1N5AA

Crystal structure of the murine class i major histocompatibility complex of h-2db, b2-microglobulin, and a 9-residue immunodominant peptide epitope gp33 derived from lcmv
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
276
structure length
276
Chain Sequence
b'GPHSMRYFETAVSRPGLEEPRYISVGYVDNKEFVRFDSDAENPRYEPRAPWMEQEGPEYWERETQKAKGQEQWFRVSLRNLLGYYNQSAGGSHTLQQMSGCDLGSDWRLLRGYLQFAYEGRDYIALNEDLKTWTAADMAAQITRRKWEQSGAAEHYKAYLEGECVEWLHRYLKNGNATLLRTDSPKAHVTHHPRSKGEVTLRCWALGFYPADITLTWQLNGEELTQDMELVETRPAGDGTFQKWASVVVPLGKEQNYTCRVYHEGLPEPLTLRWEP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords H-2 class I histocompatibility antigen, D-B alpha chain
publication title A Structural Basis for LCMV Immune Evasion. Subversion of H-2D(b) and H-2K(b) Presentation of gp33 Revealed by Comparative Crystal Structure Analyses.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
total genus 65
structure length 276
sequence length 276
chains with identical sequence D, G, J
ec nomenclature
pdb deposition date 2002-11-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00129 MHC_I Class I Histocompatibility antigen, domains alpha 1 and 2
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1n5aA02
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 1n5aA01
5GHWH 1NCCL 1XAUA 4U3HA 1R5IA 4GBXA 3ERYA 4TSCH 2EH8L 3L9RA 4HIHB 1FL5A 3GMRA 1W72L 2YEZA 3EDJA 3ULUE 2QSCH 4KI1A 4Y19B 4HKBB 4U1IA 1QVOA 1ITCA 5DDHA 4XNMB 2X9YA 2F9BT 3LN9A 5GS0D 1EO8H 4HCRL 4MA7L 4S0TD 2DM3A 5FYLE 4KZEH 1XGUA 4XHJC 3HFMH 5FFLA 3UX9B 4JREC 5ISZA 4OZFH 4YDJB 3HB3D 3MMEB 1IILE 2CLZB 3UO1L 5C0GB 1QR1A 2GCYB 3EOAB 1MIEH 4FG6D 3SN6N 2ADJA 4OZIE 3W0WE 1KIRA 1IQDB 4PGDA 4DW2L 1DR9A 2NTSP 3JV6B 4K07A 3HE7C 4E5XB 5IWLC 4UIMA 2OK0H 4P3DA 1B90A 4ZQKB 1G7QA 3PABA 1FFQA 5F7KC 4LVEA 2FEDD 3SCMA 3VWJA 4P48A 3U36B 1AGBB 3U4AA 4MA8H 4JCMA 4MDJA 3PDGA 5JNYB 1I85A 5TGBA 1VGKA 5J4MA 4XBEL 3ZTNL 4LDLB 3IDNB 5I1LA 2ZWLT 1NCBL 4WU7A 2E7MA 2BCKB 5D2NC 5KSVB 3QIUD 3SKUD 2YPLE 1BJ1H 3GK8H 2AJSH 4X6CA 1J87A 1NGWB 4QHNB 2ZUTA 4X4ZA 3I3DA 3G6JA 3QH3A 1YYML 1MLBB 2ZUWA 2QHRH 5E1AB 4JFOB 2Q8AL 4Y4FC 3I02A 3QXDB 5SX5K 2X4NA 2YWZA 1U8PA 4HKXA 1BD2A 1MEXL 1B0WA 2P8PB 1C5DB 2I27N 1N5YL 1FO0L 2G9HA 2GJ6D 1VFAB 3NIGE 3MCG1 3QUZB 5I1AB 1ED3A 1CDHA 3OKMA 2YBRB 4FS0A 5IF0A 3BKJH 1LNUB 5IM7B 3WUWB 5B8CC 4LVNC 2KH2B 3SGKC 4DZ8B 4QF1B 4GW4B 1NDMB 1FYTA 1I3VA 5FUOH 3AREB 4NKMB 3MJ9A 4BFEA 3BGAA 1IGCH 2J88H 3QUXB 4BKLB 2CO6B 4DEPB 4IIQA 5SWZE 4TNVK 5B38B 1SYSB 4PLOB 1T22B 1Z9OA 2O93L 2LAAA 4XP5L 2NZ9C 1DN2A 1XF5A 3C09B 4CU7A 3C08H 1KACB 4HS3B 4K9EL 5LJYH 2GT9B 5DUMH 4ODXB 1XGPB 2X70A 3KPRE 5DZLA 3G6DL 4GRMB 3MLWH 1F4AA 1R3LB 3BP5A 3KJ6L 5I1KL 4S1RL 3U9UB 3RY4A 1HINH 2ZG2A 3ZL4L 3D39E 3O3EA 3OJDB 4X9GA 1HILB 4XPHL 4YE4L 3BWUC 1B0GB 4Y4HC 1ZVSB 5J0BA 1HZHH 5KSBE 2ICWA 1ZSDA 5CHNA 5B22A 4HPOH 4XNUL 1WIPA 5MEPB 3MLSL 3N9GL 5IMMA 1QRND 3TESA 4JFED 5LGJB 4MXWH 5EWIL 1HHKA 3B8SA 4GAYB 4LFHG 1M7IB 4YDVA 3KR3H 2GFBB 3IDJB 1YMMA 4WCYL 3HB3C 1KJ2A 3MODL 4XB7A 5HYJE 3BQUD 1FZOB 3VWKA 5H35B 3IAQA 4UNUA 2EEAA 1D5BA 2B2XL 4XX1G 5IESL 1U3HB 1BFTA 8FABA 2BRQA 2FEDC 3C2AL 1DVFD 1AXSB 4X5XA 5F88A 4L1DA 3V6OE 4R90L 4Z78B 2QSVA 5CMAB 1RJLB 3F58L 3MV7E 2VLJA 4D94A 1CE1H 4L3ED 3VXTA 4R8WH 2A73A 5JOEA 1WZMA 4GKZA 4I3RH 2DKUA 5JIIA 1TVBB 3MQIA 1EGJH 4KK5D 2NY1B 1U8LB 1DTUA 3QIUC 1X5YA 4GRLA 4P2RE 1UGNA 4PJ8B 1NH6A 4RDQG 1SBSH 2NTFA 1YPZF 5E1HB 4N8CH 3IFLL 5DO2C 3DGCR 4TSAL 4GKNA 1HQ4A 2DJ4A 4MQ7A 3X14A 2G60L 4U1LA 4OZGB 4MLSA 4H8WH 2AJ3A 2NXZD 5TQ0L 4TUKH 4LVOB 4WTXA 3RA7L 3MLPA 1CD8A 3JV5A 4DN4L 4H1LA 4UINH 5HPMA 2NNAB 4TSBH 3ULSA 4YDLB 1NANH 4Z7OF 4MDIA 4CVWA 3EFFB 2YK1H 3VD5A 3WLBB 3ARRA 1HQRA 2IPTH 1UM5L 3REVA 4BQ9A 1G7HA 4MVBC 3KPQA 2E9JA 1LO3H 1BF8A 1KIPA 1NBVL 4DAGL 3RHWF 1DN0B 3TNMA 3BP6B 3FO0L 1XGTA 1I1AD 1I1YA 1JZ8A 5SV3A 4XAKD 3F7VA 2O5ZH 3ILQD 4XCFH 1CDYA 5T1LA 4HIEB 5JDJA 4R0LA 3NACL 2E9IA 3G5YA 1KBGL 4I3SH 4ZO7A 5KS9E 4M5YH 2YN3A 3B2UC 3TN0B 3ZYIA 4GMSH 3ARVA 1F8TL 4W6WB 5T3ZH 4AENB 1AH1A 1E4XH 5C0CB 4HXAH 3RY6C 1TITA 3FQXA 5HJ3A 3RWCB 4LOUD 3FQRA 4MMXC 1DBKL 4JN2B 2AXJA 4RSVA 4WI4A 3OBAA 4OLUL 3SKJL 1IVLA 5C0BE 2R0LH 4NBYB 4WGWB 1LILA 5ALBL 3VFUA 4YHYC 4WU5A 5HHMD 3QI9D 2OYPA 5EC1B 4MZ2A 4JKPL 4KI5C 3Q3GA 4WUUE 2BNUB 3R1GH 5JR1H 4GW1A 1HHIB 2IG2H 3BQUC 4XCNB 1EFXB 5GHWL 1G7IB 3MCKA 1LO4H 3HLAA 3V7MA 4TSCL 3WHE0 5E0QA 4PYHA 4R4BA 1BVLB 2QSCL 1IAKA 1F6AA 4IS6A 1TVDA 1KJMB 1QOKA 2FGWL 1SY6A 1T4KA 5SV4A 5B39A 1EO8L 2J8UB 3GIVA 1R5IB 2D4FA 4KZEL 3HFML 3L9RB 1FL5B 3GMRB 5CZKA 3H3PH 2UVFA 1R3HB 2PXYA 1MIEL 4U1IB 1QVOB 3SHSA 2EYSA 4X99A 4ZUWA 3BOVA 1AXTH 2OK0L 1XGUB 4P5KA 4JZJA 3CH1A 4IRSA 5DYOB 1MY5A 1TQBC 3C60B 1KEMH 3PWPD 4K94H 4TTDC 1QR1B 4MA8L 1MCNA 2G5BA 1IL1A 4RMQA 2ADJB 1C5CH 4QO1A 4M1CD 2DS4A 1KIRB 4P3CH 2LU7A 1YZZA 3L5WB 1L8JA 1GGTA 2AQ1A 3DURA 3F12B 4UIMB 4P3DB 1G7QB 3SCMB 1G7JB 1C12A 3MRPA 5CSZA 1G9NC 4MDJB 3M8OH 1K5NA 2DLTA 4WIQA 3GK8L 2AJSL 1VGKB 2NMSA 5I74C 4LLYA 3EAKA 1GOGA 4N0FB 4R3SB 1CT8A 4MAYD 2ZJSH 3HA0A 3MOBH 4HIIB 4WU7B 2MQ3A 2Z31D 1E4KC 2QHRL 3U7AA 5HYSG 3KG5A 1JGLH 1OTTC 2EDTA 1JTTA 1FG9C 1I1AC 4PJAA 1QSED 4LLDB 1GIGH 1WICA 4QOKE 5EBWA 4NHUE 4R2GC 2DQDH 1N3NA 3CLFH 3REWA 1J0IA 3QIBD 3I02B 1BX2A 3BKJL 2X4NB 2EYTA 4NQEE 1R0AH 1BD2B 1DQLH 3RZWA 2G9HB 1IGMH 3V7AG 5FUOL 1DJSA 4XT1C 2X4UA 2YUXA 1IGCL 4EQ3A 1ED3B 4B5EA 2J88L 4KC3B 3SE3C 3RZCD 4KPHH 1CF8H 5IF0B 3BGMB 1IGYA 5T3ZE 5JOFA 1HHGA 4KKBC 3C08L 3SE4C 1U6AH 1HYSC 4P5TD 5DUML 3ZZ1A 4BJLA 2W92A 3MLWL 4ORGB 3DX9A 2FL5A 3GSWA 1HINL 3L6FA 1RJZA 2C3VB 3M07A 3B8YA 1WT5C 3VFGH 4I9WD 4AZ8A 1I8LA 2C7UA 5MHSD 1HZHL 3JTSA 2FLBT 4NRXA 5C08D 5C0ND 2X70B 4HPOL 4HFWB 3WFBL 1IC4H 1C7SA 3BP5B 4NKDA 2N7BA 5KOVC 5HDBF 1J8HB 1TTGA 1EV2E 2COQA 3QQ9C 1F45A 2OQJA 4K3DH 4MXWL 4F3FB 1GGBH 2MCPH 3ZO0A 1BVZA 2HG5B 1JI2A 3KR3L 3WO4C 4U1KB 3OV6A 4KU1A 4Z7UE 1ZSDB 4P57A 2GAZB 4XXCC 3VD4A 3LVEA 1SJHA 1ZLSH 3VH8A 3BPCA 4I2XB 3AM8C 5IP4A 1OP3H 1ZLVH 1KJ2B 1XF3B 3GMQB 3QDJE 2WBJB 2FHBA 3AS2A 3QQNA 1LWRA 3VWKB 3K4AA 4WI7A 3CJJA 4NOBA 5EU6E 4FXKA 4RBPH 3MV9A 4ZSOB 1CE1L 4LEOB 8CGTA 3K8MA 4R8WL 8FABB 4I3RL 5AG9A 1BZ7B 1EGJL 3ZKMD 3QUYA 4JFFE 5D8JH 4MNHA 5F88B 3T3PF 3WE6A 1FG2B 4OV5B 1SBSL 3Q5YA 4PRHA 1T7WA 4N8CL 4LSPH 4PJBA 2R1YA 5KSAA 3U30B 2BY0A 1U8OA 4IHOA 4GKZB 4HUVA 4GRLB 4TUKL 3K7UA 2PTTA 1M7DA 3PP3K 4O9HH 4UINL 4V1DB 1F2XK 4YFEA 1HQ4B 4WFEE 4J3VA 3EKCA 4TSBL 3CZFA 2AJ3B 2YK1L 3ZMRA 1K4CB 4BM7A 4M7ZC 3IDXH 3KWWA 2ZPKH 2IPTL 5CIPH 5E9DD 2GTZA 5CZXC 2XACC 2BNRA 4X7FC 1LO3L 4PJHE 4H8WC 1M05B 2CRMA 5FYJD 3QBTB 1A6WL 2Z9TA 3JVGC 3ULSB 4JKLA 4RAUB 4WV1C 1BQHG 5C0AB 1HQRB 3AY4C 4JFHE 1G7HB 5HGBA 3F5WA 2F5AH 1Q72H 4HX1A 4XCFL 2X44D 5D1XD 3SGEI 1FN4A 4LHUG 4I3SL 2A6IA 2R0ZH 4HZLB 4M5YL 1XGTB 5BVJA 1I1YB 2W91A 1H3PH 4G6MH 4GMSL 5T3ZL 3TH4T 4ONFH 1E4XL 3F7VB 4HXAL 5IVXA 3MLTA 2W60A 3D87B 4QXTA 3G5YB 3L3DA 1Q0XH 3WIFB 4N5EC 3MLUH 2R0LL 3IJSA 4MHHG 5FOBA 1T2QH 3H3KA 1EPFA 3LDBC 3FO2A 3VXSA 2KZ1B 3D2UA 2X4PB 4EN3D 3QYCA 2VLRD 3CDFA 3FQRB 3HNSH 3R1GL 5JR1L 1Z2KA 1U8NA 1NMBH 2WUBH 2XFXA 3VXMA 5IW6A 3OXSA 2IG2L 3VFPB 2QTEA 4YGAB 4M61A 1LO4L 2X4QA 3VFUB 2H1PH 3IS0X 2NX5A 1CFTB 1OAQH 3Q3GB 3GSRB 3VFWA 1S5IH 5EA0H 5I1HH 5C07B 1G7PA 3MCKB 4K7PH 2HJLA 4YDIH 4GG6F 3L1OH 5E6IB 3H3PL 4R4BB 2PN5A 3RUGF 5IIEB 4PGBB 1IAKB 1F6AB 3BZ4A 4IMKA 2ITDB 1T4KB 1WZLA 5DQ9B 5BRZE 5I17A 1KTLB 3HS0B 1AXTL 4MYWB 3AAZA 3T2NH 3ZDZF 2Y72A 1O7VA 2FSEA 4QHMA 1KEML 5I8CA 4K94L 4FQQB 1OTUD 1T5WB 4FFZH 2DMCA 3EBAA 4OZHF 2EYSB 3AMLA 1C5CL 4X99B 4HWZB 4P3CL 5HGDB 2WNGA 2OP4H 1VACB 4P5KB 4JZJB 3CFKA 3ARBD 1A1MB 1AJ7H 2OXHA 1RIHH 4WDIA 5DFVD 4L4VE 3M8OL 3GSUB 1EH9A 2G5BB 2DIBA 1IL1B 1EUTA 2LABA 4WWID 2C4FU 2P5WA 2MWCA 3DURB 2A83A 2ZJSL 4UOJA 3KXFE 3MOBL 1MCWW 3CFEB 1RI8A 3L7EB 1C12B 1JGLL 3BEWA 4QTHA 5LAXA 1K5NB 4JDZA 1W2KT 4NQTA 3JTTB 1KLUA 4LLYB 5LQBH 5IOPB 2EDOA 1A21A 1WCBA 1AKJA 4K3EH 1GIGL 1PEZA 4ZUVA 2DQDL 5D1XC 3CLFL 1ZGLM 4F7CA 4OFYD 4N0CC 3TT1H 1R0AL 3QFDA 4QY8A 3SDAA 3HR5A 1DQLL 3QCTH 1IGML 5EN2B 3QHZH 1D9KA 3KPOB 3QNYA 3MUJA 1N3NB 2APXA 4Y2DD 4KPHL 4WHTA 1CF8L 1Z5LA 2ADFH 2BC4B 2AJXH 1BX2B 2EYTB 3KDMA 4G8GA 4PLJD 1MHHB 5BXFA 2CIKA 1U6AL 1RY7B 2V2WA 2X4UB 3E6HA 5CEZD 5F1KC 5BZDA 2MHAB 1F58H 1IGYB 1YEGH 2XIDA 3FAXA 1HHGB 3TJHA 3S96A 4NQVA 2YSSA 4G3YH 1CWVA 4YBQD 3VFGL 2ARJQ 1MRFH 5HYJB 5A2LH 1KFAH 2V7NA 4D3CH 2ZNWA 1IC4L 5B3JE 3EGSB 1UJ3C 2YA1A 5FGRA 3WNKA 3DNKA 1RHHA 1TTUA 5H37H 5ACMA 3GSWB 3VXOB 4MWFA 4OFKA 4K3DL 2FNBA 1X7QA 5IHZB 2Z92A 1GGBL 2MCPL 1EO7A 1VSCA 3U0PB 5GGVH 4PJEE 4LRIA 1KXTB 2C7UB 4LLUA 3UAJD 4FA8A 4JZOA 4NRXB 4PY8I 5EU4A 3OKLA 3F7YA 4U1HA 3X3FH 2EH7H 5ICZA 2OQJB 5KVEH 2DLGA 4QHLB 5I8OH 1M1SA 1ZLSL 3LN4A 4Q0XH 2CGRH 3PIQB 3B6SA 4O4YH 3RBGA 3TVMC 2BXZA 4P57B 4TQEH 4PDCE 2VLKE 5I1GH 3I84A 4ZTPH 1QNZH 1OSZA 3ARBC 5ESAB 5D8JL 4Z7VF 4O2FA 5AWNH 1EEZB 3T0VA 4V2BA 3ISWA 4LSPL 5TE4H 5C09A 1P7QA 4P2OA 4HPYH 4ZOEA 4W70A 3LN5B 2VAAA 5D1QD 5FCSH 5IBUB 3O6MH 2AXFB 1MAMH 4MNHB 3WE6B 4QRPE 4JM2D 3WFCH 4IMLA 1AY1H 3WLWC 2D03H 4JRYA 3K1KC 4PJBB 2R1YB 4O9HL 3O6KH 5CSBA 1UB5B 2D7QA 1U8OB 4LCIH 2JJVA 4R7NA 3P9LA 3FO9A 2PF6A 3FL7A 5E00B 1UB6A 4JHAH 2E6JA 2FHCA 5EORH 1HI6B 2BVTA 4HUVB 5KVMC 1OWRM 4ONHA 4IEFB 4KFZC 3IDXL 5JMOC 2ZPKL 2PTTB 1ZHKA 2Q3AA 1M7DB 3EYSH 1OAZH 1A1OA 4MJ6B 2MKWA 1DCLA 3N1FC 5ECJE 5GIRB 1MRCH 2ADIA 4Y2DC 1QFOA 3S36X 3KWWB 2JTDA 3E6FB 4JQVC 1AR1D 2F5AL 2WQ8A 1O5DT 2BNRB 1NCWH 1FJ1B 4ZDHA 1S7SB 4LQ1A 4JFDA 2R0ZL 5EO9A 4O00A 1H3PL 4G6ML 1ZT7A 1D6EA 4ONFL 3F5WB 2IANA 3S4SA 3FZUD 4PB9H 5JHDA 4YBQC 4NZUH 2QADC 3ET9F 3HAEG 5SWSE 1TCMA 1Q0XL 5GS0H 4G9FD 3MLUL 1PQZB 5AZ2H 3QDGE 4FQCH 4DCQA 2F53A 5HBBA 1T2QL 3STBA 1JGEA 4HHAB 3L3KA 4YQXH 5D7SH 1F4WH 2J3SA 2RCSH 5IVXB 3MLTB 2R1WB 5EFIA 1S9KC 3ZYOA 3UDWA 1KCVH 5DEGB 4RRPA 1F11B 4OI7A 4QXTB 3LB6C 3HNSL 3VE0B 4Z76B 3U0WH 3EO9H 1NMBL 2WUBL 1WAAA 3MUY1 3IJSB 1MCOH 1S8DA 5FOBB 2V17H 4F7MA 3FO2B 5BO1H 2HT3D 1E27B 5JIHA 2H1PL 3D2UB 4NFDA 4X6DE 2VZSA 1PLGH 3PXJA 1OAQL 1S5IL 5EA0L 5I1HL 2GSGB 5L2KE 5ANME 2F8OA 2XFXB 4J4PD 5GSRA 4P4KA 3OXSB 4OCLC 2BK8A 2HP4A 4K7PL 1RZGA 2AKRA 4M61B 4YDIL 4EVNA 5IFJB 1LO5A 4LNRA 3L1OL 2AK4D 1FNGA 2DIJA 5I8KH 3B9KD 2FECI 3H9HA 5D2LA 1RZ7H 2ZUUA 5C0RH 2Y36H 4MXVE 3EIFA 5D2NE 3IVKB 4YHIB 3RDTB 1G7PB 1ZGLA 2HJLB 1A9EA 3HG1B 1FAKT 5CBAA 3T2NL 2Y4SA 2P47B 4NKOA 4I0PD 2BERA 1NC4D 3C6LA 5D1QC 3BZ4B 4FFZL 5BJTA 1TVHB 1QSFD 2VLMD 3GEWB 3RL1B 4OZGF 2EO1A 5I17B 4XRCB 5DTFA 3UTZA 3EO1A 2OP4L 4PTUA 4RNRA 2FSEB 1AJ7L 3C5ZD 4QHMB 1RIHL 4GAGH 3O6FD 1MHCA 5D1ZA 3RPIA 4NC0B 5EZJA 4IJ3C 1S5HA 3D3VE 2HFEA 4YHZH 5J12B 3P4NA 3RGVD 3DUSB 4Y5YC 3V4VH 2JB5H 3ARQA 3SDXE 2APVA 4WDIB 3GNMH 3VMPA 2AV7B 5LQBL 12E8H 2P5WB 3GZKA 4K3EL 2Y5TA 2A83B 4IOSD 4OD2A 5ABDE 3LKSB 3VXPA 3I3EA 2EXYD 1NCAH 1MCEA 4M6AA 3BEWB 3ES6A 3TT1L 3Q48A 4LLMA 3E8UH 1FFOA 1KLUB 1MFCH 3QCTL 1WCBB 1RZIA 4PJFE 3LH2H 4ZUVB 3QHZL 5F7HA 4UQ3B 4OF7A 1IARB 4F7CB 4PFEA 4UMGA 2ADFL 1MHEB 1UC6A 2CUIA 3IXAA 5L8LB 2AJXL 3TJEH 5LGKA 3SDAB 2AV1A 3HR5B 4BH7A 3HUJE 4LGRB 4KKAD 3RKDC 2SEBB 1V3KA 3V5HA 4X5LA 2FYYB 3C8KA 4LARH 3QNYB 3WS6A 4FQIH 1T83C 1A6ZB 5D96C 4WHTB 1Z5LB 3DUHA 1F58L 1YEGL 5CJOH 1C16B 4ELMB 3F8UB 2IAMD 3TBWA 3OX8A 3ZYJA 2CDGB 5BXFB 4G3YL 2VUYA 3SDDD 5F9OH 1MRFL 3E6HB 1KFAL 1X5JA 4Y1AA 1RHFA 4D3CL 5BZDB 4KJYA 2BHZA 1JRHL 2J8HA 5D7JA 2NY6C 5GGTA 1HIMH 3BSZH 4JFPA 5HSFA 4TVPD 3UBXB 4RMUA 5EC2B 5GGVL 3G5VA 1NGZA 4ODHH 3QDJB 5FYKD 1FNSH 1QFWI 1NEZA 1OHQA 4S1DC 2V7NB 1AO7B 4X6FA 3BH8B 3QZWG 1UZ6E 1RHHB 3X3FL 4G5ZH 2EH7L 4MWFB 4ONGH 4KTEH 2R15A 5KVEL 5I8OL 4ENED 4Q0XL 2A6KB 4L8BA 2CGRL 4HAFA 1A6TA 2NLJB 4LLUB 4GRWE 4JZOB 3CFDA 4O4YL 4XVUD 3FQWA 5EU4B 2Y1VA 4TQEL 3ARGD 5J11C 2V2TA 5I1GL 4PJ5B 4ZTPL 5ICZB 1QNZL 4AEIH 3LN4B 3C5ZC 1U36A 1S9YB 4X7TA 1LK3L 4NO3B 3SGDH 1WVZA 2HWZH 1E0OB 5AWNL 1HXYA 1ZHBB 4LBEA 4ZFOL 4F57H 2GJ6E 2IH1A 1G9MC 5TE4L 3QDMA 4HPYL 2BVYA 1H15A 1Z6JT 3ZKQD 1OSZB 1U93A 1DFBH 3O6ML 1MAML 3VFOA 4H1LG 4U3XA 3WFCL 4HJGA 1RK0B 1AY1L 1BQUA 2D03L 2QJDA 1CFQB 1KGCD 5F7DB 2NZIA 4AH2A 3FQNA 2VMFA 3O6KL 2KUTA 5C09B 4LCIL 1MCLA 2O5YH 5CKGA 3WEXA 3A6OA 4X6CF 4JHAL 5EORL 2EXYC 1PDKA 2JCCF 2LAGB 4PIRF 4PGZA 1NFDA 2YKLH 2VDKH 2HT2D 4ODWA 1CBVH 3WN5C 3G6JF 5D5MA 1BJMA 5TPWH 2VO5A 4JRYB 3MRMB 1I7RA 4ETYA 3T8XA 3EYSL 4J3OC 5I19H 5J6GB 1OAZL 4R7NB 4NOFA 4DGYL 4LNVA 1Q94B 5CJXC 1MRCL 4ZG1A 3ARSA 3R0NA 3GMNA 3QA3B 1JYXA 4PV9A 1ZHKB 3TO4B 2FO4A 4S2SA 3ZE2E 1NCWL 4KKAC 2V2XA 1AD9B 1A1OB 1QRNE 1T21A 4OBRA 5GS1C 4P9HC 4QRTA 3QEGH 3U83A 1MAJA 4KI5E 3EJYD 4Y5XA 4PB9L 3SDDC 4NZUL 2CXGA 3EZ8A 1W72A 4ZDHB 1NPUA 4LLQA 1J05A 5DLMH 5GS0L 5AZ2L 4FQCL 3H9SD 1FGVH 3IDMA 1D6EB 2AEWA 4HCRA 5D7SL 4YQXL 1F4WL 2RCSL 3S4SB 2GTWA 5JPNA 3CPLA 2H2PC 3TZVA 5JHDB 1KCVL 5IEHA 3QUZD 3LV3B 2UVEA 1T7VA 3H7BA 3S37X 3U0WL 3EO9L 4NYLA 3BPLC 3NIFF 3MNWA 1MCOL 3SKMA 1S7VA 4Z77B 4L3EE 2F53B 2V17L 4HEPG 2K3TA 3WFEH 5BO1L 2E6PA 1A9BA 1RJYB 3EOTH 1PLGL 3ARED 2Q6WA 1GOHA 5B39G 1IZJA 2BRRH 3U6RA 3QUXD 1EJ6A 3TYGH 4XWOD 4XVSH 2UUDH 1S8DB 5E99H 4LASH 4GLRH 3QQ3A 3LRGA 4RZCA 4KKLC 5DJ2B 5I8KL 1HHJB 1RZ7L 4I18B 5C0RL 2KDGA 2EZ0D 3ME0A 3QXUA 2Y36L 2P5EA 1MCHA 3AB0C 3WS3A 4XNXH 4X5WA 5A2KH 1RZGB 1IGTA 5C6WH 4EVNB 4LNRB 4IRJA 4PJDE 1CS6A 2VDLL 5E24E 3RI5F 4MS8D 2V9QA 2Z4QA 4HMEA 2EDQA 2P8LA 3O0RH 2CUHA 1ZGLB 4I5BA 5F1IB 1QD0A 1A9EB 4K71B 4MCYB 1FO0A 4D9QD 4NKOB 2V9RA 5BCAA 4GAGL 3DTXA 2BSRA 5E2UH 4ZFZB 3QWRA 2HFFA 2IBBA 3C6LB 5BJTB 5ACLA 3CSPA 4YHZL 1JTPA 2W65A 5DTFB 1JNHA 3UTZB 3V4VL 5EU7E 1ACZA 3V8OA 1U3HD 2JB5L 4RNRB 1CN4A 5E94B 1UZ8A 4CN6A 2R2CA 2YHGA 3GNML 1CIUA 3H9ZA 3RPIB 5C8JB 1S5HB 4WFFD 1M4KA 3MNZA 3MYJA 4AL8H 4POZD 3DHMA 12E8L 4BFIA 3EYOA 5IR1A 1KTRL 2ARJA 3VJ6A 2EYRB 1K4DB 1NCAL 2NY1D 2D7NA 4PJ8D 4CVXB 5DFTA 2OI9C 5HHME 2IH3A 3E8UL 3MX0A 1MFCL 4HSQA 4H0IA 2Y5TB 4PY7A 3EJYC 3BN9C 3LH2L 4OD2B 1IGIH 3QJFB 1ZOXA 3IDYB 4JVUA 2GITA 1BBJA 3HE6A 3VA2C 3ES6B 1WFNA 3TJEL 3EW3B 4S10A 5JW4M 2Q7NA 2YZ8A 1G6RH 2DM2A 4PJGB 3SGDI 4W81A 4LARL 3BGFB 1TNNA 4P4RB 4FQIL 4NZDA 5CJOL 4JJ5A 4NNXB 3GMLA 2AV1B 5D93B 1J1PH 5F9OL 5FIEA 2XPGA 3W11C 2NY3B 5GISH 5KVDH 5JXEA 4XWOC 3STLA 3W0WA 3PWPE 1HIML 3BSZL 3OX8B 5TDPA 3VFMA 4PBWD 4ODHL 4U0QB 1FNSL 2ATPA 3A0OA 4NPYA 2QKIB 3L3HB 4HBCH 4IDJH 2IQ9H 4KJYB 3VH8G 3TN0D 2JIXA 4G5ZL 5D7JB 4OGZA 2H32B 4ONGL 4FTVB 4KTEL 3OWEA 4KAQH 5C0CD 4NRZB 3DETC 3EOBA 3T1FA 4XXDA 5SX4H 4KUZH 3VD9A 3G5VB 1NGZB 4ISVA 3RKPA 1NGPH 3T77A 3MRKA 4U1GC 3QIWA 4MS8C 1T1WB 1NBQA 4WO4C 3NPSB 5JORA 1MCPH 4AEIL 1LEGA 4FQJH 4ZOBA 1NCUA 4L8BB 3W39A 4YHMH 3WDHA 2Z8WC 5A3ID 4AYFA 5FM5O 3FQWB 1N26A 3P4MA 3PV6B 1QSEE 1WK0A 4F57L 4KVNH 2V2TB 1VKXA 3MJ7B 1O7SA 2QV2A 3I2CH 5MERA 1UWXK 5FYJH 4OGXH 5EULV 3UTSA 3IU3A 1DFBL 2XY2A 3ARZA 4PP8C 4X7TB 4QWWD 1EHXA 4P9MH 4D0BA 4LBEB 2VJXA 1BREA 2E6QA 4XTRD 2IH1B 3NTCL 1XF1A 2ZZUT 4HH8A 1MCDA 3QDMB 1H15B 5EUOF 2O5YL 4NKQB 4FZ8H 2FEEI 1U93B 4X83A 2I9LA 2YKLL 2VDKL 3U2SA 4PJ8C 1DSFH 2PO6C 5K93A 1M71A 2A6DA 1CBVL 5TPWL 1JYNA 2K9UA 4GOSA 2OMNA 4AH2B 1L0QA 3FQNB 3H0TA 5I19L 1T0MA 1UH3A 1MI5D 1U8MB 1TENA 3C60D 2YXMA 3GI9H 4PJAF 5HI5D 1QFHA 4U6HA 3BP7B 5F9JB 2Q3ZA 1CCZA 1GHFH 4MGXA 3VRIB 2G5RA 5FOJA 5D5MB 3RVWD 3KPRA 1D5IH 3DV6A 3PV7A 3VFRA 4I9WE 3KHQA 5MHSE 1I7RB 5EH1A 4AEHH 1BFOB 3T8XB 3IFPB 1JZ5A 1IKNC 3SCMD 4QRQA 4O58H 3DX7A 3JUYA 3I75B 4YDLC 4LDEB 1OB1A 3BUTA 3T65A 1TPXB 5CJ5A 2VLLB 3GMNB 4PV9B 3QEGL 1VENA 2AP2A 3KNBA 1EHNA 3T3ME 2FO4B 4OFVA 3T2PA 4QKXB 1AGEA 2RGSA 1X6NA 25C8H 4JREB 1T21B 4L4TA 2BDNH 5DLML 1F6LL 1GGCH 2ORBH 2PTUA 4QRTB 1D7FA 1FGVL 3AXLB 5IW1A 4JRXA 4DQOH 3OAZH 3CVHH 3LKQB 3VGHA 4OZFA 4WNQB 1W72B 4OI9A 1I8KA 2WLZA 4Z7WA 4P23A 3MO1B 5JOPD 2E9WA 3DHJA 4LIQE 3LKOA 4GQPH 2CKBL 4N8VB 3WFEL 3PQYE 2PR4H 2X09A 3EYFA 2Y9RT 2GTWB 4ZAKA 3EOTL 3MV7A 3CPLB 3TZVB 4KK6C 3H7BB 2BRRL 1DQMH 2OR9H 1J9CT 1QLRA 5D2NB 4EKXA 4O2EA 3TYGL 1X5ZA 3MNWB 4P2RA 4XVSL 2VISA 3SKMB 1X4ZA 1Z0NA 5E99L 1RIVH 4LASL 2W0PA 1A9BB 4M8QA 2JJSA 3QQ4A 4D0CA 3TGXA 1YDPB 3PDOA 4XNXL 4Y4FB 3BFOA 1X5HA 5I9QC 2D2OA 4RZCB 3QQ3B 1II4E 1JHTA 4ZS6C 1BP3B 4D9LH 1T1YA 4NM8H 2ZUXA 2W9EH 4QWWC 1TNMA 5DQDH 5E9DE 1WFOA 3WS3B 3JTCA 5GGSA 1J8HD 3O0RL 4X5WB 1U8HA 5JTWA 5FYJE 3FT2A 4GBXC 4TTGA 1K2DA 2GK2A 5B8CB 1WLHA 4LVNB 5E2UL 2KBGA 5DRNA 3CDCA 2Z4QB 4J3TA 2AI0H 3PHQA 2P8LB 5EBGA 4WTZA 3S5LA 3MBEA 3BUYA 1PBYA 1FO0B 1LDPH 4U2YA 3DTXB 2BSRB 3VGFA 2X4TA 5FUCC 2WBJD 4AL8L 2I25N 3VWKD 3O3BA 5FGBA 4XAWH 3VMNA 4OIAA 2W65B 3RVWC 1JNHB 4LPTA 5F21B 1K3IA 3QJHB 4TULH 3MRRA 1F2QA 3VWJC 3SCMC 3ZE0E 5CEZH 5INDB 3ARUA 3BEVB 2ICWI 5D9SA 3WHXA 4Y4HB 1PFCA 3MNZB 3MYJB 1I85C 1OP5K 3FFDB 1RZKC 5A2JH 1RFDH 2RIKA 5C0BA 1MHPH 1NAKH 4BFIB 5IR1B 4QRRA 4YHNB 1IGIL 3VJ6B 1C8PA 4G7VH 5GXBB 3OAYK 4GRLD 3DIFA 3SE9H 4OCMC 1R6VA 1XZ0A 4WI9A 3BHBA 3OKNA 4OUOA 4FFYH 5F7LB 4V1DD 4LEXH 1G6RL 3Q5OA 5K9JH 2I5YH 1MIMH 3CC5A 2FD6H 3KYNA 4YXKH 5BQ7A 1BBJB 4XP6H 5IVXF 4XZUA 3FB7B 4GXVH 2QL1A 3S36H 1IBGH 3JV0A 1R3KA 3IGAA 1J1PL 3D5OF 2EDLA 3OPZH 4MXQD 5E08H 1VERA 3RIFF 2IPUG 5GISL 5KVDL 5C0AD 2Z8VC 4JJ5B 3BD3A 3ARYA 4LCWB 5C71A 3GMLB 4CN4A 1IAMA 1TZGH 5JPMA 4KV5F 2XPGB 4X7SH 4CADA 1JGDB 5EU5A 4HBCL 1EGJA 1XGRA 3QO1A 2ZUSA 4IDJL 2IQ9L 4IIQC 1WBZA 3TO2A 1F42A 4KAQL 1GZQA 5TDPB 1MCKA 3DBXB 3P73A 4KUZL 2B8OT 4UBDD 4U7MA 5FHAH 4JPVL 3AU1B 3VFNA 4E41D 1NGPL 4NPYB 5JW4N 2EICA 4HLJA 1DUYA 4DJMA 2JIXB 4HIXH 2FIRT 2DRUA 2OJEB 3HC0A 3ULUD 5HHOE 1MCPL 1JZ7A 3ARTA 3EOBB 4FQJL 3ECBB 4YHML 4ISVB 4CDHA 1B6DA 1FIGH 3LKRA 3T77B 5K59E 1XF2B 3MRKB 4UB0H 5FHBH 4KVNL 1MELA 3TV3H 4Z0XB 5BV7H 3I2CL 3CK0H 4G6AC 4PJ7F 1JMXA 3D6GA 5FYJL 3RAJH 4OGXL 1JFMA 1F3DH 3W39B 5IJVB 4WUKH 4KK8C 4KKNA 4PJCE 5C07D 3O8XD 1I1CA 4P9ML 1ZLWK 3P4MB 1WCQA 3VWKC 3TBSB 4N5EA 4NQEA 5BS0B 2P42B 3WMSA 1B4JH 3KPTA 5E6ID 3HMWH 5FDYA 3CH8A 4FZ8L 4WFGE 3IU3B 1MREH 3MZTA 1DSFL 4D0BB 1CD1A 4J3SA 5LXGH 1WF5A 3SDCD 1A7NH 1NMCB 1NAMB 2UYLA 3GI9L 4OFIA 3RWIA 1O0VA 3TIEA 1Y18A 1ORSB 4GRLC 1GHFL 3U2SB 1X5IA 1Q9OA 5GGRA 4ALAH 3JWDH 4Y4KD 1D5IL 1N6QH 2EC9T 4HWBH 4GUPA 4AEHL 4JPWH 1T0MB 4IOIA 1QBLH 1IM9D 4O58L 4U6HB 2YZ1A 3VRJA 3O45A 3OKEA 3H7LA 3MGOA 5EIIB 1HKFA 2YD5A 5IB3A 3QFJA 2R8SH 1T66D 1ZGLP 1NCNA 2VL5A 1UWEH 3MR9B 3B43A 3EZJB 4K2UH 25C8L 3UJTH 4PLKD 2BDNL 1OB1B 1GGCL 3D9AL 2ORBL 4LCUA 3D0VA 3T65B 4BK4A 5MEOB 2FDBP 4RRPG 2E9BA 1K8DA 2WP3O 4DQOL 3CVHL 4XI5C 4G43B 1AGEB 3W5MA 4K23L 1I9EA 1J0HA 4X6BA 4L4TB 2Y7QA 5AD0B 1T5XA 1Q38A 1WGOA 3V4PH 4QNPE 2GY5A 4J1UA 4YPGA 5IW1B 1LVEA 4JRXB 5DVOA 2PR4L 3O3AA 4YBLC 1P69B 5HY9A 4R0LC 1OM3H 2UWEE 4OZFB 3JUZA 4UBDC 3GJFH 3DX8A 4UOW1 1DQML 1I8KB 2OR9L 3I6GB 2E5EA 5DRZB 4Z7WB 4D8PA 2VYRE 2OL3H 2X1OA 4HUNB 3KVQA 1D5ZA 1RIVL 5HDBE 4BQ6A 5A16B 2X2YA 1UYWH 1I7ZA 3EJZC 4ZAKB 1CZ8L 5I1DA 5A43C 1OOAA 3CSBA 3FFCB 3HZVA 3B3IA 3OF6A 4OKVA 5DHXB 1QLRB 2XZZA 1RVFH 3VI3F 1YPZA 4ZXBA 1TQCC 3MFGB 4LP4A 4YAQA 3NCMA 3FOLA 4M8QB 5J3HD 5HYJD 1X4XA 4NFBA 1HE7A 4D9LL 1NLDH 2OR8A 4NM8L 2W9EL 2XKSA 4R2GB 5DQDL 5MI0B 3WJLA 1U2HA 3D69A 3UP1A 3PDOB 2BNQE 4I8DA 1CYGA 3WD5H 4HUXA 1OAYH 4H20H 3PG2A 2MFNA 3SO3B 4NC1C 2P24A 1EBAA 1JHTB 4F37F 3BW9A 5HVFB 5FKAB 1MCQA 4PJHA 1OAUH 3E0GA 2R9HD 3PWVA 1SEBA 1GC1H 4KJPD 5EO0A 3SKOB 1K85A 2AI0L 4MLIA 3QISA 2DBLH 5GGSB 4GMTH 5BVPH 4B7IA 3HPJA 1I8MA 4HUUB 1K2DB 1LDPL 5I75B 4N68A 3MBXH 3DROB 2PXYC 3G04A 3PHQB 4ZFFB 2YS4A 1HKLH 4XAWL 2F54E 2FJFA 5EZOH 2KL6A 1ORQA 3DWTA 3S5LB 4LPWA 3ARPA 3MBEB 3DUUB 4O2CA 4U6YA 4JZJC 4IRSC 1CK0H 2VQTA 5CEZL 5T5NG 1CVRA 1REIA 5F7EH 3FB6B 1N8ZA 4JG1H 4BH8B 2X4TB 3F7QA 3B9DA 2BOBA 2W07A 1WWCA 1B3JA 1RFDL 2ADGA 1MHPL 1NAKL 2B4CH 4G7VL 1CGTA 3GM0A 2PYFA 2FRGP 1HXMA 3SE9L 3CFBB 3DRQA 5DHYA 1RZJC 5D9SB 3WHXB 3VXRA 3IKCA 1MCSA 2D9QB 4FFYL 2RB8A 4TVPH 2UZIH 4Y8AA 3CLEH 3RWDB 4LEXL 5FYKH 4X8JB 5K9JL 4NO0A 2I5YL 4NQDB 1MIML 2FD6L 4O5LH 4YXKL 4CDGC 5IFHH 4DOHB 4XP6L 3DIFB 4RMSA 5GRJH 1FL6A 2OS7A 4GXVL 4G42B 3S36L 1CDJA 4ZUUB 1IBGL 2AK4E 1NC2B 4L9DA 1HSBA 4DKEH 5D7IE 4NRYA 1WBXA 1LP9B 3OPZL 4PJIF 5B3NA 3KPNB 1ULVA 1C7TA 5E08L 5BQ7B 3BESR 4XZUB 2PW2A 5DGRA 1BVKA 5DMKA 1T0NB 2CLVA 4PPTA 43C9A 2HMIC 1TMCA 4BZYA 1EMTH 5BRZA 1TZGL 2VLME 4X7SL 3UZVB 2A1WH 3DGGA 2FBJH 2O61A 2ITCB 2X5PA 3EHBD 4PRBA 2X6MA 2ZCHH 4F58H 3P4OA 2BVQB 3QSKB 3N0PB 4JCLA 5ICYA 2GK0A 5FHAL 4JVPA 2IALB 4PY8J 5EU5B 5IKCA 5E8EA 1SVCP 3NFSH 1XGRB 3NIDE 3QO1B 5E95B 3S37H 1JWSA 4HV8B 5GS3A 1U8KB 1JPSH 1FC2D 4HIXL 1WBZB 5D2LF 3MSPA 1JFQH 1U42A 1AGFA 2XA3A 4M7ZB 1F00I 2UZXB 2DM4A 1NGYA 3QWQB 1NFIA 3P73B 1QBMH 1I8LC 3NA9H 1FIGL 1NUDA 3VFNB 3RUGE 4EDXB 4UB0L 5FHBL 4Y5VA 4WJ5A 2JE8A 2BVOA 2R9HC 3F6LA 1OLZA 3IF1A 4I77H 1WC7A 1KPRB 4NWTH 1PZUB 3SBWA 1F4HA 2CJUH 3WO3B 1CICA 3TV3L 3DXAE 4HKZA 5CIPA 5BV7L 4NQXB 3CK0L 3D2UD 3RAJL 1JZ2A 1EK3A 3ZDZE 4AMKH 3OR6A 4WUKL 2YD8A 1UG9A 3LKRB 3CU1A 1U8IA 3BO8A 2AXGA 1IT9H 4OZHE 1DQJA 5F3BA 2HJKB 3FMGH 1QFPA 3MUZ1 5EIVA 1B4JL 4NWUH 3HMWL 4EQ2A 1C1EH 2I07B 2R56H 1MREL 1MCCA 1NGXA 4FQXA 1TZIB 3QXTA 4OIIH 3U4EA 5CEXA 3RDTD 2CDEA 3HG1D 1WFUA 5L7XH 5LXGL 2KPNA 4YZFE 4KHXH 1A7NL 3LDBB 2QQQA 4X8XA 3QUYC 2RHEA 4ALAL 3QPQC 3JWDL 4M03A 1N6QL 4HWBL 5KSAC 4JPWL 1LEKA 1QBLL 2UYLB 1QRKA 3HNVH 1T04B 3QCVH 5DEFA 5T5NF 3RWIB 2C3GA 3P9MA 3TIEB 1Y18B 2PETA 4X4MA 3VG0H 1Q9OB 5GGRB 2FJHA 4TVPE 3QR2A 4JO1H 5E03A 5IUSA 5JHLH 1QTYT 4JO2H 2R8SL 4GUPB 5FYKE 4NP4H 1KIQA 3O4LA 1CDCA 2H9GA 1UWEL 2YUWA 5E2WH 5JO5B 3MLZH 4KVCH 3RWFA 4K2UL 3UJTL 2B7DT 4PJEA 2APWA 3VRJB 5T33H 4Q9BA 5CUSH 5DJDA 4K8RD 4W68A 3D0LA 3PQYB 3QEUA 5IB3B 3QFJB 3EDKA 5D7KD 2OSLA 2P1YA 4I0CC 3X12A 1XFPA 2WIIA 5CCKH 5BZWA 1YN6A 1PKQE 2NY4B 5EOTA 5FA3B 4GKOA 4YHPA 3V4PL 5E4EB 4LCUB 3D0VB 5HD8D 2QQLH 5DRXB 1K8DB 3OGOE 1F90H 4JM4H 4ZNEA 1S7TA 1OM3L 4ZPTA 5HVWA 3N1PC 3MRBB 2Y7QB 1T5XB 2OL3L 1XIWA 3HHRB 3LQMA 4DGVH 1PY4A 4MA3A 4J1UB 3GB7A 1A4KA 3SJVB 3SDAD 2NY7H 1YJDC 2CR6A 4CU8A 3ZE1E 4Y19E 1UYWL 4RGNB 4KJQC 3D25A 5CD5D 3O3AB 5IVOA 4OF5A 5HY9B 4L8SA 4J2XA 1KTDB 4XCEA 3U9PH 1RVFL 1KYOJ 3BMVA 5EUKA 2VABA 5FO9A 2X41A 1CFNA 3ZKNC 6FABH 6CGTA 3QULA 2L7UA 3ULVF 2VB5A 3BRFA 5HGAA 1NLDL 2J4WH 3B3IB 4OKVB 3MRFA 1XR8A 3RNQB 3MRHB 3E1F1 3FOMA 1DQQA 1YPZB 1S7RB 1ONQA 2IWGA 4ZXBB 4NQCA 3VGDA 3WD5L 4LQFH 1TJIH 4YAQB 1OAYL 4LKXA 1FBIH 4H20L 4KK9C 5EU3A 2YD6A 5D70H 3QDJD 3KPSA 4PP1D 3FN3A 1DE4B 5IROA 1OAUL 1AO7D 1YEEH 1QP1A 5EU6D 4Z7VE 3DYPA 3GBLA 4UNTA 2DBLL 4GMTL 5BVPL 4X9FA 4JDVA 4JFFD 3J8F7 5HYSA 3RVXD 4MNGB 5IMOB 1LEIA 4K55A 3MBXL 1FVCB 2X1QA 3BW9B 4OT1H 1F3JB 1N2RA 4IMKC 2YUVA 3T2OA 1I1RA 2AJUH 1HKLL 4PJ5D 1Z0MA 2CLRA 4KRPD 5EZOL 2C1PA 1S7WA 1I8MB 1NFDF 3TIDA 4U6XA 2A74A 1TTFA 1CK0L 3RVTC 1IM3B 3BZFA 3SY0A 4NCDA 5F7EL 1GC1C 1X3DA 4JG1L 1R5VA 1KCLA 2XG5A 4ZD3H 3TNNA 3MV8B 4PJXA 5FGCB 5J12C 3G04B 3KPMA 4WFED 2FJFB 1IEHA 1IEBA 4Z0BH 3QDGA 1ORQB 2WV3A 4Q7DA 4QT5A 2CMRH 4O2CB 1JN6A 2B4CL 3ELAT 3G5ZB 4GKSB 5T3XD 3O41B 4PRPB 5DK0B 3OB8A 1AHWA 1N8ZB 4OQTH 2XNAA 1AE6H 4TVPL 2UZIL 2XN9A 1CD0A 3CLEL 1U91A 5HHNB 3GFUA 5DS8A 5FYKL 1LK2A 3UPCA 2ZG3A 3RNKA 2PYEA 4O5LL 5IFHL 4MB3A 1HXMB 3DRQB 5DHYB 5GRJL 3VXRB 4MNQA 5C1MB 3BISA 3TVMB 1SJEA 1N5AA 4UI2A 4DKEL 4JFXA 4CJ1A 3ZYZA 2CIIA 4QLRA 2M1KA 2ZP0T 1EVTC 1FL6B 1KCUH 1G7MA 2FX9H 3O4OB 3PL6A 3SDAC 3TO4D 1MH5A 1S78D 1G84A 2C5DC 1EMTL 3HZYB 4UQ2B 4QRSA 1WBXB 1RULH 5ACZA 4LSTH 2A1WL 1KELH 2FH8A 1D9KC 2FBJL 3MA7A 1QO3A 5CINH 3FO1B 2PW2B 2ZCHL 1BVKB 4F58L 3IJYA 4ZFOA 5HHOB 4D9QE 1W8OA 3K8LA 5C0EA 2B0SH 4FNLH 5E2JA 1TMCB 1QSZA 2Y25A 4CKVX 5CEYA 4RFNB 1N64H 4YGVA 3T2QA 3NFSL 3S37L 4PRBB 2ZUYA 3KLHC 2EECA 4UV4H 1MFBH 1JPSL 4A2LA 1ETZA 4NN5B 1JFQL 4HC1H 5J1AA 3TJHC 4XGZA 5H8DA 5ICYB 3U1SH 5JHDD 1QBML 3FONA 2QR0B 2VN4A 2DJSA 3NA9L 5E7BA 3W9EA 5IKCB 5E8EB 3NA4A 4NWTL 4I77L 4NUJA 2F53D 2EDXA 2CJUL 1AGFB 5DMGD 4MQXD 1NFIB 4AMKL 2DQEH 4LRIC 3AVEA 3PJSA 4OB5H 4R96A 1IT9L 4Y5VB 3ABZA 1N0XH 4WJ5B 2BVOB 3IF1B 1XT5A 4G80B 1VFBB 4OZGE 3FMGL 3KJ4C 4KDWA 1J1XH 5CIPB 5GGUA 5I1CH 4WENB 5JLZB 3C6SB 4NWUL 4NT6B 4UNVA 1C1EL 3JWOH 1E28B 2R56L 4Z9KB 4MCZA 4LAQH 5GJTH 3AROA 5DJCA 3BO8B 2QADB 1MFAH 4OIIL 1DQJB 4EI6B 4XBPA 4LHQB 4Z8FH 5L7XL 4I3GA 4KHXL 4NJAH 5B4MC 3QUKB 3C5JA 1J11A 4FFWC 1MJ8H 1K8IA 1BQHA 3ORJA 3UXFA 1VDGA 3U4EB 3F6IA 2YXFA 4OIBA 3IDIB 3OKDB 4C83A 2CDEB 4MX7A 5DC0A 4P2OC 3GMPB 4KRNA 3M17A 5DJ0B 3E3QA 3HNVL 3QCVL 4HKJA 3C6LD 3T0EA 3Q5TA 5I8EB 4NN6C 3VG0L 4MJIA 2MQCA 4M93C 4HJ0D 4JO1L 5JHLL 4JO2L 1JZ6A 4PRAA 1MAKA 1IRAY 3MRNA 4NP4L 3RIAF 2DWDA 5JXAH 1LEKB 2P45B 4YJZL 5E2WL 4ODTH 3MLZL 4KVCL 5GRWA 5D72H 3P9MB 4R4FH 1F3RB 5T33L 1PW3A 5CUSL 5C0CE 1QFUH 2APTA 3INUH 4QHUA 1CGUA 5C6TH 1ZA6A 1KIQB 3O4LB 1S9XA 2H9GB 2HTLD 1T20A 5CP3H 5CCKL 3RWFB 3P4LA 4F9PA 1JPST 3G6AB 1AC0A 1HNFA 5TQ2H 1RK1A 3D0LB 2QQLL 4CJ0A 4HULB 1F90L 4JM4L 1ND0A 2WIIB 3QXAB 2X4RA 1YN6B 3N50A 3KLAA 4L8CA 4MJ2A 5EOTB 5F7NC 4DGVL 4YEEA 5KBNC 4AT6B 1LD9B 2NY7L 2NYYC 4IJ3B 3VXNB 3IXTA 3R0MA 1DL7H 2GJ6A 2Z8RA 1U95A 4H26B 4JG0L 3PWNA 4K3HA 5F93C 3RJQB 4OQ1A 3WNMA 4HGMA 3U9PL 4KKCD 1H3TA 5F71A 4MA3B 5F9DC 4HUWB 3EDDA 3GB7B 2CH8A 6FABL 1S7QA 3D25B 1S7XA 5CLTA 3UDWC 1A6AA 1G6VK 1IAII 2J4WL 2NY3D 4G6FD 4XCYA 4JKMA 4C57C 2C1OA 2WQRA 4LQFL 1TJIL 1EZVX 4U6TA 1FBIL 1KCGC 3QULB 5FUCE 1E4WH 5D70L 2Y6SD 1XGQB 2VLKD 3MRFB 1YEEL 3RWGA 1DQQB 1ONQB 3TM6A 4NQCB 5D7JD 4P4KC 4FTVD 2V5MA 3RHWK 1V5JA 1HK6A 1KPVA 4LKXB 4P49A 3KPSB 4JY4B 4OT1L 4WWKA 1ZHLA 2Y5EA 4JFEA 2AJUL 5D96B 4CNIA 3UZEA 5GRVL 4F7PA 2Z0BA 1G7LB 2HRPH 5HYSB 4QRPD 1GH7A 3TFKC 1N2RB 3C6LC 2JJTA 4ZD3L 1X6LA 1H0DA 3U0TB 4XP1H 2LVCA 4YH6A 3IKKA 2CLRB 4P46A 3CSYA 4LLWB 1MPAH 4XBGA 4Z0BL 4OCWH 4LCYA 5MENA 1S7WB 3I6LE 2CMRL 3TF7C 3TIDB 2NY6B 4U6XB 3LD8B 2A74B 3V6ZB 2EE9A 1DVFA 2VR9A 5JOPE 1LGVA 3BZFB 1BD2E 5D1ZC 4HZAA 5DJYA 4OQTL 4EBQH 3TNNB 1AE6L 3DVGA 5GS2H 4AG4H 4PJXB 3KS0J 4XC1H 1JF1A 1EX0A 4GS7C 4YFDB 4KUCF 3FQUA 5I1KH 4JPKH 4TYUA 1FFPA 5FDWB 3L95B 2EIBA 5ILTH 3NFPB 5IEKA 5DJZA 1AHWB 2APFA 3BDYH 5C0IA 1BWMA 2P4AB 2ESVB 4L3CA 2XN9B 1U91B 3DLQR 1OP3K 1LK2B 4RMVA 5K9QG 1CLZH 2PYEB 3FCTB 5IGXH 3C5SB 4PRDB 4NKIH 2VH5H 4MNQB 1KCUL 4R4ND 2FX9L 3ULUH 3NCYS 1SJEB 1N5AB 2F8VA 4JFXB 1RULL 4LSTL 2DL9A 1KELL 3MLYH 4PJDA 5FYLH 5CINL 1OL0A 1UH4A 3HI1A 1KNOB 4R7DA 3H6JA 1FNFA 5FAAA 4XNQA 1G7MB 3CGTA 3A6CH 4GG6B 2B0SL 4PYGA 3PL6B 4FNLL 1MH5B 2H6PB 5LWYH 2XOTA 4QRSB 2XT1B 5ACZB 2IFGA 1GOFA 1N64L 2BY1A 3WS6C 3MA7B 2ZOKB 1RURH 3DXAB 4UV4L 1MFBL 3IJYB 4M7JH 4FQLH 2Q8BH 4I2XE 5C0EB 4HC1L 1M7XA 3U1SL 3S3JA 3B2VH 4XP9H 5FK9B 5CEYB 4OZHB 1IKNA 2IPKA 4KQ3H 4YGVB 2FZ3A 1GCFA 3MOAH 4FQHA 3UTTB 1DUZA 5E4IA 3O11A 1JF6A 5H94A 2DLEA 5TQ0H 5J1AB 3DVIA 3IFNH 4GJTB 4XGZB 3RY5A 3ZT5A 4WW2A 2ZG1A 2X4SA 3NH7H 3FONB 3RWJB 2DQEL 4WHYH 4J6RH 5F7FA 4OB5L 2VLJE 3MREA 2JELH 3BIKA 1N0XL 4YO0A 1MFEH 3CDGA 1J1XL 5HHMA 5EBLA 3QI9A 5I1CL 1CR9H 3LQZA 2D7PA 1MQ8A 3JWOL 2WMPA 4LAQL 5GJTL 2YRPA 4R96B 1P7KA 1MFAL 4V1DE 3ULVC 4Y4FD 4Z8FL 1QHPA 4M5ZH 4NJAL 5GGUB 1YEJH 5FKPA 4L3AA 3ALXA 1MJ8L 1IAOB 3D3VD 4TNWF 5KS9F 4MCZB 4M1DH 5JW5A 4HH9A 4M48H 4CBPA 5DJCB 3O6LH 3IFOB 1TCRB 4M9OA 2BSTA 4XBPB 5ITBH 1JP5A 4TUOB 3SGJA 2HTKC 3THMH 4NQSA 1K6QH 1K8IB 1BQHB 3B9AA 3P11H 3N1MC 4PGEA 4C83B 2LU4A 4ODSH 5JXAL 2NW2B 4LHUB 1JWMA 1OSPL 3PWPA 3M17B 2E7LE 4ODTL 5D4QA 3QWRD 1WWBX 4HKJB 2P48B 4R4FL 1UXWA 1QFUL 3EOYG 3T0EB 1DBMH 3INUL 2J6EH 1F4XH 4MJIB 3C9NA 3LQAH 5C6TL 1A6PA 2DWDB 3ALWA 1VFMA 3QO0A 4JFZH 3GSQB 5DD5H 1P9MA 4Y4HD 3ZTJH 2VNCA 5TQ2L 1TPXC 4U49A 4JR9H 4MAYA 2FGWH 5IV2A 2GUOA 1S9XB 2Z31A 4UT7H 3P9WB 2XZQH 2FJGA 1T20B 4YPJA 4ERSH 1XCTA 2R2HA 2EKSA 3MROA 4W6YB 1RK1B 3O9WA 3K2MC 2K7PA 1HEZA 1QSEA 2V7HB 4DN3H 3UYPA 1DL7L 5C07E 3ZLQC 1EXUB 4Y5XC 3QG7L 1LQSR 4OM1H 2Z35A 3QNXA 5SWQA 3QIBA 3V5DA 3BX7C 3N1GC 3KLAB 5FV2A 4L8CB 3VI4E 3L7FA 2A77H 3IXTB 1J88A 1VCAA 2BSSA 4FFEX 4NCC1 3ZHLA 1MWAB 3TZVC 3PGCA 3PWNB 4Z7VB 4LLVA 1GGIH 1ZVHA 3IETA 3CNKA 4OCYH 4YHOH 1KYOK 1MSPA 4WTWA 2IGFH 4LCWD 1YNKH 2R2BA 1Z3GH 2WUCH 2OI9B 3MRQA 4HGKC 1KOAA 1S7QB 1S7XB 1E4WL 3C8HA 5DO2D 4GW5A 2JCCA 3PUCA 1A6AB 1UVQA 4P5TA 1LE5B 3FT3A 3RWEB 2G75A 3LRHA 2C1OB 3Q0HA 3Q6FA 5IB4A 1LDSA 3DO7B 2N7AA 3VXQA 1V7MH 1FPTH 5C08A 1T3FA 4Q2ZA 3RWGB 3TYFB 3CDYA 2BVUA 1XF4A 1TDQA 4WEMB 4MVBD 1C5BH 4IRJC 2C3XA 3F65A 2HRPL 1G6RA 1H5BA 4WWKB 1PZ5A 2YD7A 3R8QA 1GVIA 5GRXG 4XP1L 4CNIB 3V0AC 1MPAL 4OCWL 3V52H 1DLHA 4F7PB 2J5LB 4U1NA 3UTPD 3ZHKA 4PJAE 5BMFH 1FP5A 2ICWJ 3KHOA 3MRGA 3DVNA 1INQA 4EBQL 1YY8A 4NNYA 1QA9A 4AG4L 3UEZA 4XC1L 3AUVA 1YUHA 5BS0D 4P46B 3CSYB 5MENB 3B2UD 4JPKL 3WKMH 4PJ9A 5DJAA 3RQ3A 4PRIB 5ILTL 4F7TA 4MJ5B 2WY3A 2HFTA 3BDYL 5DJYB 2DWEB 1WBYA 2IJ0C 3ETBF 3DVGB 4HD9A 4QCIB 4U1GB 3FQUB 3WFBH 5EOQH 3BPOC 4LK4A 1C08A 1T7XA 2CRZA 5A2IH 2F74B 4Z7UF 2NPLX 4WO4B 1FFPB 1AIFA 3O2WL 1CLZL 4RWYH 2VIRA 5IGXL 5K9OA 4K9EC 5DJZB 4NKIL 2VH5L 4ODBD 4KI5D 2HLAA 1V05A 3ULUL 4YXHH 4DK6A 1N7MH 5J7CC 3ZKSD 2EE3A 5I66A 3MLYL 2XQYG 5DMYA 5FYLL 3MC0A 3QZWA 3HE6C 4WW1A 2ILLA 3LEVH 1KCKA 3ZT7A 3A6CL 5FUZH 4JGUA 1OW0A 5LWYL 4U7SA 2C3HA 4BUGA 4N90E 4XPTH 1RURL 3GHEH 4GXUM 3ESVF 3V0WH 3HI1B 4R7DB 4XNQB 4M7JL 4F33A 4FQLL 2Q8BL 2PO6B 2AQ2A 4DVRH 1FFNA 1A1NA 3B2VL 4XP9L 1XCQB 1U8JA 2A9NH 4KQ3L 5AAWA 4L4TD 3MOAL 3MV01 1CG9A 4YFLF 2Q7YA 4AM0A 4TTDD 1ES0A 1MCWM 2LQRA 4K3GA 1FE8H 3JSSA 5IMLA 5JXEC 2HKHH 3GGWB 3IFNL 5DVLA 3NH7L 2D0HA 1SM3H 2EDDA 4J6RL 4WVRA 2IPKB 4EUPB 2WINA 2FZ3B 3TPUB 4OLWH 2JELL 1CE6A 4TUJB 3UMTA 4FQHB 1DUZB 4C54A 5H94B 1MFEL 2YOCA 4PJHF 4EN3A 3K46A 3LPWA 2VLRA 2CR3A 1CR9L 2X4SB 3FFCD 5IHLB 4PRHE 2OTWB 4WEBH 4BA8A 4PJBE 4CW1B 1MVFA 2XXCB 3BIKB 3QIWC 3IJHB 4YO0B 1A6WH 1ZA3B 1WFTA 1OTTD 3ILPB 3GKZA 4HMDA 3NOIA 5E2TH 4M5ZL 1YEJL 4RX4D 4NO5B 5FM8A 3LQZB 4M1DL 1ZT4A 5DK2A 5ETUB 3PF2A 4K8RH 4M48L 1A7OH 4R2GD 3KLDA 2XRAH 1KXQE 3ARDC 3HCVA 3O6LL 5I71B 1RZFH 5A40E 5ITBL 2VOTA 2X4OA 2Q86B 1J7VR 3BRGC 3CVHA 3O2DH 5FKPB 15C8H 1KN2H 1P2CA 3THML 1K6QL 1QUNA 5DA4A 3P11L 3WFHA 2BNRE 3IAGC 4L9LA 3ZDXE 4ODSL 1RJCA 1H3UA 1YEDA 2WWKO 3U4BH 1J12A 2P46B 4OF6A 1NMCC 4KKBD 4KQ4H 4NQSB 1Q1JH 1R5WA 1DBML 1HYSD 2J6EL 1F4XL 2YMXH 1GYAA 3LQAL 3VFVA 4LAJH 3MACH 3HC3H 4PV8A 4NGHH 1HDMB 2X9XA 2UZYB 3SOBH 3MBED 2VC2H 3HAEB 2AVGA 3NCBB 1JWMB 5I9QB 5ADOH 1HH6B 4JFZL 2EIZB 5DZNA 3L3OB 5DD5L 2ATKA 5IVXE 2KKQA 4ZO6A 1JGVH 4JR9L 4YXLH 2GEEA 3C9NB 3S97C 5ITFA 3F62A 5C0JB 1MJJA 1T03H 1B9ZA 1NKRA 3PWUA 3PWJA 2R4RH 4UT7L 3QQ9D 2XZQL 4KGJA 4M7KH 4GBXB 2XTJC 3D85A 5E8OA 4ERSL 4HWNA 1UXSA 1TLKA 1X44A 3VXSE 3MNVA 5J13C 2YEZB 1JJUA 3TCLA 1YMHA 5DDHB 4MAYB 4DN3L 5FB8A 5CSGA 4NQDD 4MSWA 3VXME 4OM1L 1AD0A 5LG1A 4PP2A 1JPTH 2A2QT 3VFTA 1XCTB 2R2HB 5ISZB 1A47A 2EKSB 3MROB 4G59A 1RQ5A 3MZGB 1NC2D 3O9WB 4KDTA 5I1EH 2A77L 4KMQA 4IDLA 5JDSA 4PGDB 3L5JA 1GGIL 2Z35B 5DD6A 3V5DB 5SWQB 1FZKA 3PABB 3QIBB 3HG1E 4OCYL 3KYMA 4YHOL 3VWJB 3L7FB 1BIHA 2IGFL 4P23C 1YNKL 1KLFA 1HSAA 1Z3GL 2WUCL 4RDQF 5EUOA 5D7LA 5TGBB 4ZAKC 5J89A 2ZSWA 5I1LB 3F7RA 1QKZH 3PGCB 4LLVB 4BSVA 3GSNH 4P0DA 4NC2B 3B83A 3IETB 4OCRH 5CZVH 1H8OA 1BZ9A 4YWGH 2R2BB 4C56A 3MRQB 1Q8MA 4FHBD 5T3XH 1KENH 4X6CB 1V7ML 2JJSC 3NCFB 2JCCB 1FPTL 1UVQB 4G8IA 4P5TB 2G2RA 3G6JB 3QH3B 3FT3B 5MI0C 4D9RE 3Q6FB 4KXZH 3V8CA 4YDKH 1U8PB 1C5BL 4HKXB 5IQ9A 3VXQB 1UWXH 3SO3C 4CVZA 5CZXD 5IB1A 3CSGA 3FKUS 4U6VH 2P5WE 1T3FB 4Q2ZB 5D7KE 2H45A 4J7RA 3OKMB 3QDHA 5EOCJ 5I73B 5K9QI 3D18A 2IQAA 32C2A 3STZA 3V52L 4JHZA 3SKNA 2FGZA 1W0VA 1JGUH 1WISA 5I75C 1AR2A 1FFRA 1H5BB 5BMFL 4P2CG 5H37G 1WV7T 4XP4H 4RWHA 1PZ5B 1I7UA 1FYTB 5DC9B 3ZT6A 3QUMH 1U92A 4IIQB 2JB6A 3MBEC 2AXHA 3WKML 4U1NB 2BMKA 1XF5B 2CUMA 2H2SD 5B3JF 3MRGB 1BQSA 1INQB 3DVNB 4OKDA 2UWEA 3FN9A 3HMXH 2P8MA 1U8QA 1YY8B 4NNYB 2GW5A 1QA9B 3MRLA 3AS3A 4N5ED 4NBZB 5FGBC 3V0VA 5EOQL 5F44A 3WCYA 4PJEF 2DQFA 4JQXA 3A6BH 4HQQH 1OAKH 2NY2C 4PJ9B 5DJAB 3O3EB 4RWYL 3FRPA 4ELME 2UY6A 4F7TB 4JM2A 3IRZA 1NANI 1WBYB 4OD1H 2ICWB 5LKNA 5CHNB 1TIUA 1TETH 4BSJA 3FT4A 3PDDA 4N1CA 4YXHL 2FCBA 3FRUA 1N7ML 5IMMB 1C08B 4AJ0A 1A3RH 1I8IA 3OAUH 3PGFH 1HHKB 4YDVB 5HGGS 1EERB 3IS1X 3LEVL 2XA8H 1YMMB 4IOFC 5FUZL 1OLLA 4FQPA 4H5SA 1AO7E 1XMWA 2ED8A 3OJVC 1D5BB 3UPRA 4XPTL 4TN9A 1QPPA 3IB4A 2X9WA 3GHEL 3QZWB 3S6CA 4WW1B 3V0WL 4A6YH 5I0ZA 2DF3A 3PQYD 4MJ4A 4BUHA 4X5XB 4DVRL 4YK4B 5IK3A 5IB2A 3X11A 1E4XI 5KVGH 3VW3H 1IFHH 2VLJB 1CQYA 5HGHA 1PG7W 2A9NL 3CX5J 1DBJH 4PJ5E 2NY4D 3VXTB 3NN8A 2A73B 2NXYB 1TXKA 4ZPVA 1FE8L 4F33B 2CSPA 3LSOA 1OP9A 2HKHL 3P3YA 1A1NB 2NTFB 5JUEH 1SM3L 5F89A 5F8QC 4N0RA 1U8JB 1UM4H 4GKNB 4G9FA 4OLWL 4MQ7B 3X14B 4U1LB 2Q7YB 1UQSA 1CFBA 2EXWC 2DICA 1S9VA 1T1XA 3SJVD 2FATH 5IMLB 2MNUA 4P2QA 5T3XE 4RGND 4HWBA 4FMKA 1Y0LA 3HPLA 2XV6B 5C0DA 1H3GA 3D1MC 4H1LB 4WEBL 1BFVH 5HPMB 5C09E 4X7EC 4M3KB 4MDIB 4Q6YA 4FXGA 2BX5A 5L0QB 3V4UH 5E2TL 2VLRB 4GXUN 3REVB 2L4OA 4Z7QF 2ENYA 3KPQB 4JRYE 4K8RL 1A7OL 4JFYA 1KIPB 2XRAL 3CCHA 3VDAA 3VGGA 4N0CD 3TNMB 1RZFL 3IDUA 2AK4A 3O2DL 15C8L 3B9KA 1KN2L 3GRWH 4PJXF 2E7CA 5T1LB 2E27H 2H2SC 4YBLB 4C4KO 4R0LB 3HCVB 1A4JA 1IZKA 3U4BL 3DRTA 3CVHB 4I0PA 1NC4A 4KQ4L 5J1TC 3MV11 1Q1JL 3GJFA 2UUDK 1QSFA 3FQXB 3WFHB 2DMBA 5HJ3B 2YMXL 2OL3A 1KSRA 2DIAA 5FV1L 4EDWH 1KUMA 3T0DA 3MACL 3HC3L 4NGHL 4L9LB 4X6DF 5DQJA 3SOBL 4S0SD 4YFLI 5AYUH 2VC2L 1LO2H 1TQCB 4X9BA 3SDYH 3O6FA 5ADOL 2BZDA 4POUB 4WU5B 1MVUA 2OXGA 4X6EA 2WAHA 3MV8D 4A2MA 1JGVL 4YXLL 2PTVA 5I76A 3RGVA 3ZDYF 1CL7H 5JHDE 4GW1B 2AJYH 4PV8B 5CJQH 1T03L 3OJ2C 2R4RL 4M7KL 3HLAB 5HI3C 2Q20A 4AIOA 2F53E 4PRPD 5L8JB 3BT2H 4MXVF 1A6VH 5JIPA 2PCPA 5DGQA 1W0WA 4IS6B 1R3JA 3QEHA 3EYVA 1NUNB 3PWJB 3BKCH 5B39B 1WAAE 3GIVB 1BPVA 3D85B 2ZSVA 1JPTL 3QRGH 1I9IH 1UXSB 2D7MA 1YEFH 2NY4C 3MNVB 2H32H 3VXRD 3TCLB 5E4EC 2HH0H 3TVMD 1FORH 2PXYB 5I1EL 4PJ7A 1IE5A 1YMHB 1ZXQA 4L29A 4UOW0 4OD3H 5FB8B 4ZUWB 4N0UA 1INEH 2YPKA 4MSWB 2WM0A 4JAMA 3A67H 3VG9C 4B41A 2C26A 4PP2B 3CH1B 4IRSB 4C58B 4ZMAT 4LGSB 3I9GH 1IEAA 1EEYA 3VCLA 2X7LA 4RGNC 2W0KA 1A7RH 5JDSB 4CAGA 1QKZL 4B53A 3GSNL 4K94C 4OCRL 5CZVL 2OM5A 4F80A 3GKWH 3WV0A 5HHOD 1NJ9A 2HLFC 2IAMA 4N0YH 3MRPB 4YWGL 4LFHD 5CSZB 3EYQD 5EUOB 3WLWD 5D7LB 5T1DH 1GZPA 3TLRA 5T3XL 2FX8H 1LHZA 1KENL 2ZSWB 4KJWC 1CT8B 4BSVB 4G9DA 1I3RA 3SEPA 4Z5RA 1OD7A 4ZXBC 3GDBA 4PJFF 4MQTB 3WL9A 4C56B 5FO8A 2FX7H 4PJAB 1RV6X 4YDKL 5HHQA 4OTXH 5FO7A 4YHLH 3ZSSA 4U6VL 2ZUQB 4KROC 3VGAB 1JF5A 3P0YH 5EBWB 2D7TH 1ZLWH 2BHUA 3OXRA 3WJLC 1BQLH 1JI1A 3HUJF 3REWB 3G08A 1H9VA 3HRZA 3S8WA 4WFGD 3UYRH 1PG7X 5IQ9B 1JGUL 1LQVA 4I0KA 4CVZB 4N5UA 4XP4L 3JV4A 4I13B 3ARGA 2YD1A 5CGMA 2F8XC 3QUML 3D18B 2IQAB 32C2B 1FV1A 5JOFB 1W0VB 4JEGB 4ODUA 3K81A 1JNNH 4JKKA 1NMAH 2QADD 3HMXL 1SJXA 1I7UB 3AMKA 4PJGE 4WY7H 4HIHA 1CDBA 3A6BL 4ZO8A 1JRHH 3DX9B 2FL5B 4HQQL 1OAKL 3ROLA 1IAIM 3L6FB 4HKBA 1RJZB 5HDLA 1GXEA 1UZ6F 3GMOA 3LB6D 1U8QB 2W0LA 4OD1L 1V8HA 3JTSB 3MRLB 1MCIA 2GJZA 1TETL 1RUQH 2BOCA 5AG8A 1J0ZA 3ESUF 4NKDB 3MMEA 5C0GA 2CLZA 4GRWF 4X7DC 1A3RL 3PGFL 3OAUL 2XXMB 4JM2B 4L4JA 1CTNA 2XA8L 1DANT 2EKJA 3J7HA 3JV6A 3RI5K 4BZ2H 4CGTA 1X9QA 3FT4B 3FRUB 2EDKA 2DQGH 3GIZH 1NKOA 1I8IB 3UPAA 3V95A 1DLFH 2OMBA 1SJHB 4FTVE 3VH8B 4A6YL 3BIAX 4FMFA 3BPCB 3IDNA 4DZBA 5DWUH 1LK3H 5TJWK 5C3LD 3O4OC 3O4LD 5BV7B 1JHKH 5GPRA 5KVGL 3QXVA 1IFHL 4FXKB 3VW3L 3MV9B 3UPRB 1DBJL 3BDBA 3WBDA 1PX4A 1S3KH 3OG4B 4QHNA 3QUYB 1P4BH 2MOVA 1ITBB 2FO1A 3EYQC 5IK3B 4PRHB 3X11B 5JUEL 5E1AA 1L6ZA 5KSAB 5HGHB 4RFNC 1UM4L 3QXDA 1MNUH 3NN8B 4IHOB 4ZPVB 3H9SA 1T6WA 2GHWB 2P8PA 1C5DA 1J1OH 2FATL 4NN5C 5FF6A 3LSOB 2VWEC 4U7KA 5DF0A 2C3WA 4RA0C 3QUZA 5I1AA 2YBRA 3V6FA 5F89B 1ERNA 1BFVL 1S9WA 4KH2A 1JNLH 2BNQD 3QDME 1LNUA 4DGYH 5D6DA 3WUWA 5GRUH 3CZFB 4P2QB 3P2TA 3ZE2F 5GZNC 3V4UL 3WIHH 4QF1A 3QPXH 4GW4A 3WFZA 1Y0LB 3HPLB 3VGEA 2GTZB 4O02H 3QUXA 3QEQA 5B38A 1SYSA 4Y5VC 4GT7A 2A9MH 2CRYA 4DGIH 3B9EA 3SBWC 1CICC 3GHBH 4FP8L 4TPRH 4AK1A 4JVWA 4HS3A 4ZOCA 2QSTA 5DHVH 1UACH 3GRWL 2DJUA 5HGBB 2GT9A 5D5ME 4HX1B 1XGPA 4ZTOH 5I30H 2E27L 1R3LA 2F54D 3T0AA 4JFYB 3S9DB 1HOCA 5E56A 4Z95H 3U9UA 1FN4B 3CCHB 1B88A 3LAFA 4NQCD 2A6IB 4EXKA 5BVJB 4KY1L 1HILA 1BM3H 4PJIA 1B0GA 1WJ3A 3KPSD 2Z91A 1VFUA 3RKDD 1AGCA 4XPGH 2W60B 4FQXC 2YD3A 4WEUD 4RMTA 3G9AB 2ZUVA 4Y89A 5E2VH 4EDWL 1KIUA 3L3DB 1RUKH 1A4JB 1DQDH 5AYUL 2EDJA 1LO2L 3DRTB 2WLYA 3SDYL 4I0PB 3VXSB 2XKUA 3GJFB 1FZOA 4KZDH 1IQWH 4G6KH 2OL3B 5F8RC 5EZLA 1CL7L 1U8NB 2AJYL 5CJQL 1CXIA 1U3HA 5DQJB 3VXMB 1EUUA 2WZPD 5IW6B 2NY6D 1AXSA 1J0YA 3O6FB 4Z7NE 2X4QB 3BT2L 1MVUB 1A6VL 2WBKA 4Z78A 2NX5B 5CMAA 4S1DD 5DUPH 2OX5A 2AGJH 3VFWB 4PJDF 4MAUH 2ED9A 4GRWH 2X1WL 3BKCL 4Y2OA 1EHAA 1BIIA 1TVBA 1X5KA 2AJVH 4V3DB 5F9AC 3QRGL 1RPQA 1I9IL 1YEFL 1RD6A 2VDLH 3TFKA 1W0WB 2HH0L 1FORL 2ESVD 4EIGB 1N6VA 4OD3L 4Q6IA 1INEL 1P4IH 4W6XB 3TF7A 3K0WA 3A67L 3AAZB 1A0QH 3QRFM 3MFFA 2J8OA 4MNQD 1NCTA 5I8CB 1CXKA 3I9GL 4PJ7B 4X80H 2XG4A 4OJFH 1A7RL 2NNAA 4N0UB 2YPKB 3WLBA 3HR6A 3CFKB 3GO1H 4XCCH 5IVZA 3V5KA 4WW2F 3GKWL 3S88H 4M00A 1XIWC 4N0YL 1T2JA 1JRHI 1EEYB 1T80A 5T1DL 3VCLB 1EEQA 2X7LB 4CN1A 2FX8L 2YPVH 4JE4B 3ZSTA 2CK2A 2YN5A 1DN0A 3L3IA 1CXHA 5M95B 4L8SC 3MTRA 5IQ7H 3DXAD 4OQTA 3X13A 4NO2A 5C9JA 3PHOA 5LAXB 3ALPA 4HIEA 4QTHB 4JDZB 2FX7L 1GZPB 3VXUA 4OTXL 1Q9WA 4YHLL 4CMHB 1AKJB 4Z6AT 2VKWA 3P0YL 4G9DB 1I3RB 2D7TL 1QHOA 3UTTD 3TN0A 4Z5RB 3CX2A 4AENA 1BQLL 3NBNA 3L3GA 5JA8B 1NAMH 3UYRL 3QFDB 4QY8B 5HHQB 3QG6A 3S35H 1FNHA 5IROC 1ZE3C 2GQHA 5JZ7D 3L5IA 1D9KB 2R23A 3OXRB 5EO1A 3IT8D 1CFSA 2OCFD 4OAWA 3KDMB 4G8GB 2BNUA 3OHXA 1JNNL 1NMAL 4OM0H 1HHIA 2CIKB 5DVKA 4XCNA 2V2WB 1G7IA 4WRLA 4WY7L 3QT2A 3MOQA 4B50A 3NCJH 2M2DA 3LD8C 3S96B 1J10A 3OTTA 4NQVB 2YSSB 2H2PD 4N8PA 1V3LA 2R0WH 2ZCLH 2J8UA 3E2HC 1YEHH 3K74B 1RUQL 2XZAH 4HC1A 1R3HA 4XNYH 2XI9A 3ROLB 1X7QB 5F7YC 2Z92B 4LCWE 1BHGA 4AIXA 1ZLUH 4N9OB 1AHWC 2BP3A 3GMOB 5F7WC 2PW1A 1JK8A 2GJZB 1QACA 2DQCH 4BZ2L 3OKLB 3F7YB 2A0LC 1MI5A 4H0GA 4U1HB 5DYOA 3GSOA 5F70A 2BOCB 3C60A 4LHUD 3KJ4B 2DQGL 3GIZL 3U7WH 1DLFL 4KKLD 5CJBA 2OR7A 3T0ED 4X0KA 1G9NH 4MJID 3L5WA 4HIJA 5DWUL 3B6SB 2KQNA 3F12A 4XH2A 2NR6C 1I75A 1JHKL 2VQ1A 5INCA 1G7JA 1KV3A 2H3NA 5I16A 1YQ2A 4HK3J 1FCGA 4QTIH 3RJDA 1KB5H 1S3KL 4Y19D 3VDBA 2GSIA 4N0FA 4R3SA 4DZBB 1P4BL 4BSWA 3WJJA 1I9JH 1AC6A 4O2FB 1ZT1A 3PL6C 4HIIA 2VRAA 3NTCH 2R0KH 1P7QB 4P2OB 3CX5K 4F15B 1MNUL 2EO9A 1G1CA 1A14H 2VAAB 1J1OL 3B4NA 3UTPE 5FM5M 4LLDA 4NN6B 1JYVA 4LKCA 5KJRH 4IMLB 3W2DH 4M93B 4N9GA 3HI5H 1OTSC 1AP2A 1JNLL 1N59A 5BS0E 3P9LB 4MHHI 3FO9B 3PGDA 1UB6B 3H9SB 5GRUL 5FF6B 4ONHB 3UTSE 1QR4A 3WIHL 1WZ1H 3QPXL 5HYFA 5L8KB 1B0RA 3I85A 3V6FB 4O02L 2FBOJ 4CMMA 1S9WB 3BGMA 3AFLA 5JZ7C 5M94B 2A9ML 3T3MF 4DGIL 4JO4H 2ADIB 3PNWA 3GHBL 4TPRL 1FIEA 1UACL 3OZ9H 4HK0A 5CP3A 3BN9D 4ZTOL 5I30L 4OLEA 4ORGA 3QEQB 4Z95L 5E70A 3SQOH 4JFDB 5GJSH 2C3VA 3RVVC 5EO9B 3RIFK 1BM3L 1NBZA 3GJFK 4PUBH 2ZOLA 1ZT7B 2IANB 3BMWA 4HFWA 3RFZC 2X89D 4XPGL 3KAAA 1HOCB 4DUXA 1J8HA 1G0YR 2FB4H 2XY1A 5E2VL 1RUKL 2XTJE 4WHCA 3WDJA 4F3FA 1DQDL 4E42A 2HG5A 4PJIB 4DCQB 4U1KA 1KULA 2HVKA 2CKBH 3RX8A 5HVGB 1JGEB 3L3KB 2YWYA 4WWKD 2Z91B 5ICXA 2GAZA 1AGCB 2EDEA 5EFIB 4KZDL 1IQWL 5F1NA 4G6KL 3W11D 5DZOA 5GS0C 1IC7H 2BJMH 2WW8A 4L4TE 4I2XA 4G7YH 5AAMA 3E3QC 4QXWA 4F7MB 1XF3A 3GMQA 2OJZH 3W81A 4FG6C 4JRXE 2WBJA 5F72S 1E4JA 3T0EC 5DUPL 4UAOB 2VZ3A 4ZSOA 5EZLB 2AGJL 5ID0A 4P46D 4MAUL 4LEOA 5MEND 5GSRB 4P4KB 4Z7WE 1BZ7A 4HT1H 2AJVL 3DETD 2AKRB 1WITA 1LO5B 4PRID 1FG2A 4OV5A 1FNGB 5KTEH 3H9HB 5D2LB 1TJHH 3WDIA 3FFCE 4WFHD 4OV6F 4HK3N 4RFEA 2F19H 3WNPA 1KN4H 1JNJA 4QXGL 1P4IL 1BIIB 4WO4D 5CBAB 1KT2A 1IGFL 4F9PC 1A0QL 4BZ1H 3BPNB 3QHTC 7FABH 4X80L 1WEJH 4V1DA 2DMKA 1H3XA 1NBYA 1JMZA 4OJFL 4Q6IB 2VXVH 3EO1B 4PTUB 2OTUA 1K4CA 3GO1L 4XCCL 2DYPA 3MFFB 1E6JH 3S88L 2VDMH 1OGAA 1MHCB 5DVMA 5D1ZB 5KVFH 5EZJB 1BAFH 2HFEB 3RPKA 2UY7A 1M05A 2YPVL 4UILH 4GS7B 3ZE0F 3P4NB 3K80A 5KZCB 1T89A 4MXQA 4F2MA 3MRDA 1IKFH 3KYOA 4LSDA 4RAUA 5C0AA 3DPBA 5IVZB 3V5KB 5IQ7L 1T1ZA 1X5XA 1L0YA 1UFUA 2PO6D 1QEWA 4RISH 1OVZA 4UTAH 1KEGH 3OGCA 3L3IB 4B0MM 2E7LA 4HZLA 3H8NA 1NUFA 3LEYH 3VXPB 1U9KA 3X13B 4NO2B 3RP1A 3VRLF 5C9JB 3PHOB 4UDUA 1NAML 4F9LA 4ZS7H 1CGSH 2E7HA 4LLMB 4XPFH 1Z9LA 3VXUB 1FFOB 1Q9WB 4E41A 3S35L 3BJ91 3WIFA 1RZIB 4X4YA 1HCVA 3R4DA 1EAPA 4OCSH 3L3GB 3CXDH 2X4PA 4L5FH 3MJ8A 3PWLA 3IXAB 1UENA 3WXWH 1YC8A 1I1FA 4OFPA 3T1WA 1HNGA 3QG6B 4PTTA 4BH7B 2VZUA 4WWKC 4OM0L 3V5HB 3DYMA 3VFPA 1FSKC 3C8KB 4QRRE 2R23B 5EO1B 4NQDE 5DR5H 1CFSB 2PNDA 3FRPG 3WNLA 3NCJL 4DOHE 2IPUK 1SVZA 2C4XA 1OY3B 2XTLA 5I6XC 1CFTA 1MUJA 2J5LC 4OZIA 4OAWB 4LIQH 3GSRA 3TBWB 5FECA 5C07A 3OHXB 3O8XA 1P53A 2R0WL 2JJTC 2ZCLL 4PG9A 1LP9E 1TJGH 1XGYH 1YEHL 1CIDA 4Y1AB 2AEPH 4P46C 2XZAL 5E6IA 4RCAA 4XNYL 5IIEA 4PGBA 3X17A 2IADA 3U79A 4JFPB 1DVFC 2ITDA 4KK6D 1IGJA 5DQ9A 4JPVH 3UROR 3FAWA 1KTLA 3HS0A 1NEZB 2DQCL 3SDCA 4X6FB 4FQQA 5K59F 2YPLA 2BHYA 1T5WA 5DXWA 4KK5C 3SGEH 3U7WL 3T04D 2DN7A 1G9NL 1A6TB 4HWZA 5HGDA 4Y4KA 2VXUH 5IT2H 2PW1B 2L7JA 4LRNH 4F37K 3CFDB 4QGTA 1VACA 1JK8B 2BXYA 3ARDA 5FCUH 1A1MA 1MI5B 3GSOB 1DBAH 1EFXD 1IM9A 2I60H 4PJCF 4HMCA 3C8DA 1BFSA 3GSUA 4QHKI 4J3WA 2NXZC 1WWAX 4QTIL 1EEUA 1KB5L 4ZS6D 4LSUH 4X0KB 1X5AA 4HIJB 1I9JL 4M8VA 4XH2B 4U1SA 1HXYB 2YD2A 3CFEA 2VQ1B 2PUQT 5INCB 4GBXD 2R0KL 3L7EA 4U1MA 2H3NB 5I16B 4Q58C 3JTTA 4DKAA 4RMRA 2VZVA 1A14L 2LV4A 5IOPA 2GSIB 3OMZA 4H0HB 3VFOB 4XVTH 4BSWB 1FNEA 1ZV5A 1ZT1B 5KJRL 4HJGB 3W2DL 1J86A 3I50H 1KXVC 3MRIA 3HI5L 3U46A 5SWZA 5F6HI 5ISZD 2DI8A 3QNZA 3WEXB 5ERWA 3O9WD 1NFDB 4JFQA 3ILQC 5ELIA 1WZ1L 5EN2A 4LKCB 4ODWB 4U3CA 2DDQH 3KPOA 4GLRI 4N9GB 5EU7C 4X9HA 3EUUA 1AP2B 2BC4A 3ARFA 4HLZG 3D39A 3VWJD 1N59B 3AGVA 4P59H 3PGDB 2J6EA 4JO4L 1MHHA 5KSBA 1PX3A 1VA9A 2V5YA 3FJTA 1B0RB 4WW2C 4WHDA 3OZ9L 5HYIA 4LOUC 2EDHA 4K3JH 5T1MA 2MHAA 4CMMB 3MYZA 4S2SB 2AJZA 3PP4H 4D2N