1N5AA

Crystal structure of the murine class i major histocompatibility complex of h-2db, b2-microglobulin, and a 9-residue immunodominant peptide epitope gp33 derived from lcmv
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
276
structure length
276
Chain Sequence
GPHSMRYFETAVSRPGLEEPRYISVGYVDNKEFVRFDSDAENPRYEPRAPWMEQEGPEYWERETQKAKGQEQWFRVSLRNLLGYYNQSAGGSHTLQQMSGCDLGSDWRLLRGYLQFAYEGRDYIALNEDLKTWTAADMAAQITRRKWEQSGAAEHYKAYLEGECVEWLHRYLKNGNATLLRTDSPKAHVTHHPRSKGEVTLRCWALGFYPADITLTWQLNGEELTQDMELVETRPAGDGTFQKWASVVVPLGKEQNYTCRVYHEGLPEPLTLRWEP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A Structural Basis for LCMV Immune Evasion. Subversion of H-2D(b) and H-2K(b) Presentation of gp33 Revealed by Comparative Crystal Structure Analyses.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
molecule keywords H-2 class I histocompatibility antigen, D-B alpha chain
total genus 65
structure length 276
sequence length 276
chains with identical sequence D, G, J
ec nomenclature
pdb deposition date 2002-11-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00129 MHC_I Class I Histocompatibility antigen, domains alpha 1 and 2
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1n5aA02
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 1n5aA01
4G6FD 3DV6A 3TIDA 1TCMA 2DQDH 1R0AH 3BAEL 3UPAA 4MAYB 2CDFA 3WEXA 1QLEH 4G43A 3BZDA 4KAQH 1F3DH 1A1MA 3ULVE 3MYZA 2F53E 3CVHA 4OKVA 2CSPA 4ZAKC 4WFED 1MHPH 3FT2B 3N85H 5C0FA 2BSTB 4FQCH 3P73B 4OTXH 5JW3H 1SJHB 4NPYA 4RCAA 1JGDB 3BDYH 4OFYD 1QKZL 1YPZF 5HI5C 3O4LE 4TVPD 5TFSH 3DI3B 4NKMB 2GAZB 1WLHA 4PUBH 4MS8A 4C56A 1BD2B 1QSFE 4KI1A 5IVZA 1HHKA 4OI9A 3V6BR 2AVGA 1U3YA 4NHCH 1Q1JH 3DVNA 3IJSB 2W91A 1ITCA 3SGEI 5KJRH 3BDXA 2GJ6B 4EQ2A 4X5XB 1NLDL 4GRWE 5FYKH 1ZVSA 3WLBA 1OQXA 5HPMA 3TJHC 3VFWB 3ULSA 3RX8A 1U41A 4JPKH 4XT1C 3MYJB 4PJGA 2BOCA 1U8HA 5DVNA 4KKCC 4JKMA 4LFHG 1ZLWK 4OF7A 3D1MC 5F7DB 3NAAL 5JA8B 1G1YA 3GMPA 5T5NG 3DMMC 2OTWA 3GBML 3UTQA 5IBTL 5FYKD 5DD1L 1H3GA 3QEUA 3ARWA 3UAJD 2FIRT 2NR6D 4F2MA 1CFNB 2IF7A 3KAAA 3U9UB 3HPLA 4U1GC 4AEFA 3PDGA 2JB5H 3Q3GA 5FUCC 4HS6A 4XC3H 4RFOL 1XF3A 4I5BA 3GSRB 4NHUE 2Y4SA 5FO8B 4YIQA 4LIQH 2OLDA 4PGBB 3HLAB 3P2TA 1T1YA 1IZJA 4OGXL 1CFVL 4X9HA 3MBEC 3HCVA 1YA5A 1QKZH 4OTXL 4CNIA 3B9KA 3RVWC 2X44D 3EO1B 5DJZB 1F2QA 4MZ2A 3LN4B 4WUUD 4XC1L 3VFUA 3GFUA 3U36A 4PGCB 4TSBH 4JDTL 4GXVL 3MRNA 2EDOA 5CKGA 3STLA 4QTHB 4K7PH 4B50A 2UWEF 4LLMB 3ZDZE 3QB7C 5F7HA 3BD5A 4Z77B 25C8H 2GK0A 2EIDA 3WD5H 1W0VA 1GYAA 5GJSH 1J10A 5JQ6L 1OAKH 1MFNA 4WWKC 4V2CB 4W70A 5GHWH 3ULUC 1E28B 3ROOB 5C0JA 3UBXA 3WS3B 35C8H 3O2DL 5E6YA 1HH9A 2MCPH 3NIGF 4OIIH 2OL3B 1SM3H 5DDHA 5I8CB 4F15C 3MRRB 2VWEE 4RMUA 1H3PH 4KU1A 4HUKB 5KSAC 4K9EL 3QXDB 5GRZA 4X6CB 1Q0YL 3HPJB 2VE6B 3V6FA 4ZYKA 2DD8L 3GO1H 3NFPA 5I74B 4XCEA 5E08L 1AR1D 2A9MH 2AEPL 2PTTB 1C08B 12E8L 3VE0B 4Z7OE 3RWDB 5TE6H 2Z35B 3VXME 5GGRB 1SYVB 5FUCE 4QYOA 3H2WA 1RZJH 1YPZE 1JVKA 2H3NB 2C4FT 3KR3H 3O4OB 4I77H 5DFVC 5ILTL 3C8KB 1YN7B 4L4TA 3G5YB 4Q0XH 7FABL 2ZUVA 1CDUA 4Z7UB 3P77A 2NY3B 5F21B 1NDMB 3SGDI 1GGBH 4I4WA 4PGJA 2FR4A 4UOW0 3QDMB 2VQ1B 2B5IB 5E5RB 2GKIA 3HCVB 3NAAH 1ETZB 1NJ9A 5FYLH 1OARH 4MWFA 1PEWA 3KYOA 1DE4B 1S9YA 4AG4L 1ADQA 4JZOA 1WIOA 4NKOB 2P8LA 2QV2A 3IFLL 3V7MA 3TZVC 1Q9KB 4M7LH 1T7ZA 2XWJA 3HE7A 4M4RA 5JORA 2ZWLT 1II4E 4RMRA 1LE5B 4DK3A 3LQZB 1G9NC 3E2HC 4HUVB 4BKLB 3I84A 1KEGH 1YUHA 1FRGH 3NFNA 3L9RB 4L3EA 1WWWX 3UYRL 3ROOA 5C0JB 2PETA 3MLSH 5DMYA 3AREC 2X4RB 1T2XA 2BRQA 2CKNA 3SDDD 1MUJA 2BVUA 3DJ9A 2E7LA 1G7MB 4U2ZA 4BFBD 3QNZB 2Y06H 2FWOB 5DJDB 5E03A 3LEXB 3F5WA 5CP3A 3B83A 4F58L 4GRLC 4BKLA 1S7SB 4QRTB 4PJ7B 3I50H 2VZ3A 1T0PB 1R0AL 5J6GB 4ESKA 1C08A 2HTLD 3BIKA 1NPUA 2R2EA 4IMKA 3VWKA 3IJHB 1I1AB 2EEAA 3W81A 3J8F7 4RA0C 3B5HA 1Z9OA 4P2RA 1IM3A 4OZHB 2A6KA 1OLLA 2H8PA 3WUWA 3K7UA 5DMIH 5HGDB 1FE8H 2WINB 5KSBB 2ZSVA 5MENA 4X7EC 5DURB 2AKRB 1T7YA 3BQUB 2CXKA 3E6FB 3T04D 1HSAB 2M1KA 4YGVA 3TBSB 3C2SA 5AG8A 5I1IH 1CFSA 3LQAC 4U4BA 3U4EB 3AU1B 3VCLB 2YA0A 3BEVB 3VDBA 4XP5H 1NDGA 5DYOA 1U42A 4KDTC 1FDLL 3PWPD 2EO1A 5IB4B 4CU6A 4C57C 1WT5C 3LKOB 1RUPH 1MY7A 3C5ZB 5CGMA 5DGQA 1OHQA 1AE6H 3VWJC 1Y6KR 2VDNL 1CXEA 3QNYB 2VLLB 3QCUH 5I1DA 5IR1A 2PKDA 3T09A 1H5BB 3MLZH 3RL1A 3GIZH 4G6AD 4X6BB 3C60A 1W0WB 4PV9B 4LNRB 4NUGL 2Z91A 3I50L 2EDBA 1JYXA 4KRPB 4ZXBB 4F9PA 5IFJB 1YECL 3ABZA 1T4KB 4J4PD 3VFTB 5EN2A 3VI4E 3LPGA 3BSZH 5KS9B 4PJBA 4NSKB 4ONGL 4WW2C 3WV0A 4MQ7B 4OKVB 4G8FB 1V7NL 2QSQA 3UYRH 3FT2A 3EYSH 4PJCB 1IGTB 3L1OL 5E4EC 3LIZH 4ZAKD 3O81A 3UTPD 4NQDB 1A7OL 3BIKB 5DEGA 4C56D 1FYHB 4M6ML 3W11D 5ACMA 3FHAA 3EOAB 3QULA 1CD1A 5HHXH 5EUKA 4XRCB 4J3OC 1NSNH 5K9JL 4NOBA 1S7WB 5FECA 4XNXL 1R3LA 1HE7A 4IHOB 1WZ1H 2UY7A 1I1CA 1P4BL 3M07A 3SE4A 1EH9A 5C08E 2XIDA 4FG6D 4HLZG 3EOAA 3QULB 3BEVA 5EUKB 3RY6C 4GG6F 1M7DB 3PHSA 2F5AH 2GUOB 4LCUA 1RUQH 4BZ1H 1JMXA 3QEUB 4OZIE 7FABH 1QRND 3FO2B 3PGFL 1ZLVH 2AV7A 1IM9D 3TYGH 3DMMD 2HJFA 3HE6B 4GW5A 5ILTH 3C60C 5JPMB 2AERT 4FTVE 4S10A 5CEZE 1MIMH 2NYYD 1RUPL 1CFTB 3DETC 1OTUD 3IDYC 4JFHE 4OLVH 5FGSA 1DQDH 3FO1A 2VC2H 2OYPA 2H6PA 3TZVB 1XGTA 5E94A 2V7NA 5FM4A 5LG1A 2FEEL 5KAQG 5D96B 3FKUS 2GT9A 1OPGH 2GTWA 2VR9A 1YNKH 5JMRA 2Q6WA 1BEYL 4QF1A 5CSBA 1CDBA 4KDTA 4CNIB 1ERNA 3QDJD 1MJ8L 5CILL 4WCYH 1MJ7L 3ARTA 3GSWB 3FN0L 1K6QL 2EH7L 2IBGA 3WFDH 3NIFE 3VMNA 4GRWH 1QRNB 4AEIH 3QIUA 1NFDE 4UV4L 1SQ2N 3JTCA 4NT6A 4JVWA 3PHQB 1J0JA 1G6VK 5GHWL 4HWZB 1XGPB 1LK3H 4N0UB 5DJXB 5GPRA 1MHEB 4G7YL 2FGZA 1N6UA 2NY5C 3F12A 3EDKA 1A6VL 4NZDA 2E9BA 1U3JA 2EDQA 1Q0XH 3MACL 5DUML 2HH0L 3ARZA 3CDGB 3VXTB 3DX6A 3SDAC 3IFOA 5DDHB 5I1HH 1J11A 4BSWA 2OTWB 4L8DB 4Y4HD 1CBVH 4ZDHB 3FOMA 3I3EA 3VI4F 3GMOA 4CN1A 4Y16C 2F54A 3OQ3B 3BVNA 2P8MB 3CPLA 3X3GH 2OK0L 3FQUA 3VGFA 2HFEB 1CF8L 3DVGB 4TOYH 4GMSH 2AJYH 4MNQE 3DX8A 2FX7L 4YC2C 5BRZE 3STLB 4U6YB 3MCKA 2H3NA 5I16A 3DUHA 4L4TB 5MEQB 1RJYA 5D7LA 1CFQA 2YD6A 1RHHA 1RVFL 2O93L 2ILLA 1OARL 4KPHL 2UZIL 4KK8C 3X11A 1A4JA 5T3ZL 4M3KB 1FHGA 3DYMA 3TZVA 1FCCA 2DQIL 4KRPD 2Y9RT 5H94B 1KPVA 3RDTB 4HLZH 3IB4A 3G6JF 1BJMA 3QIWB 5F7LB 2YRLA 1QVOA 3QXTA 3BWAA 3N0PB 3HPJA 5D70H 1S5HA 5CINH 2DQGL 1INEL 5HDLA 4NCDA 3V52L 4LVEA 2X4UA 1CQKA 1ORSA 3RIAF 5FFLA 5CZVL 3O9WA 1BFOA 5DK3A 1QSZA 3LB6C 3MGOA 1TDQA 5C09B 3FJTA 2BX5A 2RGSA 5D2LE 5IGXL 3WCYA 5C0DB 2KZ1B 2I5YL 4YHZH 3OPZL 1U91A 1TJIH 4OCMC 3X13A 4UTAL 1NFIA 1JUFA 3MRDA 3BESR 2AEQH 4Z78A 4I13B 3WHXB 4U3CA 2CDEA 4H88L 4AEHH 4RNRA 1LNUB 1PG7H 1VGEL 2GYSA 4PBXA 1A7PH 1RZ7H 4R97B 4HIIA 1RV6X 5F97E 4NGHL 5KOMC 5I1AB 1UADC 3MRNB 4HUMB 2IH3A 5J89A 1TITA 2M8XA 3EBAA 1U6AH 1I1YB 3OAZH 1HHGA 3QUZD 3ULVC 1K2DB 35C8L 3WHXA 3CPLB 3UTTE 3UTTA 2WMPA 3QUZA 1T0NA 3X3FL 4H20H 1JPTH 1CR9H 1OAKL 4YEEA 1OP9A 3RRQA 5C9JA 2CR3A 3RU8L 1FVCB 3RUGB 4QHKI 4CRPA 5T1DH 2BVEA 4KHXL 3G9AB 4WU5A 5IB2B 4J23A 4Y16A 5IOPB 3U2SB 5FHAH 1VSCA 5MENB 1AXSA 4DJMA 1OD9A 3CJJA 2A6JA 5SWQA 3ZSSA 4BM7A 5SX4H 5FOBB 2AJXH 5KVFH 2C1OB 2AW2A 1F11B 3MV8B 1MH5A 4MCZB 3DIFA 3RL2A 4PJHA 4F3FA 2HKHH 5IROC 3RIFF 4N0CA 5I1JL 5I76B 4IRJB 1DSFH 5J57B 5DD6A 1BQHG 4Y5XA 4HWBH 1AY1H 5EPMA 4HGMA 5CSZA 3L3IA 1PW3A 4NQXA 4ETQA 1LVEA 8FABA 4XX1E 1YEDB 3HI1A 3QEGL 3RNQB 3C6LB 4LPWA 5EG6C 2D7TL 3WNOA 5AZ2L 4QO1A 2EDXA 5C0CB 4QXUH 2DRUA 2X4RA 4HJ0C 4L9LB 5DEFA 3TO4B 3VWJD 1D6EA 3EIFA 1P5VA 2VXSH 4R7DB 3DECA 4TPRH 1U3HA 1DEEB 3WUWB 2PYEE 4X6CF 4FQJL 4MQTB 1RVFH 2PW1B 4G6AC 4D9RD 5D7LE 4DW2L 5MENE 4W4OA 5AWNH 4XP9H 2FSEB 3B8YA 2DQEH 5D6DA 1YN6B 5JOFB 5TDOB 5EZLB 1BM3H 3BJ91 4JHWH 4J4PC 4ACPA 5ABDE 1JF1A 4RMSA 3ULUH 4MNQA 2E5EA 1CF8H 4D0CA 1NEZG 2CJUL 2PO6C 4AH2A 1X3DA 4PUBL 4YHIB 1KCRL 3UTTB 5F7MC 4YUEL 1H3VA 3WNMA 4PP2B 5ISZB 3BQUD 1T1WA 4NN5C 2LV4A 3FQRB 3RP1A 2ZUUA 4DQOH 3OGOE 1MOEA 2IGFL 4Y4HA 5BV7B 1EFQA 1HI6A 5FYJE 1V8HA 1RY7B 3U7YL 1MY5A 5GGVY 1IKFL 4FXKB 4UTBL 1RSFA 4LDLB 5FGCE 1L7IL 2R2HA 3OKYA 3QDJB 1WFNA 4WW2F 4L3EE 1RK0A 1ZT4A 4RFEB 1OSPL 1C5DB 4OUUA 3IKCA 2IALA 2DQHL 3BN3B 3QIBD 1F3JA 4XHQA 1MH5B 4MCZA 4FQIL 1UEMA 3S37H 4CMMA 1DVFD 2YA1A 5C09D 3HMWL 3TO2A 3SDYL 5IVZB 1A2YB 2HRPH 2OL3L 4ERSL 4NKDA 3SDDB 1BGXH 2BVQB 3U1SH 3VRIB 3T0DA 1BIIB 4RRPG 3UC0L 3OKEA 5CLTA 1JHTA 2X1OA 3FQWA 3L5WA 3VFGH 4DKFL 1F4XL 1IM9B 4KDVA 4ZD3L 3VFNB 2XZCL 4UNTA 4YHKL 3RVVC 1P1ZB 3ZDYF 1FZMA 1A3QA 3K80A 3LKSB 3RI5K 2V5TA 5F7EL 1ZANH 4HUXA 1AO7B 4HC1H 1B0WA 5I15H 1OTUC 3DSFL 5AZEL 5J3HC 3BGMB 1GOFA 2I26N 4U1JB 3HR5B 5DQ9B 3BRGC 3LKPB 4LARL 5HHNA 4QRPD 1UYWL 2DB8A 3QEQE 3T0BA 1URLA 1AQKH 1FL6B 3LS5L 3MV7E 1G7JB 1BBDH 3CCHB 1GGUA 4L4TE 2ORBH 2GCYA 5I18L 1O5DT 1P9MC 1WUNT 1S7UA 3C87A 5DZOA 5MERA 5DHVB 1U36A 4HUXB 4OT1L 4KGLA 4PJIF 4QGTA 3GSVA 2YS4A 2F58H 3HUJF 1P84J 3KHQA 3P4OA 4G80B 2I60H 1TJGH 1DLHB 1VPOH 3IFNL 1SEQH 1GH7A 4X7DC 2V2WA 2VITA 1SYSB 4NN5B 5SWSE 1ZTXH 4KMTL 1MJUL 5DQDL 1CFBA 3STBA 1BX2A 2BVYA 1MFEL 4WFEE 5HGAB 2FX9H 3BKYL 3FMGH 4XCCL 4XWOD 1L6XA 3ARED 4YX2H 1HXYB 4LLMA 5J9PB 1MCRA 4E0RB 3LN9A 5EWIL 4U3HA 4TVPL 1RK0B 1S9WB 3HZKA 2PCPB 3WE6A 2OXGA 1YDPA 4UIMA 2PTVA 2XN9B 2W9LA 4JAMB 2CR6A 5J11C 1UQSA 1V7NH 2R0WL 3GSNB 4TVPE 2K1MA 1KELL 2A6IB 3F65A 3GHEL 3PWLB 5FM5M 1X5AA 4DCQB 3LQAH 3SOBL 4QF1B 5FB8B 4OIAA 2BY3A 4UU9A 3KYKL 2YZ8A 3VFSA 2EC9T 4HH8A 4OLEA 1HKFA 4ZFFA 2PCPA 4LVOC 5DJCB 5J12C 3VXSD 2IPTL 3MXWL 1YDPB 5JW5B 4ODTH 1JYWA 1A1OA 2OR9L 1LEGB 1Q9OB 5EO1A 2D03H 4JQIL 2IMNA 1RU9L 4JQVC 5IF0A 1ES0B 3HNTL 3RX5A 1BQHA 4LLYB 3U0PB 3MXVH 4Z95H 3OXRA 4X8JA 1I7TB 4JRXD 1JHLH 4OZIB 1JGVL 5D7KE 3N9GH 5DK0A 2PF6A 2EZ0C 4R4BB 3IFOB 5C70A 4NZUL 3MLWL 4YHML 5AAMA 2J3SA 3MJ6A 1LMKA 2VQ1A 5FKPB 3IGAA 3EYOA 3BT2L 2R0ZH 5DS8A 2V9RA 1NL0L 1F6AB 5FYJU 5IMMB 2OZ4A 2FATL 5T3XE 5JUEL 1F2XK 1I9IL 2NXYB 1A3LL 5C2BH 1U8PB 5LBSH 1CYGA 3EO9L 3MV7A 1RFDL 5FDWA 1BMGA 1XH3A 3FQUB 5F3BB 2P5ED 3CFDB 3QEQA 1E4XI 3DV4B 1HZHL 2AABH 3MRFB 4MJ5A 5IP4A 4RMWA 4NM8L 4OGAD 4Y8AA 1CT8A 1EAPA 4NQDD 4ZAKB 5EZOL 1GHFH 4PRDA 4M6OH 3SDXB 3UDWA 3BWAB 2O5ZH 2QSVA 1G7HB 1OAUL 4P59H 3LHPL 1TVBB 1CD9B 2DLGA 4YO0B 1YMMD 2C5DC 3T3PF 5K59F 5FCUH 5L0QC 3FFCB 3KS0H 3QFJE 2VZOA 1UKQA 3PABA 4XTRC 5GS3A 4ORGB 4YR6B 4JRYA 2A2QT 3MNVB 3P9LB 2X2YA 3CFKB 5C0AE 3FB5B 4XPFH 3RZWA 1OT2A 1KN4L 4ZPTA 5BQ7A 4LQFH 3SDAB 2YWZA 3U82B 4M8VA 3M45A 1NBQA 3V4VL 1NC4D 4HW6A 1JZ5A 1PKQB 5EU7C 3WJLC 3I6KA 5A2JH 5BVJA 5D93B 3QDMD 5C7XL 1J88A 1KLUA 4JZNA 1VKXB 4XWGH 5INCB 2VLKD 4RDQG 4NM4H 1OL0A 4NO5A 4LBEB 4Z78B 2B2XL 5TGBA 3RY4A 1N5YL 5IG7A 5J1AA 3VW3H 2VQTA 4K71C 4HIEB 5GGVL 4LFHD 4LLWA 2E27H 2PTTA 4J12A 2PYEB 3MROA 4XPTL 3IF1B 5ACZB 3NGBB 4YPGA 3IT8D 4P2OC 2QTEA 4MDJB 4EI5A 1RIUH 2NYYC 1NDGB 5C0ND 4XCFL 4NRZA 3LSOA 4K3JL 5IB2A 4NRYA 1PZUB 3GMQB 1WQVT 2PW1A 1EEYB 5T3XH 1V7MH 1YEKL 1JTOA 4H25B 3IJYB 4DGIH 4ZO7A 5C9JB 3A6CH 3FB7A 4RIRB 3O3UN 1SY6H 5C8JB 1RZJL 3Q5TA 2XTJB 5IM7B 1DBMH 3MA7A 5TPWH 1QBML 2NY0B 2APTA 1AO7D 3NZ8B 5MHSE 3OKLA 3VXMA 1INQA 5CBEA 5D6CB 4HGWB 1MAML 3HUJE 5I1LA 3ROLB 2MMXA 43CAA 1T83C 3MSPA 5CZXD 3O6FA 1AP2B 4M5ZL 5CP3H 3RVTD 5GJTL 5TF1L 2FO4A 5I1AA 3Q0HA 4AL8H 1GVIA 1CXIA 2IH1B 3K2UL 3LEVL 5FV1L 5DK2A 1LO4H 1TVDA 3RA7L 4FXKA 4GQPH 3VD9A 1QSEA 1WWBX 3MCLL 3N06B 3MFFA 4AIZA 1N3NA 5M7QA 4TRPH 2R69H 5ICXA 5DJAB 3KJ6L 4GQ9L 4JY6B 5BZWB 1VADA 2DQUL 5GRXG 3S3SA 4ZFOB 4XI5C 2R56L 4GAGL 2Y1VA 2E7CA 5EZLA 3ZKXB 1MQ8A 5HDQL 4BFEA 2GSGA 5EO9A 4G6KH 2V7HA 1OWRM 3VGEA 4XC1H 3VMOA 4O02H 4L9LC 3NCCB 4YNYB 1ADQH 4FOMA 1KOAA 1V3MA 2WWKO 5EU3A 4ZSOA 2R15A 1PYWA 3NOIA 3AB0B 1CFVH 3GRWH 4OGXH 3O2WH 1X7QA 4H26B 1FVEA 1P7QD 2ZJSL 4KK6D 4YHOL 4ZFZA 5LQBH 1U2HA 4NHUA 3LS4H 3L7FB 4NNYA 1QEWB 1UWGL 3JWOC 5T33L 5H35B 1D5BB 1QBLH 2QR0B 3T4YA 3GI9L 2QLVB 1QSVA 2GJ6D 4H8WH 4YBLC 3U4EA 3U7WL 4LCYA 3FO1B 3GBMH 2G2RA 4IRSA 1BLNA 2VAAA 5HVHC 2ZOLB 3VD4A 3C6SA 1F58L 2D9CA 1XGRB 32C2B 4FFYH 3JUYA 1H15B 1UJ3A 5F6IB 4LSQH 3OAZK 3S34H 5E24E 1X5LA 1H8NA 4M1DH 1NEZA 2BSSA 3H7BA 5GSVB 4XP6L 3CZFB 4G8IA 4MJ6B 4U6HA 4MAYA 3ULVH 4YDVB 5JOFA 2OTUB 1T3FA 2HVKA 4GS7B 4ODHH 2VLKA 4OLUH 4BH8B 5BMFH 3VRIA 5IBUB 1S9XB 3MFFB 5JR1H 3TBTA 1CL7I 2IPUG 3MO1B 4WW2B 4X6EA 3QNXB 2E9WA 3EFFA 4MMXC 2KL6A 4Y89A 1QLFB 1U8NA 5ICXB 5J6GA 5FUOH 1NCAH 1JFQH 3IU4H 4HH9A 4PRNA 1N5AB 5MEND 4RGOL 2NY6B 3QDGE 3O3AA 5DD5H 4ZTOH 5I2IA 4YHPB 3EDEA 2R29L 2BERA 3EJZD 4UDUA 3U83A 5T3ZD 3OAUL 3PF2A 3UEZA 4MXQA 3NCEB 4PJCA 5EBWA 1QUNA 3RBSA 2EXWC 4JFEE 2VZVA 4HWEL 2F54E 1ZEAL 3CLEH 4DTGL 1MAKA 1NCWL 3MLPA 1XGTB 3C5SA 1CE1H 2LFGA 2IG2H 3K2MC 1KENL 4XX1G 4PG2A 1A4KB 5HYSA 4BH7B 2WUCH 4P23B 4X9BA 2IAMA 1IGJB 1JK8A 3MREB 3HI5H 3KYNA 1D6VL 1BP3B 5DO2C 3OJ2C 3T4AA 4PJEA 2D31B 4ZUWB 5GISL 4U0QB 4KK9C 4LRIC 4OD3H 3WFBH 4PJ5E 3DURB 1FZOA 1H5BA 1E4KA 2JJVA 5H94A 4LSUL 1N2RA 3UO1L 2VUOA 5B22A 2ZOKB 1MF2L 1QRKA 5IBLD 5EOTB 5C0EA 4KY1L 5GGUA 5HHNB 1ROWA 2PR4L 3G6AB 4HJ0D 1PFCA 1S8DA 3GSXB 4QXTA 3GJEB 5HGHB 2IQ9L 3K3QA 4GAJH 1NMCB 3OJDA 3BZ4A 1SJEA 3NACH 4FFZL 1XH3B 1A6WH 4Y19A 2WWMC 5EU4A 4YDVA 3D0VA 1DQLH 4XPBH 3D85B 4X83A 1KCUL 5GGTL 4JFZL 2J6EL 3PHOA 1BD2E 3MZTA 3O6FD 3SPVB 5GGUB 5C1MB 5KW9L 1T21B 2DWDA 3NZHL 4WHCA 3WFEL 1T1XA 3AREB 5CUSL 4P4KC 5C6TH 1DUYA 1RZKC 4G59A 3A67H 4X8JB 1U3HD 4QWWC 2PO6D 5I74C 2F53B 3E2HB 5C0IB 5FYJL 4G8GD 3CVHH 2HFGH 1LO3H 2WUBL 4M7KL 3QXVA 1J5OL 4NZRH 4XTRD 2RQ8A 3C5JB 4N0UA 3ZE2E 3HPLB 1JNNL 4MB4A 5C08A 2QQNL 5D72L 5GS1C 1ZS8A 4DKDC 4IRJC 4YQXL 4XBGB 2FJHB 3EO1A 1RPQA 5DJZA 3X11B 3BP6A 5ID1A 3CFDA 5SWSD 4Y1AD 4NFCA 2AJSH 3E1F1 5T5FH 4PJXE 1YEHL 2KBGA 1A3RL 3TVMD 4FQ1L 1HSBB 4NP4H 1RZFL 3RJQB 1EJOL 3T3PE 1P7HL 4NO5B 4X80L 4P9ML 2HVJA 3D9AL 3MV7B 3B9KB 5CJQH 5GRUH 4QXWA 2E6QA 1EA9C 1JPSH 1NCTA 1C5CL 2YKLH 3U0TB 4NWUL 2NXYC 3MC0A 4G3YL 4OQTH 3RVVD 4PREA 3OL2A 4N0FB 3P9MB 5B39B 4JKPL 2LAAA 2ITCB 1AH1A 3MNVA 1J8HE 3PQYB 5F6HI 4JO2L 2ICWA 4TSCH 4NN7B 1NC4A 1NUFA 4XVSL 1DFBH 2Y6SC 3EYUL 2QKIA 5K93A 1XF4B 2IFGA 1U2CA 5EIIB 3TLRA 1JZ3A 1VFAA 4GSDL 1PDKA 5GS1A 4WHDA 1P84K 2DS4A 2Y72A 1G7IB 3FB8B 4URTB 2XKUA 1A9EB 1KBGH 4HXBH 1YJDL 4OZ4B 4HWZA 2X9XA 3O8XC 2HKFH 5CBEB 1WBXA 1UENA 2B8OT 1N26A 2WBJD 1UM4H 2MCG1 3UZQA 3RIAK 3X14A 4EJ1C 1B4JL 4XMLH 3VXNA 2QQQA 4EN3C 2VR4A 3S96A 4MQXC 1SYVA 3V4UL 4AT6B 4RGNE 1TJHH 5ADOH 1DTUA 4OZHE 2XRAL 2OQJA 3MJ7B 3UZEA 4EUPH 4OCWH 2R2BB 1Z0NA 3QUKA 3VDCA 1FGVH 1B6UA 1QBBA 4ZDHA 2XA8H 5MEOA 1PAMA 1H0DB 3RPIA 2ZG1A 2FD6L 1OF2A 3ARFD 1JN6A 3KXFB 3U9PL 4XWOC 1TZGH 2HWZL 1B0RA 5DVMA 3W39A 1U8QB 1CLZL 5DUPL 4CU8A 3HZYB 2H8PB 1MRCL 3PGCB 5INDA 5I71B 1K8DB 4FMKA 4G6ML 5I0ZA 4JKLA 5HSFA 1IFHH 1MPAL 4L8BB 4WNQB 4HUWA 2XG4A 1OSZB 3NPZB 4FP8L 1QSED 5CIPA 3KPOB 5E99H 3IYLW 2F8XC 4WI5A 3QFJD 1ZWIA 4Z0XB 1RJLA 1Y0LB 4NBXB 3UBXI 4OCRH 3ZT6A 1RZGB 5JHDD 2ZP0T 3KLAA 5D1XD 4NZTH 2HFFA 1TQBB 3LMJH 1FFPB 1P4LA 4NJ9H 3G5YA 2BNUA 1JP5A 5SX5K 4TQEL 3MRMB 5CCKH 4K2UL 4K3EL 1JPST 3D25B 4QNPF 1N64H 4BSJA 1Q9WA 1HDMA 1G7IA 1EERB 1TCRA 5D1QB 2O5YL 4QLRA 1FNSL 2DQJH 3MV8D 3H0TA 1HKLL 4PP8C 2WP3O 3QDME 1DBJH 1JZ8A 1DVFA 2GSGB 5EO9B 1JGEB 1M7XA 2BFVH 1ZLWH 1EJ6A 2WWKT 5DJ6A 2WINA 2XACC 3HC4L 5JDSA 4M7ZC 4DN4H 4FRWA 3DX9B 4NWTL 1D5IH 4RAHA 4L5FH 1JHKH 2CUHA 4Z5RB 5L9DL 3DI2B 4Y5VA 4MA8H 2GJZA 4OQ1A 5KS9A 1PZ5A 1BZ7B 2R23B 4U1LB 3S36H 3TO4A 3Q48A 2PYFA 5B4MD 1FNHA 5HYQA 4ZS7H 4HWNA 4PGDA 2ICES 4ZNEE 4HKJB 2XG5A 1A6TA 2VH5L 4I3GA 2BJMH 3KLHD 4O4YH 4JREB 4MAYC 4OSUH 3SJVD 4KI5D 2VDQH 2FB4L 2AXJA 1A21A 1UGNA 2EIEA 1M05B 5E1HB 2V2XA 1EXUA 5D1ZB 4H26A 4ODSL 1MUJB 4XB7A 4Q9RH 2D3VA 3OAYK 1N59B 4V1DD 3WSQL 3BKCH 4MXWL 2NZIA 4XP4H 4UIKL 4BUHA 5ESQB 1AXSB 1G9EA 2IANE 1KT2B 2A6JB 5SWQB 4DKEL 1NBYA 5IWLA 3H9SD 1IM9A 2IBZX 2X9YA 2OJZL 3I6LD 5A2LH 4V3EB 4F7TA 4XCYB 5EOQL 1NANI 5FV2A 5BZWA 4EIGB 2EXWD 3E8UH 3ILPA 3QFDB 1CGWA 3L5HA 3U30C 1LK2A 1EEZA 5J7CC 5C09E 1EGJA 3S4SA 4P2QD 4P23A 1B2WL 1FORH 4XVTL 4ZXBA 5I1CL 5I9QC 3TESA 3T2NL 3MZGB 5TQ0L 3KNBA 3DUUA 4U6VL 3WUWG 4L9LA 3KLSA 4X5WB 4HSQA 3HG1D 2C9AA 5DO2D 4XXDA 4IEFB 1CLCA 4AQOA 4ZFZB 2FCBA 1G7LA 2Q7YA 4MJIA 2G60L 3K8LA 3ARVA 4NHUB 1MCHA 3L95A 3ZL4L 1IAKB 3OJDB 4ZOEA 4PRNB 4FZEL 4QRPE 3DHJA 1MFDL 3O3AB 4OCSH 2DYPB 4B7IA 3EAKA 4JG1L 5IBUG 3W2DH 1VFBB 2H2SC 3UJTL 1I7UB 2WWMD 3MV9B 4JY5L 1JNHA 2BY0A 1ZGLP 3AY4A 3RGVC 1F4YL 1UB6A 2EE6A 1G6RB 1AXTH 2EKJA 3QQ3A 3SKOB 2CIIA 2ZCLH 5IMLB 4CU7A 1Z9MA 1VENA 1YEGH 1NCCL 3QXUA 3O6FC 1NMBH 1YC8A 3RWIA 1JNLH 1AKJD 5I8KH 1KGCE 4Z7WF 5D7JB 1QNZL 3LD8B 15C8H 3QUMB 1N59A 1EVUA 2O5XL 3MRFA 1I7UA 4NIKB 5I75C 1EUUA 4R3SB 4JO4H 1M7IB 1UWXH 2JIXA 5CWSA 4HX1B 1EO8H 2YPLB 2EC8A 3CXDL 3ZE0E 5HPMB 5F9OL 5KZCB 3O4LB 1U93B 2Z31B 3F7YA 1OTSC 4WIQA 2A77L 4IIQC 4M7LT 1U8HB 4JFXA 1BOGA 2MPAH 2W65A 4LCWB 4X7CC 3THMH 3U6RB 3QEHA 2BMKA 1RUMH 1WTGT 5DEZA 1J1OL 5CP7B 2AGJL 1NFDB 4V1DE 2DI8A 4OV5B 2RJMA 2J8UA 4X6DA 4G9DB 4OIBA 1QSFA 3FB5A 3WL9A 5BQ7B 4QHUA 5IK3B 4PJFA 3VFMA 4MNHB 2FNBA 1QFOA 3C9NB 3KNBB 3B4NA 5LGKA 2VWEC 2XKNB 1JE6A 3BPOB 4EI6A 3D6GA 2XFXA 1P69B 5JIHA 3DX6B 3JWOH 4AIOA 2NZ9D 1T83A 4PREB 3KYAA 2KUTA 1ZVYA 2CKBL 4HDIA 5J13C 3VJ6A 5TDPB 3DBXB 1FZKB 4N1CA 3DMMB 4H8WC 3MMEB 4P4RA 4FTVB 1UT9A 3WJLA 5D7SL 1LP9B 4D8PA 4EXKA 3ZE2F 5E2UL 5DJCA 1MREL 2XQBH 3UPRA 2NY2B 1KJ3L 4XMKL 5EUOE 3UYOD 1JZ7A 1IAOA 5MERB 1FL3A 4KJWD 4RAVA 5DVKA 4PRIE 3GMPB 3F7PC 1KLFA 5CKAA 1KTLB 5DHVH 4FNLL 2CKBB 1WBXB 1UXSA 5C08B 4ZS6D 4OF3A 3TJEH 5HXMA 3RX7A 1IC5H 4LNVA 1DBKL 4KZEH 2DLFL 2EXYD 2GY7B 1TETH 5GSRA 1MAJA 4G5ZH 4Q97A 3IDXH 4OGYL 1R24B 3EOTH 4N5EC 1UM5L 5D2NA 4XPAL 5F1IA 1MCWM 4NCC1 1WWCA 4OCYH 1TZIB 2DM3A 4S1SL 1AGBA 1Q94B 4EDWH 2PXYA 5KN5A 3G5VB 4UZGA 4KUZH 1XZ0B 3VRJA 1BFOB 2QQKL 3B9VA 3BJLA 3GHBL 3OF6A 4JG0H 4LHUD 4OLYL 3MTRA 3QIWA 1U8IA 5E2TH 2R1YB 3L5XH 4Z18A 4PYGA 4UU9B 3VFSB 3GMRB 5ERWB 2R2CA 4PLNC 5I66A 2AV1A 1S7XB 1MRFH 1V5JA 5HYJE 4YWGL 1MJJA 2OP4L 4QHLB 4NO2A 2D7OA 1AFVL 4HMDA 1G6RH 3GNMH 3KPQA 2VLMD 3NABH 3TBWA 4LSVH 5E8PB 3ARDB 1AD0B 4JQVA 4OZGF 4M9OA 4GT7A 3FQTB 2Q8AH 4IOIA 3I2CL 4GLRH 1LP9A 2IQAA 3IDJB 3WNNA 1LNUA 1OAZH 3E6FA 5DA4A 3MJ8A 3B2UD 1G7QA 5EU3B 3IAQA 4R0LB 2MFNA 3TBSA 3MFGB 3CFJB 4R4BA 4LP4A 2CIKA 1T2QH 3BP7A 4P46D 4ORZC 1U8QA 5KANG 4F57H 3QCVL 3WS6C 2FBJL 5AEAA 4RISH 5D1XA 5HHOE 3HMXL 2YK1L 4LCCB 3TN0C 4EBQH 3G6JA 2VXTH 3O6KH 5E2VL 5ENWB 3A6BL 1I7RA 3DVFA 1JN6B 3SN6N 3DPBA 1BF2A 3I02A 1I8KB 2ARJB 1GAFH 2V17H 3UCRA 3OKDA 4PJ9D 5I1DB 2ZG3A 5LAXB 3PL6A 3CGTA 4HS3A 3HI6H 1CT8B 1EAPB 4XBPA 5D7IE 4WV1B 1KULA 4QTIH 4APQA 2RHEA 5JXAL 2J8UF 4X6DF 4LLQB 1IC7L 3OGCB 2AQ1A 2HFFB 5B4MC 1EHLH 1UVQB 3ARXA 4B53A 3WIIL 4PJ7E 1KJVB 4OLXL 4JO3H 4GRMB 4PYHA 5B38A 4QOKA 4J1UA 4U1HB 2V2XB 2FJFB 1MRDL 3VXUE 4HIXH 4OZGE 5HHMD 3RGHA 3REVA 2WQRA 1YEFL 5L88L 2JB6A 2M26A 1I4FA 3B9EA 2HLAA 3VWKD 4EOWL 4WV1A 3CSYA 5I8EB 4M62L 4G9FE 4QRQA 2BZDA 4S0TD 4OKDA 2E7BA 4J3XA 3I85A 3NCBB 5FUZH 3CH1B 4EUPG 3LPFA 5AD0A 3KXFE 3QI9D 3G08B 3P0YH 5JNYB 2AQ2A 3HZMB 4YGVB 5LXGL 4KKAC 1PYWB 2FYYB 1D6EB 2R9HD 3OXSB 1A1NA 3CSPA 3V5HA 3VGHA 3B6SB 4KKBC 2FH6A 1NGQL 3WN5B 5F1SA 4C59B 1B9ZA 2NY2D 2CRMA 4P9HL 1JGUH 5I30H 3ZKSD 2X1PA 4JR9L 1GSMA 1FVDA 4MD5A 1NGYB 2FLBT 4FTVD 3TVMC 4WI2A 1Z6JT 4PRHB 3BIAX 3BPNC 2WBJB 4RQQB 5DRWB 2OSLA 3K74B 4X5WA 3ZE0F 2ZPKH 4JFOA 4AMKL 5FHBH 4PG9B 4ODVH 5A16A 1MLBA 4UV7H 3MA9H 5I76A 1J12A 4MS8D 3HR5A 4WW1A 4D0CB 5DRNB 3ZLQC 1QR4A 5ALBH 5IVOA 4YHIA 5AYUH 4Y88A 1XGUB 3G6DL 4U2YA 3MCG1 1MCOH 4CMHB 1IL1A 4N9GA 2X4TA 2Z8WC 1RURH 1M6OA 1ZA6B 3H7BB 5TE4H 1CFSB 4WY7H 2NY4D 1R3IL 3KPRD 1EEUA 3ILPB 3QFDA 1LO0L 3D2UB 1MNUH 2EICA 4TULL 1X5KA 3VXMB 3OB8A 5JOEA 3Q6FA 3CVIH 3V6ZA 2W9DL 1IQDB 2H2SD 4HK0B 4Q9QL 3BP5B 4RDQF 2MTPA 4N8VB 4M1GL 2W0LA 3V95A 3KVQA 4JDZB 1CU4L 2BDNL 2ATKB 1QFUH 3ZYIA 2WBJC 3TBYB 4ZODA 4XNUH 4EN3D 4KMQA 3C09B 3ZKQD 4MQXD 4KI5F 5CBAB 1FH5H 5ALCL 3R1GH 2DI9A 3TNMB 4RGMC 2Q7YB 4J4PA 2CGRL 3T77A 1GCFA 1X5IA 4O5LL 3GMNA 4HAGA 2Z31A 4W4OC 4HD9A 4NQVA 2DMCA 5E56A 3N1FC 2IADB 3QQ4B 5GGQL 2WLYA 5C6WH 4NQEA 5E8NB 1JF6A 4OLZH 3UJJL 2VXVL 1OLZA 4IIQB 2DLTA 4U1JA 3AM8C 1NAMA 4P5TA 4G8GB 5HYFA 4L3CA 5TDNA 3T77B 4HCRA 4OZHF 2OI9A 1DDHA 1WAAE 2IBBA 4FABH 3MRQB 5FK9B 3KYNB 4O2CA 1OGTA 1PSKL 3SJVE 2HT3D 5KVGL 1TENA 2GITB 3P4MA 1KB5A 3BEWA 1WC7A 3QCTH 1A2YA 4G43B 4KKNA 4DVBA 3ZTNH 4Y5XC 2JK5A 1NAKH 4H5SA 5ETUA 4N0CC 4NKIH 3WIFB 2H1PL 4DN3L 1BWWA 2P5WE 3G04B 1I9RH 5E2WH 1XGYH 3L3DB 5F6HJ 3M8OH 3D39B 1JGLH 1RJYB 1YQVL 4KGJA 4CADB 1QD0A 5CEXB 2N56A 4NQSB 4HKZA 2YSSA 4M61A 2HN7B 2VKWA 1XIWC 2IAMD 4X6BA 2VDKH 2Y5TB 3DOSA 2Z8VC 5CD5D 4E0RA 1YMHB 4P2QE 4OFYA 1AIFB 1R3KB 1UXSB 4LVHB 3VXPA 3ZDXF 4ONHB 5DRZA 3D39A 5E6IB 5I1GH 4LASH 4UIMB 4CADA 3R06A 3MRJA 2NY3C 5DJ8A 3BH8B 1HXMA 3O9WB 3D39D 4MGXA 2E8ZA 3L3OB 5AG9A 4V1DB 4O00A 4BSWB 2J2ZA 1HN1A 5FXCH 4HV8A 4O9HL 2B0SH 3BPLC 4IRZL 5D71L 5TDPA 2Z0BA 3PDOB 3MUJA 4MB3A 5BO1H 1SBSL 3JTSA 1FG9C 4P4RB 3SJVB 3N1QC 5A2FA 3HC0B 3QP3A 4HCRH 5GZOD 1RIHH 1LILA 3KJ4C 2OMBA 1NKOA 2YPLE 2YN3A 3Q3GB 1FLRL 3CMOH 4KTDL 1XZ0A 4K8RD 4XPGL 3UBXB 1KPRB 3I9GH 3QZWG 3SGJA 4NRXA 4MAYD 3JWDH 1UCBH 3QUYD 5T1KB 1QRNA 4OFVA 3QT2A 4DGYH 3PHQA 3PGDA 1I3GH 4V3DB 2YXMA 3QDGB 3OB0K 4KTDH 1N0XH 2AJ3A 2ENSA 1A6AB 4I18A 1WEJL 3O9WC 4FQLL 2NY6D 3PJSB 4OM1H 4UQ2B 1IBGH 2ED7A 4LRNH 1J86A 1NGWA 4UQ3B 1GJIA 5F1KC 5LVEA 1J1XH 3MV9E 4BZ2L 3IJSA 1IAMA 4QYOB 3IGAB 4YH6A 5H37G 1J1PH 1N7MH 4XAKD 4LK4A 5KAQF 2NW3B 4GO6B 2QKIB 4N9OB 3VGGA 1WV7T 3BVNB 1A0QH 3S88L 2EH8H 1P7QA 5ITBL 1VCAA 3DTXA 5C09A 2BOBA 2XZAH 4KJYA 4M93C 1GGTA 3GMMA 3PIQA 2R4SH 4LGSB 4ENEC 5KSUA 2A83A 3LSOB 5L7XL 4XVUD 1CFNA 3KPRB 2BNUB 4FN0A 3G5VA 1GOHA 5GRJL 2I27N 2EDJA 5F9JB 5E2WL 3MRJB 1IGCH 2P42B 3PXHA 3OHXB 4MAUH 5TE7L 3ZTNL 4DGVL 1UWEH 4N1HB 3P30H 1Y18A 1CVSC 3ZTJG 1VKXA 1W72L 5E8PA 1A6ZB 5L6YH 4RMQA 4PS4L 1HYSD 1KEMH 4KVCL 3SGJC 2LU7A 5CMAB 3ROLA 3RGVD 1MFCL 4WGWB 4Z76A 1R5WB 2X4QB 3T0XA 1IGFH 2I25N 1KC5H 2JF1A 1BZ9B 2CLRA 3UROR 2VLRD 5CJ5A 2C1PB 2QSTA 1XCTB 3TEUA 1T7WA 1OAYL 4J8RB 2W0FB 3GMQA 3INUH 4Y2OA 3QJFB 1BFVH 2D4FA 2EDLA 2FL5A 3TBVA 4MHHI 1BQLH 2C26A 3FFCA 3FAXA 1FH5L 2A1WL 1VADB 1S7RA 2DIJA 2Z92A 1YYLH 1J05A 2APXA 1OB1A 1I85C 3OKMA 3QUKB 1CI5A 4ELKB 1AGCA 2J4WH 4N1EA 1XCTA 4M6NH 1F3RB 3L5IA 4OZGB 4GMTH 5HGDA 3QI9A 4IS6A 3BKJL 4Q9BA 3OGCA 2VSCA 1KNOA 1MIEH 2D4DA 4HPYH 1KFAL 4UILL 1MQKL 1LO5A 4FZ8L 4QHLA 1KB5L 2CUMA 5JHDA 3LD8C 5BVJB 4TULH 5D7IB 3MJ9A 3BN9C 2DJUA 2NNAB 4ZFGL 3Q5YA 2DMKA 2BVTA 1C8PA 4G6JH 5IT2H 1U3ZA 2PW2A 3QWOA 3UTOA 4L8CA 1OGAE 1RURL 3EHBC 5EFIB 3TFKD 1FIGH 2H32H 3BPOC 1X4XA 4MCYA 2YR3A 3UTSE 4A2MA 2Y23A 5ALBL 1S7VB 4Y5VB 5TJWK 3TVMB 1YYML 3RWJA 1YNLH 2EDFA 5C0DA 1FZJA 1BZ7A 2R23A 2F19H 2NY1B 5HHOB 5C0RH 6FABH 1S78D 3GUTA 4U6XA 1IM3B 3JXAA 1LD9B 4GS7C 4NRYB 3UJIH 4U31A 2VLRA 2WNGA 4LCIL 4JEGB 3FB6A 4DZ8A 3L3GA 4YK4B 2CLZA 1JRHL 1CZ8H 1Q9WB 4JPVL 4HS8L 4UT6H 5BZDB 5I19H 2R2BA 2NY7L 4HZAA 4D9LL 2CK0L 3MV9A 4TVSa 4WDIB 5L8KB 4GKSB 4NQCB 1PKQE 1U3HB 1QP1A 4LSPH 4O51A 4WU7A 3MRLA 4ODWB 2O61A 4Y4KC 1KCVH 2B1HL 4PRHD 1UVQA 5A3IC 3MGTB 1K3IA 3EFDH 5EIVA 3U4BL 3O6FB 3MLVH 1S7RB 4M62H 5DFVD 3SHSA 1A7RH 1BAFH 2MKWA 1NGXA 1SJXA 1UG9A 2Q7NA 3RGVB 4RGNB 5DR5H 4Z0BL 1CTNA 2BC4A 5TQ2H 2KQNA 3W9EA 3CLFL 3MLTB 1QFWH 1MCKA 1H15A 4U1MA 3MUY1 1SJHA 2E8YA 3EJYC 1FLTX 1QLRB 2B1HH 4P9HC 1P2CA 5HJ3B 3MRPB 5EU5A 4R2GB 3FQNB 3VWJA 4PJDA 1E6JH 3I6GB 1J8HA 3O2DA 2QHLA 5EORH 3ARRA 5GSVA 3CFBB 3VFTA 3V5KA 4KWUA 1M1SA 3PWPE 3D2UA 5KG9B 4IRSB 5K9OA 4DUVA 5SV3A 2Y07H 3T0AA 1FNEB 4Z7VB 1IGYA 4RA3A 1CZ8L 3MV01 1B6DA 2W92A 3H42H 3S5LG 4XCNB 1F13A 32C2A 4R7NA 5IJVA 4LCIH 2X4PA 3RNKA 1FAIH 4LLUA 4DOHB 3NFSH 1ZT7A 3C2AL 4ZFFB 2VQUA 3IU3B 2ICWJ 5DD0H 3TA3B 1S7UB 2PXYD 4YDKH 2YUVA 1U8OB 3PV6A 5BW7A 6FABL 1T03H 1BVLA 1W0YT 3DURA 4PJXA 1FVEB 4UB0L 2OCFD 2ZCKL 4D94A 5E8DH 2VIRA 4CVWA 2YPVH 4F9PC 1RIVH 3TH4T 2P24B 2MOVA 4P46C 1XIWD 4JRWA 4QHNB 1CE6B 1C1EH 1OAZL 3HNSH 1LP9E 4S1QH 1LQSR 4HHAB 1IEBB 1LE9B 3VFNA 1KJ2B 3PWJA 4KXZI 2DBLL 1CIDA 3HNSL 1XR9B 4LSVL 1J18A 5C0BA 1I8IA 2VL4A 2RIKA 5DTFA 3TT1H 1PQZA 2R0LL 3JUZA 5B3NA 3MBXH 2AEIT 3MLXH 3OZ9L 3WYRA 4BFGA 1EAJA 4PJ9C 4TTDD 1WT5A 4Z7QE 4NNXB 3HKFA 1BFTA 3AREA 2R0KH 2HJKA 3FO9B 3GSUB 3RWCB 4LMQI 3PWJB 2J88L 4IDJL 3QRGL 1UFUA 2V5MA 4YXHL 1X9QA 3MR9A 1MCCA 4K8RC 1FFNB 3VG0L 4XGZB 4OLWH 3FCTA 3GEWB 4QTHA 2Y5TA 3HE7C 4R9HA 4K3DL 4P2OB 1KT2A 5GIRB 2EDRA 1EV2E 1QLFA 2DKSA 3AXLA 1KIPA 2Q76B 2G75B 2WK2A 4H0GA 4YK4C 1AC6A 1N5AA 1QO3B 2GHWB 2OM5A 5J6HA 3BP6B 5ID1B 4P3CL 1DQJB 1NGPL 1FPTH 3LEYL 3O9WD 2NY6C 2AJVH 3GK8L 2EIBA 1L0YA 2VDOH 3KPMA 4G5ZL 4YE4H 2GT9B 4XCNA 4YFDB 3TN0A 1F4WH 5ID0B 3DGCR 5BJTB 2X4PB 3QXDA 3IVKB 4JGMA 3V5DB 3I3DA 3P73A 2RFXB 5E5MB 3V8OA 3MLVL 3AMLA 1YEEL 3U4BH 3HRZB 1IILE 5KS9F 1P1ZA 1DUYB 2NY2C 4HMCA 4E9LA 4PTUB 1I9JH 4RMTA 4PB9L 4GXUN 4QCIA 3QG7L 3EYFA 4OFPA 3LOWA 5T1LB 2R1XB 3SO3C 1MCIA 3TT3H 4NKQB 2FX8H 5DRXB 5I19L 1I3UA 2X1XR 3QUMH 3T0EA 1IC4H 5D9SB 2FZ3A 2IPUK 5KVMC 1LE9A 2NX5B 4PJGB 5DWUH 4XVUC 5FDYA 1QA9A 4NQSA 1V05A 5KBNC 3RFZC 3LQMA 1NGWB 2EYRA 4X7SL 1TPXB 2XNAB 4RX4D 1K3ZA 1T0MB 4CMHC 1U58B 1TVHB 1F8TL 2NY4C 2HLFC 4ONFL 4NN7C 5FA4A 2AJUH 4PJFE 3WKMH 2CDEB 3GSUA 4EIZC 1KJ2H 1KCGC 5FO8A 4ZUVB 2J8UE 4X6DE 5C2UB 1N4XH 1UB5B 2F8OA 1Z2KA 3OF6D 1T1YB 2AGJH 3WHE0 3EYOB 3PIQB 2BNQA 4G7VH 2J1KA 1S3KH 3FN9A 1DJSA 3UPCA 2IPKB 4Y0GA 3RHWF 4AM0B 4HEME 2GJJA 2ZUYA 4O58H 5HHVL 4IM8A 4FZ8H 1F3DJ 2AK4E 5GRVL 1ACYH 1A4JB 2RCSH 3QDJE 4H1LG 4DGYL 2P4AB 3O6LL 3RWEB 1BF8A 3DV4A 4XVJH 1XF2B 2NY0D 1MWAL 2RCSL 4C83B 5DGRA 1U8JB 3GBNL 3C60D 5D2NB 3MJGX 2L0DA 3OKOB 2EO9A 5TGBB 2H32A 3O8XB 2VXUH 1OM3L 4L8SB 2R4RH 3BMWA 3O41A 5IW6B 2DDQL 3RJDA 1KN2H 1MELA 2IJ0C 1GC1L 2ZCLL 5J12B 1R3JA 1GIGH 3OKKA 4I2XA 4CVZA 4O9HH 4Y5YA 3KJ4B 1ED3A 2WANA 4X6FA 5GS2D 4ODXB 3G9VA 1XF2A 5D7IA 4KDWA 3RVUD 1Y18B 3BHBA 3QA3B 2VUYA 1U92B 4F8TA 3RVXC 1TTGA 3P9LA 3BPLB 3WKML 2VISB 5JPNB 1KB9J 2P49B 4FZEH 3KPSA 2VR5A 3VA2C 4TNWK 4HK3N 5HY9B 5GRYA 3TA3C 1XFPA 2FL5B 3FOLB 1BJ8A 3EUUA 3GJFK 3GMLB 1UZ6F 3HRPA 4HPOL 4GOSA 3CNKA 4HBCH 3RDTA 5HGGS 3GMMB 3T2PA 3B9KC 4N68A 4DGVH 1UH4A 2A0LD 5E8OB 1NC4B 2A9NL 5I1CH 3QJFA 1S78C 2A74A 1IGCL 2ZNWA 3F7QA 2EYTB 4BQBA 2FEDD 3SDAD 1KJVA 2H26B 1I9RL 1K5NB 3DROB 5CJOL 4C4KT 1FORL 4QOKB 2VLRE 3O3DA 1CXFA 1WISA 1S7TA 4MA3A 1A5FL 4HKBA 3G5XB 1NQBA 3KPSD 5GS0C 4X4XB 4YAQA 2APFA 4Y16D 1RJLB 3ARSA 4HBCL 3LV3B 3RHWK 5CIPH 4X4YA 2GK0B 2BVOB 4DKAA 2CLVB 3MV8E 4CJ1A 1QTYT 3WXWH 4L8BA 4WNQA 3HUJA 3HR6A 2IANA 4QXGL 1MEXH 2YBRB 2X70B 3GK8H 5A3ID 4DAGL 5IVXA 3D18B 3MLYL 1NC2D 5C8JA 3MNWA 2C3HA 4K3HA 3NTCL 1DQML 2OBGA 3MA7B 5CJXC 2E6JA 5F7WC 2ZCHH 1F90H 5GQBA 5DMKB 3RTQD 2A6DA 4K7FA 3QH3A 2H9GB 1J1XL 5DXWA 4XZUA 3AS3A 3QUYC 4LSTL 3VGAC 1OF2B 3B5TA 5KTEL 2VH5H 3OTTA 1RI8A 1YMME 1HDMB 3KXFD 1NMCC 4XNUL 4HFUL 5JXEC 5F7UA 4IDJH 1P53A 2AQ3A 3O3BA 4XAWH 1VEOA 1I3GL 4I3SH 4RGMB 4DK6A 4MA7L 3ARBD 3ARDA 4BQCA 3WJJA 2GTZB 5DMKA 1JZ2A 3GKWL 1Y6MR 4KQ3L 5C0AD 5J1AB 5HHQB 1OY3B 1F5WA 2NY1C 1Z5LB 3ZSTA 2NXZC 4UT9H 1GPOH 1CGUA 4HJGB 3NCJL 3F7VA 4KVNH 1IAIM 5EC1A 1ZWIB 2DIBA 3GI8H 4B41A 4PRIA 1A7QH 5DMGD 1JZ4A 4X9GA 4D9RE 1B3JA 5EZJA 4Y5XB 1N4XL 5TF0A 1CDYA 3LKPA 5DVOA 1SEBB 2VDLL 2DQTL 2P46B 1TMCA 3B43A 3QR2A 2BXYA 2DM2A 3MREA 3K4AA 1I8MA 3HE6A 4GW5B 1RIVL 2ARJA 4ONOA 4LVNC 1WIUA 2NW2A 4MXQD 4ZSOB 3FQNA 3TVMA 4PJEB 5HHPB 3O6MH 4DEPB 1BZQK 1J8HB 3PQYE 5IM7A 3IAPA 1I8IB 4FFEX 3LH2H 5MP6H 5DD3H 4F8QA 1HHJB 2I9TB 2BC4B 1JGEA 4JN1L 3WO3B 5AYQA 3NH7L 5DJ6B 4HKXB 2QADD 4KTEH 4U3XA 3NA9H 4XCYA 3WFCH 5I1KL 4TTDC 2FJFA 3M8OL 3F8UB 3D18A 1HYSC 2JB6B 5E8NA 4LPUA 5F9WB 1NBZB 1BPVA 4XRCA 4V1DA 5C3LD 3QIUB 5D7JD 3QFJB 3QG7H 1E6OL 1G7LB 2XOTA 3R4DA 1HINL 3TO4C 1RULH 4C4KO 2FO1A 2R1WB 1RUAH 4R26H 1G0DA 1KIPB 1H8OA 3SDXE 2QHRH 3IXTB 4FABL 5ICZB 3QAZC 3U4AA 1LP9F 3QEHB 1A7RL 3BPCB 3MRGA 1NMAH 3JV4B 5F6IC 3BMVA 4PJGF 3L3KB 2W9EH 2QHRL 4GBXC 1UACH 3DXAB 4WI9A 2DQFB 4HIXL 1KTDA 3BE1H 4POYA 2D7NA 4JO1L 5F8RC 3EFDL 5I17B 4JO3L 2JELL 3BH9A 3ULUF 4UMGA 4JPIA 2I07A 3MODL 4U1MB 1CK0L 1IC7H 4PJDF 5C6PB 4QHMB 4NC0B 4CMMB 2HJLB 5C92A 3LAFA 1OOAA 2Z93B 2CDFB 4JCLA 2C4XA 3R1GL 2NPLX 1QRNE 5DJ0A 5HVFB 5IF0B 4HZLB 3D0LB 4YHLL 2BCKA 2JJTA 1EEQA 3GJEA 2NW3A 1QEWA 5F3HB 3BN9D 4JFHD 3BZ4B 1UA6H 1XCQB 4GFTB 4M48L 4XNQA 3NCYP 2QR0A 3FO0L 3T4YB 3BZFB 2ZSWB 3MODH 1C12B 2GAZA 3TFKC 3DYOA 1G9MH 4PJAA 3U0WL 2UZXB 1YYMH 4PP1C 3TT1L 4LF3A 2Q3AA 1T2QL 4ZUUB 4LKXB 5HTSA 1DBAL 5FKPA 1OAQL 3PWLA 3BQUC 5C0FB 1MNUL 1FIGL 3AXLB 4JB9L 4Q2ZB 5CJQL 2OMNA 3SKJL 1MHHA 1JWUA 1MHCB 4G6JL 5F88A 4MSWB 3OKNB 3MLUH 1MCOL 4S1DC 4S2SA 5ADPL 1OAQH 4PY7A 5GS1B 4NSKA 4M7JL 1J0HA 2LAGB 1YEHH 5EC2B 4PJEF 1CDHA 3QHFL 3L3JB 3U0WH 5CD3B 5ITFB 1MIEL 4AMKH 4LLVB 4J6RH 3IS1X 4KQ3H 5ISZD 3PWVA 5DD0L 4I3RH 2FHBA 4ONHA 2BK8A 2X9WA 1G7HA 5CMAA 3GSNL 4JM4L 4Q6YA 3TPUA 3BZEA 4PTUA 4HIHA 4E41D 4AEEA 3MRGB 5JXEA 2YRPA 1F6FB 1GC1C 4JN1H 4P9HH 1V3JA 4D2NA 1DCLA 1MI5B 4CAGA 1HSBA 4LSTH 4FQQB 5D2NC 2P5EA 1NCBL 5SWSB 3A67L 3B2VH 2V6HA 5FA4B 5CGYD 5EO0A 3WFEH 4JFYB 5GS0L 3MV9D 3V0WL 5F3BA 4R4FL 2APBA 4NO2B 5FAAA 1VERA 4F80A 4NRXB 5IUSA 4XAKE 4LVHC 1IGFL 2DYPD 1D5ZB 5DJ0B 4JHBA 3MUZ1 4BQ9A 1KLUB 4JZNB 3OKMB 1MI5A 5DS8B 1NMAL 5KSUB 3D0LA 1FL5B 5KS9E 4F7CB 5T3ZE 2PO6B 3PGCA 3ZYOA 1IAIL 3HTLX 3C6LD 4Y19D 1XIWB 4GKNB 2AXFA 4MYWB 1RULL 5KN5B 4ZOAA 4Z8FH 1A5FH 4KY1H 1PLGH 4EI6B 5LKNA 1HH9B 3R0MA 1OAXL 4YPGB 3QDMA 3TA3D 2EDYA 2OL3A 4M43L 3UTQB 5F1IB 1HHIB 2J5LC 1NEUA 4M5YL 4PJEE 3VGBA 2PW2B 2ADJB 1MHCA 4NQXB 4CDGC 1XMWA 1CFQB 4Z76B 2A0LC 3HI1B 3PV7A 3RNQA 4HF5L 4HPOH 1WBZA 4IRSD 4NFBA 1R3JB 4HIIB 3Q1SL 4HKBB 2IFFL 5BV7H 1QYGL 4X0KA 3VGDA 3O6KL 4YAQB 2EH8L 4KUCD 4WTZA 2Y25A 2E6PA 1GGYA 3BWUC 3BISA 3BKML 4NO0B 3OKLB 5J13B 3SO3B 3CLEL 1JPGB 2AV1B 1IARB 4HUVA 4JFEA 4Y4FD 2VAJA 4K8RH 4P57B 3NFNB 4L3EB 3P0VH 4QT5B 1XGQB 2X4UB 3SGKC 1TTUA 5KSBE 1PJ9A 4BZ2H 3CDGA 3VXTA 1C7SA 3F6IA 1IBGL 1WAAF 1KV3A 1A9EA 2CQVA 2R4RL 3RWGB 2MQ3A 5IW1A 1X5JA 3FOMB 2Q1EA 3QH3B 2H9GA 3ZE1E 4I9WE 1KB5H 5ESVB 5DJYB 5ISZE 5DT1L 3I75A 1N6QH 4UILH 2YOCA 4N5UA 5BXFB 4WJ5B 5JW4R 3HE7D 2PYEA 1S9YB 4MVBD 3PP4L 2DKMA 1A9BB 3BP7B 1I1AA 5JHLL 3ZHDA 2VLKE 4QY8B 3LZFH 2CLRB 1OWWA 1NGXB 3VH8B 4MMZC 3MCKB 3SKNB 1RIHL 3AY4C 3RGVA 3TNNA 5MEOB 5I75B 1S3KL 2F74B 3DSNA 5F7FA 1NGYA 2APWA 5IW6A 4X4ME 2DMBA 5KVEL 1L6ZA 4QEGA 5F93C 4FQ2H 5BS0A 5FKAB 1S7TB 3QWRA 2NY1D 3VD5A 1BVKA 1A9BA 5D1QD 3F7VB 2NXZD 2ZUSA 1GGCH 3OR7B 4X98B 3RDTD 4XNYH 1SBBA 3V8CA 4E5XB 2X4SA 1ZGLB 4ELKA 1L9NA 5HD8D 1AQDA 1D5MB 3EOTL 2VB5A 5C0CE 1KC5L 4OZGA 2Z8SA 3VXUA 4X7FC 4QOKE 3VFRB 1S5HB 1YUHB 5IFHH 1GIGL 1BWMA 5F1OB 3SCMD 3OJVC 2YMXH 5EIIA 5KVDL 2DDQH 1NBVH 5D8JH 2GQHA 4KVCH 4HXAL 2BRRH 4HT1H 2J8HA 4BUGA 1W72H 5E70A 2ZJSH 3ULUE 3ZZ1A 4MXQC 2FBOJ 3CSYB 1X4YA 3ES6A 1ZGLA 1UM6L 3ZE1F 1VEPA 4NO0A 1UXWA 1EVTC 4WRLA 3C6SB 5JHLH 4P4KB 4XZUB 1HIML 1J87A 1FYTE 1WF5A 3D87B 1B2WH 4LAQH 1ZHNB 3AGVA 3QJHB 1HK6A 3C6LA 3EYVB 1NUDA 4LEXL 4HJGA 4TYUA 5E1AA 4HS3B 4AENA 3WO4C 2DLIA 2AS5M 2BVOA 5L8JB 3CSGA 2XA3A 4MD5B 3U30B 3SE3A 5ITBH 5D7JC 4Y8DC 2AI0H 5HI3C 5BXFA 3FB6B 4P2CG 3P9WB 4DZ8B 2AJVL 3QPQC 3UJJH 4KZDL 1H3UA 1OP3H 1KIQB 1RZIB 3PP3H 3CSBA 5D7JA 3IAGC 3SKMB 5EULV 2VRAA 2ZNXA 3HZYA 3D3VE 5TF1H 1KTDB 5GJTH 5BV7L 3UYPA 4X7SH 4GG6A 4FMFA 5I17A 2VDQL 2JJWA 2UZYB 2NY0C 2JCCB 4HF5H 4OM1L 2YUZA 5HYJA 3THML 3ME0A 2XWTB 1OGTB 2VXUL 4W81A 2NR6C 4UUJB 4ZFOA 2EYSA 1KIQA 2FX8L 3PP4H 1HIMH 1OAXH 3MUGA 1D5MA 5CEZL 3SDXF 2J8UB 2P24A 4X6DB 1UM6H 1D5IL 4NWTH 4HUUA 4PTTB 2VTFA 2YD8A 5I8KL 3RVUC 1I9JL 2P7TA 3HE6D 3CVIL 3T8XA 2OZ4H 1XCQA 4OCNC 4GUPA 3RVXD 3ULSB 4RFEA 2JIXD 2BRRL 4HT1L 4NQVB 1LO0H 5BRZA 5EC1B 3TBYA 3RVWD 2V7NB 1NCDH 5E4IA 1F4WL 2B0SL 5DUBA 5HGBB 1EO5A 1IGYB 5EOTA 5C0EB 2DJSA 3B3IA 4K3EH 1CGTA 4M8QA 3G6DH 1KF9B 4HMEA 5DRXA 4NNXA 4P3CH 1IGMH 1IRAY 2I07B 5GS0H 3FQWB 3L5WB 3LMJL 2AJUL 2XPGB 4GXUM 9CGTA 5IESL 4Z5RA 2NW2B 3K0WA 1IC1A 3H7LA 3QEQD 3RWIB 4ONFH 4QHMA 5FHBL 4WI3A 5HHPA 3ZL4H 4IOSD 5KVEH 5BW7C 4WWKD 4K3DH 3ULUD 1AGEA 1G7PB 2E3VA 1KG0B 4S1RL 3Q1SH 4MNQB 2ERJC 4WUKH 5HGBA 5E99L 1YEIL 5CEYA 1J7VR 4LNRA 1A4KA 3Q6FB 3QUXA 4KROB 2JKXA 2OI9B 1OCWH 3WDIA 1CG9A 1DN2A 4O2CB 4XI5D 1ONQB 4G6MH 1N0LA 4RWHA 1KIUA 5EU7E 1MLCA 3SDCD 4A6YH 1LWRA 1O7SA 1C5BL 4GRWB 4ZUVA 5GSRB 3OZ9H 1NAKL 1FJ1A 1JL8A 1W8OA 1MFBH 2Q87A 2XKSA 1QSFB 2XN9E 4HAFA 4M9PA 3C5JA 4J3TA 3LHPH 3H3PH 1AIFA 1R3KA 4Z0BH 5I71C 2DBLH 5IFAL 1AKJA 4I18B 5DEGB 2HA1A 3RTQC 1ZHBA 4HH9B 4S1QL 3FO9A 3RWCA 2QL1A 2WW8A 3GJFB 1KLGB 4KK6C 5F1NB 1RZ8A 3P0VL 4OCWL 1XF5B 3FT4A 4UBDD 5LGJB 3KWWB 1X5ZA 2YPVL 3FONB 1KJMB 3BPNB 2VLME 3CUPB 4HJJL 1LHZA 1FPTL 3L3JA 5E6ID 3SEPA 1BIIA 4EI5C 3ARYA 1BQHB 4F33A 5JXED 3BH9B 3RPKA 3U79A 2BSTA 4BFIB 1I3RB 4YDKL 1RFDH 1CXHA 2VL5B 3B2VL 2AXFB 2IFFH 3ARBC 3IETB 5JUEH 3PWNB 4D9QD 1ZHBB 4B5EA 1IZKA 4S2SB 4PIRF 3P4MB 4YPJA 3BT2H 3SKUD 5DUBB 4HV8B 1VA9A 3MRKA 4KROD 2OR8A 3FN3A 5FEBA 4OV5A 1T5WA 3WNKA 3QRGH 1KTLA 3IFPA 3ELAT 3LCYA 4JLRA 2X89A 4B0MM 4M43H 3WL9B 2OR7A 2X4NB 1PLGL 5DURD 2DTSA 1X4ZA 3QEQB 3V0AC 4HJJH 1ZOXA 1HH6B 2FGWH 1B90A 2D03L 5DC0A 2ZOKA 4JVUA 1IAIH 3HAEG 3GZKA 3H9SA 5JIKA 4E41E 1JI1A 4WI4A 1I7RB 5J11B 1P6AB 1T7XA 5H2BB 3HS0A 3CFCL 1DE4A 4TQEH 1MFBL 1KIRB 4Y4FC 2D7QA 2VDPH 3DTXB 4M3JA 2HTLC 1MCBA 1EHAA 2R0WH 4N0FA 2NY7H 3OR6B 2E7MA 5LGHL 4M48H 1T21A 1DN0A 2DWDB 4YFLI 5D72H 3HC0A 5L2KE 2GY5A 1E0OB 5EWIH 1OCWL 5L2JB 5JIIA 1K85A 3GDBA 3IDMB 1DLFH 1RZ8B 1YEIH 2G9HA 3REVB 1CDCA 1UB5A 4S1RH 1UKTA 3UTZA 2UVEA 4CW1A 4R0LC 1PBYA 4PJ7F 3QNZA 4S1SH 1CLZH 3BYYA 5IESH 5IEHB 4KRMB 3QHFH 1FV1A 4LCWD 1WIPA 3NZHH 4JFYA 2I60L 1WBZB 3S5LB 5CIPB 3D2UD 3IDMA 4Z9KB 5TQ2L 2HAZA 1QHPA 2H41A 2X1QA 4BA8A 4K23H 1Q72H 3QUXD 2D0HA 3VJ6B 1CDJA 4YZFE 2PYED 4KVNL 4PS4H 4PJFF 2MQ0A 5EIQA 3RWGA 5HI5D 5F89B 3TJEL 3NIDE 4NCC2 2COQA 1CLYH 2ZSVB 1E4KC 1G9MC 1FVDB 1ZSDB 4Q74A 1PG7X 3MV11 5HD8C 2AKRA 1RD6A 3KYOB 1HINH 1E6OH 1LEKA 1UWEL 3S36X 1FGNL 3ETBF 3VXRE 3MOAH 4WI7A 3BKJH 4FS0A 3S3JA 5IMKB 5JXAH 3DSFH 4LIQE 4MA7H 4MJID 2X42A 1U58A 5DMJB 4JPVH 4PG2C 3LPWA 4BYHA 5I1KH 3F6LA 5GZNC 4PP1D 2FLRT 4P0DA 4GW1A 1BQLL 2XZAL 1L4IA 3INUL 3EYUH 3EYVA 2YC1B 3MROB 4C55A 1CK0H 1I4FB 3HZVA 2E7LE 5MHSD 1A0QL 3EOBA 1ODAA 2F19L 1U91B 2FBJH 1FO0B 4JFPA 4IRJD 3FFCD 5SV4A 1WGOA 3VFPB 3QI9B 4OD1L 4JO1H 1K4CB 2G5BA 4NWUH 1BECA 5K9QG 1MEXL 1WWAX 1JYNA 3UTPE 1ND0A 1I8KA 5IHUH 1KEML 4POZC 2JJSC 1H9VA 5C0AA 3NA4A 2C3GA 4UTBH 4JREC 2VSDA 1EJOH 4NP4L 3V5HB 2IEPA 1BIHA 2MPAL 1AQDB 3CFKA 5JORB 2AAVA 4CJ0A 3VI3F 4J8RA 1K4CA 4DFIA 5FUOL 4LAQL 3JZ7A 4HPYL 1T89C 5E7FA 3OKKB 4F15B 1VFUA 1E4JA 1YY9C 2WIIB 3JVGA 5ICZA 4M6NL 4Y2DC 3ULUL 3JV4A 3CMOL 1JNLL 2L4OA 4F9LA 3ULVL 4N8CL 1MLBB 5I8EA 1YJDC 1SBSH 4RAUB 3VFOB 1NBVL 1QFHA 1YEGL 5KTEH 5DD3L 2F74A 1HCVA 1ZHNA 4FFYL 5IJKC 4GUPB 2XZQL 4UDTA 2GJZB 4GG8A 4H0IA 3HE6C 5KSAD 1D5XB 2ID5A 3S8WA 5KW9H 4PBWD 1N7ML 4OCSL 3VXQA 3BDBA 2DQTH 4NO0D 2J6EH 3BD3A 4MZ3A 5T33H 1W72B 1B0GA 2D7TH 3FRUB 4JRYD 4CVXA 5BV7C 4HKXA 3QPXH 4Z7UE 3OAYH 2B39A 2JCCA 1KUMA 1IEBA 4F7TB 3VXRD 3ARQA 4GAJL 3JTTA 1YPZB 1CCZA 1FZJB 3SKMA 4OZFG 3L5JA 1ZLUK 2X10A 4JM2A 3TO2B 2XI9A 3ALWA 4IOFC 5TE7H 4LKXA 3ARFC 1X5GA 3VFPA 1MCLA 4N0YH 1DEEA 2X41A 3C08H 1UCBL 3JWDL 4K55A 4XAWL 4Y4HC 1MREH 2XQBL 4JPWH 3ESVF 4GKZB 3GSQA 1YEJH 5BS0D 4MB5A 2IALB 2YBRA 1DL7L 2CH8A 2CRIA 2VNCA 3D0VB 4OZFH 5BRZB 5E1AB 4IRZH 3O45B 2PYFB 4L4VD 4PB0H 3CFEB 2W60B 5E4EB 5I6XC 4HKJA 5EOCJ 4PTTA 3F58L 5EOCH 3W0WD 3B8SA 1UH3A 4XP4L 1FYTD 4MVBA 3GSQB 4OD1H 1FL6A 4N8VA 4OLZL 5F9WC 3LKSA 8CGTA 2AI0L 1U8LA 5FM5O 4JFFD 2MKLC 1WC7B 3K2UH 4Y2DB 3TH2T 3EGSB 2OTUA 4DVBB 3T1WA 4M5ZH 4NGHH 3T0WA 1WITA 4MVBC 2VYRE 1A64A 5ID0A 1PQZB 1XT5A 5A2IH 3BO8B 1KN2L 1VGKB 3QQ3B 1JBJA 4H88H 4X7TA 1DL7H 4YBLB 4RGOH 4LEXH 4U7SA 4WHYH 3SDDC 3C9NA 1IQWL 1YEJL 1EBPA 3HB3D 1XGYL 3BX7C 4N0UE 2XKNA 1VFBA 1U8LB 1X5XA 4LKCB 4QRRD 2XFXB 1CLOH 4JDVA 3C08L 4LF3B 4O2EA 4ZUUA 4N0YL 5B39G 3WUZA 2EEBA 3BW9B 2P1YA 3O6LH 3P4NA 3W0WA 2A9NH 5D2LA 3MOAL 4NQTA 4GRLD 4NQUA 15C8L 1JI2A 1JWMA 4UDUB 1JTTA 3P4OB 2YD2A 4M1CC 4PJGE 2NX5E 4P2OA 5DF0A 3RDTC 5EB9A 4KROC 4LLUB 2BFVL 3FHQA 3NIDF 4HXAH 3ARFA 2GSIA 5IVXF 4JJ5B 4XCFH 3TA3A 5DSCB 1DUZA 2EE2A 4WTWA 2YMXL 1Q72L 5DQJB 3U6RA 4EKXA 2FECL 5E2JA 1ACZA 5CP7A 4U1NB 4XXDB 3KLHC 1HHJA 3P4NB 4G42B 1ZE3C 2VXVH 1YC7A 1YY8A 2X09A 2APVA 1JWMB 3MOQA 4LLVA 4U49A 3TCXA 5GGVH 3O4LA 3DNKA 3EZJB 3U7WH 1JGDA 2P43B 1N5YH 2XZQH 4Y5YC 4N90E 4FQ2L 2OTPA 2ZPKL 3QUZC 3VXOB 3ULVD 3LN5B 2B5IC 4W68A 1PG7W 2XV6B 4LPYA 2H45A 3CFIC 4QRUA 4WFGD 4OLWL 4WI6A 3TYFA 7CGTA 1OM3H 1DLFL 1YNTA 5IJKA 4TOYL 4OQTA 4N8CH 3GSVB 5BJTA 4PJ5A 5IHZB 1Y6NR 3O4LD 2OK0H 3LZFL 4JM4H 2UWEB 2XQYK 2RB8A 2CRZA 1A6UH 4MNGB 4MNHA 1IC4L 5E6IA 2X4NA 3DLQR 4F9LC 5HVWA 3X14B 5DUPH 2LTQB 1ACYL 4G8GE 1UEYA 5DT1H 1N6QL 4K7PX 2R0LH 2W9DH 5LXGH 4O2FA 4KC3B 3FCTB 1S7WA 3QPQD 1ZGLM 2R1YA 3QG6A 3ZYZA 5IHZA 4QGYA 4ZPVB 3OKOA 3MLUL 5GIRA 1QFWM 1PSKH 4L8SA 5EOQH 1S9WA 3HZKB 5TE4L 4JN2A 5IHUL 4WTXA 4JB9H 4NBZB 4HIHB 4PRPD 4PJCE 4C56B 2ED8A 2X89D 1RHFA 4LKCA 1KJ2L 5DC4B 1HHKB 2JJSA 2IMMA 3W0WB 4LSDA 1U8MA 3AS0A 3MCLH 2JK5B 1HHIA 1UM4L 3LEVH 3TM6A 1IGIH 2HJFB 4YEFA 4JN2B 5E6ZA 3HS0B 1BEYH 1TQCC 3NFSL 2CGRH 1KBGL 3JV0A 3HG1B 5EO1B 1Q38A 2FR4B 4M5YH 4U1SA 3N9GL 2J88H 1CU4H 5FA3B 3RIFK 3D85D 3QHTC 1J9CT 1JPGA 1E6JL 2FJGA 2VXTL 1NJ9B 4OZFB 1U8KB 2YK1H 4EBQL 4JFQB 5MEQA 4DOHE 1AGFB 5E00B 2JELH 3MLXL 3PGFH 4M02A 1L0QA 3VRLF 3WS6A 4NFDA 3MRIA 3BE1L 5T5NF 1RUQL 3D3VA 5DR5L 4XHJD 2MQCA 3KDMB 4CN6A 1I1FA 3TC9A 1U8IB 4WWID 1JTPA 3ZDYE 4K23L 3X12A 3NZ8A 4YHNB 1LQVA 5FIEA 5IFAH 4PRHE 4KK5D 1CXKA 3SDAA 1ZAGA 2VDOL 3DETD 4HGWA 3SDCA 5I1LB 4BSVB 2WQ8A 3TPUB 4R4FH 2XT1B 1NGPH 4G8EA 3LQAL 4Z7QF 2V9QA 1B0RB 1KPRA 5HY9A 5F9AC 5I73C 5FYJD 2CIKB 3VA6A 1R24A 4MDIB 1C5BH 2D9QB 3QIBC 4POZD 1MRFL 3X12B 4QRRB 3LRGA 5C7XH 4ELMA 5J1TC 4YHYB 1I7ZA 2YD7A 4MJ2A 4AM0A 1K9TA 3M1BA 1KXQE 3WFCL 4KTEL 4L3ED 3CD4A 4Y4FB 4LHUG 1I1AD 3QIWC 3PJSA 5DC9B 5J0BA 2BVPA 4WUKL 3IF1A 5FYJH 2Y07L 3TGXA 2R0KL 3BKYH 1NGQH 4P5MB 4AT6A 1OW0A 3LH2L 5MP6L 1MRCH 5LGHH 4KJPC 1HI6B 3MJ7A 2X4SB 4PJ9A 3EOBB 3KLAB 3WHE1 4OF5A 4Y2DD 4F57L 1PD6A 1R5VA 1FAKT 2WV3A 4UBDC 3IFNH 2H26A 5ADPH 4Z7WB 2J7LA 3T1FB 1FNLA 3GSOA 4NDMB 4YBHA 1CVRA 5L2KD 2VDLH 4EI5D 4WJ5A 4AYFA 1P9MA 3I2CH 3IDXL 4PRHA 4W4NA 5DI8B 3RWDA 1HYRC 4LPVA 4NO3B 4UUJA 4R97C 3AROA 1QSEE 3ZDXE 2XWJB 3NABL 4P46A 3P40A 4IMLB 1JV5B 2DWEA 1LD9A 1DBAH 1G6RL 1BBDL 5INDB 4QRSA 5EU6A 3RY6A 3UTSB 1T7VA 1ZSDA 4X4MA 3CDCA 3QBTB 1QACA 3QAZB 1I8MB 4L4TD 3RKDD 5JNYA 2XYCA 4N5ED 3H9YA 2ERJB 3EO9H 4LSUH 5JW4N 1UA6L 3CFJA 3SE4C 3SQBA 2DL2A 5I15L 4D9LH 4NO3A 4XMKH 3C2AH 3OR7A 4X98A 4YHLH 1QSEB 3RL1B 2YD5A 4EI5B 4WFFD 4NRZB 3HI5L 4BELD 2EDWA 2V17L 5EPMB 1FNFA 1KYOK 1VESA 4MJIB 1S7SA 4QRTA 4L8CB 3VFVA 2F8VA 3ARGA 2ENYA 4ETQB 4GKZA 4QT5A 1T1WB 3VXNB 3QO1A 1IGIL 3CCHA 1UH2A 3CU1A 4Z95L 1F90L 3S35X 5K59E 4Y4HB 5ESAB 4YJZL 4KZDH 3LKQA 4XBPB 4OF0A 4FQIH 3MLYH 3S37L 4JGJA 1S9XA 4OGYH 1DQTA 3QUXB 1LE5A 1UACL 4WW2A 4X6EB 4JFDD 1CG9B 5HYJB 3L6FB 2DLFH 4HGKC 1HILA 3V7AE 2VZUA 4UOW1 4X99B 3H3PL 2GK2A 3KYKH 4MXVE 4OBSA 5JA9A 2DBJA 2EKSA 5SWZB 5KG9A 3EGSA 1RAMA 3O11A 3P3YA 4U1LA 3P30L 4JVPA 1FNEA 4Z7VA 1KCVL 4RFNC 3SDDA 4MAUL 2A6DB 5F9OH 1B0GB 1MQKH 3FRUA 2FEEI 4G8GA 5CJOH 3MLSL 5ACLA 2CK0H 4U7KA 4HK0A 3G08A 4A6YL 4JO4L 1MCDA 3KGRA 1KEGL 4HS8H 1EDQA 2GEEA 5H35A 1A6UL 1D5BA 5FKAA 2R2EB 4RFNB 3NA9L 5MI0C 3L5XL 4TVPH 3I6LE 4CUCA 4J3WA 1S9VA 1J5OH 4YX2L 4JRYE 1NFDA 4WHYG 1W0WA 4PV9A 1L8JA 2FX9L 1XAUA 3QFJA 3S34L 3WNPA 1FFPA 5HHQA 4QHNA 3L3IB 3S88H 4EDWL 1F4YH 3DGGB 3EDJA 3QUXC 5F72S 4FQJH 1G7JA 4JDZA 4FXGA 4RZCA 4M1CD 5D7KD 4FA8A 2ZSWA 1PGRB 4LQ1A 4XNYL 2HVKB 1J1PL 3QZWA 4F7MB 3WFHA 2WSKA 3MRKB 1EEZB 2BSRB 1TETL 4HDIB 1NCDL 1DANT 1T5WB 3OV6A 5JTWA 1MFCH 2GTWB 1FZKA 4ZFGH 4PJBF 3OKEB 5TDNB 4FTVA 3NCJH 5I6XB 3L3GB 5MI0B 5LQBL 3VWKC 3BRDA 1GXEA 1BHGA 4Z7VF 4PRBA 2EDDA 2OZ4L 2P5EE 4FNLH 4HS6B 2CUIA 1NCUA 5GZND 4OZIA 1HXMB 3GBNH 4LGPB 1C16A 2HKHL 4GRLA 4P2RD 5HGAA 4LARH 4XVJL 3QI9C 4U1KB 3W0WE 1TFHA 1CLOL 2NTFA 4I0PB 5IW3A 2DKUA 4Z7NF 4ZXBC 2Z91B 2J4WL 3SPVA 1ZANL 5EBWB 4M8QB 2AEPH 2A9ML 4C54A 1IQWH 1FC2D 2Q76A 2WAHA 3ILQC 5HHVH 4I48A 2GSIB 4JFXB 5L0QB 3K1KC 4XNQB 2R4SL 4TNVF 5F44A 2BMKB 1DUZB 2K7PA 1H3PL 1AXTL 1LGVA 4OIIL 1CE1L 5IWLC 2OL3H 3C5ZC 4K8RL 1VACA 2ZZUT 4JFDE 1S8DB 4QXTB 5HGHA 1WCBA 5F9DC 1BD2D 4PY8J 1ZS8B 2L7JA 3WO4B 1LO4L 3F58H 2Y5EA 5EOCL 3RA7H 3WFZA 2EYSB 1CD1B 4HC1A 2ARJQ 4KJQC 1FZOB 5BCAA 3OAUH 4PB0L 5K9OB 5DHYA 4PDCE 1A1MB 4YHYC 1J8HD 1J1OH 4PJBE 5L6YL 2BJML 1FL5A 2XTLA 3ZMRA 2KDGA 3U7YH 4FQLH 3SE3C 5FCSH 3ECBB 3MMEA 4AQ1B 3VDAA 2W0PA 4D9QE 5B3JF 3R8QA 3RY5A 1MHHB 1DDHB 1BREA 3BUYA 3T2NH 1U0QA 2LU3A 4JPWL 3QUML 3RI5F 3S36L 4JFDA 5DJ8B 2YD3A 4UTAH 3ZKXC 2X1WL 4CVZB 4NKIL 4I0KA 4Y5VC 2ZG2A 3B5GA 3EKCA 4ODXA 1T04B 2A6IA 3PHOB 5LGJA 3GGWB 3NIGE 5KSAB 4PB9H 2ED9A 1M4KA 4ODBD 2BCKB 1AD0A 3V52H 4Q9CA 1BJ1H 4XC3L 2P5EB 2B7DT 5SWSA 5KVGH 1NMBL 3TP4A 5F3HA 4K3JH 4HIJB 2DQEL 5FYKE 5K9KB 1DBJL 4XP9L 1DVFC 3BZEB 4WEMB 2GCYB 3DVIA 2P8MA 4Z7UA 3QPXL 3VFUB 1L0XA 3ZDZF 5TH2A 3ARBB 2HFEA 4UIKH 2DQIH 1N2RB 1HOCA 3LEYH 3VD7A 3PGDB 5KSVB 3X13B 4LASL 5FYKU 3GMOB 5E8OA 4LL9A 4GKOA 4IOFD 4ODUB 3QSKB 1NCBH 5IHBA 3BGAA 4TNVK 4O5LH 1MCJA 2GI7A 2VN7A 4PY7B 4I18C 2FX7H 3VG0H 2ATPA 1D5ZA 5I8CA 4ZS7L 4P2RE 4LHUA 1T2JA 4R6UA 4LLDA 3V0VA 2DM4A 4U6VH 3O2WL 1FO0A 3GSNH 4JFPB 4U7MA 4LQFL 2W0FA 2G5BB 4PRPE 1WCBB 1ZLUH 3STZA 1U8KA 4XPFL 4J6RL 2NQCA 5JW3L 3BP4B 1QO3A 5J6HB 2IANB 4L4VB 4DN4L 4I2XB 2P47B 2XN9A 4X6FB 1I1AC 3MNZB 5I1HL 2GFBB 3FB8A 4YBQC 5FCUL 3EOYG 4LPTA 1X5YA 3MBEA 3E8UL 1G7MA 1HKLH 1S7QA 2FD6H 2O5ZL 4PV8B 4G7YH 4QOKD 4RBPK 1T22B 4GQ9H 43C9A 5DA0B