1N5LA

Crystal structure of mycobacterium tuberculosis thymidylate kinase crystallized in sodium malonate, after catalysis in the crystal (2.3 a resolution)
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
208
structure length
195
Chain Sequence
MLIAIEGVDGAGKRTLVEKLSGAFRAAGRSVATLAFPRYGQSVAADIAAEALHGEHGDLASSVYAMATLFALDRAGAVHTIQGLCRGYDVVILDRYVASNAAYSAARLHENAAGKAAAWVQRIEFARLGLPKPDWQVLLAVSAELAGERDNYERDAELQQRTGAVYAELAAQGWGGRWLVVGADVDPGRLAATLA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Mycobacterium tuberculosis Thymidylate Kinase: Structural Studies of Intermediates along the Reaction Pathway
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Transferase
molecule keywords THYMIDYLATE KINASE
total genus 74
structure length 195
sequence length 208
chains with identical sequence B
ec nomenclature ec 2.7.4.9: dTMP kinase.
pdb deposition date 2002-11-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02223 Thymidylate_kin Thymidylate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1n5lA00
5CJPA 5K8UA 3GJ3A 3N2EA 2D62A 2NPFA 5HZKA 1ZVQA 1FNMA 3EG5A 1Z47A 3KZ1E 4QBIA 4FCTA 1J8YF 4LV6A 2XZPA 4ITRC 3CLVA 4W5JA 1JR3A 3EC2A 1P4SA 3ZZ0A 4AD8A 2VP0A 1GDDA 1UPTA 2R2AA 1N6NA 3CNNA 4TMTA 3ZJYA 3ASZA 4IKEA 5AWFC 2AWNA 2DB3A 1P5ZB 3L0IB 3SR0A 1XU4A 4BWYA 1JJ7A 1G5TA 2GCOA 1Y63A 2ERXA 1U9IC 3DM9B 5EXXA 5BN3A 2VO1A 2GVDC 2OESA 4D4KA 1N6PA 3BE4A 1II8B 4E5UA 5KSOA 2R9VA 1P75A 1Z0DA 2QTVB 3B1VA 3PEVA 1EFHA 4LRWA 5FBVB 3CH5A 4C0BA 3FFAA 1ZC3A 2CE7A 4UNNA 1OKKA 1M8PA 2ODEA 1E0KA 3H4MA 3S1AB 2IS4A 1NIJA 4DWJA 3QUSA 2GHIA 2PL3A 4D0LB 4PZLA 3SE0A 1L4UA 1T6NA 1ONBA 1EX6A 5HTKA 5KDLA 3MWJA 1E2NA 4NCKA 3RRZA 1IY0A 2V9PA 2ANBA 4D82A 4KJZA 1P7CA 3L8ZA 4URZR 1WB9A 1QHSA 2KWIA 1CULC 5KYKA 1CLUA 2GF0A 2IYSA 1ZNWA 4C9BA 4BZPA 1FMJA 2ZE5A 4DSOA 3B6EA 1I2MA 2D2FA 4OHXA 1W7AA 2OZEA 3CNOA 4RD1A 2ZRAA 2WM9B 4V0NA 1D2MA 1FTNA 4R71A 3VX4A 4OQXA 5B30A 2R65A 5FTJA 2AN9A 4LGMA 1YR8A 1KJYA 2ZETA 3MWYW 3U61B 1SXJA 1M2OB 1ZD8A 5EUMA 1O87A 3GLHB 3NH6A 3T15A 3IQWA 3I3SR 3LAWA 1CJMA 1UM8A 4JVMA 4TYNA 2KB0A 4BLTA 2C9OA 3TQCA 3K70C 2ZYUX 2VF8A 1VCIA 1W5SA 2JA1A 1LW7A 1XTKA 3QPWA 3C7KA 3LBHA 3K0FA 4LDJA 4BUJA 1YRAA 4RD3A 1LS1A 3BC1A 1E79A 3NC0C 4DLYA 1E2FA 4X8LA 4QBGB 2VEDA 1MO4A 3ADBA 4M9QA 1XMJA 2QPTA 2GNOA 4II7A 1G3IA 1OYYA 2P0EA 3C5HA 4UXHA 4DC9A 1DVRA 5DYGA 5FPTA 2FZ4A 3LRPA 3KKMA 5F9HA 3ADKA 2QP4A 4MYUA 4FMBB 3T5DA 1U98A 1CR1A 2H92A 4KFRA 4XIGS 3LVQE 3MD0A 4B3GA 3ZQ6A 1IN7A 4S35A 3PUVA 3K09A 1PLKA 3TMKA 1ZMXA 2FFBA 3KKOA 3QXCA 3B13B 4Q7MB 2IYTA 2C2HA 3EZ9A 1VIAA 4NHOA 2P6UA 2XXAA 1XD8A 2F43A 1OE0A 1XB2A 1ZBDA 4Q18A 4CYMA 3QBVA 1G6OA 3TIFA 3K1JA 2JLXA 2VSXA 3OE7D 4MA4A 1NY6A 3KXIA 4N0DA 4IDPA 1IJEA 3ADCA 4Q4HB 3QPVA 1XEXB 4LHVA 1N3BA 1KI6A 2W6JA 3DM5A 3NBFA 4QBHA 4U02A 5FBRB 3UXMA 1E3MA 3EZ7A 2DBYA 1G8GA 2L0XA 5D3MB 3RS5A 3AVOA 3HDTA 3PUWA 2FH5B 3WMGA 1JALA 2PZGA 3VAAA 3VU9B 4F91B 3F3YA 4QC2A 1KI9A 1P61B 2EW1A 4L8GA 4WZBE 2D3WA 3RLFA 3OIWA 3AKYA 1SQ5A 5JWOA 1C1YA 2HT1A 5AUQA 1XZQA 1NN1A 4WOPA 5UKDA 2G1KA 4TQAA 5L3SA 2C99A 1QHNA 1G7RA 1I4TD 5EZ6B 5C1BA 4LJAA 3SBDA 1W4CA 2XNDD 4WVFA 1V5WA 1K5GA 3DKPA 5KSPA 4A8JC 3WRXC 2C9YA 2IF0A 2GKSA 3NG1A 2WAXA 3P4YA 1QHXA 5DI3A 5FOWA 3RRMA 3MFYA 3B1ZA 4DLSA 2ZU0C 2JLRA 4ERNA 2DFNA 2HF8A 1KOFA 2OLJA 3THXB 3QXXA 1VTKA 4BRUA 4JJZA 4P4SB 4BECA 5C4MA 1WDTA 4QG7A 1S2MA 5C2JB 1NVVQ 2YNMA 2Z5FA 1T0JB 2ORWA 2XB2A 2Z4SA 1WF3A 2BHRA 1OH7A 1XEWX 5IDVA 4LYAA 3A4NA 4ZKEA 2X19A 4CW7A 2FWRA 1OFUX 3FMPB 1TQDA 2R6CA 4JYBA 3WP1B 4A8JA 3ZYCA 4GZLA 4B32A 1SXJE 2F6RA 4H9GA 5FL3A 3UMFA 1GSIA 5LB2A 1X8KA 3FFBA 5DI9A 2F7SA 4CEIB 4RY2A 2AHOA 4C0SA 3KKNA 1RW4A 4V02A 3CRQA 2LWIA 4PO8A 5L3RA 2C77A 3WYFA 1SHZA 1UKZA 4MGIR 4D81A 4NONA 2FZLA 2IT1A 2J0UB 1JNYA 1SVOA 2VLIA 2AX4A 5H70A 2GF9A 1M74A 4LJ5A 4TLDA 1JQLB 3EPLA 4A6XA 2XZLA 3GLIA 4KFSA 3IPXA 3LVRE 2ZR9A 5L3QB 4B48A 3QVUA 3KTAA 4EDHA 3GEIA 3AVXA 1OYWA 1SZPA 5CJ2A 2WKPA 3MJHA 3TRFA 1HH4A 5FR2A 1LY1A 1DG3A 2AD5A 5HE8A 4IHQA 2IHBA 1TU3A 2FF7A 5AJYA 4JS0A 4C2TA 1G3RA 2ZS9A 3K0CA 1G18A 1P72A 1ZJ6A 2CBZA 2DR3A 3MGCA 5LPNA 2KI5A 4ZDWA 1XZPA 4QM6A 1UKYA 3IO5A 1QZXA 4EPYA 1ZU5A 5JS7A 2OAQ1 4QXAA 1IONA 4YMWA 4HLUA 5DE3A 5SZJA 2Q3HA 1P3JA 1YZQA 1Z5ZA 2BMDA 4V03A 2OCBA 3ZDQA 1KSHA 5FFMA 1T4GA 3HYTA 5JI3E 1SKQA 4W9MC 1J7KA 2YC4C 3LW8A 1QG4A 4L9SA 5JLJA 4IDNA 2GRJA 2WSSA 4URYR 3Q3JB 2YVUA 3NC1C 4PHFA 4Q4HA 2O0JA 2REBA 3THWB 2WWHA 4PANA 4FCVA 2O8FA 1W4BA 1XD2A 2CCGA 5C4GB 2XOKA 2WJGA 3EZFA 3I72A 2J1LA 2FE4A 5E4FA 2ZJAA 2ATVA 3LA6A 5DO9A 1KK3A 4RFVA 2ZR7A 1J8MF 2QPOA 3B7GA 4A0FA 4IOJA 4PAMA 2ZYTX 2Y8EA 2ZJ8A 4GZMA 4MH0R 2WJYA 2CLCX 4TL7A 4Q1DA 4TTQA 1EFUA 2WTUA 4B71A 4KLNA 1E1QD 2BKEA 1TF5A 2JLSA 2KSQA 5EXSA 1SULA 2ZYVX 2D06A 3MAAC 1J99A 1DTSA 2FNAA 3I92A 4LI0A 2BMEA 1QHHB 4KLZA 4XTCS 2QSZA 3PQCA 1V43A 1YZTA 3AF4A 5EZ5A 4D4LA 3C15C 1R6BX 4JL8A 5FUWA 4A2PA 3BS4A 3VX3A 1XMIA 2F1RA 4LK2A 3NHBA 1ZD1A 4B6EA 2BVNA 2QMUA 1KJZA 1OFTA 4MITA 2IUTA 4RD2A 1RE0A 2WVJA 3M6AA 2GBLA 5FOXA 4KYUA 4NE2A 3IBGA 3EPHA 3MJRA 2YOHA 3KKPA 5E3HA 5FPYA 4NL4H 1OXXK 1WMSA 1VG1A 2I1QA 4CT4B 2UVQA 4R2IA 2GZAA 4B3CA 3PFIA 2DFKB 4GNKA 4CEJB 4XTRA 2FFHA 4TQ9A 4A15A 1G7SA 4JBWA 1B0UA 2I3BA 3P4XA 4RVCA 2J45A 2JJ2A 1ZC4A 3CRVA 3R7WB 4YMSA 4D26A 1MABB 1CXZA 3WBJA 3ZH9B 1VCMA 4AI6A 2EFGA 4TYPA 2RGXA 2ANCA 3PR1A 4LYHA 1U8YA 1PLJA 1Q57A 3ND8A 1GOTA 3SNHA 2OLKA 2YOFA 2IA5A 2W2VA 2ONKA 3P26A 4RSGA 3VR2A 5KNCA 1KAGA 2J59A 2G0TA 3Q7QA 4XVUA 3GLFB 4KO8A 1OJLA 2OBLA 2ERYA 4MGZR 1OH6A 4Z54A 4CF7A 2J0VA 1N5JA 3L8YA 4FIDA 3IQXA 2ZI4A 3IBYA 2A5DA 4Q4AB 3CPHA 1KI3A 1N5LA 4ZCLA 5HKKA 4YONB 2G6BA 4C0QC 2OFOA 4TZ6A 1DAHA 4AG6A 1AGRA 1KO8A 2WZQA 2CDNA 1Z6TA 1NI3A 1ZM2A 2ODNA 3AF0A 3DEFA 3JZMA 3Q5EA 5HCNA 3L43A 1UADA 2GEUA 5TB5A 4P32A 2PX3A 4BFTA 4EPWA 4QOSA 4RKFA 1T0HB 4DIDA 5CITA 5F2EA 2IEYA 4HUQB 2GA8A 4KV9A 3RS3A 3P32A 1G64A 5KNBA 1TQ2A 4TMKA 4LUCA 2J7PA 3RANA 3EA5A 1RRPA 3G5UA 1CRPA 5J4HA 4G3XA 3CF6R 3R20A 5DHFA 5J4YA 5JEEA 1G7TA 1XXHE 5JSZA 2O8EA 2X2EA 2F9LA 4LYJA 4GPTA 1HE1C 1NL3A 1M6NA 1W2GA 2CK3D 3ZZUA 2R62A 3GJ7A 1UAAA 3EA0A 5C46F 2J0QA 1FPMA 3SQXA 2VHJA 4Q7JB 1N6OA 1COWA 4B3DA 1XBTA 3DVLA 4HAVA 4KU4A 3BB3A 3U3OA 3GPLA 2A7QA 4CT5A 4HDQB 4M1KA 4ACBA 2W6ID 1XTQA 1W47A 3GFOA 4C7OB 1GZSA 4UNSA 2XGJA 1UBGA 3ZVNA 3D31A 5P21A 2IYQA 3ICEA 4HATA 4Q4LA 1Z6XA 2K5UA 5KPJA 2ZVPX 2IUSA 3TSWA 1QHHA 1FUUA 1XTSA 1R5BA 5EXTA 3FB4A 2VHTA 3VKGA 3CX8A 1Q3TA 1VG0B 1Z6AA 4Z51A 3KQKA 1N0VC 2F55A 3ZD7A 5G3YA 3GJ4A 4ESHA 1Z0KA 2B8WA 2BKUA 3B78A 3TE6A 5BN4A 2CK3A 1E79D 3DMNA 3HPQA 2YC2C 4DT1B 5JMTA 1W0JA 3KQUA 2C04A 4YXWD 1XPRA 2VP5A 3R8FA 1BIFA 4O2LA 2OV2A 3A1VA 3JVUA 1JAIA 1E2DA 5CDFE 1N0WA 3OHMA 1W1WA 2FPKA 4IOLA 3Q7PA 1GL7A 2BWJA 2G77B 1P2UA 3K70B 2O0HA 1S3SA 4I4LA 4PZZA 4XWAA 3I8SA 2QY9A 1P2TA 1AS0A 4US0R 1DEKA 2JATA 4K8OA 4HI0E 2A78A 3LDAA 4OJKA 3V4RA 3KQLA 2FSFA 3KL4A 4I1OA 3ZD6A 3QG5A 1K6MA 3B5JA 3SQWA 1W49A 4DDWA 4FMDF 4TMXA 5LB4A 1YHNA 1SVSA 1IAQA 1KZ7B 2HEIA 4PSVA 3GFTA 5FUXA 1E2LA 2W00A 1P9NA 2ZI7A 3A1UA 3QF4A 3THYB 3U7FB 3VNUA 2G83A 5BWMA 1AN0A 3RSLA 1J70A 2W6JD 1NLYA 1Z83A 4ZV4A 1NBMD 1F5NA 4BLOA 2D7DA 3GLGE 4FD2A 4FW9A 4EPRA 4Q7KA 3LQQA 1NN5A 2OHFA 1U0HC 4GL2A 1OT3A 2BDTA 2GDJA 2CHVA 4FWIB 4GOKA 1RPZA 2WWFA 2ZS7A 4PC2A 1EGAA 4EUNA 3BB4A 1F2TB 2NO0A 1Q1ZA 4DCVA 5KSZA 1DBSA 4DRZA 3TVDA 3OFND 4GRAA 4IRUB 2MSEB 4LV5B 3W6NA 4B2LA 1P2VA 2XNDA 3CPEA 4NKRA 4PC6A 2DWQA 1IY1A 1G3QA 4LY6A 6Q21A 1Q1BA 4MRPA 2HDNB 4FINA 1K8RA 1XMVA 1XX6A 4TLAA 5JECA 4BLSA 4LPSA 2IXFA 2HCJB 4B44A 1Z0AA 1YZNA 2R6GA 1GVNB 1Z8FA 5CYPA 1RC8A 3T12A 1VIYA 3AVYA 4HB4A 1XDBA 3QSYA 4X8HA 5KPDA 1UBFA 4L15A 1NG9A 1ZW6A 1FX0B 2JDID 4YDSA 4QNRA 1D9XA 4LHWA 4IOMA 2QMOA 2PX0A 3LLMA 3ZGXA 1DOAA 2H16A 1NSFA 5DYIA 5FOUA 5TDHA 3R9XA 1W2HA 1H65A 3HPRA 3K9GA 2AK3A 5D3QA 4LOAA 3RC3A 3SJBA 3GEHA 4OK3A 4I1VA 1YQTA 1T3SA 2YYZA 1FOEB 1KNQA 3BWDD 4KAXA 1YZGA 2ZI3A 3NBYC 3VHXA 2UZIR 1VHLA 2VH5R 4M0LA 1OH8A 1VYUA 2CL0X 1Q44A 2ZUCA 3PITA 4WAUA 1E2MA 3KQNA 4C7OA 3HR8A 4N0EA 5H1YA 3TR5A 4RZXA 4DLTA 2W0MA 3DPUA 3TW8B 2FPLA 4F7WA 1SXJD 3I61A 5TXGA 1GAJA 3CIOA 5CIWA 4DLWA 5JCPA 1F6BA 4CEHA 2HJGA 4PZYA 2ZU6A 3QPUA 1TUEA 2QTFA 4PSAA 4TZ0A 5L8VA 4JBYA 3EPJA 1SHKA 3FMIA 3PJRA 4JZKA 1BS1A 4ZI3A 2MSCB 2X2FA 5FL7D 3VU9A 2N42A 3F0TA 4IXMA 4CGZA 2IYLD 5J40A 4RCYA 1R10A 4GFDA 1G291 1GKUB 2JCSA 4BQSA 1G17A 1E2HA 4FCWA 1YR9A 2E87A 3U3MA 1J2JA 5CDFA 3PEYA 4LBYA 2D2EA 1TEVA 2Q0HA 3REGA 5TARA 3AB3A 3IEUA 4UJ5A 2EYQA 3SU8A 4JSYA 4IDHA 3W8RA 3EWSA 4G0NA 4MUAA 3ZLJA 2IUUA 1RYHA 1E1RA 4NMMA 3IO3A 1KMHA 2NG1A 2PMKA 1OH5A 4FI3C 4JVSB 4OQLA 4B33A 1KK2A 2VA8A 5FUYA 3Q85A 3IEVA 1X1SA 3P1JA 4NH0A 1E2QA 1VCOA 4XJXA 4EKDA 2CMKA 2REOA 4JT4A 3QEJA 1NBMA 2QG6A 1KIMA 4ZO4A 4V0KA 2JLZA 5TY0A 1CRQA 4OI1A 2HXSA 2WSSD 1G6HA 4RD0A 4RKEA 3ZS8A 5KTYA 4R7ZA 2GBLC 4A4DA 4V0MA 4PFSA 2QQ0A 4Q1CA 1XCPA 1Q1QA 1T8TA 4WXPA 3TAHA 1S1MA 2XX3A 3KJGA 2ZSBA 2IHYA 3AVVA 3A4MA 3K8YA 3SDZA 2XTZA 2IYXA 4ZCIA 1AM4D 3LWNA 2GETA 2CNWD 4W7SA 1TPZA 5CK5A 2ZJZA 1ZYUA 1AZSC 3OEHA 2ZS8A 4QJ5A 4A36A 1E94E 4IFBA 2NO6A 1P9RA 5BQ5A 1ZAKA 1E32A 2UKDA 5GJWC 2QAGB 4NZYA 3QI2A 3L0SA 4HUTA 4QM7A 4NCNA 5CIQA 4URVR 2N46A 2ZRKA 3VR1A 4DLUA 1A5TA 3IIKA 2XEXA 3O8CA 4BZQA 3K0CC 1DAGA 1XTIA 1Q20A 5GVRA 4KI0A 1ZNZA 4Q19A 4PX9A 2Z6VA 4EPXA 4NTZA 4HB0A 5KO2A 3KFXA 4JLPA 1G21E 4ZDJA 2LKCA 2G3YA 2GAOA 5K8IA 2QUZA 4XSGA 3MCAA 1M7HA 3RC8A 3I62A 3KKQA 2IWHA 2FG5A 1OHHD 2X1VA 2ZVQX 3QE0A 3K0AA 2V3CC 2BBOA 4KCGA 2DWOA 3H1TA 3DZDA 2O8BA 3BAFA 4QHSA 1LF0A 3UANA 4AKGA 2VTKA 3VKWA 4LX0A 1JEEA 4KITB 2HCBA 1M1YE 1VKJA 4TT3D 1IXZA 2P67A 5JWHA 1IXSB 4RD4A 2VYFA 1MKYA 2IF2A 1CR0A 3FKSD 3BB1A 1VPLA 4TTPA 2WICA 3CONA 1G8YA 1CU1A 2WJJA 3RDPA 1Z06A 1G5PA 4PQYA 3BXZA 4C0JA 3F8TA 3A1TA 4I1UA 4QJ4A 5FPSA 2YKGA 4HAUA 4MYCA 1LF5A 2RGNC 4ZDIA 1P6XA 1N2CE 3CX7A 2Q9BA 1JR3D 2P3SA 3PXGA 1MO3A 1W36D 1KSJA 2CLDX 3GJ0A 1II8A 1GM5A 1TUIA 2E1RA 4JVNA 3CM0A 3CF0A 3HU3A 4Q03A 1Q0UA 4JLOA 2ZRCA 1GP2A 3UATA 4URXR 1NY5A 4E09A 3N70A 4KVAA 3B85A 3B60A 4D2IA 4ASUA 4HLUC 1TNDA 4PHTA 3KX2A 1NMZA 2Q21A 3CW2A 4A8JB 1QVRA 1T8UA 3E1SA 2GCNA 3K0EA 2ZITA 2WWWA 3EZ6A 4B2IA 2B7BA 1OKKD 2ZIAA 3BH6A 2RGNA 4LBVA 3I5YA 3AV0B 1ZNXA 4BFSA 1L4YA 3A58B 4PAOA 1KMHB 4UQOA 121PA 5GJCA 4Y0AA 1KZGB 3U4QA 4R2HA 2Q3MA 2DHRA 4JLDA 4LJ8A 4M9SA 3QJYA 4NYJR 2VP4A 2GJKA 1EFRA 2J0UA 4NP6A 5IHPA 3LX5A 1NVXQ 4DLXA 3FMFA 4OK6A 1GITA 5IF9A 1LB1B 1S9DA 4JT2A 4TYYA 3OESA 1EFTA 1TMKA 2CXXA 1S9HA 4XVRA 3KB2A 1HQCA 1T9HA 4AYWA 5JEDA 2P5SA 5AJXA 4CRWB 3B1WA 1MT0A 3BH7A 4PC3A 4JLMA 3EIHA 2PMDA 4EJSB 2FJUA 4KFTA 2NO9A 4ASUD 4KYIB 1G41A 2OT3B 1KNXA 1E9SA 1YVDA 2ZM5A 3MMPA 4JKYA 2ZAOA 2CLSA 4OI2A 4R9UC 1KI1A 3BIFA 1P73A 2ORVA 1N6RA 4I1SA 2HUPA 3PENA 1II9A 1NRJB 4LWZA 1L8QA 3EWAA 4Q1FA 1AS3A 3SJCA 3BERA 3U60B 1AQYA 1PJRA 2QI9C 621PA 3QEOA 3AKEA 4MRSA 2PT7A 4YC7A 4QKQA 1HUQA 1NKTA 3HU1A 2V1UA 1YJ5A 1IBRA 1ODFA 4PPGA 4QGHA 4Q4AA 1XXHB 2GWHA 5JCZA 1NSTA 1JXMA 2W0SA 4JBXA 1E96A 1LNZA 2G9NA 3WRYC 5JFGA 2YZ2A 4HSEA 3QKSB 4ZDKA 3VKHA 3FE2A 1YE8A 2IYUA 2RMKA 5CLQA 3QBTA 3QXSA 4CVNA 4A0HA 3EX7C 1BMFA 2VP9A 2P2LA 3RS2A 4TMVA 5IRCD 3ZIAA 3VFDA 2AWOA 1W44A 1E69A 4FMDB 4QGFA 1H8EA 4HB2A 1XEFA 4B74A 2BOVA 3UMRA 4DZZA 4BFYA 4LHXA 4LJ9A 2ZRFA 1S96A 3ZZTA 4W5HA 5HR5A 4QNMA 1VG8A 2ZI6A 3EIEA 1JJVA 4PQRA 4Q02A 4BFXA 1X86B 2DFLA 3KUDA 5E7JA 1X8LA 4KBGA 3BFKA 3TNFA 4HLQB 4ARZA 1K5DA 5KDDA 1HT1E 4BFVA 3S1AA 3UPUA 1OLOA 1ZNYA 5KHOC 3IGFA 3TVTA 2J5XA 3OEED 4F38A 1DPFA 1NBME 2MSDB 4KBFA 2BEJA 3SHWA 2BMFA 4Q5IA 2KE5A 3LFUA 5EXPA 1YU9A 4ABYA 1XWIA 1N25A 2V7QD 4PC7A 3T1TA 4V0ME 3RSOA 1FP6A 3EASA 2HYIC 2G0NA 1ETUA 1NF3A 1GTVA 1XRJA 3GMTA 4G5OA 2A5JA 1QVAA 3RABA 5GVSA 4HZUA 3IPYA 1BYIA 1CP2A 3TUJC 2XTMA 5FI1B 2ZRPA 3QXJA 4NYIR 4G5RA 3QENA 4EIWA 3R9WA 1I4LD 3NXSA 3QVVA 4MKFA 4P3YA 4A0GA 2JJ8A 4RZ3A 4TSFA 1PV4A 3WHLA 5DHAA 1OXUA 1HY3A 1H8ED 2D7CA 1DARA 1RJ9B 4IVQA 2CJWB 4NYIQ 5A5GA 4DLRA 1CS4C 1GRRA 1Q21A 1E9AA 1UDXA 2R6AA 2WAYA 3W8NA 2GJ9A 1WXQA 1XJ0A 3TAUA 3W5IA 1FMLA 3WYGA 2NQ2C 5JI2E 5EUQB 2QAGC 2HLDD 2GK6A 3CKLA 1E0AA 2JGNA 5JJLA 1GRNA 5M04A 1U99A 2GZHA 4XVQA 1N0UA 2AD1A 4P4SA 2XJ9A 5HZHA 2QROA 5L3VA 1JQJC 1LFDB 2RHDA 2ECKA 2GCPA 3RRYA 2Q6TA 1YKSA 1JR3E 2VIIA 3O47A 4B43A 1O3YA 3WNDA 1G3UA 1R2QA 4Q9HA 2F3TA 4IFEA 2FPMA 1II0A 1ZRHA 1F60A 1SKYE 4CDGA 5DN6D 1KGDA 3DKVA 4ZPXA 5KDOA 1XCMA 2AKAB 4GSYA 1W4RA 3M4YA 4DCTA 1IN6A 5FPKA 3NIBA 4TSFD 3QKRB 1KDRA 2ZI9A 1E2PA 1TTTA 3NBZC 4EPTA 3OF5A 1ZIPA 4DDVA 1BH2A 2RGCA 1EX7A 3F5FA 2JJ1A 5J4LA 1HURA 1G4AE 4TMWA 2JASA 2ZSAA 1OIWA 3FYHA 4TWZA 3K0SA 2FGJA 3AP1A 1R8SA 3B9PA 2FMXA 3NH9A 3QKUA 3QKTA 4JLNA 1AS2A 5IK2D 1E2JA 1G8PA 1ESNA 4B47A 4JYCA 4EFNA 1YR7A 2GXUA 2FFAA 4AIIA 3QF4B 4JJKA 3U6BA 2VBCA 4PTLA 4BRWA 4NCIA 3ZQJA 4KFUA 4HUQA 3W6OA 3QOFA 1DO0A 3U44B 3GLFA 3K9HA 3IIJA 5FL7A 3NEYA 2XZOA 1TL7C 1XXHA 1UDWA 1XEXA 4G1UC 4WBSA 2BBSA 3TGPA 2C03A 4UNRA 3BJIC 2PEYA 2FA9A 3JVVA 5GADl 4JMPA 1KK0A 3CUEF 2AXPA 1G8HA 1RKBA 1FQJA 4BASA 2B8TA 4B6FA 3PIRA 1GUAA 2YHSA 4MRRA 2AL7A 2PZFA 2RGDA 3U6KA 2ODWA 3DZ8A 1ZM9A 1XPOA 1DAEA 2ZRMA 4LHZA 1QBKC 3FGNA 4NCHA 2J87A 4LC1A 4RD6A 3X1ZA 4Y0VA 3TQFA 3H84A 3ZVMA 1FZQA 4HB3A 4BLRA 5SZKB 3U7GA 2ZAMA 1Z0IA 2WJIA 4M8NE 3SYNA 3CPJB 2J46A 3T1OA 3CR8A 4LHYA 2PJRA 3HU2A 4M9XA 4HDCA 4A92A 1Q3HA 1UBCA 1T3HA 2C95A 1C4OA 4M2LA 3VR5A 3WNCA 1D9ZA 3EIQA 1BOFA 4MDEA 4JVLA 4TL8A 5FI0B 4N1AA 2ZRHA 4IVPA 5KOYA 4EAQA 2QE7A 2XOKD 5JBQA 3DL0A 1TF7A 3B1YA 3A4LA 4LCBA 4OYHA 4F4IA 1CTQA 3KJHA 1KHTA 2PLRA 4EFMA 3SN6A 1H8HA 1Z6GA 2OAP1 2J3EA 2VSOA 2OO7A 1RJ9A 2NO7A 2NOAA 4GT1A 4JLAA 3CX6A 4E07A 1E9RA 4XWKA 2REXB 2O8CB 1LV7A 2ZRNA 1TF2A 2O5VA 3L0PA 4URUR 4Z8YA 4NPHA 2ZSDA 4G5SA 1OFHA 3BFVA 2JIZA 1N6KA 2QA5A 5FUVA 1AKYA 4PPQA 1VHTA 3X1XA 2WMOB 2EFDB 3GLHE 4DLVA 1PVOA 3RNLA 5BXQC 1ZP6A 5CK4A 4NYJQ 1E0SA 4ZIRB 2ONJA 3LO5A 1XD9A 4U7DA 1LS6A 1TX4B 4IOKA 2BJVA 2CHGA 4DT1A 1X6VA 1UEJA 2LCFA 3E70C 3W90A 4AWXA 5L3QA 4BEJA 5SZHB 1QHIA 4PHGA 4TMZA 1OB2A 3H2YA 4NDZA 1OXSC 4XOIA 4FMCB 2PCJA 721PA 3C16C 4QHYA 1SVKA 2Q9CA 1RZ3A 2ZTSA 3VTKA 3OFNA 4D80A 1SVWA 2VHUA 1VECA 4DEYA 1I2DA 2H57A 4PPNA 1WP9A 1P9WA 2YWFA 2Q9AA 5ELXA 2RHMA 2FDCA 2Q3FA 3LXXA 1JAHA 4KVGA 2ZEJA 2O0KA 2I4IA 1Z6YA 2ZI5A 2O8DB 4YMUA 3H0KA 1PZNA 2BC9A 4F4CA 4C30A 3ETLA 1OXTA 1S0UA 2FEMA 5FBQB 2NMVA 3GLFE 4BLQA 2KBFA 2FU5C 2C9CA 2GJSA 4GP6A 1G19A 1KDPA 1U0JA 2KJQA 4IW3B 1P62B 1FX0A 2XAUA 2ODBA 4LJYA 3T61A 8OHMA 3U5ZB 4A1FA 3Q9LA 2NIPA 2GTPA 1N5IA 4B3FX 2FEOA 3KTAB 1D2EA 1NN0A 2VHQA 1WQ1R 4MUBA 2OM2A 2QN6A 2ZQ5A 2RCNA 2PT5A 2ZRGA 4AY2A 1COWD 1ZCBA 2ZREA 4POAA 1UBEA 1TQ4A 4M4SA 2P65A 5FOVA 3WHKA 5DH9A 3LX8A 1F2UB 2OUKA 3ICQB 4IXNA 4HEJA 3OZXA 1NN3A 3TW4A 3REFA 2GXSA 3LNCA 3DO6A 3DDCA 4C3ZA 2ZRBA 1KDTA 3EARA 2O8EB 1MRSA 4AK9A 4W5WA 4TLCA 4ACAA 1G20E 1ZM4A 1X3SA 1RRFA 1MOZA 2B21A 2J7PD 2WHXA 1UFQA 3AH8A 4YDHB 4ZI2A 2XJ4A 2ZJ5A 2EFCB 3I73A 1OB5A 3GLIE 2DCUA 4Q21A 4BGDA 3AF1A 3TR0A 4CEHB 2QPAA 2BJWA 4GP7A 5LD2C 1KI8A 2AR7A 2J7KA 3BRWD 1CIPA 4IEIA 4JIMA 2MMGA 4UKDA 1DE0A 4PQFA 3WXMA 1IXRC 1AQUA 2HT6A 1BO6A 4H1VA 4DSTA 2ASEA 4A6PA 4MRNA 1Z0FA 4B3XA 3K53A 2PCLA 5JRZA 3CWZA 1IN8A 3C4JA 1MO6A 3D8BA 1US8B 1ZUHA 2WBLC 3RAPR 5JRJA 4B34A 2B7CA 4EQ6A 3JZAA 1KMQA 3TLXA 1QRAA 4H1UA 2QL6A 4V0OA 3SBEA 5CB8A 2QENA 1JI0A 1G1MA 1KO1A 2A9KA 3HR7A 4K81B 3SI7A 1DAFA 4C4PA 3PEWA 3PV0A 4YLGA 1KDOA 4ILEA 3LV8A 2RGEA 3Q8XB 3R7WA 2RGAA 1GIAA 4A2WA 1SXJB 3TJZA 4NYMQ 5H8WA 2CCJA 2GJ8A 4MRVA 3K09C 5DNYB 3FMOB 3C41J 3FWYA 3FPAA 1YRBA 4O0MA 1R8QA 3PCRB 4PSKA 1KAOA 1T3LA 3WP0A 5B2ZA 1KO4A 5H68A 1GNQA 2IXGA 3E5HA 3N2IA 1YZKA 4DLZA 4QFMA 1W46A 3KXKA 1GL9B 4Q7LA 5CM8B 4ZIRA 3CB4A 2OFXA 2JLUA 3CR7A 3VQTA 2N1BA 1RIFA 1XJCA 4M1WA 4TN1A 1XTJA 3SZRA 4DVGA 2Z0MA 1Z3IX 3C8UA 1NLFA 3IHLA 4JLKA 4LJ7A 4WW0A 4M1YA 1Z29A 3CBQA 4US2R 2WSMA 4CEJA 1GRQA 2XB4A 3U4QB 2QAGA 3RYTC 2GK7A 2G1JA 2FOLA 2OBNA 5JS8A 2X8AA 3GFPA 4DJTA 3FOZA 2ZRDA 1E99A 2QNRA 2O8DA 4NBSA 3FDIA 2A5GA 3Q72A 3OEEA 2V8OA 3G0HA 1GWNA 2RGGA 2OE2A 4L9WA 1GL6A 3SYKA 2V6IA 2WV9A 1AJEA 3Q5DA 2DWPA 1G3MA 3FKQA 1R5NA 3CRW1 3I8XA 4M21A 3TK1A 2O8FB 2W2XA 1KKMA 3K9NA 2J41A 1KO7A 1RYFA 3LD9A 1NNEA 2QMHA 2BBWA 4PO9A 1A82A 5CM9C 2WPDD 3SOPA 2O8BB 2IW3A 4I81A 4ON9A 4TT3A 4NYMR 1WRBA 4U5XA 3K0AB 1M7GA 3OAAD 3O8DA 2IYVA 1E9FA 2IWRA 3TSZA 3AP2A 3FKSA 3VMFA 4OJQA 4OHVA 4L4UA 4HYYA 3ND9A 4QRHA 5CLLA 2XSZD 3EAQA 1JB1A 3TUIC 3QNUA 4HAYA 4ZKDA 5JHGB 1IN5A 2PBRA 3IKJA 4YMVA 5G41A 3EXAA 4Q1AA 2HV8A 3GD7A 1QF9A 5DSZA 2VPPA 1G9XA 1M7BA 1UF9A 3U3RA 3VHLB 5D3MA 2EU8A 4OHWA 1C9KA 5DI3B 1QHYA 2V1XA 3WMFA 1R5OA 5FTKA 3GEEA 4D0GA 4A82A 2RKOA 1NVUQ 1ZU4A 1XPUA 4LV8B 3O8BA 4JKIA 2IYWA 3H86A 3DOFA 2DFTA 1TU4A 1TADA 2KBEA 2OCAA 2H17A 3PUYA 5DIFA 1YZLA 1IQPA 1RFLA 4CIDA 4F4JA 4Q9JA 4GOJA 1UKVY 4OL0A 2EVWX 1WBDA 1E4VA 2QSYA 2D4HA 3NWJA 5TMPA 1Z63A 5EE0A 4EJSC 1EK0A 3D3QA 1G5RA 1ANKA 1U8ZA 3DOEA 1KSGA 3UG6A 1IY2A 1OV4A 3KJEA 1KY2A 1UKEA 1U2RA 4XWOA 4BE7B 5IK2A 4P33A 3THXA 1FUKA 4M1TA 3I32A 2XTNA 2YV5A 4PPFA 1XEWY 1E9EA 1CBUA 2R44A 2UZ3A 4BFUA 1XFAA 3AVPA 4KXFB 1E9CA 3LXRA 1FL9A 5J5CA 5J47A 1VCNA 1W36B 5LBIA 5FOTA 2W2TA 3UIEA 4F93B 1JXOA 5BW8A 3V4FA 4D0NA 5FTNA 1A2KC 3K0FB 2QAJA 4E03A 3GLIB 2BM1A 2W6IA 2PZEA 3BH0A 4Q00A 2NGRA 5FH9A 5EE1A 3T34A 3SC3A 2YOGA 4AYTA 2AXNA 3CZPA 3HP1A 4NU0A 2V55B 2FFQA 3C5CA 3NVAA 2WJHA 4BEBA 2R8RA 2GEDA 4A9AA 1KK1A 4DXAA 2NZJA 2DPXA 5LDDC 3A8TA 4U00A 2RB4A 3GLHA 2OXCA 4M22A 3KQHA 1F2TA 4JSTA 1WCV1 2C5LA 3RS4A 4TYWA 2FV8A 4HDOB 3CO5A 5KNDA 1R0WA 2QZ4A 1XTRA 2BM0A 2W58A 4GMDA 3DHWC 1EESA 1NJFA 2DY1A 2ZYWX 1NLZA 1A7JA 2OXRA 3NDPA 2F43B 2P6RA 1ZD9A 1XF9A 3VNVA 2QEQA 1EG7A 3K9LA 2YWEA 1P60A 1MR3F 2GXQA 3SJZA 1E9BA 3AVTA 1GNRA 1Z2CA 1Z0JA 3ZIAD 1X8JA 1UJ2A 3QQ5A 421PA 3GLGB 2SHKA 2GVZC 3THYA 1SVLA 3BBPA 1QHGA 1TQ6A 3I4LA 4PC1A 2CCKA 3ONWA 2IX3A 5F9FA 4US1R 1KI6B 1HE8B 4BFWA 5FOSA 4DUGA 4YQFA 1DAMA 4TLBA 4MDFA 5AJVB 3P20A 5BN5A 5DLQC 3IILA 1Z08A 1Z28A 4Q01A 2EWWA 3BGWA 3TKLA 2WKRA 4WIAA 4MGKR 3HJNA 4AG5A 2V6JA 5SZIA 3QF7A 2WOOA 2P6NA 3EC1A 3MRSA 4NCJA 2H7VA 3PG5A 1EFCA 4P4UA 4KODA 2WIAA 4YXWA 5FTLA 1HV8A 3QIAA 4A0RA 1E4YA 1N5KA 2OG2A 5EE5B 4GBMA 521PA 3UG7A 2QGNA 1YR6A 2QP3A 2V7QA 2WMNB 3GP8A 2ZPTX 5DISB 5K8TA 3FHTA 3CZQA 2QQEA 1CKEA 1CEEA 1NJGA 4LSGA 4EPVA 1QG2A 5JJKA 4AKIA 1B23P 4CZ2A 2C8VA 3QKSA 2QRZA 3QXHA 3CNLA 5G53C 3UMSA 5AK0A 2V54A 1NMYA 5EP2A 1GG2A 3W3AA 2JEOA 3OIYA 2CL6X 3AUXA 5EE3A 5BYKA 5F98A 4GDFA 4OHYA 1S1CA 1NG1A 4RZ2A 2ZUDA 4P4TA 1Q12A 2B92A 1HTWA 1US8A 3AKDA 1KTVA 4Z1MA 1RRGA 3SS8A 821PA 1RRCA 3AVUA 1Q1EA 2GXAA 5DN6A 2OCPA 3WBKA 3X1YA 4HZIA 5F3WB 3AVWA 5AUOB 3UK6A 3K70D 4FWTA 4DSUA 2V4ZA 1RVDA 4Q48A 1S3GA 3LLUA 4D4MA 3GQBA 5J4VA 2PLFA 4DBLC 5L3SB 3OE7A 4IEEA 4QGAA 1U90A 4HAZA 4IDQA 3NKVA 2ZJYA 3W5JA 3EPKA 4CEIA 3U3JA 2JJ1D 1N6LA 3A1WA 1N6HA 5GJBA 5JJIA 2JLWA 3GJ6A 1NVVR 2ATXA 3KB1A 3KJIA 2AFHE 4HLDA 4MYHA 3HWSA 4Q1BA 4PHHA 5B57C 4Q9LA 1NKSA 2NTYC 4PXAA 1G4UR 1VDZA 2IEZA 1KYIA 4V0LA 4KSBA 3RVBA 1CF4A 2G88A 1D5CA 1LVGA 1VYTA 3DMDA 2GILA 5EP1A 1TEXA 2VP6A 4LBZA 1Z2AA 4B3BA 5KU1A 2OEPA 5EQTA 5CYOA 1NIPA 1JEDA 4MKHA 3W6PA 4ESVA 1W48A 2EYUA 1Q22A 2O8CA 3T1VA 3AUYA 2QT1A 4S2EA 2QM7A 2QRNA 4PO1A 2YINC 4UNPA 1JECA 2CJWA 3BK7A 3RS0A 2ZSEA 1T5IA 3WNBA 3IUYA 2LKDA 2WWIA 4IDOA 3CF2A 2FN4A 5GJVC 4HAWA 2JDIA 4G5QA 4RZUA 3BFXA 3QY0A 2WKQA 4OKSA 3PVSA 4AKEA 2JJ2D 3EW9A 4BFZA 1JR6A 3QG1A 4TYQA 4M1OA 2R6DA 2ZJOA 1E2GA 2RGBA 3PUXA 1CR2A 4C0AC 3T06B 2BIFA 3LBNA 5KSYA 3PEUA 1TAGA 3FTQA 2BMJA 1E2KA 2XNSA 1EFRD 5TVKA 2RAPA 4RCZA 4WXRA 1NVWQ 1QDEA 4N3NA 4OQMA 1R0XA 2JAQA 4DUGD 1NMXA 3MG9A 1ZM7A 2J0SA 4DEXA 4JLJA 5BYJA 5HCIA 1IJFA 5JSZB 4DHEA 4OI4A 4WA7A 3THWA 2ZRJA 1FP7A 1UEIA 5A0FA 1OW3B 3U7HB 1XJQA 1KSFX 2FSHA 2EQBA 1G8FA 3IDQA 3I5XA 4LJ6A 2VF7A 2VHCA 1CR4A 1D8TA 2X77A 3AQ4A 3FHOA 3RRNA 5HKKD 1A1VA 5EJEA 1NP6A 1SVIA 2IL1A 2GEVA 3BD9A 5FBLB 3B1XA 1JPJA 2ZANA 3NBXX 4QBFA 4K46A 3TH5A 4DCUA 3D6TB 5KUTA 4C0HA 2H1LA 1CJVC 2ZSFA 2WWGA 2A2ZA 4Q1EA 2OSBA 3U44A 2ZE6A 3NEJA 4FXPA 1WA5A 5E7MA 4DCNA 1VMAA 1MO5A 5FBWB 3AEZA 1GNPA 4C2UA 1E2EA 1DAKA 3GCGA 3M1IA 4PAQA 3SEAA 1OSNA 1XD2B 2QMEA 4MQBA 4Z8XA 2O52A 4I99A 1ZCAA 4BZXA 221PA 5A4JA 2IYZA 1AGPA 2EFEB 2VSFA 4EFLA 5J4KA 3TUZC 3L2OB 1BYUA 2J9RA 2NPIA 4M53A 1HA3A 1KY3A 1W0KD 2YWHA 1LTQA 1GILA 4HAXA 4E22A 4DDTA 3SFZA 2FX3A 2CL7X 2GCOB 1ZUIA 3AVQA 3GJXC 1T5LA 3O8RA 2XITA 1Z22A 3AF2A 5ANRB 1E0JA 4F92B 4YMTA 2DYKA 2PH1A 1BKDR 4G5GA 2A5YB 3BOSA 5AJZA 2WOJA 3X1WA 1D2NA 3MUFA 4C0KA 2BBTA 2HLDA 2NZ8A 2EFHB 2HYDA 4XD7D 3J81k 2CNWA 1KKLA 4G01B 1OPXA 4HZUB 4DIEA 3A6PC 3OEHD 1AKEA 2IS6A 3TBKA 4P31A 1HT2E 2H5EA 4OK5A 4OQFA 1W36C 1JBKA 2OCYC 2WWYA 4RFSB 3C14C 2OBMA 4X8MA 3AGPA 1S8FA 1DELA 2BV3A 4PR0A 3X2SA 4M1MA 1GKIA 4RJLA 4UJ3A 1AK2A 3AF3A 3VR4A 3ZVRA 3TSOA 2ZJBA 3THOA 4B73A 2QTHA 3AP3A 2ZE8A 2WPDA 1HEIA 2AKYA 1IOZA 4EJSA 1J90A 1E6CA 2FSIA 1XNJA 4AYXA 5JWRA 1EXMA 3LW7A 1S4QA 3OAAA 4URWR 3ASYA 4TTRA 3W34A 5HPYB 1ZUNB 1L2TA 2WIBA 2BCJQ 1OHHA 3KDSE 4QL3A 3KUCA 2XSZA 2P5TB 3FVQA 4RFSA 2IS2A 1IM2A 1OIVA 2IXEA 2ZUBA 3RHFA 4TL9A 4XD7A 2JLQA 5FTMA 3SFVA 1A4RA 2AFIE 2QGZA 2GAAA 2ZRLA 3I1FA 2CHQA 5AUPB 1IN4A 4TLEA 3LBIA 4Q9KA 4OI0A 5G3ZA 4WZAE 3X1DA 2QP9X 1E9DA 4MKIA 3ZS9A 3ECCA 3VR6A 3LQRA 3CRMA 4LPKA 2GZDA 3R8CA 3AGQA 4ZCMA 2XXAB 3B82A 4MKGA 2YJTD 2F1JA 3CH4B 2PEZA 4Q9IA 1DS6A 3LH5A 3A37A 4J0QA 1MV5A 5C18A 2EWVA 2QM8A 5JHHB 1IHUA 3PUZA 4B75A 1E98A 4KHZA 5JZVA 1Y3AA 1E2IA 2CVHA 4LYFA 3CWQA 4B35A 2GJAA 2A5FA 1DO2A 2F9MA 4XH9B 3WMEA 1ZIOA 3AM1A 2B6HA 1Z07A 1U81A 2Z43A 3SJAA 2AK2A 1ELOA 1KI7A 3RS7A 5HE9A 1DAIA 3IIMA 2MMCA 4OHZA 1CJTC 3UWKA 4JLVA 2H8KA 3CRRA 1WE2A 3MWLA 2NO1A 4MGYR 1MRNA 2BEKA 1GKYA 1KO5A 1OF1A 1VG9B 3B9QA 2ZE7A 4DCSA 3U2QA 1DADA 1FFHA 2CEAA 2HJVA 3V00A 3LY5A 5B58C 5B64A 2WJVA 1DG1G 3EZ2A 2QBYB 1W0KA 2HF9A 4JL6A 3W3ZB 4D6PA 3W9YA 1CJUC 2FGKA 2ZRIA 4AURA 2QE7D 2ZJ2A 1KI2A 4JLBA 5EP3A 1ZINA 5EE9A 4D25A 1HYQA 1OFIA 3GJ5A 4AKHA 3SYLA 2CE2X 4FN5A 2QORA 1L7VC 5K8LA 1H8HD 4GMXA 4JL5A 4DSNA 1WBBA 4KSCA 1CJKC 5LD2B 1U8AA 2JLYA 4LBWA 4B76A 3GJ8A 2YWGA 1E1RD 2ZR0A 2H18A 1U94A 2OFWA 3L82B 3NHAA 4Q47A 2IS1A 2QBYA 4MYTA 3E2IA 1FNNA 2C98A 4QJ3A 5FPHA 1AZTA 3V9PA 2IBMA 2TMKA 4TL6A 2QU8A 3U3KA 4D4JA 4XSHA 4C0LA 1T91A 1KI4A 2IYYA 3WYAA 2IK8A 2OILA 4Q4JB 1EWQA 1VYVA 1I4DD 1MABA 1W4AA 2A30A 5AJWA 4O3MA 3OIUA 1HQYE 3D7MA 1SVMA 2IYRA 3SHFA 3M0EA 3RWMB 3VR3A 2VQSA 1M34E 4QGGA 4DB4A 1FTSA 1P2SA 4UNQA 3B2EA 2JLVA 1PUJA 1R4AA 2RH5A 1R7RA 4DKXA 2BCGY 2C78A 4TQUS 4EQ6B 3T35A 1X1RA 3KXLA 3N5CA 4LJ4A 2ZXUA 1PLLA 1EWRA 2Z83A 4B2PA 4L16A 1JPNA 1SXJC 4X8OA 1U0LA 4OQNA 1W0JD 1A2BA 5E95A 3ZVLA 4LZZA 4A2QA 2ZROA 1BMFD 1OXVA 1G16A 1MH1A 1E1QA 1G7CA 1XMSA 3HYRA 4IJMA 4Q4JA 3IHWA 5TV2A 2JIZD 4GOXA 2VP2A 3MSXA 4BLPA 3L0OA 2E9SA 4O2RA 4QHTA 2VL7A 5IT5A 3MLEA 2PJZA 1F48A 3G82C 2WWXA 3P27A 5E7IA 3R9IA 3OIVA 2F3RA 3NDBB 2QT0A 1SKYB 2F1HA 4L5BA 1N6IA 3RWOA 1GFIA 2R6FA 4Q66C 2F1IA 4HLCA 1ZM3A 2C96A 3UKDA 1R0YA 1OIXA 4P0TA 4UXIA 3ADDA 3KFVA 1AA9A 2FSGA 3B8HA 3FHCB 4WZ6A 2I1VB 4UXJA 4IVRA 2ORIA 3GLGA 2HXYA 1FW6A 4BPBA 5AR1A 5CB6A 1SGWA 3QKRA 4DDUA 1XP8A 1R0ZA 3NTUA 4Z1MD 4M9ZA 5EP4A 1XCGB 2D74A 4M1SA 4AC9A 4DB2A 2CVFA 4GI7A 4O25A 3BORA 3WY9A 5AUNB 1D6JA 4ARZB 1YZUA 4OBEA 1AIPA 3U7EB 1PUIA 1FQKA 3T5GA 3UWOA 1KJWA 2IC5A 3A1SA 5DGXA 3T1QA 2W83A 1F2UA 1W5TA 2VRWA 2Z4RA 2GESA 1ESMA 3AKCA 1U9IA 4FMCF 5FR1A 4R98A 5G40A 3A36A 3MWKA 4LC0A 2A3RA 1F3OA
chains in the Genus database with same CATH superfamily
2WSLA 1VGVA 5K8UA 4B3JA 4IV0A 5IKEA 1O94A 3RSZA 1FNMA 3EG5A 5ALTA 4RJKA 4EDHA 3GJZA 1OAKA 3A25A 2KPOA 3Q0TA 1TMGE 4ITRC 3CLVA 5KOJA 4BX8A 2H5IA 3VC7A 2A84A 2CVZA 2D0PB 4KR0A 3E27A 5MF6A 2DQZA 3CNNA 3KOMA 4D5GA 1OYVA 4TMTA 3ZJYA 1JIKA 2AZTA 5B4TA 1DDGA 4Z5XA 4IKEA 5AWFC 2AWNA 1FFXB 1P5ZB 1C3XA 3KR2A 1XU4A 2BHNA 3D6FA 2HIGA 1QTNA 1V4NA 3M5CA 5FHRA 4MVJF 1H42A 1U9IC 3G8YA 3VPGA 1RBYA 2VO1A 2OESA 4JT9A 1I1HA 4Q0MA 2J3HA 4YJ2F 1EE9A 1II8B 3ET4A 5HA5A 3L0YA 1C4WA 5B3JC 2QTVB 5KSOA 1IJKA 1EFHA 2VPIA 3EGOA 3R23A 3BPSA 3WQSB 1A0OA 3N53A 5JARA 4R9RA 1RNLA 1QGOA 4YAJA 3FFAA 1ZC3A 1JEAA 1NPYA 3CX3A 4DDHA 3EZNA 3H4MA 5H59A 1B0AA 2IS4A 3QZUA 3Q41A 4CLHA 3PT9A 4J4BA 2IZZA 4HRVA 4RM3A 2GHIA 3DV9A 4P9NA 4TMFA 5KQGA 4DBZA 4D0LB 1ZJZA 1T6NA 2X8JB 4QICA 4RVUA 1EX6A 5HTKA 1B41A 3MJDA 1X8XA 3MWJA 5JD3A 3ICWA 4ZT3A 1ZOOA 4W8HA 3T7KA 5JAHA 1IY0A 1DIGA 5AW7A 4KPYA 4IJ5A 4XM0A 2ANBA 1WMFA 2BPOA 1A9SA 1HL7A 3L8ZA 2G07A 2WG0A 5KWIA 3TN7A 1NUAA 3L4KA 2GF0A 5AI5A 2BGTA 1ZNWA 3AI1A 3M9XA 4E11A 1FQOA 3JZDA 2GTHA 4RQBA 4ND3A 4DSOA 3ESAA 1DEHA 1LA2A 2G72A 4FNOA 3VR4H 1GFWA 2H2FA 4B6JA 5JFTA 1XFDA 3DVRX 2QG4A 3W3AH 4XDYA 5LLDA 2R1UA 4FDUA 4L4XA 3AG5A 2WM9B 4IWNA 1CLEA 1EDOA 3UAXA 4F8EA 5K01A 1SC9A 3WBBA 4OQXA 1GTL1 2R65A 2NW6A 5B30A 3WAKA 1ZOLA 2OXTA 3MWYW 4CTNA 1ULSA 4ZPJA 1OBFO 3SHTA 4OHUA 1FDSA 2FMIA 1KJQA 3EWNA 3I2HA 1SRQA 3OWOA 4R3NA 3C5VA 1JVBA 1KF0A 3B3FA 3ABRB 3QPCA 3VKUA 3GIWA 3GLHB 4DLNA 1RPTA 3T15A 3M9LA 1SCJA 3EUFA 3SSMA 1BD4A 1C8BA 1MNAA 1CJMA 4BP3A 1EB9A 1JLLA 4IQ8A 1UM9A 4ZOLA 3T7DA 1ISGA 3WNQA 3DNPA 4HPWA 3UUGA 1FRZA 5CDSA 4IIFA 4J2TA 5IT0A 2ZYUX 4FYHA 2VF8A 1P4HA 1G4HA 1X9IA 3C3BA 3C7KA 4AM8A 3LBHA 3K0FA 2XE6A 4BUJA 4PCUA 1LS1A 3JZIA 2PMEA 2NT4A 1X2EA 2OD7A 4BGVA 4EABA 5D00A 2YXBA 4L22A 4HFMA 2GPYA 4M9QA 2X6RA 5E6UA 2QPTA 4II7A 1G3IA 2P0EA 1JDNA 3C5HA 4K6OA 4DC9A 1EIWA 3KAKA 5FPTA 1DBPA 2P9TA 3VR5D 3OP1A 3ZUGA 4HKTA 3WHIA 3LRPA 4B6QA 3HFGA 1GPDG 4KYVA 1M76A 4IQ0A 2E3JA 4W9RA 2YJ5A 4QUGA 3DTYA 5KQRA 3FUWA 3EOBI 1OWLA 3T5DA 1H2AS 2YY6A 4M6WB 1MQSA 4GX2A 4RVFA 4XYLA 3MD0A 4PNEA 5B3LA 3ZQ6A 4B3GA 4RY9A 1Z4NA 2FG6C 3K6JA 2EIHA 4DZRA 1FA9A 5EJGA 3VJRA 3OECA 3UT0A 1QGAA 2MYPA 4PLVA 1RQLA 3B13B 3Q7EA 4DMMA 1DBRA 1XD8A 3H99A 3OT5A 4P7JA 2FPOA 3AT1A 3HUTA 1FVFA 3H87A 3K1JA 3JD2A 4KXMA 4NG5A 4XRRA 4E88A 5KZMB 4N0DA 1S2GA 1O5TA 3D3WB 4BN5A 4R01A 4LHVA 1N3BA 3NBFA 2AZXA 1XRSB 2BFNA 1I3KA 3PGXA 1JS1X 3PL1A 4Y30A 2HHHB 1SA0B 2ZUVA 1H0HA 5HIMA 1JHMA 3E81A 2QDKA 2W90A 2APJA 3AVOA 1K68A 3G2KA 4Q6BA 5D3MB 3RS5A 2I4TA 4RVNA 4EZIA 1LLCA 4KG7A 1GZ7A 2C2YA 1GUBA 4C07A 1KL7A 4N48A 5BY2A 2CVPA 4U2KA 2D3WA 4GP9A 4M55A 4OA8A 1GZ3A 4FUTA 1W4ZA 1NN1A 5JSKA 3ESZA 4NBRA 4WOPA 1DAPA 3CZ9A 3QSGA 1SUEA 3RG8A 4ZHSA 4XDGA 4EDFA 2R7AA 3UJPA 1CR6A 5C1BA 3OJLA 4QUIA 5E1DA 3P0RA 4N0PA 3RU3A 1ZGCA 1W4CA 4FSXA 1H6BA 2A1UB 3UMCA 3DKPA 3I37X 3ZV7A 5BNIA 3AEXA 4QXQA 2F48A 2RSLA 1EVYA 1QHXA 2WAXA 2OBXA 4UPDA 1ODLA 8ATCA 2BR3A 3GEMA 3OJCA 4JQCA 2QX4A 1KOFA 3IVXA 4G36A 4AZ0B 1ODSA 3JATA 3EGVA 3MWFA 2B4TO 4MRMA 5D8DA 4LFAB 1WDTA 3HCFA 1JQ3A 4DR7B 4QT4A 3GCXA 2WSIA 2XB2A 2ZLBA 1PKEA 1UMBB 1JVSA 2Z4SA 4X44A 3CLHA 3P94A 4QULA 4BQNA 1OH7A 3TZHA 3EEBA 4CTMA 5J2UF 5IDVA 4H3HB 5JJBA 2X19A 4EA6A 4PGFA 3TCNA 3TZKA 3OM0A 3T95A 3G2HA 2AXQA 2DBZA 1TQDA 3FMPB 4A8JA 3DLIA 5AM5A 4NOKA 1SXJE 2F6RA 2CFOA 2P9HA 3O4VA 1ACJA 3P9IA 4F9TA 3JQCA 4LZNA 2YFHA 3WLJA 3BSYA 3FSEA 3PIIA 4XGNA 1C30A 3RFVA 1H23A 2F7SA 1QRSA 4CEIB 3JS5A 4RY2A 1SKUA 4C0SA 3KKNA 1SCAA 4KSYA 2E2WA 3C39A 1MIHA 1QHEA 4X41A 4MGIR 1LNQA 4NONA 2FZLA 3D5EA 3OQIA 4UVEA 4Y6RA 3SQOA 1E1DA 2VLIA 5E3JA 4KI7A 4RMHA 3T9CA 5LA6B 2GF9A 2GHQA 2VWQA 1Z37A 2VF5X 1UT5A 2HU2A 3AK4A 4RHCA 4RZSA 1NVKA 3ANMA 3LSTA 2RBKA 1KRHA 4ZAYA 2ZR9A 3WDLA 5L3QB 5B55A 4RTKA 3Q8WA 5JYCA 4RY0A 3SGLA 1DWUA 1GADO 1OYWA 2HL6A 2XKAA 2A14A 2YR0A 4Z7QB 5C7OO 1OROA 4TX1A 3TRFA 5DLEA 4XQ0A 2HU7A 2VS1A 1KH3A 2AD5A 2ZWVA 5TGTA 4BB6A 4BQRA 3ZVKA 2IHBA 4EVSA 5ALYA 1J1UA 1P18A 2ZQYA 1LJ8A 3SG0A 3A2KA 3KPYA 5DU2A 3OQIB 1JMYA 2AMLA 2ZS9A 4WT7A 1HF3A 3GZNB 3T52A 1E1LA 1K9VF 1XP5A 2WIGA 3Q10A 5AXDA 3T7SA 3DMTC 1BVYF 2YCBA 2AG0A 1NQVA 2PPLA 3LT4A 3TQRA 4QM6A 1RAFA 3AETB 3WDMA 4D3ZA 2ZBUA 3PUJA 4PLCA 1ZU5A 4K3VA 1DINA 2BFWA 2OAQ1 3FUVA 3JQ6A 4IYRA 4OA5A 5DE3A 2F8LA 3KIPA 1QYXA 5EYPB 3FUXA 3G9XA 3SLKA 3ZDQA 3DUFA 2WYIA 1SKQA 4W9MC 2YC4C 2IV2X 4N76A 2UXDB 4IDNA 2P91A 2PGDA 1WXXA 3UJCA 1IWOA 1QH8B 2WC1A 2P9ZA 2DG2A 2O0JA 4RGQA 5LCXA 4QE3A 3THWB 2GPTA 3GP3A 1RYNA 2Q3EA 4ZU3A 1OT5A 3VNBA 2ECPA 1Y8AA 3EZFA 1BEEA 2J1LA 4OYRA 3ZD8A 2VJDA 4BTVA 2Z5VA 2ATVA 4WASA 1ZK4A 5DO9A 1KK3A 1ZMTA 3TZBA 3HXLA 3SIPA 2JCVA 3UUWA 2ZK7A 4B4UA 5G0VA 2VRBA 2PV0A 3H2SA 1XLTC 4KKXB 1FSGA 2Y8EA 2YIDA 4R5HA 5ED0A 4IZOA 1Q2UA 3PFWO 5DX8A 4EX7A 1I10A 3OICA 5BRAA 2C2KA 5LQCA 4TL7A 3J7TA 2L82A 2WJWA 3Q8KA 3OCVA 3W4IA 1WUJS 2XQVA 2BM9A 1JIXA 2BFPA 2WNSA 3SYRA 2BKEA 1UBOS 4V0SA 2WB2A 3U4CA 1PCXA 4G0OA 1SULA 2ZYVX 1Q6YA 4IO0A 5EXSA 4JI5B 1U0FA 5JZOA 1J99A 1DTSA 2FW0A 4U9IS 3IUNA 4OEHA 3RSFA 3SZ3A 5K03A 1PJ3A 4FILA 2BMEA 1A3CA 1NW8A 1P5RA 1BA2A 2ZUTA 5F1PA 1YZTA 3FTCA 3EJ6A 3PCTA 4WK4B 4JDUA 1QTRA 4E5PA 4J76A 5EAIA 1VJTA 4MAAA 1JG1A 3MRTA 4IP0A 7MDHA 1KDVA 4A2PA 1HDCA 1JKMA 1TO2E 1GAWA 2YUIA 4X7MA 4EHJA 4ZFNA 2HHAA 2QMUA 4F0JA 5SY6A 1TZ2A 2IUTA 3BWCA 3K5IA 4RD2A 4EJ2A 3SWWA 2AS0A 4QUKA 1RE0A 3M6AA 2GBLA 3BCUA 4NE2A 1Z4PX 3EPHA 4ZOQI 2E6KA 3MJRA 1HPLA 2UYGA 5E3HA 3MTQA 4GW3A 1NNLA 1SPBS 2FKNA 2I1QA 1EAMA 3AF6A 1UEXC 4HNAA 1JDBC 4IIJF 2I66A 3V8NA 4B3CA 2PL5A 3ANSA 4DHWA 3U1BA 4PRKA 3L05A 1GCOA 2GS9A 2I67A 3H9UA 3S2EA 2YXDA 3OPNA 4EUEA 2R60A 3VKVA 3UWSA 5JWHA 2J45A 2JJ2A 5AKXA 1YA6A 2PBFA 2VJQA 4YMSA 2TECE 5G0SA 1AKWA 2ENWA 3BMOB 2GPSA 1N2CA 4P4LA 3AHGA 4KXUA 1CXZA 4KH0A 1VCMA 3RRFA 4AI6A 3JZFA 3U5TA 1CD5A 4WNIA 5LIRA 4QQRA 2G04A 3VI3B 1G1AA 4FHZA 4Y2GA 1RR6A 3OLXA 4CLRB 2AHRA 3E9YA 1FJGB 3P26A 5C8XA 3VR2A 1ENZA 2H6EA 3E8MA 5EPEA 2G1PA 5T6BA 5CHYA 1Z8DA 1NC1A 4BUCA 1F4PA 2PS9A 1HRDA 4MGZR 2AC7A 3MJEA 1YA8A 1EM8A 4IDDA 1CUGA 2EZ8A 3KUKA 1TO6A 5EJFA 3WRVA 4FEGA 3L8YA 3FUTA 4I4IA 5AICA 3IBYA 2A5DA 3G89A 4FDAA 1HEUA 1N5LA 1TI7A 3DYIA 1G20A 2NU9A 4TZKA 3R7BA 4LGCA 5IX8A 2Q1UA 1T9CA 1JZSA 4CIWA 1WKVA 3GVHA 5H9WA 2H7XA 2CEKA 3A4YA 3A70A 5IBPA 3NP9A 3K3PA 5IYZF 3R5KA 6ADHA 4AG6A 4HQFA 5AVQA 2QMZA 2QN9A 1AGRA 3PJFA 4U1RA 1L5RA 2DPYA 3OFSA 4FNMA 5AT1A 1B8PA 2CDNA 2Q2QA 1NI3A 2ODNA 3TCKA 2ZW9A 1Q0ZA 3GCDA 4MIYA 1JFLA 1ZHOA 3K0KA 3L8EA 1WW3A 5CITA 3IOCA 1IJBA 1NOIA 2QD4A 3OQNA 1G64A 1K5PA 2ZJ7A 4TMKA 5G0WA 5KYXB 2Q6IA 4NZPA 2R97A 1RRPA 3TRJA 3B3GA 5J4HA 2I91A 3I9OA 2Q4BA 5J4YA 3VU3A 1G7TA 1N3YA 1QGED 1BFDA 1XXHE 4X97A 1JYSA 1NL3A 1W2GA 2H4FA 2D3TA 2BHSA 4HDRB 3U0BA 5C46F 4LNHA 3BTOA 4ML3A 4WGFA 2B82A 4RTMA 1C0KA 2Q6OA 1E1YA 2NVOA 3M6XA 1XBTA 2J9ZB 1E8DA 2H48A 3U3OA 3ZNQA 1VLVA 3GPLA 2A7QA 3EFHA 4ZYTA 4E2WA 4OAQA 5CR9A 5TQVA 1OI4A 5TIIA 3DWFA 4M1KA 1U2ZA 4RC9A 3PGVA 1WCYA 4AJOA 4GGMX 2JS7A 2COKA 3NDRA 4GKKB 3VHXB 1B8VA 2OAGA 2QX7A 3KS9A 1W47A 3GFOA 1X87A 1GZSA 3LK7A 3N3BC 1B3BA 4UNSA 1K6EA 1DUSA 4OHCA 4UU8A 3ZVNA 7REQB 2RHWA 4OJTA 1CYEA 3HR4A 4RY8A 1SAYA 1RKXA 3KBBA 4CV3A 2VWHA 4IQ4A 1WD5A 1YQGA 2IUSA 4WH0A 3RSQA 1XTSA 1N4AA 1LX6A 3CZRA 2JI8A 2PDAA 3FW1A 3IV6A 3F5QA 5ALUA 3T41A 2XADA 1NVGA 2EXXA 3AEUB 1YS6A 2WD8A 2XWSA 3KQKA 1DC8A 1HOTA 2F55A 3FOAA 1HTBA 1PFKA 1VSQA 3RFTA 1U8CB 5G3YA 4Y0NA 2Q28A 5H7XA 2IYOA 1VOTA 1KJNA 1DKOA 3S29A 4ARIA 4DT1B 3IDAA 1V3QE 3EDCA 1G6Q1 3TFQA 1U7OA 3ZXSA 1W0JA 4FSDA 4MUEA 3KQUA 3HGTA 4MPPA 4TVSA 4CCWA 4O2LA 5FAXA 1OX4B 3EVFA 1JAIA 4QEDA 4ZHQF 5CDFE 2Z4TA 1DFIA 2J9GA 1AQNA 1NJ2A 1W1WA 1L4BA 2FPKA 1AKNA 3Q7PA 1U8TA 4IKPA 2BWJA 5GWXA 4ZYYA 1NT4A 3C45A 1I2BA 5EXDA 3K70B 2O0HA 1T8PA 4RA6A 2XWBF 4REQB 2HMAA 2HHLA 4LJRA 3DBIA 4XWAA 3UH1A 1RYYA 3A1EA 3DAHA 1P2TA 3GVXA 4BYGA 4JOBA 1AS0A 3VZBA 3WOVA 4DYDA 5KC9A 4RS4A 2NV2B 2WZDA 4OLBA 1W96A 2OL4A 1DJOA 2EAUA 4HI0E 4K9OA 1BE1A 3KQLA 2GNPA 5KHAA 2JGIA 1W49A 2XCLA 1F8GA 2J3IA 5FPPA 2OFPA 4DDWA 2L69A 1SIWA 2V4UA 2XWJI 1L1QA 1OWOA 3CSDA 4PG6A 5DF1A 5CG1A 4PSVA 3GFTA 3M1LA 3R3XA 1FNDA 4WN9A 3A1UA 2DSNA 3THYB 4D9JA 2QRUA 3VNUA 4ZVVA 3LC0A 4U6NA 3QMMA 1AN0A 2EG5A 3E18A 2BFEA 3IP5A 3PUHA 3RFXA 1NLYA 5TGDA 2WP0A 2XGMA 2ZYIA 4HBGA 1NBMD 3LZDA 3IUJA 1V7CA 5DRTA 4EKGA 4KQHA 1G55A 2R8ZA 4TV9A 5GP1A 2P2GA 4PYQA 1FC0A 4D74A 4X84A 1Q0HA 2CW5A 2TS1A 3ANYB 2I7XA 4PCLA 3U9TA 2CHVA 1XRMA 3T9EA 4YP0A 4F71A 4CNBA 6NULA 2CNDA 3BB4A 3WL5A 4AG3A 4YDQA 3I2JA 1E20A 4GQBA 4Y6PA 1V9CA 4ZRDA 2Q2NA 3IIIA 4IRUB 3GRKA 5F5NA 4ZVKA 1KVUA 1XKQA 1RZVA 5C5IA 5JBIA 5CBPB 3K73O 2PGJA 2JNWA 3DGFC 5IH7A 2DWQA 1G3QA 3DWIA 4KGXA 3MS2A 4LMBA 4LSWA 1O58A 1K8RA 4AJ4A 3OX3A 1W6RA 1PZEA 3L6OO 4BLSA 2IXFA 1N2EA 2HCJB 3B6ZA 4B44A 1OYOA 4LECA 4MCHA 5ADWA 1HLPA 2PMFA 1Z56C 3LDFA 1X2BA 1NRWA 3K6RA 5IZCC 1G5IA 2XUZA 3N07A 3O8OA 4TMYA 4UDOA 3URKA 4HB4A 2I76A 2VRCA 3FYCA 4WUTA 4Y2XA 5KVCA 1GYPA 1P2BA 1ZJYA 3M33A 1N0IA 3DULA 3S8YA 1ZW6A 4RVGA 5I4CA 1EGMB 3DFFA 2Y9MB 3MIIA 1T9AA 2UXCB 1FRQA 4MV9A 3LLMA 2XH8A 3ZGXA 5EIBD 1P1CA 2I8CA 1M75A 4RHUA 2GUGA 2HWUA 5TDHA 1FDVA 1LJLA 4NNPA 3K9GA 2EKQA 4C1NA 2QL5A 2FF5A 3HO8A 3SJBA 5HM8A 2B1RA 3AONB 2R85A 1XJ5A 2ID8A 4I1VA 1M1UA 1U3VA 2YYZA 4ZAGA 1Z5OA 3TWOA 3BZBA 3SC4A 4PN7A 1KNQA 3SJUA 4FZ5A 4KAXA 4PXYA 1O97C 1PHPA 3N8DA 3VHXA 2CV1A 2XXBA 5AXCA 3NNDA 4ZAXA 1VYUA 2FRXA 3PITA 1E2MA 1JIJA 4N0EA 2O2HA 3KKZA 2W0MA 3FBGA 4ND2A 4EYGA 2AG6A 3I61A 1SHUX 2AT1A 4EG7A 3NWOA 2PRJA 5T7BA 1EK2A 2HADA 4MRAA 4MR8B 1L5ZA 4PZYA 4CEHA 3E3MA 1KQPA 2QTFA 4TZ0A 1I30A 1WMEA 3PC2A 3S4YA 1G8KA 3ZYZA 1NHWA 2QOEA 4JR1A 3EPJA 3MS7A 1PFYA 1BS1A 2GQ0A 2J5RA 4JZKA 5DHSA 4OXQA 3HZHA 4C05A 3O3OB 3ZCPA 3O21A 3C8HA 1GCGA 2IYLD 1E0DA 4RCYA 5J40A 4GFDA 4BB5A 1ZK0A 3BK2A 3Q9NA 2JCSA 4AP5A 5KQSA 3HA3A 4GLBA 1JJIA 1VPTA 4I55F 4NZMA 1YRQA 4YRMA 3U3MA 4ENUA 1BRMA 4DCCA 4LBYA 1AO0A 3S40A 2Q0HA 3S7TA 2QLMA 3IEUA 4V1CA 2G40A 2VZEA 4P36A 2ORED 2ZBGA 5JYEA 2ZTMA 4L85A 4IDHA 4MR8A 4Y2QA 1WDMA 1FFBA 3W8RA 4MNTA 2P9QA 3ZH2A 1PEAA 1KMHA 3ZWWA 4K9MA 2JFXA 5KOHA 6PFKA 1W88A 4OXNA 4M87A 1CE8A 1KK2A 2FY8A 2VA8A 4KRXA 3Q5GA 3P1JA 5K05A 2OGSA 3V4ZA 2H59A 4R1UA 1HFJA 2HRRA 3VO8A 3BX1A 2REOA 3H2JA 4HFNA 4JT4A 1J8VA 2JGJA 4RABA 3QEJA 3CSUA 2X1HA 1FK8A 1KIMA 2DWCA 2QG6A 3G8DA 3LOUA 1SBCA 3U4AA 3RV3A 2JLZA 3HEBA 5I8WA 1CRQA 1UKCA 3P9PA 4OI1A 1G6HA 4RKEA 4TV8A 3OCXA 5FRDA 2AF3C 4R7ZA 2B3DA 3DS8A 1Z34A 4PFSA 1YE3A 1XCPA 5HF8A 1Q1QA 3WIDA 1T8TA 1FLNA 3I2GA 5T5QA 3A0RB 1S1MA 3GRYA 3LXMA 4OQYA 3KT3A 4RMNA 2ZRQA 1G20B 3SDZA 4NDNE 2FPUA 3BDAA 4FSHA 1S2IA 2JGFA 2ZUWA 4YIKA 3MNFA 2CNWD 1D1PA 3LT0A 4NEHB 2XDYA 1MG5A 2Z98A 4FFVA 4M1QA 2ILTA 4KR3A 3LCUA 3I52A 2GPWA 3LFHA 4M88A 4HADA 2AG8A 2FW7A 2QVXX 1SEVA 3VBEA 5BQ5A 4UEWA 4DL9A 4EKNB 3HVRA 3ER9A 3E1KA 1E32A 3WSTA 4NDAA 4GS5A 2P7HA 3M70A 3F6CA 2WFMA 5CIQA 4G84A 1O77A 3N8NA 4QM7A 4H7JA 4GMHA 4LN1A 2HW8A 4MCAA 4YCBA 3FTPA 1I6LA 3IIKA 2XEXA 2WTXA 1NPDA 3EJWA 3RFFA 1GVHA 2OZKA 4RO0A 4RX1A 1WXHA 2VCEA 3K35A 1DAGA 4RQAA 1JQEA 4RXMA 3OSZA 4KI0A 3NHMA 1N92A 3OJOA 2YJZA 4YT4A 4AVYA 4HB0A 4YT8A 5KO2A 2IXTA 1IM5A 3WLRA 4UOEA 3SF8B 1G21E 2FN9A 2PJDA 3PI6A 4FCCA 2QUZA 5K8IA 2GEKA 3K15A 1M7HA 3L7LA 3LCCA 4X64B 2EW2A 4G09A 2E89A 3A0UA 4UE6A 3NTVA 2R8PA 1DDIA 2FG5A 4P83A 4JKOA 3I0NA 5DLPA 3HGMA 4FS8A 4DIKA 2V3CC 1C7IA 2DWOA 3ZU2A 3PHCA 1AMNA 1NW6A 2GFIA 1M2FA 4H17A 1LF0A 2YWXA 1YQQA 4UZFA 4C4TA 3TD9A 2GN8A 2C2XA 3UOWA 4EGAA 2P67A 5CT8A 1VJ1A 5KTOA 4RD4A 1I9CA 6LDHA 3ZJVA 5A3SA 3FNIA 2MWMA 3TLJA 4S1WA 2BYTA 1VPLA 2Q3BA 1RLJA 1X7WB 2HO4A 2BKXA 4LY0A 4Q15A 1NVTA 1SR8A 1MB3A 1Z06A 3CU5A 2PTHA 3DNMA 4LRQA 1G5PA 4PQYA 3BXZA 4C0JA 3CEPB 3F8TA 5FADA 5AXAA 5EFZA 3A1TA 3DD1A 3GFSA 4HAUA 1G98A 3S2GA 1HLDA 4Y7DA 1LGYA 1INLA 3WTBA 3CX7A 2P77A 1FYWA 3PXGA 3AESB 1UUFA 3W3AD 3ZZNA 1II8A 1FS6A 1ONNA 3R0IA 4AL4A 1CVIA 3ZW8A 5LP1A 1XA4A 4FOTA 3CF0A 3ZE9A 1F38A 4AZVA 2VPZA 2ZM6B 1EP2B 2ZTHA 5AVSA 3SHQA 1A9OA 3L84A 1J39A 3KCQA 4HLUC 5AVOA 1IOWA 4E4TA 2AOWA 3WGUA 1TC1A 1L5VA 3ZY4A 1X7DA 4I9NA 2GCNA 1LBSA 2O2ZA 3ZDCA 1YOVA 3HCNA 4C0WA 3EZ6A 5IASA 4B2IA 2B7BA 1OKKD 2FX5A 2ZIAA 4RXTA 3C0KA 3OQ1A 1JXAA 1K92A 4EY5A 3M82A 3Q9UA 1Z5NA 4Q34A 2OYRA 2GEFA 3HCOA 1L4YA 5A04A 5J2UA 4UREA 3M1AA 3PNQA 4OGFA 2JC3A 4Y0AA 3ZNOA 5AOAA 3VJKA 1KH1A 1Z0UA 2XRZA 1RWBA 1U4OA 3FDJA 4BMCA 3QJYA 1WVMA 3BHMA 5CW2A 4AQDA 2AZMA 5IHPA 5BVGB 4UMEA 4MPTA 4Q3DA 1RMQA 3DZCA 1NVXQ 2H9AA 4E51A 3DLPX 5LFAA 4P22A 1KBQA 4OK6A 4XWGA 4TYYA 1S9DA 4UEKA 1EFTA 4NRDA 4XVRA 3VGPA 1T9HA 3N5KA 1YTUA 5JEDA 2P5SA 3BG5A 5AJXA 5GPBA 4WSOA 5KYYA 2HSDA 4RTJA 1OGIA 3KCNA 4V24A 1CK4A 1OFGA 1U4NA 2BSQA 3GEGA 4JLMA 1V45E 3NALA 2FJUA 4C14A 1S3IA 3KZOA 5IM4A 3ENKA 5KU7A 2OT3B 1IWPB 2FYTA 4NQRA 3V3KA 4PBSA 4W1SA 2ODPA 2ORVA 3LLCA 2QTBA 3E6AA 3NTOA 1FQWA 3IAHA 2ZFUA 3DFUA 1SOMA 4AT1A 2F62A 2GPJA 1KZ1A 1JTFA 4IG4A 2HUPA 3NETA 1CX9B 5IBCA 3EWAA 5FNVF 1BD3A 3SJCA 4UUOA 4J43A 3U60B 1GZUA 5JZ9A 2PWPA 1RM4A 2D1YA 3NEAA 2HIHA 3D0OA 5HS6A 1ORIA 1Z8NA 3LK6A 4CMAA 2XKKA 3COJA 4HAOA 1AURA 2HCRA 3H18A 3K4QA 1X92A 1HUQA 1DZ3A 1NKTA 1ULAA 1YJ5A 2LGJA 4PLZA 3JQQA 1MNQA 2NZXA 2Q41A 2Y0EA 1E4EA 4L7QA 3T3PB 2JAHA 1NSTA 2Z04A 2W0SA 2YQZA 1LNZA 1CIJA 2ZJFA 3F6SA 1WZNA 3LUCA 3QKSB 2KS6A 5KJCA 3KSDO 4BKQA 1TZKA 5EWJB 4WLEA 3COPA 4UBKA 4F4UA 1PW5A 4YRAA 4A0HA 4IKOA 3EXG1 3E15A 4DIOA 3EX7C 1BMFA 2VP9A 2P2LA 4YCNA 4TMVA 2V65A 2JIRA 2QTMA 1FLAA 4TTAA 5JVDF 2QK4A 4B74A 1G60A 3UMRA 4UMFA 4BXOA 4LJ9A 4X61A 5E9JA 3CN9A 3I5UA 2AB0A 2R8EA 3ZZTA 5LZ7A 2UYYA 4JYPA 3EIEA 1PS9A 1Y1LA 3CLSC 1X86B 2YVAA 4W1PA 4HWKA 1ML4A 1DBIA 1FXWA 3DEYX 4KBGA 5DTEA 3TNFA 4ARZA 1YC2A 3LXUX 1K5DA 5A71A 3WWZA 3D3WA 1KYVA 3DPIA 5D1HA 1M5RA 4M3NA 2ZYAA 1ZNYA 1F0NA 3IGFA 4KN9S 2J5XA 1R4NA 4F38A 1Y7LA 2FPSA 4PYIA 1PGPA 4KBFA 4DG9A 1WVIA 2HHJA 2JHAA 3W7VA 4CMBA 1YU9A 1N25A 5CG2A 4V0ME 5FO1A 1FP6A 3RSOA 3UMMA 2G0NA 1ZH0A 4LJSA 5JCOA 4AUKA 1XRJA 2CFRA 2QIPA 1QVAA 1UDAA 4H0FA 2YL2A 4HZUA 2C7GA 1BYIA 4KXYA 4M60A 3TUJC 4BVEA 1TMOA 2JK1A 4GECA 4EIWA 3LTNC 4QYTA 2YRWA 1BJKA 3UHJA 2QRHA 4N5HX 5KCMA 2PSHA 1NXTA 3LCMA 2WIKA 4G85A 1UFOA 3GLQA 4MRMB 3GMSA 5BNTA 2AFIA 5FAKA 1Z4LA 2D7CA 1DFHA 5ECWA 5DYNA 5A5GA 4DLRA 1D3AA 2QS9A 4JEMA 3ITEA 2HO5A 2WAYA 4IXWA 4YN3A 3D3EA 4Y1FA 1S8OA 2BKAA 2XWQA 2GJ9A 4P2BA 5CTJA 1H93A 1PWHA 3T7JA 1TC2A 3TAUA 4JWKA 3W5IA 4TV8F 2J09A 4XASA 4XFJA 3NOQA 4Y2RA 4YP6A 2HLDD 5LP6F 3F4BA 1V5IA 2ZCVA 3MWGA 3GU3A 1XZMA 2B20A 1Z33A 4AZ0A 4E13A 1U99A 5A9RA 5BWCA 4QECA 2GZHA 3ONFA 1GA6A 1ZS9A 2Y9PB 3INNA 3WWPA 4F12A 1GNLA 2P2YA 2OQVA 5HZHA 5L3VA 4XLZA 3K8QA 1UQTA 1KMCA 1VC2A 3KJNA 2E82A 4BP1A 1P0PA 3OQMA 2ACWA 4RF4A 1YKSA 3FOEC 1ADGA 1JR3E 2VIIA 4IXDA 4QOGA 1O3YA 4C6SA 4NBKA 1G3UA 4FQ8A 4Q9HA 2CBGA 2FPMA 1II0A 2RK4A 3K9QO 4Y8VA 5GONA 2HTFA 5U4QA 1DQPA 1SKYE 2O5RA 1IEXA 5ULLA 5KDOA 1XCMA 1XU7A 1F7VA 3JD0A 4O8ZA 4IUBS 1UMKA 2C4MA 4TSFD 3AHIA 5CA1B 5CFOA 1DV2A 1TTTA 2BFMA 1ZWLA 3CUUA 3QKIA 3FWNA 1T43A 3B20A 1GUYA 1RWWA 1XZKA 2OXEA 1JNXX 1W34A 2RGCA 3JY6A 3LUFA 4G89A 4DDVA 1EX7A 3TD6A 3L7KA 4C5CA 1IULA 3UEOA 5J4LA 4HLNA 4P3KA 4ZTBA 2FGJA 3AP1A 4B7CA 1WCXA 2WYWA 1GZVA 4CGYA 4DLPA 1ESNA 3GO4A 16PKA 1YJQA 2JKVA 2HEGA 2OK7A 2YJGA 2GEBA 4JJKA 3QEMB 1IUPA 4ND8B 3TQHA 3U6BA 1PNVA 3KM0A 3VVBA 2CNLA 3ZQJA 3CVJA 1V4BA 1KC1A 2AX3A 2P1ZA 3DOUA 3O95A 1C7EA 3ESCA 2FN7A 4HUQA 4OXYA 3SXUA 3U44B 4GO1A 4FHDA 1NF9A 4PPYA 1X7XA 4D45A 1ZICA 2X14A 3RUFA 3DE6X 3ACBA 1Z2PX 3IHTA 4ALJA 4F2HA 4YRCA 1GD1O 1ZISA 3ZI7A 2HJHA 1TECE 1SXPA 4TGLA 3K1AA 2G9QA 5F35A 3QVLA 4YB8A 2JFUA 1UWVA 3PQEA 4R2WA 2RHLA 2C3UA 2G6TA 2Y6VA 3ZHYA 4HMQA 5JQGF 4R5MA 4LF6B 2NZ2A 3R0VA 2YXPX 3Q40A 4FQ7A 5EYPA 3SQNA 1Z68A 1K7EB 5CCXA 2AL7A 4HQLA 3U6KA 1WU8A 2FPRA 1XPOA 1ZM9A 3VGJA 2H2DA 2ZJ6A 2ZRMA 3EIFA 3GNQA 3C3MA 2FB9A 4LVUA 1LSOA 1NI5A 2OP1A 1EK6A 4RD6A 2R86A 1P1BA 1H94A 1ORVA 3H6GA 1FZQA 1X14A 3H84A 3PQFA 1QFYA 4KLAA 3NJ8A 2ZAMA 4R1PA 3E7PA 2XKJE 5KYUA 2JLBA 1E6LA 3VO9A 3ZHRA 5CDYA 1R4NB 2QYHA 1U04A 3AHJA 4LF7B 1IVNA 3HU2A 4OKNA 4X92A 4M9XA 1CIVA 4HDCA 4AJJA 2GASA 1PSDA 3D7NA 4XQEA 2C95A 1C4OA 4M2LA 5G2OA 3VR5A 1D9ZA 3WNCA 3G8AA 4YRIA 3LDUA 1SWVA 3P2KA 4JVLA 1MGOA 4M37A 4TL8A 1OXBB 5BPFA 3VYWA 2AJDA 3U17A 4BKUA 1ECLA 2XGSA 4YDRA 1C50A 4E21A 3DL0A 4UHJA 1TF7A 3VO1A 1WB6A 2BLLA 4QDXA 5AW4A 3L4EA 4BVAA 4AQYB 4F4IA 1CTQA 3KJHA 1KHTA 2H3HA 2PLRA 4EFMA 1GU7A 1Z6GA 1OMOA 4NOMA 2HPHA 2FQWA 1RJ9A 2I1LA 2NO7A 2OO7A 3HSSA 2NOAA 2YS6A 4JJ7A 2GZ2A 3CVWA 5E8RA 4O1HA 2BUCA 5TEWA 1U8FO 2REXB 5I4KA 1DC4A 1VGQA 1LV7A 1W94A 3T1NA 3W5HA 5BO5A 5LZ9A 1TF2A 3EAGA 3UV3A 4JI2B 4AF7A 4AF8A 4ANFA 3KJFA 2H07A 2EFJA 1N6KA 1ZH2A 1LEHA 2QA5A 4ZMBA 4Z0HO 2YN0A 5IKMA 4M83A 1AKYA 4NC9A 3QV1A 2P6OA 2PXCA 3CLUC 5KNDH 4JVOA 3GLHE 3DR5A 4DLVA 3RNLA 4KLCA 4RADA 1M8KA 1UDBA 3RCBA 1CUZA 1ZP6A 3GUZA 4G86A 5CK4A 3W2IA 4LY3A 3ELWA 1GT91 2ADFA 1RAEA 1PV2A 1LS6A 3CINA 4P5DA 2BJVA 2CHGA 4QELA 4DT1A 4Y3UA 2UU9B 3HFRA 3W90A 3WWYA 2NYUA 3NNNA 1DKQA 3O31A 3DQPA 2H2IA 1QHIA 3G2LA 3I2YX 4PHGA 3G9UA 4TMZA 2AFHA 5HG0A 4NDZA 4WZBA 1P4RA 4M9CA 1BW9B 5CA1A 4L2IB 1XK7A 1LUAA 1BX0A 4UU1A 3RYCA 1J9ZA 4DUPA 2Q9CA 1RZ3A 2ZTSA 3O90A 1XDSA 4B81A 3BFPA 2HA2A 1SVWA 3ZHSA 2XNCA 4NS1A 3S3TA 3CUSA 3JALB 5ECYA 1P9WA 2X0RA 2IXAA 1USIA 2P3OA 2YWFA 3PWZA 3GLSA 4MDHA 1Y1SA 2HAEA 1DUIA 1W8DA 3OLVA 2HPVA 1MAUA 2KX7A 5F52A 3UFXB 2NUPB 1YZYA 4FP9A 2IDMA 5JNRA 5G4KB 1HDXA 1BHSA 3EVDA 1JAHA 5KYWB 1LPAB 2PZLA 3JVIA 3KDPA 4EL5A 3WGQA 2O8DB 4YMUA 5IT4A 1PZNA 2BC9A 3PT5A 3M1YA 4WOJA 2CHUA 4Z53A 4RJJA 4TXJA 2M6RA 2QUIA 3GLFE 2FN8A 4OQEA 1H2ZA 2GJSA 2C9CA 1BJTA 2WHPB 3R3YA 4GP6A 3EOAI 4RH0A 4IW3B 5BN1A 3RTEA 3A3KA 1FX0A 1RAGA 2ODBA 4DCGA 2Z5GA 2OFFA 1HYHA 3DT9A 5MN5A 3K6SB 2NZUG 3FBTA 5AJHA 3SZGA 1FIUA 2C3YA 3KTAB 4WWHA 2AFRA 1NN0A 4I3FA 4MUBA 1E7WA 4N7BA 1IMJA 3L79A 4GXTA 3ZNNA 1U7ZA 4GE3A