1N5LA

Crystal structure of mycobacterium tuberculosis thymidylate kinase crystallized in sodium malonate, after catalysis in the crystal (2.3 a resolution)
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
208
structure length
195
Chain Sequence
MLIAIEGVDGAGKRTLVEKLSGAFRAAGRSVATLAFPRYGQSVAADIAAEALHGEHGDLASSVYAMATLFALDRAGAVHTIQGLCRGYDVVILDRYVASNAAYSAARLHENAAGKAAAWVQRIEFARLGLPKPDWQVLLAVSAELAGERDNYERDAELQQRTGAVYAELAAQGWGGRWLVVGADVDPGRLAATLA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Mycobacterium tuberculosis Thymidylate Kinase: Structural Studies of Intermediates along the Reaction Pathway
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Transferase
molecule keywords THYMIDYLATE KINASE
total genus 74
structure length 195
sequence length 208
chains with identical sequence B
ec nomenclature ec 2.7.4.9: dTMP kinase.
pdb deposition date 2002-11-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02223 Thymidylate_kin Thymidylate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1n5lA00
2IYTA 4PHFA 2X2EA 1ZUNB 2HDNB 2X2FA 3MMPA 5CDFE 2ZR9A 4QBHA 3VR5A 3S1AA 1D9XA 1FNNA 2QUZA 1R0WA 3TGPA 4DB2A 2ZRDA 3AF0A 2QQ0A 1AZTA 3O8BA 4HSEA 5GJVC 1I4LD 5L3RA 2J0QA 3UXMA 5AJYA 4C0BA 1CJVC 2OCPA 4BFTA 2P5SA 4Q02A 3EIEA 4ZIRA 1CRPA 4Q4HB 1G7RA 3K9NA 2PJZA 1LTQA 2AR7A 2ONKA 2D7CA 5HE8A 4QHSA 4OKSA 3PIRA 5CM9C 4CT5A 2G9NA 5H8WA 1COWA 4LJAA 5J4LA 3WY9A 4BZXA 3VKWA 2R6CA 2BBWA 4KITB 3NBFA 3C16C 3AF1A 2ZJYA 4AURA 1YZLA 4PO9A 4DWJA 3GLHA 3L2OB 4M1SA 1E1RD 2C9OA 3I62A 2CHGA 4IEEA 4TSFA 1DO2A 1CRQA 3LBIA 2E87A 4U00A 4A92A 5AK0A 1IJEA 2IYLD 3IPXA 3THYA 1CIPA 1G5TA 4Q4AB 2REXB 4CRWB 3HU1A 3Q72A 5M04A 1KIMA 3VHXA 4KVGA 1VIYA 1P4SA 4GZMA 4PAOA 2A5DA 1ZINA 2C77A 2H5EA 2JIZA 2Q21A 2F1IA 2QGZA 4OI4A 3K9HA 1N5JA 1Z08A 4AYWA 2FDCA 2CL7X 1N0UA 2VEDA 1W7AA 3QKSB 4D82A 3I73A 4S35A 1W36D 5DI3A 4OI1A 2C98A 2RH5A 4KYIB 2ZS8A 2CK3D 2ZEJA 3PFIA 1UFQA 2B21A 2O0HA 4HAYA 3PXGA 4YMTA 4DCUA 2FEOA 1FZQA 4KFSA 4UNQA 4B2LA 2G0TA 2NO6A 3FHOA 2WZQA 5LD2C 2W83A 5GVSA 1UF9A 4V0LA 4PPGA 4W7SA 2BCJQ 1RYFA 3IUYA 1XXHE 4JLMA 2ZXUA 1VMAA 2BM0A 3T15A 4BGDA 5JI2E 1AGPA 4UJ5A 1ZW6A 1XPUA 1V5WA 1ONBA 2ZJAA 1E9DA 2IHYA 3OIYA 4HEJA 2PCLA 4JJKA 1QHNA 1G291 1Q3TA 4EKDA 1OJLA 2W0MA 2QT0A 2J41A 2WICA 5FI1B 4DDWA 4EPXA 2ZTSA 2QSYA 3RAPR 1K8RA 5FTJA 4BFYA 1I4TD 1XD2B 5F9HA 2IXGA 2NO1A 3K1JA 1KNXA 4Z51A 1W47A 4A0FA 1XRJA 1JR3A 2EYUA 5HCIA 1HT1E 1US8A 3HR8A 4ACBA 1UDXA 4B76A 2WKRA 2G1KA 3NWJA 3DOEA 3ZD7A 2XJ9A 3VNVA 2ECKA 4D26A 3GP8A 4ZCMA 3ND8A 2PCJA 1OB2A 4RCYA 2VYFA 3BXZA 2CK3A 2AL7A 1VIAA 3CLVA 4AG6A 5L3SA 3UK6A 4AYXA 1U0HC 1Z3IX 1XZPA 3RWOA 1VG0B 3UMSA 1GUAA 4TTPA 4LHZA 4PQRA 1X86B 2ZSDA 4I1SA 2ZSEA 4LHXA 3JVUA 3REFA 1ZCBA 2NO0A 4PHTA 1E2HA 1Y3AA 2OFWA 1QZXA 3PEUA 1ZRHA 2WJHA 1A82A 3A4LA 3Q7QA 4AKGA 2GCOB 4Q66C 1OFHA 4PHGA 2CCJA 1KK0A 2PEYA 3NEYA 3CWZA 4G5OA 5DYGA 1U0JA 2AFIE 4AKIA 1TQ4A 4M9XA 4TZ0A 5HKKD 5HTKA 2XXAA 1JAIA 5EZ5A 2C9YA 2OFXA 1W0KA 2CNWD 4G3XA 3LA6A 3HYTA 3A36A 2FX3A 1N6KA 4HAVA 3OEHA 1X6VA 2FJUA 3DHWC 3ZVMA 1S0UA 1CJUC 1G3QA 2V54A 3E1SA 3LY5A 1HT2E 4B44A 3ECCA 4DLTA 3UMRA 2IS2A 1DEKA 3GLGA 4A36A 4CGZA 4C2TA 3GJ8A 4OHZA 1KI6A 1Z8FA 1KI6B 4JLOA 3ZVNA 5TV2A 1MABA 4GNKA 3HPQA 2GF0A 4Z1MD 5LD2B 1EWRA 1DAHA 3FHCB 3C14C 4OI2A 4R2HA 1NKTA 2VHQA 2QPAA 4BLTA 4NMMA 1M8PA 5BYKA 1UKYA 2QG6A 1W48A 3C8UA 3M6AA 3QBTA 5EE1A 4GMXA 1J8MF 5FOTA 3PR1A 3A6PC 2XXAB 3BRWD 5JSZA 1W46A 3PEWA 2JJ2A 4LBVA 2XX3A 1LF5A 1SKYE 1W0JD 1LF0A 4EDHA 5FBVB 3FTQA 4WW0A 3BBPA 2ZJZA 1ZAKA 2DR3A 3QPVA 3IDQA 1R4AA 3QIAA 1RRPA 2ZE8A 4LX0A 1G8GA 1KDTA 2WVJA 2VO1A 3KXLA 1OHHA 3RVBA 3IKJA 3OEHD 5TMPA 4RZUA 4KI0A 4QJ3A 221PA 2XGJA 1KI1A 4URVR 2KE5A 1QF9A 2GJ8A 4IHQA 3VNUA 3RRNA 2XOKD 4JZKA 2A7QA 3W34A 5LB2A 4C7OA 2C5LA 3THYB 2B8WA 1KGDA 2IUUA 3OFND 4URZR 1G3UA 4JBWA 2AXPA 4LDJA 3I72A 5DH9A 3GLHB 1HE1C 1QRAA 3B6EA 1QDEA 1DTSA 4O0MA 5KSPA 1YZTA 4OJQA 1IY1A 3WYGA 3GJ3A 3T1TA 1ZMXA 2IF2A 2FH5B 3SYNA 2OCAA 2ZU0C 2IYQA 2IYRA 4MDEA 4DT1A 1WBBA 4P4TA 3CZQA 3MLEA 1U8ZA 2C78A 1NMYA 1VCMA 3FHTA 2EVWX 4PSVA 2VH5R 5GJWC 3PQCA 3W8NA 1RKBA 4RFSB 1X8LA 4P0TA 1Q22A 3DDCA 2Z4RA 1ZVQA 1G16A 2ZROA 3B7GA 5G3YA 4GOKA 1ZYUA 1KKLA 3SR0A 3QF4A 3NBXX 4Q21A 1XCMA 1IY2A 3AP3A 1OHHD 3WNDA 4XVUA 1G7SA 1NN1A 1X8JA 4ZIRB 1NLFA 2ZRNA 4HZIA 4D0GA 2QAGB 2QAGA 2FSGA 1Z0IA 3CX6A 3GD7A 3K09C 4ZKDA 4RY2A 3WHLA 1VYUA 5BN3A 2HV8A 2WJIA 1J7KA 3I8XA 2WJVA 1XTQA 3QEOA 3THOA 5LPNA 4A15A 1SKYB 1Z2CA 4KHZA 4NE2A 4BRWA 2O8DA 3EIHA 1OW3B 4QHTA 1ZBDA 3CWQA 1XPOA 3AF2A 3MSXA 3B5JA 1OYYA 5ANRB 2GEVA 2FGKA 2GAOA 1BOFA 1P72A 3H1TA 3W6OA 1NJGA 2GHIA 2H8KA 2PT5A 3CPJB 1II0A 3BH7A 3L0OA 2ZAOA 4V0NA 5FPSA 5KPDA 2JJ1D 3C5CA 1HQCA 4TQAA 3K0EA 4CIDA 4URWR 4LYHA 3I5XA 2ZI3A 5FOUA 2AKYA 1KK2A 5FOWA 1Z83A 1Z6AA 1GG2A 1G3MA 3U7EB 1D9ZA 4DCNA 2BDTA 3WYFA 3AKYA 4LJYA 5DSZA 3NC0C 1NG1A 2O8BA 4GBMA 2CJWA 2JLZA 3ICEA 1T8UA 5KOYA 1N2CE 2QMOA 3OAAD 4KYUA 1TMKA 2IEYA 1FNMA 2PZFA 2O8CB 1TX4B 2CE2X 1KTVA 2V9PA 2YJTD 3FKSD 3HWSA 4TT3D 1B23P 1KI2A 2ORWA 4F4CA 3HYRA 5JJLA 3VX4A 3AVUA 2CLDX 2J45A 1O3YA 2O8FB 4OK5A 2J1LA 4JVSB 2QTFA 4A8JB 1IONA 2WSSD 1EXMA 1F6BA 1XTRA 4LBYA 1EFRD 2JLXA 4AIIA 3VHLB 2Q9CA 1KK1A 4LHVA 721PA 2WWIA 4M9QA 2FGJA 2IUTA 3X1WA 1P7CA 1ZM7A 3EWAA 3T34A 3I92A 3I3SR 4Q1DA 1RFLA 4W5WA 1H8HD 1WXQA 1E2JA 1E2DA 2IA5A 4PSAA 4ESHA 3LXRA 4HDOB 4A9AA 1RZ3A 1W4CA 4RD3A 621PA 2QENA 2ZR0A 4OL0A 2FSIA 2J7PA 5FPTA 2UZ3A 2OSBA 5B30A 5CITA 3QVUA 3SC3A 3ETLA 2AXNA 3EIQA 4CYMA 1LNZA 1OXUA 1RE0A 3CRQA 2ZVPX 2D62A 1E2GA 4L15A 3UKDA 3LW8A 1Z0DA 5KSOA 1I4DD 3MWJA 3BB4A 5DNYB 1XTKA 2G77B 4FWTA 2GBLC 4G5RA 1GVNB 4TYQA 3KL4A 1OSNA 2WKQA 1IM2A 1W4RA 2G83A 5K8IA 4KSBA 3CONA 5EP3A 3EA5A 1DADA 1XFAA 3NHBA 4GFDA 2JLSA 2KBEA 1X3SA 2W6JA 3MJRA 4EQ6A 3K0SA 4WVFA 4GOXA 4UXHA 3TJZA 4ABYA 3IILA 3R8FA 4Q9LA 1SXJB 1XMVA 3LLMA 3QKRA 2I1QA 1M34E 1OH6A 5AJWA 3WP0A 2FSHA 3L8YA 2J9RA 2XNSA 2GWHA 2NG1A 2MSDB 1MRSA 5DI3B 4TYYA 2WOOA 1Z2AA 1UADA 3SYKA 4TYWA 2DFNA 4ZDKA 1QHSA 1D2NA 5CYPA 1ZM9A 3IEVA 4CDGA 2V6IA 4IOMA 2QT1A 1N0WA 3U7GA 2W6IA 5DIFA 4B3DA 1II9A 3ADCA 1TTTA 2GXSA 1KSGA 2IXFA 3X1YA 3AGPA 4US0R 3UIEA 3AVTA 1DAEA 4B3FX 1EWQA 2IXEA 2F3TA 1DAMA 1T3HA 3DO6A 5KDOA 1XXHA 2UVQA 1G19A 5TXGA 2JJ2D 2Z6VA 2GCNA 3CX7A 1Z6YA 3CIOA 2FEMA 3QKRB 1MH1A 2RKOA 3ZZTA 4Z8XA 1WE2A 3CRMA 5EP2A 4QGFA 2R6AA 3KB2A 4LPKA 3SS8A 1PLJA 5J4KA 3AVQA 4JSTA 1L7VC 2RGCA 4DLWA 3CKLA 3EA0A 2ERYA 4Q18A 4CW7A 1UBCA 1E98A 3G5UA 3K0AA 2OCYC 2C04A 4A6XA 4KFTA 4JKYA 4EPWA 5F3WB 1XTJA 3WMGA 5JS8A 1ZC4A 4F93B 1PZNA 1XDBA 4P33A 4X8HA 4CEHB 1W44A 2RHMA 3VR4A 4B71A 4NYIQ 2DWOA 3H0KA 4B48A 1YE8A 1Q1BA 2XSZA 3QPUA 1A2KC 1XXHB 3U3JA 1N0VC 1QHHA 4WZAE 3CRW1 4IXMA 1NN0A 2G3YA 2ZJ8A 2NO9A 1NNEA 1FX0B 2P67A 5DO9A 3BB3A 1NBMD 2XNDA 4HDCA 4A0GA 4JIMA 4JS0A 4L5BA 4QGHA 1UBGA 4CT4B 1E9SA 1P73A 1BYIA 4DSOA 5FOSA 1PUIA 3B9PA 4I1UA 4TLEA 2VF7A 1LY1A 4XWAA 3TUIC 2ZRBA 3NKVA 2WMNB 4KFUA 2WBLC 1ETUA 2BMJA 1W36C 1KOFA 4MYCA 5KNDA 2A5GA 3EC2A 3EZ9A 5FUYA 5FH9A 2P6UA 4V0ME 2GDJA 2IYZA 4IDNA 1JR3E 3Q3JB 5H68A 3GLFA 3EZ6A 4ON9A 2ZRPA 2VA8A 1F3OA 3IHLA 5CIWA 3SJBA 1TL7C 4EJSA 2XEXA 1R8SA 1P6XA 1P9WA 4IDHA 5GADl 3AVPA 3L0IB 1VHTA 4E09A 1PJRA 1P60A 3NIBA 2WPDD 4D6PA 1L4UA 3A4MA 4Q00A 5B58C 3J81k 1T6NA 4RZXA 5SZHB 4FD2A 4AKEA 3MRSA 1YZQA 3BJIC 3IBYA 4QM7A 1N5IA 3LVRE 3IHWA 5L3VA 3TQFA 3RSLA 3KJEA 3S1AB 1M7BA 2XTMA 4TLCA 2DPXA 2PZGA 2R2AA 1CLUA 3WXMA 2IUSA 3PEYA 2WJJA 1OLOA 2ZRAA 4L8GA 4JVNA 3OAAA 3PENA 5FBRB 1QHYA 4OQFA 2JLQA 4BLRA 2QORA 1CR1A 1GM5A 2D4HA 2GTPA 2WOJA 3KQNA 2JA1A 2OUKA 4Q4AA 4JL5A 3TQCA 1P61B 4QKQA 3KZ1E 4NHOA 4BLQA 1Z0AA 1YZGA 2QRZA 5CK4A 1DPFA 4Q9IA 1E79A 5GVRA 1YRBA 2OXRA 1G8PA 1D6JA 5KUTA 4JLJA 2WWXA 4U5XA 4P4SB 5K8LA 2WIBA 4B3BA 2ZPTX 1BIFA 2WPDA 3BH0A 3WBJA 3W5IA 4JLKA 4DUGA 4U7DA 1W36B 3B60A 2GXQA 4URXR 1RYHA 1ZIPA 4LJ6A 3GLFB 4IOLA 3C41J 4D0LB 1W2GA 3QXHA 4N3NA 2JJ8A 4GZLA 2BKUA 3GEEA 3AGQA 4TWZA 5BN4A 4OQLA 3GJ5A 2QMEA 5DISB 3B9QA 2ZYVX 1LV7A 1C9KA 3EW9A 1GWNA 4BEJA 3AVVA 1UBFA 3ADDA 5SZIA 2FFBA 1KO8A 2OLKA 1A5TA 5G41A 4MA4A 4I1VA 2J7KA 4XJXA 4M9SA 1E9BA 1I2DA 1R7RA 5KYKA 3TSZA 4JL6A 4JT2A 4A4DA 1VYVA 4DIEA 1UDWA 3K70D 4C0SA 4DLSA 2YC2C 3DM9B 5H70A 3SJCA 3N70A 3B78A 2ZR7A 1IY0A 1KDRA 1VYTA 2VP2A 4NBSA 3RDPA 1HURA 4DBLC 3PUZA 2AWOA 4DDVA 3U60B 4BASA 1NMXA 2A3RA 1Q21A 3VKGA 5JFGA 2A2ZA 1OFUX 2D06A 3ICQB 2V55B 4HB4A 5CDFA 5TARA 2QPTA 4NYMR 3AB3A 4HLQB 4XH9B 2GAAA 3CZPA 4NCJA 3U3KA 1Z6TA 2VPPA 5F9FA 4PAQA 3KDSE 2BM1A 4RFSA 3CPHA 4JBYA 3PCRB 4QJ4A 1FMLA 2LCFA 2ZS9A 1OE0A 3GJ4A 1NG9A 1M6NA 3EWSA 2GJAA 2RGNC 1IAQA 3BD9A 1XZQA 3KUDA 1IBRA 1VKJA 2V7QA 3TR5A 1EG7A 4WAUA 4B33A 1XU4A 5UKDA 2FSFA 4E5UA 4D2IA 1U90A 1AJEA 5CYOA 4JYCA 1FQJA 2ZITA 4OQNA 4JLBA 1II8A 1N6PA 3CRVA 4Q4JA 2BEKA 2KWIA 2XB4A 4MUBA 2GK7A 3I1FA 2QBYB 4GL2A 4DEYA 2FV8A 5CJ2A 2HUPA 2CE7A 4IOJA 4TYNA 4ZCIA 4DB4A 4NTZA 4C0KA 1YR8A 3O47A 2OEPA 4RD6A 1S9DA 5K8TA 4MGIR 2NPIA 5JJKA 3P20A 2O8EB 3T06B 1JECA 2D3WA 5B64A 2BHRA 2X1VA 2IT1A 1WBDA 1AKYA 4HYYA 3NHAA 3HJNA 4DLYA 3Q85A 1TF7A 1QBKC 4LY6A 1E2MA 4FIDA 5EUQB 2VP5A 4HB0A 4ILEA 5JBQA 5IDVA 4QRHA 3TVDA 4FMBB 2ZI5A 4MH0R 2VSFA 3MWKA 4FN5A 4P3YA 3UG7A 4Y0AA 1R0YA 4Q4JB 1D8TA 3REGA 4N0DA 1JQLB 1U99A 4PZYA 5E7IA 3PUWA 3M1IA 3B8HA 2GJSA 2J0VA 3PG5A 4Z1MA 1OXSC 4J0QA 5KDDA 1NBMA 5FBWB 3TW4A 1NF3A 4EPYA 1BMFA 1NMZA 1XEFA 4QGGA 5A4JA 2P6RA 3VR3A 1XD2A 2QNRA 1WRBA 3K0FA 1XEWY 2QMHA 2ASEA 3P4XA 2C9CA 4PANA 1FUUA 2W00A 2IL1A 3EZ2A 5BQ5A 3R8CA 1R5OA 2ODNA 4C0HA 3SI7A 1J99A 3CF6R 3ASZA 1E94E 2W2VA 4FCWA 4LI0A 3RLFA 3CNLA 4TTRA 1XMSA 1MR3F 5IK2A 1J2JA 1UKVY 2DB3A 1VDZA 2ZSFA 1DELA 3X2SA 3G82C 2F43B 4MYUA 5C1BA 4DIDA 5C2JB 2H17A 4O25A 3UATA 4GPTA 4B2PA 4NYMQ 5J5CA 1ELOA 1TAGA 3KJIA 2F7SA 1RRGA 3O8RA 1UM8A 5J4HA 1F48A 1G1MA 1HEIA 1A4RA 1Q1QA 2PX3A 2QU8A 2XOKA 3A4NA 3DM5A 3OE7A 4BUJA 3OFNA 4A8JA 2XAUA 4W5HA 3U44A 4HUQA 3U4QA 3BK7A 1WMSA 3NEJA 3M0EA 2C99A 3CF0A 3N5CA 4M2LA 2JIZD 5G53C 2W2XA 4PPQA 2JATA 3ZQ6A 3TE6A 4YMUA 3TMKA 2RMKA 2DFTA 5FUWA 2ZS7A 1YR6A 2HCJB 5SZJA 4M1TA 5EZ6B 2KB0A 2OM2A 3AH8A 4MUAA 2CDNA 4CF7A 4XWOA 3LX5A 3QXJA 4AWXA 5EXSA 4P32A 2A78A 3ZD6A 2UKDA 3U7FB 4JYBA 1ZD9A 2WIAA 3K8YA 3ZIAA 4EFMA 1EFUA 2ZRIA 1TQ2A 4BQSA 5KO2A 1NI3A 4C0JA 2BKEA 1IXRC 4JL8A 3B1WA 2YZ2A 3EARA 2XZLA 3TR0A 1HH4A 3CPEA 4L4UA 4RD4A 2ZE7A 2ZI9A 3WYAA 5BXQC 3BERA 1XP8A 3UPUA 2R6GA 4KAXA 4BEBA 3FE2A 1TF5A 1UAAA 1G41A 1NN5A 4IW3B 3I5YA 2KBFA 2WAYA 4JLVA 5JMTA 1UEJA 4Q4HA 3CX8A 3BS4A 2ZE6A 3JZAA 1KHTA 4PX9A 2GZDA 4BLSA 2GCOA 1W0KD 4QNRA 4RD2A 1R5BA 1NVUQ 1U9IA 5AWFC 1I2MA 1TQ6A 4N0EA 3RRYA 1H8HA 1DG3A 2QAGC 4KBGA 4F7WA 3B1VA 4LRWA 4W5JA 1TQDA 1XEXB 3FFAA 4S2EA 1G6OA 1SHZA 3WNBA 1NL3A 1Z6XA 1WB9A 3KJHA 3UWKA 3LW7A 1WQ1R 1M7HA 2B8TA 2WAXA 1KSFX 5L3SB 3TK1A 2GBLA 4ITRC 1FTNA 5D3MB 3RS0A 5J47A 4LYAA 3UMFA 2O8BB 3WMFA 4AKHA 1K5DA 4NH0A 1BKDR 3F0TA 5AJXA 1C4OA 3PUYA 1G7CA 3A1UA 2J0UA 1M7GA 4AYTA 1XD8A 2FZ4A 4URYR 2WTUA 1KO5A 5AUQA 2GRJA 3SHWA 2QP4A 3MG9A 3QE0A 1YJ5A 2IHBA 2YVUA 1IQPA 2AWNA 3SFZA 3RC8A 1HUQA 2Q3FA 1EX6A 2Z0MA 1WCV1 2VHUA 3AP2A 4OHWA 4B2IA 2HXYA 5EE5B 2VBCA 4AK9A 1SXJE 4V0OA 3VR1A 4LJ9A 2BIFA 2QM8A 3LQRA 5JHGB 4MDFA 4L16A 3Q8XB 5GJBA 5BW8A 5JCZA 3I4LA 3U6BA 3AVYA 4QG7A 4B3XA 3GLIE 1ODFA 1Z0KA 4GT1A 1R0ZA 1SGWA 1CU1A 4D81A 2VHTA 2F55A 1XJQA 2LKDA 4Q48A 4BZQA 2VTKA 3KXIA 3QEJA 2FG5A 1AIPA 4LPSA 4M9ZA 2QQEA 2BJVA 2OAQ1 2ZVQX 1P3JA 2YKGA 4OHYA 3AUXA 5G3ZA 3HR7A 2RGNA 1AN0A 2FF7A 5EXPA 1K6MA 1QG2A 1W1WA 2AK2A 3HPRA 4P31A 3V4FA 1Z5ZA 4M22A 1XPRA 3DEFA 4R2IA 2EFGA 1EESA 3SYLA 4MRSA 3RC3A 1ZP6A 1E9RA 1BS1A 1CJKC 3TLXA 3TSWA 3KXKA 4NPHA 2Z83A 3M4YA 4Q5IA 1XD9A 2W58A 5IF9A 2XZPA 2ZYTX 1GIAA 1V43A 3SE0A 2AX4A 5J40A 3BB1A 2GILA 1JXMA 2CEAA 4MKFA 1YKSA 5EUMA 3KKMA 3SJZA 4QC2A 2EW1A 4NP6A 5KSZA 4BFSA 2VHCA 1CJMA 3CRRA 2ERXA 4PHHA 2WV9A 1ZU5A 1TEXA 1F2TB 4GDFA 1E3MA 3C7KA 1XCGB 2ONJA 1Q12A 2QA5A 2YYZA 4DCSA 4PTLA 4NYJR 2CCKA 2ZI7A 4LHYA 3THWA 2N42A 4DSNA 4M8NE 2Q3MA 2ORIA 3U4QB 4II7A 5K8UA 3KFVA 3MJHA 4DSUA 1KAGA 3QOFA 3JZMA 4MQBA 3Q5EA 2GXUA 3B1ZA 2H7VA 1YZNA 1SVMA 3AKCA 1G8YA 1S4QA 5JZVA 3LAWA 1ESMA 1G17A 3K70B 1YVDA 2R9VA 3TUJC 4DEXA 3LFUA 4TMVA 3VU9A 3TRFA 5JSZB 3NDPA 3VU9B 4BFWA 3TAHA 5IT5A 3RS2A 1KMHA 1GL9B 3ZS8A 1XCPA 2QE7D 2JAQA 1E2KA 2YNMA 2AFHE 1OT3A 1NKSA 3MFYA 3AKDA 3D7MA 3ZS9A 3V4RA 2XB2A 4D25A 1KDPA 3IQXA 4KSCA 4US1R 2GESA 1YU9A 3W3ZB 2FE4A 2QTVB 2ZETA 1E96A 1QHHB 1S9HA 4Z8YA 2PX0A 3ONWA 1CEEA 3B13B 3E5HA 3R9IA 4B43A 1ZCAA 2ZRGA 3IIMA 4Q9JA 3LO5A 3KQLA 2Q6TA 2ZANA 1LW7A 3TVTA 4UXJA 3MUFA 4LGMA 3GLIA 1GFIA 3OE7D 4HATA 4M1KA 1BYUA 2VQSA 4TSFD 1J90A 2HF9A 1MKYA 4WBSA 4OHXA 3D3QA 4I1OA 1EFRA 1SULA 2OHFA 1T5LA 1C1YA 1Q44A 4LWZA 1MRNA 1VG8A 4QL3A 4LV6A 1IN6A 2RGDA 4V02A 4X8OA 1T0HB 2BBOA 4AG5A 1G3RA 2V4ZA 2B7BA 1JBKA 4Q7KA 4JLNA 3T5DA 1W4BA 4LOAA 5L3QB 3T35A 2CL6X 3OIUA 4MKHA 4MGKR 1AZSC 1UJ2A 3HDTA 4B34A 3ZZ0A 1Z0FA 1G5RA 2MMGA 5KDLA 4R7ZA 1XWIA 2HT6A 3QKUA 4ZDIA 4NCIA 4PZZA 3K9GA 3EPJA 1CBUA 1SXJD 1P75A 5KTYA 4CEJB 2BBTA 4H1VA 4OI0A 2O8EA 2AHOA 3MCAA 1KZGB 4PO8A 3RNLA 1J8YF 4A1FA 5KU1A 3HU2A 3KKQA 3ZQJA 2REOA 2DCUA 3JVVA 5JLJA 2QBYA 1DAGA 3GJ7A 6Q21A 5CLLA 1U8AA 5FPYA 2RB4A 2NGRA 2BCGY 4JLDA 4C30A 3H84A 5J4VA 4LK2A 1QHXA 1XMJA 2CMKA 2HEIA 2I1VB 2ZRCA 4H1UA 4LJ8A 4NYJQ 4WA7A 4KLZA 3GMTA 2QN6A 2VHJA 3RANA 1U94A 1W2HA 4UKDA 3L82B 4EIWA 2RGBA 1F2TA 4ASUD 3R7WB 3U3MA 4MRRA 1KMQA 1S3GA 4DKXA 1XNJA 4LJ4A 3GLFE 4PSKA 1RW4A 1U8YA 1Z6GA 5FUXA 1IOZA 1US8B 3FB4A 3IIJA 3FGNA 4MRPA 4ARZA 1Z0JA 4W9MC 1NVXQ 4TL6A 1PLKA 2Q0HA 2BBSA 5EE3A 2EQBA 1N6NA 4AD8A 4LZZA 1KI4A 2ZI4A 5C18A 1GILA 2Q3HA 1KJYA 4CEIA 3RS5A 3X1ZA 2PEZA 3CR8A 4B3CA 3PUVA 4LC0A 3VTKA 1GITA 3DPUA 1JXOA 3GJ0A 4A0HA 1TU3A 3U61B 1CS4C 1S2MA 1IXSB 3KKNA 2P5TB 3LRPA 2FN4A 2IYVA 4BLOA 1HY3A 1ESNA 1ZD8A 1UKEA 2ZSAA 1VG9B 1VHLA 2IBMA 1E9AA 3K0FB 4C0QC 3BOSA 1GL6A 3R9XA 121PA 1KAOA 4M4SA 2VP4A 4POAA 1RVDA 4LYJA 4QGAA 2F1RA 2MSEB 3GFPA 2Y8EA 3QF4B 4DZZA 3LX8A 1CF4A 3AF3A 2ZJ2A 2QM7A 2HLDD 3D6TB 2VSXA 3QKSA 2J7PD 5FR2A 2ANCA 2HT1A 4GP6A 4NCHA 2QL6A 3IQWA 3VR2A 4XVQA 4NCNA 5B57C 5KSYA 2Q9AA 3F5FA 1JR6A 4R98A 3ND9A 4FINA 3ZH9B 2PMDA 5A5GA 3THWB 1ZNWA 2GEDA 1K5GA 1GL7A 3CF2A 1N6HA 2YV5A 1OH5A 2ZRHA 4RSGA 4GRAA 4N1AA 2IWRA 3FDIA 1JB1A 2ZUBA 2ZREA 2JDIA 1Q1EA 4IDQA 5EXXA 4X8LA 3GEIA 1L4YA 1G4AE 4M1OA 3NDBB 2XNDD 4KXFB 4EJSC 2FWRA 4LSGA 1DS6A 4QBFA 2PT7A 1KJWA 4Y0VA 3AM1A 4Q1FA 2GF9A 3LBHA 2R44A 2EWVA 3A58B 3WMEA 1E0AA 3EX7C 1SKQA 1KI7A 3NH6A 1CR0A 1OB5A 1GZSA 3VX3A 2JASA 1XEXA 4HZUB 4CEJA 2R6DA 4HDQB 4QHYA 1GRNA 2FPLA 1GRQA 4LV8B 1N6IA 3A1SA 1LFDB 2AKAB 3U3OA 2VRWA 1L8QA 2PJRA 5DLQC 3K9LA 5GJCA 4ZI3A 3KKOA 2XSZD 5FTMA 2WWGA 3AUYA 2GK6A 2J46A 4MRVA 1KO4A 2CCGA 1O87A 2O0JA 5FOVA 1MOZA 2HCBA 3L0PA 3FVQA 4RJLA 5JWRA 4GI7A 4TTQA 1BH2A 2BMFA 1KKMA 1QVAA 4XOIA 4UNSA 1XF9A 1R8QA 3D31A 3DMDA 4YDSA 3UANA 1XB2A 3IIKA 1RRCA 1DO0A 5BYJA 4LHWA 5FOXA 4ZO4A 4OBEA 5CK5A 4ESVA 4K8OA 4DT1B 2BJWA 4BRUA 2L0XA 2NOAA 2RGXA 3E2IA 3BFXA 3TW8B 4TZ6A 1H65A 4WZBE 1MO5A 1E1QA 3IO5A 4YXWD 1Z06A 2BV3A 2WM9B 4KBFA 1H8EA 1E6CA 3W5JA 3ASYA 2J5XA 4YMSA 1KMHB 1JPNA 1GNQA 4JMPA 4FCTA 5AJVB 1P5ZB 3CNOA 3LNCA 1HQYE 3EG5A 3GJXC 4KFRA 5D3MA 3IEUA 4DDTA 4YQFA 2IYSA 2VP0A 4NDZA 1KO7A 4EAQA 3AV0B 2OFOA 4KO8A 1S1CA 2DYKA 2MSCB 3PITA 3RYTC 4F91B 3U44B 4JLPA 2OLJA 3AP1A 3B2EA 3SOPA 4TMTA 2ORVA 1Z22A 1GKUB 4M1YA 5C4GB 1A7JA 1KDOA 1NP6A 2DWPA 4MYTA 2QPOA 5IHPA 2R65A 1G8FA 2P6NA 2HYIC 2WSMA 1DOAA 1T3LA 4PQYA 3AVOA 3K53A 1ZNZA 4FMCF 4JBXA 3ZYCA 1PVOA 2OZEA 2ZYUX 2ZJ5A 3NBYC 4IDOA 4XD7D 4ZI2A 2IK8A 3WRXC 1N6OA 4FCVA 4GP7A 2OESA 1YZKA 3LDAA 4A82A 4B3GA 1U0LA 1XBTA 3SU8A 1AK2A 4US2R 4CVNA 1TF2A 1G3IA 1GP2A 3GLIB 1P2SA 3T1VA 3U5ZB 3KJGA 2OBNA 2GEUA 2YINC 3QBVA 4ACAA 1ZD1A 1COWD 1JJVA 2J59A 1WF3A 3A1WA 1HA3A 5DE3A 4PC3A 3LWNA 4DC9A 3ZGXA 4JSYA 4FWIB 4ZV4A 2XZOA 4UNPA 3T1QA 4TL8A 3AVWA 1N25A 1ZNYA 4JT4A 4TT3A 2FFHA 1TPZA 3FMPB 3EZFA 1G64A 1FFHA 2J87A 4AY2A 4QXAA 5BWMA 4UNRA 2JEOA 4G0NA 2X77A 3QENA 3Q5DA 3VMFA 1EGAA 3VAAA 2H57A 3BC1A 4A2QA 1NVVR 4ZCLA 2DHRA 2ZI6A 4TN1A 1DBSA 3L0SA 3EXAA 4LJ5A 4BFZA 2GETA 1ZNXA 4FW9A 4A0RA 2B7CA 3KUCA 421PA 3P1JA 3LD9A 5EP4A 3K70C 2N46A 3ZIAD 5JJIA 3QNUA 4Q7LA 3NXSA 1XJ0A 4BFUA 4Q01A 1JEEA 3QVVA 1R0XA 3KKPA 1OV4A 1N3BA 5SZKB 2QSZA 8OHMA 3CH5A 1Q20A 4JVMA 2HXSA 4OK3A 1F2UB 4BE7B 1D2EA 4P4UA 3MWYW 4XVRA 5DN6D 2WMOB 2J0UB 1II8B 4TL9A 1SVWA 1EFHA 2JLUA 3KQHA 4Q7MB 1VECA 1E2PA 3QG1A 1G18A 3AF4A 4I99A 4TMZA 4HAUA 2FNAA 1CKEA 4TMWA 4HUTA 1T9HA 1AM4D 1P62B 3C4JA 3Q9LA 2QMUA 3ZVRA 2GJ9A 2ZSBA 4DUGD 3U7HB 2N1BA 1M2OB 3TSOA 3C15C 4OYHA 5F98A 1CP2A 2EFHB 3DMNA 5E7JA 2OBLA 3X1DA 2V6JA 2NMVA 1P2UA 1JR3D 3GCGA 1GDDA 4HZUA 5JHHB 2IX3A 3KQKA 2HJGA 2VLIA 5CB8A 4ZPXA 3OEEA 2IS1A 1E4VA 3RS7A 2G1JA 5FBLB 1A1VA 5FPKA 5FR1A 1AS3A 4CEIB 2WJYA 4HB3A 2VP9A 2OILA 2D2EA 3MWLA 4DLRA 1FP6A 3VR6A 2CLCX 4Q1CA 4RKEA 2W6ID 1E2IA 4L9WA 2ZRKA 4Q1BA 3U3RA 4B73A 2O8FA 4QBGB 2IYYA 2GCPA 2D74A 1F5NA 1SHKA 3FYHA 4E03A 1WA5A 5JI3E 4DSTA 5DYIA 3QI2A 5HR5A 2H92A 5FFMA 1N5LA 4EPTA 1JALA 1Q0UA 1KNQA 1W5TA 3QY0A 5CM8B 2GJKA 2WJGA 1FUKA 2QGNA 2PZEA 2Q9BA 4Q47A 3KQUA 3GLGB 3OIVA 1OYWA 3F3YA 2GNOA 3B82A 3D8BA 4MITA 1W0JA 1AGRA 1QHIA 1G6HA 2X8AA 2H16A 2OAP1 2ODEA 3LXXA 2YWGA 4FMDF 3PVSA 5FI0B 3T61A 1JPJA 2BMDA 2G88A 1LS1A 5FBQB 3P26A 5B2ZA 1PLLA 2FA9A 2BEJA 2VF8A 3ZDQA 1CR4A 1SVSA 3IGFA 3W9YA 3KTAB 5EXTA 5HCNA 1EFCA 4P4SA 2BWJA 3EC1A 4PFSA 1BMFD 1KI9A 3UG6A 1SXJC 1NN3A 1M1YE 1ZM2A 1RPZA 1T5IA 4QOSA 3TNFA 4M1WA 3GJ6A 4Q9KA 4K46A 2YOHA 1KY2A 3SQXA 4IEIA 1L2TA 4XIGS 4PPFA 1TUIA 3RRMA 2F1JA 3A1TA 3WRYC 4HAXA 2P0EA 4NL4H 4A2PA 4DLVA 1J70A 3VFDA 3K0CA 2DBYA 4C3ZA 5IK2D 3GLGE 2GKSA 2RHDA 3EZ7A 1ANKA 3P32A 1E9FA 1TUEA 2EFEB 4UXIA 3K0AB 3K0CC 2O52A 3AQ4A 3K09A 1OPXA 1SVOA 3R7WA 4DJTA 4B47A 1DVRA 1ZM3A 2CVFA 4G5GA 3GFOA 4TLAA 1CULC 3RS3A 3SQWA 2PBRA 4RD0A 1Z47A 5JEDA 3EPLA 2Z4SA 4IDPA 2R8RA 1AQUA 5CIQA 4CEHA 3FPAA 2ZUCA 2ZRJA 3DZ8A 2XITA 2PLRA 1GOTA 4RKFA 5IRCD 5HZKA 1KI8A 1SZPA 3CH4B 5EP1A 5JRZA 3VQTA 3OZXA 4Q03A 2CLSA 2IS4A 3W8RA 2EU8A 1AQYA 4JVLA 1RC8A 4C7OB 3H2YA 2F9MA 4O3MA 4NCKA 2F3RA 4TMKA 4BLPA 2YWEA 1MV5A 5AUPB 3SN6A 4KU4A 5E7MA 3CB4A 1FPMA 4A8JC 3L8ZA 3CR7A 2BMEA 2JCSA 1GSIA 2NIPA 1A2BA 4URUR 1RJ9B 3W3AA 4XD7A 3ZZUA 1RIFA 4Q19A 5C4MA 2YC4C 5JECA 1HV8A 1S3SA 1KK3A 1KJZA 1TEVA 1EK0A 1MO6A 5DI9A 4FMCB 1VCNA 1SXJA 4HAWA 1VG1A 1VPLA 1W49A 5CJPA 1P9NA 2NPFA 3CBQA 2AN9A 1FL9A 1IN7A 4OK6A 2OO7A 1D2MA 4O2LA 1NLZA 3QF7A 1UBEA 4B74A 2UZIR 5KNCA 2X19A 4TMXA 4AC9A 1OKKD 2QEQA 1T0JB 4ZDJA 1MABB 1VCIA 1AS2A 1NIPA 3MAAC 2B92A 4AI6A 2EFDB 2F1HA 3CNNA 1KO1A 1M74A 3O8DA 4XSHA 4FXPA 3SDZA 3QSYA 1Z63A 4EFNA 4RVCA 1T3SA 1FOEB 2A9KA 4E22A 5HKKA 3SBEA 4RD1A 4YONB 4B32A 2DFLA 2CNWA 1E9EA 1NSTA 4QJ5A 1TU4A 2C95A 2IS6A 4YLGA 3RABA 4E07A 3RRZA 1KYIA 4DHEA 3TH5A 1UEIA 4Q7JB 3IO3A 2ZM5A 1EX7A 5TVKA 2KSQA 4HLUC 2WWHA 3GQBA 5FL7D 1WP9A 2YHSA 3THXB 4Q9HA 4XWKA 1NJFA 2NQ2C 1JI0A 1U9IC 4MGZR 3ZJYA 1QVRA 1ZUHA 2IWHA 1JEDA 2IF0A 4RZ3A 1U98A 1R2QA 1YR7A 2QI9C 4HLUA 5FL3A 2TMKA 4KLNA 4IXNA 5D3QA 4A6PA 1E2EA 2P2LA 4PC6A 2FPKA 4V0MA 1E0SA 4A2WA 1VTKA 2R62A 5TDHA 1ZJ6A 2AD5A 1AA9A 1RRFA 3CUEF 3IBGA 1CJTC 2VP6A 1P2TA 3W90A 1N5KA 1GTVA 2WSSA 3T1OA 4KJZA 1OKKA 4EUNA 2PL3A 2RAPA 1Y63A 2ZRFA 4DLUA 3QKTA 2ZU6A 5HZHA 1QG4A 3QJYA 4LYFA 1CXZA 2AD1A 5E95A 3RS4A 3SJAA 1S1MA 3B1XA 1OH7A 4FMDB 4B6EA 3I61A 4UQOA 4D80A 1FP7A 3CW2A 4ZKEA 2BC9A 4C4PA 4DLZA 3A37A 4PR0A 2I4IA 2FZLA 1LVGA 2NTYC 4U02A 4YMWA 2HYDA 3NC1C 1W4AA 4L9SA 2DY1A 1G8HA 1SVLA 3LVQE 3F8TA 5FL7A 3R9WA 4TYPA 3LBNA 1F2UA 2RGEA 2HF8A 4G01B 4HLCA 3DL0A 1ZC3A 1E2LA 4HI0E 3GLHE 2LKCA 4DCTA 4EQ6B 4JLAA 2VSOA 5EQTA 5FTNA 1G5PA 2KJQA 3BFVA 2YOFA 4HUQB 5E3HA 4F4IA 2ZRLA 1Q3HA 1KZ7B 3NBZC 3T12A 3DVLA 2V1XA 2V7QD 1DAFA 2O8DB 2IW3A 3PUXA 2ANBA 4NZYA 4NU0A 3RWMB 3V00A 2CHQA 2IC5A 5DGXA 3MGCA 1QHGA 3I8SA 4XTCS 1D5CA 4IFEA 4PZLA 1XEWX 4NKRA 4QFMA 2QE7A 3BH6A 4IVRA 1E69A 2GA8A 2QP9X 2E9SA 4O2RA 3TKLA 4F4JA 521PA 5KNBA 4WOPA 4F92B 3P4YA 5EJEA 2A5JA 4LBZA 2BVNA 3BFKA 4MYHA 4KV9A 4WXRA 5CLQA 1E2QA 3TIFA 5DHAA 2ATXA 2D7DA 2YOGA 1DARA 1FQKA 1KSHA 1R5NA 2V3CC 2VL7A 1UKZA 3C5HA 2C8VA 3BORA 1MT0A 2F9LA 3OIWA 3OESA 1WDTA 4PO1A 4D4LA 2AK3A 2D2FA 3FOZA 4M0LA 1VCOA 1UPTA 2DWQA 3GFTA 4YDHB 4GMDA 1F60A 5AJZA 2KI5A 4ARZB 4PQFA 1OXVA 5FTKA 4BZPA 2WWYA 4M1MA 4DXAA 3LLUA 4M53A 2LWIA 1BO6A 1Q1ZA 3NG1A 4D4JA 3LH5A 3SZRA 2WWFA 3G0HA 1X1SA 3GEHA 2NZJA 2REBA 3QG5A 4RZ2A 5JEEA 1PV4A 2GVDC 2DFKB 4WZ6A 4DLXA 4BFXA 3DZDA 3KTAA 2RGAA 4TL7A 1XMIA 4V0KA 3BWDD 1XX6A 2IYXA 3ZLJA 1FTSA 1YQTA 4K81B 4Z54A 5TB5A 4R71A 3ZVLA 1Z07A 5JWHA 3GPLA 1XJCA 2C03A 3E70C 4H9GA 3WBKA 1P2VA 4UNNA 4DDUA 1E2FA 4DRZA 2NO7A 5TY0A 4I81A 821PA 1B0UA 3RSOA 2MMCA 5JCPA 4F38A 1ZUIA 1H8ED 1OXTA 3FFBA 5LB4A 3RHFA 5CB6A 5HPYB 4WXPA 1TADA 4Q1EA 4YC7A 1E0KA 4OQMA 1HYQA 1W5SA 2CL0X 1E79D 2IYWA 3W6NA 3X1XA 4IKEA 1DG1G 2C2HA 3FKQA 2ZQ5A 1KI3A 4HAZA 4QNMA 1E99A 1N6RA 3KFXA 5L8VA 2ZIAA 5BN5A 3Q7PA 2OE2A 1IN5A 2ZRMA 4Q4LA 5L3QA 4QM6A 3ADKA 3B1YA 2JJ1A 2FOLA 1NLYA 3TAUA 5AUNB 4ASUA 1AS0A 1OFTA 3R20A 3MD0A 4QBIA 1ZU4A 2PH1A 4JJZA 4WIAA 5F2EA 3U6KA 5KPJA 3SNHA 4DCVA 2A5YB 4D4KA 1E4YA 1JJ7A 3B85A 1EFTA 3FMFA 4MKIA 1MO4A 1T4GA 1IJFA 1DE0A 1E32A 1E1QD 2CHVA 2ZYWX 3FMOB 4TLBA 4YXWA 2QROA 2ATVA 2C96A 2CVHA 1S96A 2RGGA 4G5SA 4LV5B 1G7TA 4IOKA 3OHMA 3U2QA 1G21E 4TQUS 2A30A 1SVKA 3SEAA 2F6RA 2ODWA 1Q57A 4BWYA 3FKSA 3DOFA 2GVZC 1YR9A 1G20E 2G6BA 2RCNA 1YRAA 1GKYA 1KSJA 3H4MA 5DHFA 2CJWB 5J4YA 4KODA 3SHFA 2GZHA 5FTLA 5G40A 1GAJA 4GOJA 4B35A 4IFBA 3PV0A 4Q1AA 4TLDA 1Z29A 2G0NA 1GKIA 1OIVA 4G5QA 1SVIA 3NTUA 1XTSA 2P65A 2W6JD 4C2UA 2OV2A 2ZJOA 1HE8B 1NVVQ 1RJ9A 3L43A 3TUZC 3SBDA 2WHXA 5JS7A 3FWYA 2QY9A 2GXAA 1DAKA 1NBME 3NH9A 4KCGA 3WHKA 4OJKA 4EPRA 1IN8A 1CR2A 2QP3A 2OG2A 5JRJA 3N2EA 1FX0A 4V03A 1YZUA 1AKEA 2A5FA 2VIIA 3QXCA 4HB2A 3BGWA 4KVAA 1JAHA 1P9RA 5LDDC 3DKPA 4B75A 1R10A 4M21A 1FW6A 3WNCA 4XSGA 1U81A 2E1RA 2FU5C 4MGYR 4C0AC 2HJVA 3LV8A 2K5UA 3QUSA 4CZ2A 1G4UR 3IPYA 4LBWA 1LB1B 1FMJA 1GNPA 2XJ4A 3EASA 4ERNA 4EFLA 3A8TA 2JLVA 4BECA 2OCBA 5AUOB 2O5VA 2B6HA 2QTHA 5ELXA 4D4MA 2V1UA 4R9UC 4UJ3A 2JLRA 1G9XA 1SQ5A 3UWOA 1JQJC 2EYQA 3QXSA 2EWWA 2XTNA 3OF5A 3LQQA 2PMKA 1U2RA 3QQ5A 3EAQA 2O0KA 4B6FA 2Z5FA 4IVPA 3AVXA 3AKEA 3H86A 4FI3C 1T91A 2WKPA 2J0SA 3DKVA 2FPMA 4I4LA 1KY3A 4ZDWA 1NY5A 2SHKA 1NY6A 2YWHA 1TNDA 4OQXA 4IVQA 3AEZA 3BIFA 1NVWQ 1XTIA 4RCZA 5EE9A 2JLWA 2W0SA 3VKHA 4IRUB 1OFIA 2JLYA 2IEZA 3W6PA 4JKIA 3CM0A 4G1UC 2XTZA 4OHVA 2Z43A 1X1RA 1ZIOA 3BE4A 4HLDA 4XTRA 4DVGA 1T8TA 5JWOA 1NSFA 4IJMA 5A0FA 4MRNA 5HE9A 2OT3B 2NZ8A 1CTQA 2QZ4A 5EE0A 3KX2A 3ADBA 2ZE5A 3KB1A 4PAMA 1N6LA 1IN4A 2JDID 2I3BA 3PEVA 5FUVA 1S8FA 3TBKA 1R6BX 1OIWA 2ZUDA 3NVAA 4PC7A 5DN6A 5AR1A 2OXCA 2J3EA 3V9PA 1E2NA 4LUCA 1HTWA 1OXXK 2QAJA 3HP1A 4MKGA 5E4FA 3QPWA 4GSYA 4EJSB 3CO5A 2O8CA 3SFVA 4TQ9A 1NRJB 1E0JA 4X8MA 2JGNA 2W2TA 4LCBA 4C0LA 2QRNA 3T5GA 2P3SA 3HU3A 3PJRA 3EPHA 1PUJA 1YHNA 1JNYA 4PPNA 4BFVA 3FMIA 2ODBA 3P27A 2R6FA 1OH8A 2F43A 3I32A 3A1VA 2FMXA 2OBMA 5KHOC 3O8CA 1DAIA 3THXA 2YWFA 3EPKA 1IHUA 4NONA 1NIJA 1GNRA 5C46F 1Z28A 2HLDA 2CBZA 5P21A 2ZAMA 2IYUA 4PXAA 4RFVA 1LS6A 3OEED 1X8KA 1ZM4A 4C9BA 3N2IA 2V8OA 2EFCB 1IXZA 2FFAA 2PLFA 4D0NA 2ZJBA 5H1YA 2FFQA 5LBIA 2H1LA 5FPHA 3BAFA 4YMVA 3WP1B 1E9CA 2BOVA 1E1RA 4PC2A 4LJ7A 4LC1A 1OIXA 2GZAA 1GRRA 2CXXA 1MO3A 4EPVA 4NYIR 2H18A 4PC1A 1OF1A 4BPBA 2WWWA 3QXXA
chains in the Genus database with same CATH superfamily
4J90A 5AVVA 4PHFA 2X2EA 4Y2XA 2R1TB 1MC8A 1YJBA 2X2FA 3AERB 4JA0A 5CDFE 4QBHA 3VR5A 2XMGA 5BRAA 3WLJA 2QE6A 1D9XA 3I1JA 4HSEA 1AZTA 5GJVC 2FRDC 2P90A 3P9YA 5AJYA 3JWJA 4C0BA 5G0TA 4BQFA 3G7NA 1OA0A 4BFTA 3EYAA 4QLOA 4BNYA 4LVNA 5KB3A 1C1HA 2QQFA 4EM6A 4ZIRA 5A4DA 1STOA 5KHLB 1BC5A 2AR7A 4TXLA 2ONKA 2D7CA 1A9PA 1WM1A 2OHOA 4BMOB 5HP4A 5LZ4A 2IIPA 4OKSA 1XXLA 1TVEA 3EYWA 1TW2A 3HCRA 3P9NA 3MMZA 3PGA1 4XARA 3E82A 1FMCA 4CT5A 1YA6A 1GPDG 5A9SA 3ZJVA 1COWA 4HR7A 2AUTA 2CHUA 4BNZA 4DQ0A 1S5PA 4ALKA 4W8GA 2WNHA 3MT9A 2C9MA 4QYSA 4BZXA 1NXPA 1VL2A 5AK3A 4COKA 4H27A 3ZQ4A 3AZQA 1Y42X 3RROA 1IDOA 1Z68A 1M6WA 4LZWA 2X8WA 2ZXEA 3PSHA 3DQQA 3NYIA 1SU6A 3EF1A 5SY4A 3EIUA 4PO9A 4OHYA 3GLHA 1J8DA 2C9OA 2V58A 2XNHA 3X2FA 3LBIA 2FLWA 4JJIA 1W30A 3PPIA 3O2QB 4HBZA 4MA0A 4I1IA 2PU7A 5AK0A 3IPXA 3PCXA 1RKQA 2XB6A 4Q4AB 1QPGA 1L7QA 4CRWB 2NPOA 1RQLA 2HU7A 4ZQHA 3RUAA 1TCBA 4WKBA 5A9TA 3FCCA 3DWEX 2A5DA 2C77A 1H4QA 2H5EA 3FBWA 4ZD6A 5E8JA 2Z09A 3ZY6A 1N5JA 1U2EA 3KVOA 1CP3A 1LQ2A 1N0UA 4Y30A 4MP6A 3PFCA 4N49A 1SY7A 5J5AA 3C3JA 3ZKWB 3N0VA 4D82A 4CI9A 1PGNA 3NDIA 4H7IA 3ZE0B 5IS2A 2C98A 1RM3A 5FHRA 1W73A 2NYAA 4ODIA 2ZS8A 3FGZA 3RV4A 4BNIA 1I24A 2JAWA 1KETA 1OXKB 4FJ2A 2VSQA 3OWOA 3CCFA 2A9OA 2B21A 2O0HA 4YMTA 1X1EA 3E9ZA 5KTMA 2IH2A 2EGGA 3LM8A 3LVBA 2FUKA 2JCYA 4LRQA 1KH3A 2JIPA 4UNQA 5EWMA 4DCUA 2UYHA 2NO6A 1DINA 3CLSD 3NTXA 5HOEA 1K0FA 1T0UA 1UF9A 1HG1A 2BI4A 2H8GA 4V0LA 1IU9A 2JVKA 2QRVA 5DNAA 4OQDA 2OK7A 5JI2E 2QL7A 2GKGA 3T15A 4BGDA 2I1LA 1DP4A 2RK3A 1D4ZA 1E1CA 4UJ5A 5CPBA 1C0KA 1OVGA 1V5WA 2I3ZA 2IHYA 4HEJA 1SUDA 2HQRA 4C1BA 1QHEA 1QHNA 1G291 1Q3TA 4JJKA 1NZJA 3NOVA 3RS8A 3ZHXA 2J41A 1DIAA 5FI1B 2OFFA 4EPXA 4FQ5A 4BV8A 4AQ7A 3FTEA 5IN4A 2QSYA 4G37A 3RAPR 4KPYA 1VB5A 3VYRB 5K05A 2B1GA 2OKGA 3AJ8A 3O4IA 5F9HA 2O7SA 2QU7A 1Y7PA 4UM7A 4Z51A 2R8PA 4A0FA 1XRJA 3WZ2A 4P80A 2G8LA 2WVGA 1M1UA 1J97A 3LLVA 2EYUA 3O3NB 5EWJB 1OX4B 2FR1A 4D8UA 3QITA 1HT1E 4WE3A 4MQLA 1US8A 1O6GA 2VP3A 1A72A 2BSQA 4IZ6A 1FB5A 3HC7A 2G1KA 2QJRA 2RARA 4OKNA 2XJ9A 3CF4A 4FEEA 1ABFA 4C4ZA 1RWBA 3UMCA 1IIBA 3WL8A 4DJDC 1AUXA 2PCJA 3AR5A 4RCYA 4U6SA 1TEZA 4PTZA 3OCJA 4G1MB 3WLIA 2AH5A 3BXFA 2YV4A 1XF1A 3R4CA 4IIEA 4EABA 1ZIDA 3EEBA 1U2PA 3EXHA 1C9JA 4AW9A 5LOVF 2VZ9A 1XZPA 2Y76A 5I48A 4IGKA 4IICA 1B42A 3BM5A 4TLLB 3UMSA 4EYQA 2WV7A 4LHZA 1Z4QA 3AEXA 4F12A 5H3CA 1TRKA 3L04A 2Q1WA 3IFSA 1RKUA 4TV8B 1KAMA 4JI2B 4TM7A 3REFA 1VE3A 1SCJA 2VK1A 4UDNA 4UDYX 1E2HA 2XD4A 4HJRA 4MPPA 5DRTA 1ZRHA 2DF8A 2QXYA 3PJGA 4GC9A 4HDRB 2ZSJA 4YGYA 5IU6A 4AKGA 1W6RA 4F3CA 4EVIA 3UGJA 4CKEA 2O2CA 5K0FA 5DYGA 1LDEA 5G2OA 5I4BA 1U0JA 3KP1A 4X3PA 4AKIA 1TQ4A 2WUVA 4RHUA 4TZ0A 4LY3A 5HTKA 3KZOA 4QDUA 1JAIA 3NTLA 4DQUA 3KWLA 4X94A 2Q49A 1OU0A 2V7XA 4G3XA 4IUYA 3LA6A 1R4NA 1W35A 4LQLA 5A4KA 4HDKA 4AULA 2VOJA 5P8WA 3VVCA 1N6KA 4B2YA 3TFOA 1IATA 2D5CA 2FJUA 3IUBA 2ECPA 3QW2A 3OQNA 1JUDA 1L7AA 3AESA 1ZW1A 3MB5A 1MIHA 1ZKMA 4I08A 4NZMA 1DTWA 5CXUA 5K1ZA 4Z3OA 2IH5A 1OBCA 1MUUA 3UMRA 2IS2A 2QUHA 2Y1CA 4RGQA 4RL6A 3TLYA 4OQZA 4NSNA 4A36A 3KOWA 2NV0A 1JFVA 3BCSA 3GJ8A 1KI6A 4WLUA 1BKYA 2ZJFA 3U39A 5CH3A 1UFKA 2W48A 4R8SA 4Q4CA 1R64A 1Z37A 4EG1A 3OMWA 4CTNA 1VGRA 1Y9DA 2GF0A 3T9DA 1CQPA 4Y2JA 3VTFA 2YZGA 2EEPA 2MINA 4DRXB 1DAHA 3S40A 1UDCA 1YIDA 3LL4A 4OI2A 4WWHA 1SMKA 1MQ8B 3C1UA 4FFOA 4NMMA 3R9KA 4BLTA 5E6RA 5BYKA 3R1IA 2NSHA 3WJ2A 5KS2A 2X23A 5LMZA 3QU5A 3C8UA 5EE1A 3QBTA 1LLFA 2NYUA 4GMXA 4M1ZA 5FOTA 4D3DA 1IUPA 1JSXA 4QO7A 2XWJI 1PYGA 3BRWD 4LWOA 4BLUA 1UC9A 1S02A 3PEWA 5J2TB 4KXMA 1UFVA 5HWSA 3GDHA 1IWBB 1LF5A 3H99A 2OCXA 3LYLA 4G8DA 4KEAA 3WLPA 1G0NA 2Q4TA 1BHSA 4XB6B 3UM9A 1XYYA 3B7WA 1X2EA 2BHSA 3F1LA 3IDFA 3QPVA 3CHYA 4KRFA 2ZE8A 1RR6A 5ALRA 5BWNA 1KIAA 4BRSA 3KXLA 5C7LO 2FSVA 5B7QA 7AT1A 3N7UA 3IKJA 1ZVMA 3OEHD 3HCNA 3QVWA 3F9IA 1DFIA 4IQ4A 4RZUA 4ZOLF 5CX1B 5TMPA 1TTPB 3A6FA 3GX1A 4QJ3A 2K7FA 221PA 1OGIA 4PLGA 3GYGA 1SHLA 4CM5A 5A2QA 5DYYA 1QWOA 1T9KA 2UDPA 3H7AA 3LGXA 5IULC 4NAUA 1L4LA 4C06A 3QV2A 1QF9A 4LF7B 1ORDA 3C1OA 5HDBB 2XOKD 3BF8A 1NDUA 2A7QA 4RV5A 1U3WA 1E6WA 2B8WA 5K51A 2IUUA 4URZR 2KM1A 4JBWA 3OJWA 5DH9A 4GMKA 1TM5E 1QRAA 1UK9A 1RP1A 4O0MA 2FPSA 2VHYA 5KBYA 4MR7A 2ACEA 3FYTA 3O4GA 1UIMA 2FW8A 3ZN2A 4BMSA 1IY1A 4MVJD 2RJOA 1GCAA 3GJ3A 2SKEA 4KE6A 2FH5B 2J3HA 3ZHOA 4B6QA 1W52X 2IYQA 2CN1A 1WBBA 1T2NA 2O2HA 2XUPA 3LWDA 3P9PA 1D8AA 1U8ZA 2G40A 5GZ1A 1TW3A 4WD3A 1JDZA 2PMCA 4K03A 3WGZA 3GFGA 2LVBA 3PQCA 3V33A 1SXHA 2X2OA 4DR3B 4NG5A 2JIRA 4IFTA 1JPUA 3GRZA 3O91A 3TM4A 3I0NA 3TZLA 5DXJA 4YUVA 1G16A 2BJHA 3B7GA 5JY6A 2J08A 1NGSA 1R16A 2FDXA 1KKLA 3OT5A 1A1SA 3A9SA 3QF4A 4AVYA 2GO1A 3LCUA 1NQVA 1WPXA 2ZDQA 3DNFA 1XCMA 2D1YA 3PSAA 3PQ3A 1OHHD 1JDTA 2IHKA 5FA5A 1NN1A 3UK0A 2ZKLA 1F8FA 3GGOA 1CHNA 2O3JA 5DMXA 3STYA 3HSSA 4ZCTA 3WAGA 3S1SA 4MKXA 2QAGB 3GI1A 1JNXX 4BQPA 2G9VA 3E81A 3K09C 5GGYA 4ZKDA 1O1YA 4RLSA 2WJVA 4UBLA 1XTQA 2XMSA 1WULS 1H05A 3HA3A 4UPVA 3VU8A 4ZXPA 4AL4A 3QVSA 3EIHA 3UMMA 2GWRA 2IV3A 4QHTA 1W6UA 2YJ3A 2I9PA 3CWQA 4RWZA 1L6RA 1SOVA 3KQVA 3L1IA 3W3AD 3VTZA 4CIWA 2HLPA 4GXTA 1P72A 2P5UA 1NI4A 1X1AA 3H1TA 1ZBQA 4NBLA 4TSKA 2FZEA 1ORHA 3JPYA 1V8ZA 3C5WP 3W6OA 1NW3A 1H4SA 1WEHA 2G07A 1EP3B 1OC2A 2BM9A 4HFJA 4DBLE 5A0TA 3H2KA 3BH7A 5FPSA 2Z2XA 2GN9A 4BBJA 5KHAA 1HRKA 4TQAA 1SHJA 1CY8A 2ATCA 4LYHA 4RY9A 2GD2A 4CIDA 1IK4A 3R7FA 1GNLA 1YMQA 5FOWA 4A27A 1Z83A 1GG2A 1G3MA 2X7HA 2J3KA 4URHA 1ZS9A 1D9ZA 5J58A 3PDWA 3AKYA 3OD1A 4YAUA 3NC0C 4DR4B 2YHIB 3QU7A 4FGKA 3WK5A 3GRFA 4UMFA 1KHHA 4M37A 1RHUA 4MV0A 4C04A 1FVOA 1V3TA 5KOYA 3ICEA 4S12A 3O90A 1TMKA 1U8CB 2M98A 3UC9A 3FETA 1A7KA 5IDYA 2CE2X 1XDSA 1AH2A 3QFCA 1I32A 10MHA 3VX4A 2J45A 1DC8A 1ABEA 4JVSB 1VKNA 1X9HA 4EFKA 4A8JB 1E89A 4F06A 3CEHA 4LBYA 2MYTA 4N12A 4NWIA 1CJSA 4S24A 4BNJA 2I22A 2JLXA 3VHLB 1GQOA 1HTBA 721PA 5HG0A 3D1VA 1TM3E 3N8HA 4CLDA 4ZEMA 2FUG6 3H5RA 3USES 3DQPA 3X1WA 3KZNA 3NAZA 2C4HA 4OQYA 1MDBA 3TS1A 2JGFA 2X9QA 3I3SR 4DLBA 4BQOA 4GZ6A 1N9ZA 4W5WA 3DV0A 3V8MA 4ESHA 5I3CA 2R8ZA 2VJCA 1NYTA 1OZGA 4JBHA 4MOWA 4MVJM 4RD3A 621PA 1LEHA 2VT3A 5JSHA 2ZR0A 1T10A 1R0RE 2Q1XA 3DBVO 2FSIA 2DFVA 1B43A 1MGPA 4JU9A 2J7PA 4NU8X 2IZ1A 1RYMA 1SQGA 3D4IA 3EG9B 5FPTA 2G04A 4RTOA 4HQLA 3HCFA 5GM1A 4G63A 3I1YA 2NTNA 1BMTA 3CPSA 2ZR8A 4IUDS 4NPCA 3EIQA 2JFZA 3UKJA 4ARSA 3CTMA 3RVNA 1LNZA 2WKWA 2CZGA 3A70A 1RE0A 3CRQA 2ZVPX 4N9QA 1Z0DA 3MZ0A 3FF1A 2JAPA 3HI6A 4PW0A 1I4DD 4YV2A 1NQ5A 3HVHA 2OVFA 5EY5B 1N1EA 2G77B 4XIIA 5B7PA 1JHMA 5LA6A 2GBLC 2PNFA 1C3VA 2WKQA 3PPXA 5CUQA 1IM2A 2WRZA 3SLRA 5EHXA 5KC8A 4L8WB 3UJ8A 3O1HB 5EIXA 2G83A 1E64A 4URFA 1GGMA 3HKEB 3KPYA 3KV3O 3LF2A 1CQXA 4CG2A 4EQ6A 3CSDA 2OGSA 3K0SA 4LE0A 1GQQA 5K6TA 4GOXA 2BGWA 4YRAA 5KOHB 5ALDA 3B52X 1KZ6A 4IAOA 1M34E 4RVGA 3RR2A 1OH6A 3DP7A 3WP0A 1N2CB 4RHEA 5A6VA 5CA1A 2ATEA 3LC7O 2GWHA 1UJMA 2NG1A 2WYIA 1MRSA 3L6DA 3NJRA 5DI3B 3P19A 3W6UA 3VSAA 1RZRA 1Y3DE 4TYYA 2WOOA 3MGGA 5J3JA 2JHGA 2RE8A 1VMKA 4ZDKA 1U5CA 1JFLA 4KWHA 4F6RB 4NCBA 4HDNB 1GNTA 1UJ6A 4B3SB 1ZM9A 3X1JA 3IEVA 4CV0A 4HDMA 5ALPA 3W6ZA 3E15A 3OMXA 5IUJC 2OO5C 1QFJA 3ZHSA 3M83A 2QSJA 1UJBA 2GVNA 2G5PA 2W6IA 1II9A 4ZJPA 3ADCA 3R2JA 1B8VA 2QN2A 2JFHA 2VYQA 1BG6A 1T2EA 1KSGA 1KOGA 1ADJA 2VWHA 4RV9A 3X1YA 5EFZA 2CHFA 2WJZB 3AVTA 2C88A 4YJ2F 4QPDA 1T3HA 5KDOA 1GGNA 1XXHA 2CKDA 1G19A 3FWPA 5TXGA 3O4HA 4ND8A 3WK8A 2JJ2D 2POQX 1RJDA 5A1JA 2PXHA 3CX7A 3W2IA 3ROXA 2EJTA 3ZZTA 4ZVKA 1EK2A 3QYPA 1PGJA 3ROTA 1GDHA 3HFJA 4HCJA 4OG2A 4QGFA 2R6AA 3MWEB 3ESXA 3OQOA 4HXEB 4II3A 5J4KA 4BNNA 4B8WA 1SC3A 4JSTA 1RXCA 1L7VC 1PU2A 2CHEA 2P75A 1QG6A 3CKLA 1HDRA 4QOJA 3U3XA 4R9NA 2ZSKA 3RIHA 3VPCA 1CS0B 1NNUA 1NW7A 1XA3A 4MIYA 1POXA 2QRJA 4KFTA 1X2BA 4NH4A 2ISSD 4E0BA 4ZTZB 4EHIA 1HX7A 1XTJA 1XCJA 1F0YA 4WDRA 3O1IC 4NCXA 3CKMA 2I3GA 1ZC4A 4F93B 4NBUA 1XDBA 1RRKA 2YQZA 4KUEA 3SLGA 1NC3A 1UM9A 1K97A 3VKUA 2RHMA 3HJCA 1FRZA 1L4NA 4YRZA 2N47A 3NOXA 3V6LA 1FFDA 2KLBA 3H0KA 4B48A 1J1ZA 4WI1A 1YE8A 2VZEA 3MBIA 3RTAA 1UPXA 1BVRA 1XXHB 2OC4A 2GLTA 2P91A 4CM1A 5BNWA 1AGYA 3AEUB 1YOBA 3MBKA 2NZYA 3GPCA 5KJFA 3ZGZA 1PNOA 4HWPA 5AVRA 3RADC 2G3YA 1SNYA 2HA5A 4FXOA 4J76A 1T8RA 3KB8A 1M8JA 2AJDA 3ZUGA 3B9RA 4KDCA 2VCHA 4PAWA 4Y9UA 2H4HA 3ML1A 3OCCA 2CXQA 4HDCA 2FKNA 2BFCA 4D46A 4IUCS 3I1IA 4CT4B 1BYIA 3PFKA 1NU6A 4R5HA 2VDKB 1WW2A 4ZEVA 1XNGA 4XWAA 5SY6A 3DGFC 5TGDA 3ROGA 5IM4A 3IXQA 1NDHA 1E0DA 4N01A 4Z7QB 5ENDA 5HIAA 1W36C 1KOFA 2VHWA 3OPMA 4MYCA 2VHVA 3GLSA 3JQGA 3EFOB 4LDRA 4WK0B 2P6UA 2R6ZA 5LOVA 2O2ZA 3Q3JB 1YIAA 3TR6A 4HP8A 3GLFA 5I7OA 2IELA 3G1WA 2YZMA 2W2MA 4ZOCA 3WO0A 3O0DA 4DPMA 6AT1A 1XAGA 2QRHA 2CV1A 2LP4Y 4REQA 1KFEB 4UZEA 3TIGA 5JNRA 2XMRA 2AZXA 2XEXA 4GLFA 1KJQA 3JV7A 3ZCXA 3L6OO 4IDHA 3V6MA 5K8CA 3L0IB 1FVXA 3PHHA 1OI7A 3NIBA 4OM7A 5H7XA 3JRWA 3TBHA 4D6PA 3LYAA 4RENA 4J94A 3EEQA 1X77A 5KI6A 3COZA 4K28A 1KVTA 3OFJA 5LU9A 3MRSA 1YZQA 5C1IA 1DC4A 3BJIC 3OU7A 1EGMB 1L8AA 3G2KA 2YV3A 4LE1A 4DM4A 4QM7A 3EW7A 1T4BA 3IHWA 2WU3A 4MVCA 3TQFA 1VKZA 5LQKA 2PUGA 1XU9A 3KJEA 2LIVA 3CNHA 2GPNA 3ROKA 1M7BA 1XL0A 4TLCA 2E5WA 4KVFA 1XHLA 1XPJA 2K4MA 3FRHA 4RLHA 2G76A 3GLVA 4UCWA 3WXMA 3PEYA 1USKA 1PS8A 3UO8B 1M6VA 4OP2A 1QX4A 1OLOA 1PGOA 2AN5A 3K8OE 4GM4A 1LI4A 4JVNA 4L8GA 5J2UA 5FBRB 4JY7A 3ZWQA 4PSUA 1UP6A 4BLRA 1J0BA 1YZHA 1COZA 1PR3A 1GM5A 2ID9A 3ZXXA 1GGJA 3OQIB 2ZAYA 4OAQA 5LCXA 2VCYA 2BZSA 3MTEA 1P61B 2COEA 4HDNA 4QKQA 3KZ1E 1XU7A 2GPJA 4BLQA 5I01A 2QRZA 1IM5A 2PKWA 1FMTA 3CJTA 4PYJA 1D6MA 2X5JO 3AJDA 4C6HA 5BOVA 1E79A 4G41A 8MHTA 2X8LA 3HSKA 3G5AA 5GVRA 3PXEA 1JXQA 2OAGA 1F6DA 3G2IA 3SC4A 4BNDA 4IJVA 5KUTA 4B31A 3EXFA 4P4SB 5CH8A 1I1HA 2WIBA 5IAOA 3KRTA 3RSQA 3WBJA 2JH3A 2F8LA 3LT1A 3ZEAA 4OJMX 1RTKA 4U7DA 3EMDA 2H4XA 1GG5A 4P7JA 3UK7A 1W36B 4URXR 4LTNA 3LBYA 4QEDA 1RYHA 3HNRA 2FJPA 3N86A 3FD8A 3TQTA 1RQRA 2WKSA 3ZNOA 4D0LB 1W2GA 2IPOA 1W5AA 1Z3CA 2R79A 5TGTA 4MW0A 4B7XA 2CLHB 2MJLA 1KC3A 1SEPA 4OPMA 4WNIA 3G9TA 4D8YA 2DHCA 3DAFA 5BORA 3F6RA 3WHPA 3L49A 1DC7A 3GFSA 1I7NA 4BNVA 5BN4A 3RUHA 4PU0A 2QMEA 4PN7A 3WK4A 3AMVA 1N77A 2XE4A 1W9HA 3EW9A 1C9KA 1VI2A 3Q7TA 3FOWA 5HBGA 3CLSC 4F46A 2ZBFA 3FCOA 2OR3A 3ZDEA 3HDJA 4IH9A 4HVCA 3DXYA 5AM0A 3GRUA 5EJIA 4GYWA 4YJHB 4EW3A 3DEAA 5KYKA 2PQ2A 4WESB 3OPXA 3PE6A 4JL6A 4X6LA 5H81A 3NHWA 5CEJA 4EI7A 5K0ZA 4MHTA 2IUYA 3HV0A 4R4JA 2HRCA 3DB1A 3IEPA 2RK4A 1TQ8A 3QHQA 4B82A 1J1UA 4RADA 1JE0A 1NRXA 1T4CA 2PUVA 3K3PA 4KQ2A 5DYWA 3CLUD 4WBNB 2C54A 4OL9A 1UK8A 3V1LA 4WXHA 1ZR2A 3FAZA 1RWWA 2QRLA 1D6SA 4DDVA 4EGSA 1U7PA 2FOXA 1FJGB 3P0HA 3VKGA 1JB9A 1T8SA 5AI0A 2D06A 3OZEA 1P7ZA 2VHEA 5CDFA 2C4VA 4NYMR 3VNRA 4YLYA 1KMCA 2PAFA 1I6KA 2I7VA 3MK31 4PNHA 2G9QA 3R5KA 3ZCPA 2HIHA 5LNK1 2GAAA 2P3OA 1CF2O 3CZPA 1WY5A 1Z6TA 2DT5A 3AUJB 5EERA 3U3KA 4TKUA 3UPDA 3ND7A 3JW8A 3LGSA 5F9FA 2BM1A 3QUBA 3A9VA 1JHOA 1FMLA 2LCFA 3GGJA 2GJAA 4WZBA 5ADHA 1H1DA 3BD9A 3KUDA 4ZT2A 4EAAA 4YRSA 3V7YA 4MQUA 4CIAA 3TR5A 1GLGA 3VO9A 4D2IA 3L0BA 1U90A 4R40A 1I33A 3BG5A 1W85B 1L1QA 2QW0X 3K94A 1JR4A 5FT9A 1Z2EA 4PGGA 4JYCA 5JAPA 4XDZA 4OQNA 5JYCA 2O5CA 4Q4JA 3I01M 3ABZA 2B8NA 2BEKA 1V41E 4MUBA 2GK7A 3I1FA 4GEKA 4HPWA 5DP2A 4FB4A 4LXHA 2QBYB 3C7DB 3D7KA 2NWQA 5TLSA 2HUPA 2CE7A 5BWLA 3AR8A 4H0CA 4NTZA 4RIGA 2YS7A 2CJFA 4XLLA 4RJKA 1IOLA 3ABQB 3EDQA 3S2SA 1LDMA 4S1WA 2I6FA 2Q2VA 3PFBA 4FKZA 4U3JB 2NPIA 4DREA 1ADGA 2C57A 2BT4A 3GEPA 1WCIB 4H6WA 5E1BA 3F1KA 5PNTA 2O8EB 4UAUA 5AHRA 5B64A 3KEOA 5AHOA 4O4LF 1A27A 1NLMA 1OVMA 1AKYA 3GBPA 3VHRA 4BTVA 4E2FA 1PJ8A 5C7YA 1H2WA 4CDMA 1TF7A 1HI9A 3RSSA 5BSGA 3PHLA 3BKXA 1ISHA 3AO0B 3E84A 3I45A 4U3JA 1T1JA 1FTQA 4ZVVA 3N6XA 5H16A 1RS0A 5IDVA 3TVDA 4FSDA 2XA1A 1K5PA 1RZVA 1AG9A 4D74A 1QSGA 4FMBB 2PV0A 2OGWA 3QBJA 2E85A 3R44A 4JMLA 2EKDA 2GHQA 2PG3A 2Q07A 4LSMA 2ZRQA 4N3GA 4Q9DA 4L95C 4P3YA 4DBVO 2FLVA 3KZMA 3PP8A 4JUFA 1BDMA 3DLTA 1ORTA 1D8TA 2R6HA 1B2RA 4ND4A 4Q4JB 2IEDA 1OAAA 2V5VA 2HJ9A 3NGLA 5BQXA 1RRVA 4R1OA 4FDMA 4U2BA 1NBMA 1LDYA 1RZUA 3RJ5A 4UCQA 2IV2X 1XEFA 2CKMA 4MV7A 5C80A 1XD2A 2QNRA 5DWQA 1RHJA 3X44A 2QMHA 1FMFA 4MVWA 2VG8A 1FUUA 2W00A 3MTBA 3GA5A 5BQ5A 4WZBB 4BP8A 2ODNA 2XQFA 1J99A 3CF6R 4C2AA 1DTWB 2ILVA 3H5AA 4LI0A 1DXQA 1KFJB 2XUFA 3HVJA 5CXQA 3E7FA 1XMSA 3E7PA 1A9RA 3PD7A 4XM0A 1ZN7A 3SZOA 3VKFA 4OLHA 5ICGA 1ILWA 1X1CA 3EULA 3Q6IA 5EWLB 1YA8A 3Q12A 5I7RA 3ID6C 1OZFA 2OV1A 4QOHA 3G0CA 2Y1WA 3UATA 3WLTA 2DPLA 4NYMQ 1GUZA 1R4MB 2LCIA 3PZRA 1SU7A 5J5CA 4NFHA 4B3JA 4BYGA 5IT4A 1TAGA 1SJ9A 3KE9A 2F7SA 1RRGA 2IOHA 4QT0A 4V0RA 4ALNA 5IEBA 1HORA 2J0EA 4LXUA 4CFYA 1F48A 1G1MA 1HEIA 1A4RA 1Q1QA 4FYVA 4EI2A 3OE7A 3DM5A 5K0SA 5KYUB 4TM8A 2PVCA 3EVNA 3OIDA 2A6PA 1AUQA 4W5HA 8ATCA 1E8DA 3U44A 1AMUA 3U4QA 2AFIA 4QATA 5T8KA 3FOEC 2I99A 3N5CA 1YDMA 3P0EA 3SCZA 3SKVA 3GB9A 2PQMA 4PPQA 4TS4A 5KWSA 4H3KB 4GL4A 3IHTA 1TLLA 3KYCA 5MN6A 2EGHA 1XSEA 4M0FA 1ORIA 2IY8A 3P9XA 2E37A 4XA8A 2CNDA 5SZJA 2H9AA 5CCXA 4YP5A 2GN6A 1V2GA 3RUFA 2OM2A 3OETA 1Y3IA 2XOEA 3AH8A 2CDNA 3ANLA 4FJ0A 3E3MA 4ARVA 4F3NA 2O7QA 3G2NA 3OQMA 4AWXA 2Y4NA 2VAXA 3EGEA 4QJBA 5TMEA 1EP2B 3AL2A 3HQ4O 3ZIAA 4EFMA 3U7FB 3TGLA 1U9JA 1BWQA 1J5XA 2ZRIA 1JWAB 2BTQB 4S1TA 4BQSA 1NI3A 1ODJA 1VKOA 2P2CA 4C0JA 5HIIA 2YZ2A 2XZLA 4J2HA 1LNQA 1ZK1A 1CDOA 1LVHA 1U9CA 1CJBA 2A0UA 2O3QA 2G63A 4I6EA 1M72A 1LQTA 2IHJA 3B7PA 4RD4A 4OB8A 1A5SB 2ZE7A 3IPCA 4QDJA 3WYAA 1GFSA 1Z7YA 3H8VA 2R6GA 4KPUA 4BEBA 3TLMA 3K9CA 1DHTA 3I3OA 1UAAA 2NUTB 4CKBA 1QVZA 2IKSA 1TKCA 5D51S 3T1YB 4TTIA 1OWMA 1J0XO 5TRTA 3RBZA 2WAYA 1XJ5A 3E1KA 5JMOA 5KQSA 3L5OA 4J43A 4JLVA 1NR5A 5AOVA 4Q4HA 3TG2A 4GQAA 1IHXA 1R18A 1A9TA 3FZQA 4UU7A 1NUPA 5C8YF 1F4LA 1KHTA 4XDYA 1N9GB 2H7XA 5CW2A 4DCOA 4RD2A 1TPYA 3V8VA 1CFJA 1MJFA 1NVUQ 1ZH6A 3Q8MA 4M8SA 1I2MA 1TQ6A 1QNFA 4B45A 4G1FA 4QT4A 4N0EA 3RRYA 2P3QA 1DG3A 2QAGC 1E66A 2NV2B 3ILSA 3FFAA 1QRRA 3WNBA 4KQHA 4HVTA 4CTOA 1U0OC 3FDXA 4CMEA 3LW7A 4OMUA 4QOEA 1WQ1R 3TECE 1THGA 5JXIA 1VYHA 3R6WA 1KSFX 4WUTA 4MS4B 5L3SB 1HDCA 5J47A 2C8JA 2VPWA 3RS0A 3SQMA 5IUKC 3BJEA 1Z0ZA 3C6YA 5BW5A 2R96A 4ND3A 2O8BB 3COVA 4X41A 4XRGA 3WNVA 4LQDA 1SBCA 1K5DA 2I3DA 4GUDA 5CGZA 5EIWA 4AJHA 4C3UA 2AEJA 3N74A 4WN9B 4TWJA 1T9AA 4MYRA 2G1AA 2R2GA 1LC0A 3LX4A 3U4MA 3LK7A 5L40A 3C7CB 4P6VF 1M7GA 4AO6A 1XD8A 3PQ5A 4L8FA 4URYR 2YJ6A 3MAGA 5IBPA 3SHWA 3OFVA 2QP4A 2ZT5A 3KKZA 4UREA 5ARCA 2WFLA 4JUIA 1YJ5A 2IHBA 4EF5A 2PUCA 5IJ9A 1FFSA 1FDOA 1Q1AA 4F11A 2Q3FA 3BEDA 1UXGA 3HYSA 3CISA 5D3ZA 4ADSG 1RACA 3WNDA 2W22A 1U7ZA 3L4EA 4QVIA 2HXYA 5A0VA 4C03A 2X3FA 1G1AA 5DGDA 3F98A 4I5IA 4RVHA 5IM4F 3H83A 3K5WA 3UICA 4AK9A 4F72A 2BEVB 2C3MA 5AM1A 2C7GA 4QARA 4V0OA 3ORQA 5A5FA 4MDFA 3USCS 2L18A 3FYDA 3DZCA 5K0BA 3Q8XB 4FR2A 5GJBA 2QTGA 3KJXA 1PNQA 2H1HA 1SFRA 5J5VA 4AJJA 4B3XA 4PR3A 5HS6A 1Q0HA 3LOUA 2I6TA 5A5DA 2X9LA 3K8QA 3NWPA 4QO8A 1IL0A 1GO2A 4AN1A 1O95A 2OZVA 2QAIA 4D8VA 1XJQA 2LKDA 3JZIA 4BZQA 2EGUA 2HWYA 2VTKA 3N2GA 4KIGA 4LPSA 3DAOA 2BJVA 2OAQ1 3ISTA 4INOA 1J07A 1DZ3A 1IOWA 2JH9A 3CZRA 4IO0A 2C3UA 1AN0A 3TTXA 4GVPA 4HGOA 1K6MA 1VKRA 1Y7TA 1Z12A 3UAYA 3AEUA 3DEFA 2VJMB 2EFGA 2RHHA 4CHTA 4MRSA 3COWA 3VC2A 1BS1A 4LDPA 3FFXA 2EBWA 2DQYA 4M87A 1LZKA 1GGEA 1XG5A 4Q5IA 3LSYA 1XD9A 3GT3A 5IF9A 2CDCA 3R3WA 1GIAA 1YK0A 1T9BA 4IWXA 3WTBA 1N33B 3UBTA 2I2WA 1M1YB 5SYNA 1T3GA 2Y0PA 4KGDA 5F3RA 1JXMA 4CMAA 1Y1RA 4D8TA 2CV0A 4KR2A 3KKMA 1MC4A 1NAIA 3PJFA 1TUGA 4NP6A 2VZ0A 4QC2A 1P1IA 5KSZA 3DTNA 4QOFA 1JT2A 2VHCA 4Y6PA 1RBYA 2XEDA 5BSUA 3HFGA 4JV5B 4PHHA 1RLMA 4DM3A 1Q16A 1T2AA 1V6AA 3OX3A 5TQVA 4DIUA 1ZU5A 1DCKA 2QW1A 3A14A 3C7KA 2V7VA 4X9XA 4OAPA 1Q12A 1MXHA 3NUGA 3R3VA 2QA5A 4G56A 4LECA 4DCSA 3THWA 2ZI7A 4V2UA 2P9CA 2WHRA 4YMHA 5EFOA 2XBLA 3U4QB 3D1LA 5K8UA 1WW8A 1EJ2A 1XTUA 4I3GA 3R77A 3D3WA 4K6MA 4XQ9A 2E4XA 1KAGA 1TC2A 2Z04A 5K2MA 5KQRA 4XJVA 3JZMA 2Q29A 1V4BA 1X8XA 3B1ZA 4MR7B 3VO2A 1YZNA 3AKCA 2WHPA 1R37A 3H19A 2XRZA 4YRMA 5M5BA 1EB8A 4RZIA 1G17A 4GX2A 3FUVA 2R9VA 2XNKA 1ZY2A 3V1YA 4TMVA 3TRFA 3AM3A 5JSZB 3VU9B 4KH0A 2ENUA 1M2VA 5DKFA 1GL9B 4U39A 3VPSA 1XCPA 2QVYX 2A67A 3RASA 2MWMA 4RHTA 4G5YA 3ZEIA 2NU6B 3IMCA 1NNLA 2DLNA 3ZS9A 3CN9A 1ID8A 1TUBB 1EBUA 1DBIA 1QZ3A 2ZQYA 5LP6F 1UT5A 1M1ZA 3KOXA 4FOSA 3A6ZA 1KOLA 3OQBA 1YU9A 4IKPA 4ZV9A 4U5QA 2ZETA 1JTVA 1JVSA 1S9HA 4PG4A 4Z8YA 1HDYA 2HBYA 2ZUUA 1UDBA 1WTAA 3ONWA 4P7KA 5EJAA 3RUDA 1KS9A 3E5HA 4RLQA 1JHAA 4CQLB 3MS2A 3KQLA 2Q6TA 2ZANA 1PJBA 1C7FA 4DC1A 5CURA 3S2FA 3TVTA 3MJSA 2VDWB 4PYKA 4HATA 1BYUA 4TSFD 3LDGA 1UDRA 2BUAA 4KLAA 1C3EA 4HLNA 5IBQA 1J90A 4WOBA 1U7XA 1Y5LA 3FJOA 3QKIA 1BAPA 1T5LA 5FFNA 4R31A 4LV6A 4NZ9A 4DRXA 1IN6A 3CZ4A 3EVCA 4ZICA 3I6ZA 2RGDA 2QIPA 4M98A 2BBOA 4AG5A 1N8NA 1G3RA 2V4ZA 1JBKA 3QMMA 5AVOA 1B0ZA 1L0BA 3G2JA 2JFUA 5IZCC 4JASB 1YRHA 1O5TA 2CLEB 3ETNA 4MGKR 5D6OA 1ENPA 4E4TA 4B34A 1UCFA 1OWPA 5TQ2A 4D9HA 3PNQA 5K0JA 1A9SA 1JJIA 2PPLA 2MMGA 3C6KA 3O2NA 4FDLA 1TIBA 4R7ZA 5H5JA 1Z18A 3QKUA 5HQJA 5KDLA 4EDFA 1MAHA 3CG0A 1U3GA 3OUTA 1LSOA 4EF4A 4NV0A 1SXJD 2VRCD 2BBTA 3A7DA 4OI0A 3MOSA 3WYNA 1HQKA 2HF7A 4F4UA 2JFFA 5HKBA 1NV8A 3LCCA 2YIDA 3Q6NA 5F4BA 1KZGB 1RCFA 3ONEA 4PO8A 5KKAA 1NE7A 2G7ZA 3SEQA 4A1FA 4BV3A 4YMGA 2QYSA 4IO1A 4HDMB 3FOBA 5HF5A 1QH9A 2PKXA 3JVVA 2CVZA 1BE6A 1DAGA 2WPNA 2CMHA 3CE6A 1VFPA 3M3PA 3L40A 2JI4A 3L6CA 5AVSA 4LRSB 3MTJA 2NGRA 3KXPA 3FRIA 1VB3A 4RTSA 1SBQA 2JGRA 1N2SA 2VI5A 4BO1A 2GGSA 1EAYA 1Y5RA 2GS9A 3EQZA 2PJDA 3EGXB 3LX6A 3PCTA 4C30A 4C14A 5K01A 3MOIA 2YNMC 3DFZA 3R5TA 1XMJA 2IQ5A 2ZRCA 2DX7A 3IKLA 4BHTA 1L5HA 4E70A 4AZWA 3TZQA 3C70A 4EB6B 2I71A 3HYCA 3FNIA 3K6JA 1SCAA 2G06A 2VHJA 5HOQA 3O8OA 1U94A 1WDMA 1T8PA 1W2HA 2OHJA 3NO4A 3EZGA 1DJPA 2RGBA 4RK6A 1YRLA 4R6XA 3R7WB 4ASUD 1GSAA 4DC0A 3DMGA 3DXZA 1KOJA 1XRNA 1J2RA 1WZNA 3MCVA 3OCXA 1IOZA 1MBZA 1US8B 3V32A 4ARZA 2B35A 1DX9A 1Z0JA 2H4JA 3INTA 4DDMA 1ZIYA 1WXGA 3FX2A 3F7NA 1VLQA 2Q0HA 2BBSA 4JP8A 3O21A 3OTIA 1N6NA 3KLPX 4AD8A 3OPQA 5C7IO 4C07A 4Z4IA 1GJRA