8B 4IOIA 1ZMYA 5DEFB 1CBVL 4FG6D 2A0LC 2XY1A 1OAZL 1QQDA 3OKMB 3VD9A 3RQ3A 5E2WH 1N7ML 4PBWD 5CJ8A 4JY5L 4BKLB 4BM7A 1DVFC 4AH2A 3BOVA 1T03H 1VGKA 1RIVL 2LU4A 3WFCH 4L5FH 3HI5H 3G5ZB 1Y18B 2DD8H 1NCBL 5GRUH 4JFEA 2C3VA 4XNXH 5EBWA 1JF1B 5IW1A 1DEDA 1SEQH 2W38A 5E99H 5LGJA 3LEYL 2XKUA 3VW3L 1KNOA 2IPKB 1RZJC 3CXDL 5T5NG 5IMMB 1TETL 2VTFA 1YEHL 3DMMB 4R0LA 4M61B 5BV7L 1W0YT 3UJJL 1CU4L 4D0DA 4QHUB 1H3PL 1YEFL 2BC4A 4S1RL 1QHOA 4W68A 3HC3H 3TESA 1QOKA 4OZGE 3CSYB 1YPZB 2GCYB 1WZ1L 3QXAB 1PW3A 2I5YH 4LCUA 4PJDA 4XPHL 1K8IA 5CLTA 3UC0H 4JB9L 2M1KA 3D1MC 2B2XL 4G9FB 5JDSB 3LY6A 5D7IF 5J12C 5KVEH 5FYLE 1NGZA 1AGCA 3L3IB 3FFDB 5DVNA 1V3KA 3GI9H 5I9QC 2Y36H 2R8SH 3IU4H 3W11D 5A43C 1U8HB 3FHAA 1NGYA 5DK2B 2QKIA 3L7EB 5GS2D 3HMXL 4P23B 5HGAB 2G75A 3LQAL 4ODBD 5ICXA 1FLTX 3ZE0F 3T0BA 3G6DH 5KSUA 2RCSH 3BW9A 1P2CB 4KFZC 1V3LA 1TVHB 2AJXH 3EJYD 4IRJD 1PKQE 4G80A 5MP6H 5LKNA 1EJOH 3BUYB 3H9ZA 1QVOB 3L3DA 4NQCB 1VFUA 1FIGL 1JPSH 2YC1B 3WO4C 2IANE 4Y2DD 4OIAA 4BQCA 3QXTA 4J12A 2KKQA 2FBJH 5DUPH 3GSOB 1P7KB 3AS1A 3MRGB 2CRIA 2M8XA 3SHSA 5ETUB 3RWJB 4MDIA 3CFCH 2F5AL 3D3VE 2B4CC 5IR1A 3BRFA 5D5MF 5I8EB 4Y4FA 3PIQB 4X4XB 3TEUA 4Y5XA 3IDXL 5EUKA 2NY7L 3T2PA 4J3XA 4WFED 5HHPB 4M02A 1BAFL 2X4PA 2XN9B 4GAGH 3F7RA 3WIHA 4PB0L 4PBXA 1FN4B 3I6GA 5GRZA 3REVB 3TN0C 4G8FA 4U7SA 3BZ4A 4U6YA 2W65A 3BN9C 3RU8H 5EO1B 1QKZH 3SJVD 1F90L 3EGSB 3KYOB 4M7KH 2OZ4A 1EXUA 5DZLA 1GHFL 3PWJA 3MNZA 4TSCH 2KZ1B 2AV1A 3UO1H 3T0EB 4B53A 5AD0B 4LRIA 2AK1L 1WTLA 3U0TA 1ZXQA 5EOTB 3X13A 1YNKH 1J1OH 3P4OB 2F19L 4UOW1 1UGNA 3IJSB 1ZANL 4EQ2A 4MS8C 5M94B 1JHTB 2BY3A 4Y5VB 4HV8B 3FO1A 3QXDB 4N0CA 4WGVB 2V9RA 4YQXH 3O6FD 3VXNA 3P9WB 1FAKT 1FZMA 3LSOA 2CIIB 5CJBA 1P9MA 1INEL 1ZSDA 3E3QE 5MENB 4GKSA 3O3BA 4H1LB 4LKCA 3LB6D 4PJ8A 3ILPA 4EBQH 1M7XA 4MJIE 3RRQA 5IF0A 1HHIB 1H0DA 1DDHA 3MJ9L 3MOQA 3LQZA 1FH5H 1LK3L 5ELIA 3T77A 2FO4A 3UTTE 5I6XB 3GZKA 4ZAKA 4NNXB 5KZCD 3PABB 1SQ2N 5DJ8A 4P5TC 3SDXA 8CGTA 1CF8L 4RA0C 4HFWA 2HLFC 5DLML 2R0ZL 3WNMA 1PY9A 4ZODA 4WI4A 1IGIH 5KVFH 2PETA 4WWKA 4MNQA 4XAWH 1MEXH 2JJSA 2AJ3A 1PYWA 1MAMH 4LP4A 3AXLB 1UB5B 2ZJSL 1RJZA 2JCCA 3MV9E 3SE9L 3FB5B 3VMOA 5BS0E 4Q9QL 5HHOB 1G7HB 2DM3A 3MV8E 1OW0C 1U3HB 5CD5C 4K3GA 4HFUL 4MJ6B 3OGCA 1FYTD 3CZFB 2W60B 5E95B 4GMSH 4UIKL 3AM8A 5I2IA 3ZYOA 4O2EA 3TPUE 1ZHBA 4TUKH 1HIML 1QSEE 5JIPA 2VDOL 4M8QA 3DSNA 4TSBH 4U49A 1Z9LA 4KH2A 5DSCB 3U4EB 2PW2A 2IJ0C 4M7JH 2BVOA 1KEMH 2DF3A 2FH8A 5I71B 1JRHL 2J8UB 3MA7B 3CLFL 5FGCE 1GZQA 2W0FB 2D03L 4X5WB 2DQHL 4OGYL 5DJCB 15C8H 4PJ5B 1EMTH 3QAZC 4ODXA 4JFYA 3E6HB 4KK5D 1A7RH 3GIVB 5D7LE 5CJXA 2DBJA 3MZTA 4XPBH 1B0RB 4HZLA 4YDLB 1NC2A 3QNXB 4XPTH 2GJZA 4L9LA 2V5MA 3VFPA 4KTYA 5KTEH 1QYGL 3OG6B 1BEYL 4RGOL 4EXPX 4YXKH 3HRPA 1YEKL 2I9LB 1EK3A 5EORL 5EULV 3VD3A 5J4MA 3TWCL 4NT6A 2BDNH 4C4KO 1NCCH 4RNRA 1OAQL 3VGHA 1OARH 4KTEL 1YC7A 2D7QA 3A67L 4OF5A 4U1KA 4XCFL 3GK8H 1IC4L 4ZFZB 2W9LA 4X99B 4DAGL 3T0XA 5HBBA 1X4XA 2NYYC 4PG9B 3AROA 5ESQB 4FQPA 1UWEH 3WNKA 5ACZB 5IOPA 2XPGA 4QHLB 3VFMA 1FV1A 2QQKL 5ID0A 3WFDH 3FCTA 1SJEA 4QYOA 5IFJA 4DKEH 2AXGB 4XWGH 3RZCD 5ALBH 4KK9C 3HZYA 4PRBA 3FOMA 3SDDD 3ARUA 1FG2A 3BH9A 4QLRA 3FO0L 2PO6B 5IB2B 4DJMA 3UZEA 5T33L 3BIKB 3BGMA 4K7PL 4OF8A 2IALA 1OCWH 2BRQA 1YQ2A 2WBJD 3PWPB 3QDGD 4UTAH 3MRFB 3X3FH 3R8QA 2ITCB 1DQLL 1KIRB 4FFWD 3TFKD 1CLYH 2XZCH 2FD6H 2JK5B 1BJ1H 4DKDC 4WHDA 4D9QD 3O41B 3GUTA 4NHUB 3T3MF 4OF6A 5FGBA 3ZTJH 2Q87A 4XPFL 4LF3B 2P5WE 1XH3B 2E9IA 4JRXA 4K55A 4NWTH 4ZUWB 5E6YA 1XIWD 1N2RB 1OM3H 2DICA 3HC4H 2Q8AH 4YUEH 5C0BE 5DO2D 1RJLA 2VDRH 2VLLB 1IZJA 4M43H 1Q72H 2E9JA 4KRNA 4G7YH 4L29B 2H26A 4PJCF 3RGHA 2ZCLH 1YEGL 1MAJA 4GMTL 3CFEB 3QUXD 4IHOA 4OZIA 1S7QB 1G0YR 3MCKA 2G9HA 3MRPB 1U8PB 4TTGA 5DR5H 3SPVA 4EN3A 4XX1G 4QCIA 5GSRB 2Z91A 4X7SL 3M8OL 5FYKH 5HDBF 2DMCA 4S11A 3TZVB 5EUOF 1MVFA 2OQJB 4Y8AA 2VZTA 3LQAC 1G7PB 1ODAA 3B9AA 4CADB 3DGGB 1A6VH 1JWMB 1LP9F 3EFDL 1NFDE 5ITFA 3KVQA 1U6AL 5L9DH 5LWYH 2VLRE 4LVOB 1WFOA 2WBKA 4NO2A 1EUUA 3FB7B 1WVZA 3PL6A 1ZT4A 1NEZG 1FRGL 3MLTA 4ZOCA 2CDFB 5KW9L 4OM1L 2VXTH 1RUAL 2X42A 4HLZG 4F3FA 5DJAB 5FXCH 1D9KB 3L3JA 2FHFA 3NCMA 1DQML 3CLEL 1AGDB 5MEPB 4D0BB 1AO7D 5K9JH 1QTYT 4IRSA 4JHAH 2P1YA 1FSKC 3VFRB 5IB1A 1FFOB 4FQLL 3BH8B 4P2OB 4I18B 3I75B 4O2FA 4LIQE 3ORJA 5DGRA 1W72L 3W2DH 1U8NA 2EEDA 5ALCH 3U1SL 3LKNA 4P46A 1F97A 3UBXI 3RNQA 4GXUN 2WWKO 4HJ0D 5CJOH 5HYJE 3EDJA 2VH5H 1JN6B 2CD0A 5IVXF 3VWJB 5EPMB 4MAYA 1OTTC 3L3OB 4X8JB 1A7PH 3TH2T 5JPMB 5KAQG 4DEPB 1OHQA 1AXIB 5E2WL 3QR2A 2MFNA 2A73B 3H9HB 3PQYB 4DUXA 3WNLA 5I76A 1MFNA 4FQXD 4Y4HD 4UQ3A 1C08B 1T03L 4JFDE 4PRNB 1A1MA 3WFCL 3HAEA 4HF5H 5GS1C 3RWFB 2H41A 4FQQA 1WAAF 12E8H 4KKCD 3LEVH 1EHNA 2DD8L 3OF6D 4LKXA 3EJZD 4OBRA 2VDLL 1U8QB 3TVMB 2VXUL 4IRZL 4A6YL 2Q3AA 1FNLA 3BPCB 1HHJB 5DHXB 1T7ZA 4G6AC 4GRLB 3UPAA 4AY0A 4AEEA 4Q6IB 3ULSA 1HHKA 1B88A 3EJJX 3KPMB 3QDJB 4GSDH 5C2BH 1MLBA 5FOBB 4YNYB 4BELD 5CZXD 2F53E 5DWUL 3VXOA 4YBLB 5IMKB 1QACA 4JPVH 1I9IH 4RISH 1YJDH 1S7XB 5F7UA 4FS0A 3F8UB 2VLMD 1RZGA 2NW2A 3EOAA 1JHLH 4H25B 2BSRB 3CUPA 4ODUA 3UC0L 3QPXL 4I3RH 4J4PD 4HUVA 5EO0A 3Q0HA 5HHQA 3RGVC 3P77A 5KVEL 4L8SB 4UMGA 4FG6C 5DQJB 4CDGC 1GOGA 2X1XR 1NC4A 3BGFC 5DT1H 4P5KA 2AKRB 2M2DA 1DQQA 2Y36L 3MRQB 4ENED 4MA3B 3QA3B 4AMKH 4MQXD 4KXZI 3OKNB 2MCG1 3V6OE 5IB4B 1A6ZB 3ME0A 3VGGA 5BOPA 3QG7L 3WEXB 3PHQA 5JHDD 3WS3B 1OGTA 1LEKB 2RCSL 1X4YA 1XGYL 4KKAD 4IS6B 2ZOKA 1MFBH 5EU6B 5FA4B 1H8NA 1CK0H 4JVUA 1G7IA 4LU5L 1QFWL 3ARGA 4QF1B 1FNAA 4JANA 3WBDA 4OV5B 2FBJL 5DYOB 3FO9B 5IQ9B 4URTB 2C1PA 5DJ6B 4R0LC 2EXWD 3FQNB 3K3QA 4S10A 4AIOA 4HS3B 5I1IL 2HTKC 4BZ2H 3VWKD 3O2DL 3OAUL 5MERB 2GAZA 2HG5A 3ZT6A 4PJBA 1A2YB 1D5ZA 4QRPB 1A3RH 3JZ7A 5DMYA 1DN0A 1AJ7H 2HP4A 4RGND 4OZGB 5JLZB 2R4SH 1BZ9B 2UWEA 4M48H 2GJ6A 3DYMA 3W11C 3CDCA 4LCCC 4TQEH 3RU8L 1QEWA 1DFBL 4XP1H 3DVGA 3A6BL 2EE3A 5ERWA 3VFUA 4N0FB 3IDJB 2VSDA 1JNNL 3MRRB 4M7KL 4R4FH 4MVBA 4KY1L 3EJYC 1AY1H 3O8XA 3CH1B 3EYOB 3UO1L 2CJUH 3H9SE 2FHCA 2GYSA 1J1OL 1S7UA 3QFJE 3BWAA 2F54E 3VXSE 2VJXA 1IAOA 3OXRB 3IXAA 1JPFA 1AI1H 2PTVA 3S3JA 4UTBL 3WFHB 1YMHA 3NACH 5IEKB 4YQXL 1T7WA 4X80L 3ZDYE 4PUBL 1IQWH 5C8JA 3NH7L 4F9LC 4I2XE 4ONGL 2DDQH 4ZOBA 4HGWA 4UBDD 5D5ME 3O4LA 4S1SH 4EBQL 4JQIL 3GSXA 4F80A 5JMRA 2FEDD 2GK0B 5EIVA 5BMFL 4Z7VB 1FNHA 1SEBB 3IRPX 3RWEA 5J3HD 1PVHA 3EO0A 4P2RD 1A3LL 1PSKL 4PJ7A 4FABH 5A2LH 1WITA 3VE0A 3QISA 3LS4L 2DI9A 4LAJH 4OZFG 1XR8B 3OHXA 4NQEE 4J6RL 5FYKD 1MFEL 2VWEC 4ALAL 2A6IB 4POZD 3QCTH 1Q9WA 4QTHB 4U6XB 3FB8A 3WL9B 4DTGL 3QIWD 2ITDB 1MHHA 1CICD 1QO3A 1RMFH 4YDJA 3AAZA 1X5JA 5F88A 5KVFL 4LSSH 4XAWL 1MEXL 1JF5A 4Z95L 1YUHB 3RDTD 3P3YA 1Y0LA 1ZV5A 2V7HB 3CFKB 3O6FC 4K7FB 3VXTB 5E1AA 4F7EB 3P9MB 4M1DH 4M9OA 3WLBB 4U7KA 2HWZL 3SKJL 4WDIB 4AT6A 1RULH 3WN5C 5K59E 3MLXH 4Q0XH 3LQMA 3LB6C 4GMSL 4U6VH 3DYOA 1VENA 5AG8A 5FM5M 1QLRB 4LHUD 2KQNA 4OQTH 2RFXB 5SWZE 4QGYA 2XOTA 3MJGX 1DE4A 4YFEA 2CK2A 3TP4A 4JFFB 3GMMA 2ARJB 4PJ8C 2DYPA 4Y8DC 3VD7A 4Z0BH 3PHOB 2UZXB 2VE6B 5DZNA 4LDEB 3QUYB 4YHIB 3KDMB 2OR8A 5DJ0B 3RWIB 2PYEA 2DTSA 2FSEB 4V1DD 3GJEA 1WTGT 1MAKA 3P40A 1ZT1A 1G7JA 3V7AG 5CD3B 1AGEA 4HWBH 4KAQL 4M00A 1QD0A 5KTEL 3JBG7 5EN2B 2MNUA 4JPKH 3BDYH 4YXKL 4IOFD 1KTDB 2E7LE 4S0SD 4EDWL 1JYVA 1ORSA 2AEPH 1OL0A 3HCVB 3QNZA 4ZOEA 1C12B 4PJGA 5GJSH 1F3RB 1JJUA 1RIHL 1G6RL 3NMEA 3IDNB 1CIDA 4R97C 4G7VH 3MLUL 4HBQA 3QQ9D 4NO0B 5ISZE 1A1NA 1PX3A 1J1XH 3KPQB 2H45A 4KRLB 2VLJB 3EO9L 3IAPA 5F9WB 5IB5B 1E4XH 3MV9B 4GKZB 4QOKD 2R0WL 4HK0A 5BS0B 3IYLW 4FOMA 4LNVA 4GLRI 4HPYH 3FFCA 5LG1A 4PJDF 5B4MD 1UWEL 4Y16B 5D7JD 1KOAA 4M5YH 4P49A 4PRPA 3HNSL 2NZIA 35C8L 3T0DA 1ACZA 1FZJA 4TRPH 3ARFB 1NFIB 3H9YA 1IFHH 3S88H 2WMPA 2AJVL 4PG2A 3Q3GB 4M8VA 3TPUB 4KK5C 1TVBB 3L7FA 3LN5B 1S5HB 3SDCA 2WSKA 4OZHA 1VGEH 5CIPH 4GS7B 4TSAH 1W8OA 2FECL 4XGZA 1T1ZA 3HLAA 3GNML 1R3KB 3SGJC 5H94B 1HKLH 1I1YA 5JPNB 4JPIB 4GG8B 5LCVL 4RAHA 3X3FL 3TLRA 2EDFA 1CLYL 3EUUA 4MJ5A 5D7LB 4C56B 2QHLA 1DQDL 1I8MB 1QRNA 1ZGLM 3HNVH 2YWZA 1ZHKA 4M5ZH 3QQ3A 4Q2ZA 3IFPA 5IG7A 5I19L 4NWTL 1BREA 1SYVB 4U1LB 1I85A 6CGTA 3QH3B 4QRRA 3BD4A 5C08B 3S96B 3HC4L 4LLWA 3BZFB 5I8CA 2Q8AL 1UM4H 1JGEB 1IEBB 4NHCH 1ZVSA 4PJEB 3TCLB 4Y4KA 1E28A 2JB5L 2WINB 5KG9A 4G7YL 3RZCC 5B3JE 1UVQB 2A9MH 4HXBL 4ELMF 4AIZA 3U4BH 3TNMB 2E8ZA 5DR5L 3SO3B 1S9YB 4ZTPH 1RZKH 4ONHA 5FYKL 3T09A 4DGIL 3SE3A 5HHNA 4KRPC 4PJHF 5EIQA 1J8HE 4WV1A 3CVHA 1LHZA 4U6HA 2WBJC 1ZLUK 5T1MB 2IBZY 5T3ZE 5C7XL 1V7MH 1ED3A 3OBAA 3TFKC 4CU8A 5KSBB 4L3EA 3DURB 4F33A 3GHEH 1A6PA 2VL5A 5E6ID 2NPLX 1XGTB 1MLCA 2WM0A 1LE5A 3RWDB 3ZKND 3ETBF 1CTNA 1KIQA 1AXTH 5FECA 1N6QH 3EZJB 4HUXB 3C2SA 1MVUB 5FB8A 1XIWC 3HPJB 5EA0L 1FLRL 4M4RA 3RTQA 3P30H 3V4VH 4JHAL 3U0WL 2AJSL 5MEQA 5B22A 5IW6B 4DKFL 5DO2C 2A6DB 2CGRH 1LNUB 4NYLA 5IHBA 2DOCA 2R1WA 3WNPA 4G6FB 3O3DB 4XP9H 4RIRB 5D2NB 5L7XH 1UB6A 4K3JH 2YPVH 1EDQA 3QUXC 1NBVH 5HGHA 5JW5A 2VH5L 4P23D 1MCDA 3KPSA 5C0BB 3UTSA 2FZ3B 5HDBE 4NCC2 1N6UA 1KIPB 4YHYB 3FTGB 4ZSOA 5EUOE 4NOBA 3S5LB 4HF5L 4NQCD 5J9PA 3ECBB 3SDXF 3MRJA 3LEVL 5HYEA 5IJKA 1LP9E 4KI5E 3TH3T 1P7QB 2JJWA 2OL3B 3SKOA 4JM2B 4GKNB 3AY4C 4XH2B 4GH7B 1NGWA 1N8ZA 3LD8C 2BVYA 4FP8H 3F5WB 1MFCL 4YR6B 5DC4B 2VDQH 1OOAA 1ZA6A 4D9LL 1WBYB 2OJZL 1ZLVK 3BP6B 2XACC 1YJDL 4WEUD 2RJMA 1A5FH 4WI6A 3WHE1 1JZ3A 1KTRL 1IQDB 4OQTA 2XN9D 4KQ4L 4XVTH 1JHLL 1EVUA 2X4NA 4HJ0C 4G9DA 2R29H 1R0AL 1I7ZB 4I3RL 3JWNC 3I3DA 3EYFA 5E2JA 1HEZB 1HE7A 3KR3L 4I0PB 4YHPB 1MCCA 5BOZG 1HH9A 4RX4D 1UJ3C 3AFLA 3AB0C 5IVXE 1S7SA 3G5YA 5DT1L 3N1MC 5FKAA 1IM9A 1RK1B 4P46C 3S9DB 4ZS7H 1AC6A 4FQXC 2QLVB 4Y4HC 2CLVA 5IBTH 3T0ED 4Y19E 3RNKA 4CN1A 2DBLL 1CDCA 3KJ4C 3QULA 4HIJB 5EU4A 1VEPA 4KKCC 1DBKH 3EJZC 4TVPE 4YDIH 1ACYL 3UPCA 1Z9MA 1T1YA 2A6JA 2VLKA 3W0WB 2WBWB 1NEZA 1B2WH 4CNIB 5DFVD 1PDKA 1ES0A 1MJ8L 2BY1A 3O2VL 5DRWA 4X4ME 4WI7A 2H2PD 5CZXC 3UTPD 3OZ9H 4MWFA 3TV3H 3VXMA 4YHNB 5SWSE 3GMOB 2ATPA 3EDKA 4RCAA 1WT5A 2P5EE 3MBXL 3QZWG 1VFBB 3PWLB 3HPLB 4UB0L 3CFIC 4Z7QF 4GRWH 3LRSB 4KVCH 1A6WH 1NBYA 4J4PC 2DMKA 1F6AA 1I4FB 2NX5E 5EWIH 4OI7A 2C4FU 3L3HA 4I48B 4YHMH 1HN1A 4LLQA 3QI9D 1A3RL 4K3HA 2BMKB 3K8MA 1NMCC 1K3ZA 1EZVX 1ZKAA 2YXFA 1TFHA 3C5JA 3QFDB 4ENEC 1MCOH 5C0AE 1Q0YH 2HFGH 4AYFA 4MQXC 3MLZH 1M6OB 5L2JA 1AIFA 4TQEL 3C2AH 4UDTA 1CFTA 4E9LA 2ORBH 4AEFA 1CFSA 2QADB 3UBXB 5CP3A 2WQRA 4M62H 4GO6B 2GTZA 3K2UH 4KKAC 1AY1L 4U1NB 1QSFB 1JNLL 4LCWE 2CJUL 3GSNB 1KJ2B 4U1GB 5DVOA 3FT3A 2GUOA 3NTCL 5K9OB 3MRBA 4LFHD 4X7DC 1H3TA 1LO4H 4HIHA 4O2CB 5BZWB 4HBCL 5AZ2L 3P11H 2G5BA 2HJKA 4XXDB 5IJVA 1F58H 2NLJB 5K9KB