1N5QA

Crystal structure of a monooxygenase from the gene actva-orf6 of streptomyces coelicolor in complex with dehydrated sancycline
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
112
structure length
112
Chain Sequence
AEVNDPRVGFVAVVTFPVDGPATQHKLVELATGGVQEWIREVPGFLSATYHASTDGTAVVNYAQWESEQAYRVNFGADPRSAELREALSSLPGLMGPPKAVFMTPRGAILPS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ActaVA-Orf6 monooxygenase
publication title The structure of ActVA-Orf6, a novel type of monooxygenase involved in actinorhodin biosynthesis
pubmed doi rcsb
source organism Streptomyces coelicolor
molecule tags Oxidoreductase
total genus 28
structure length 112
sequence length 112
chains with identical sequence B
ec nomenclature
pdb deposition date 2002-11-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03992 ABM Antibiotic biosynthesis monooxygenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.100 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1n5qA00
3QGPA 3VTIA 3HHLB 1CC8A 1APSA 1JK9B 4Y2MA 3LO3A 5B08A 3BR8A 1JWWA 2BYCA 4A48A 4ZOSA 5B09A 1R6YA 1RJJA 2QLWA 3DXSX 2GGPB 2XMJA 3FRYA 2RU9A 1AFJA 4OJ3A 4HI2A 3HHLC 4Y2KA 1IUJA 1CC7A 1TUVA 2KT3A 1KVJA 1N5QA 2KYZA 3KNGA 1CPZA 3UDCA 2LQBA 2ACYA 3BB5A 2XMKA 3IWLA 2LQ9A 2HLUA 3CJKB 1OQ3A 2AJ0A 2G9OA 1Q8BA 1VQYA 1ULRA 4HH0A 1AW0A 4HI1A 2BBEA 2KKHA 4Y2IA 1P8GA 1TZ0A 1LQ9A 3HX9A 1YJTA 4QOTA 4Q2LA 2BJDA 2FTRA 3GZ7A 1XBWA 3K7RA 3TNVA 1AFIA 2FB0A 2W4PA 3HDSA 2PGCA 1FVSA 2K1RB 2BUNA 5B0BA 2BJEA 5B0CA 1X8DA 1W2IA 4EFAC 3HFKA 2OFHX 1Y3JA 1V3ZA 3E8OA 4OJ1A 3BN7A 3WDOA 1FESA 4Q2MA 2ZDPA 1YG0A 3LGMA 2IYGA 2XMUA 2W4CA 1OSDA 3MZIA 1Q4RA 1OQ6A 1S6OA 2HLTA 2XMMA 2XMVA 5T7LA 3HF5A 4DPOA 1YJVA 2K7JA 4YDXA 1Q53A 2ZDOA 1TR0A 2K7KA 4DN9A 1QUPA 2N7YA 4DL0C 3F44A 3HHLA 2FHMA 2OP5A 1U7LA 1WD6A 3TOQA 2OMOA 2HIQA 4FNIA 2LDIA 2RILA 1S6UA 1TL5A 4A47A 1GXUA 1Y0HA 1MWZA 2EW9A 2GGPA 1SI9A 4HH1A 4U9RA 4OJGA 2AW0A 2L3MA 5B0EA 2Q3PA 2GV1A 3DCAA 2OD6A 1GXTA 1X0PA 1Y3KA 1VQSA 2ASYA 1URRA 1TL4A 2AJ1A 2GCFA 2N4CA 5A6PA 2VH7A 2GFFA 1N5SA 3KG1A 1P6TA 4YEAA 5B0AA 3T9NA 3BDEA 3CJKA 4HL9A 4OIXA 2GA7A 3HHLD 4NL5A 4F67A 3I9ZA 5K9FA 3IWXA 5F0WA 2QLXA 2PD1A 1SQEA 1YJRA 1KVIA 2ROPA 4OJHA 2GO8A 1N5VA 4A46A 5IXUA 2IFXA 2JDJA 1Q8LA 1YRXA 2HQIA 5A6WA 1FVQA 1K0VA 2QYCA 2K1RA 2LXFA 1FE0A 2FIUA 2OFGX 4ZA1A 1N5TA 4A4JA 2OAUA 2OD4A 3FGVA 2KT2A 4NPOA 2AP6A 3MCSA 5B0DA 2HFOA 2W4DA 1Y9OA 5B0FA 2QIFA 3BGUA 2RSQA 1YJUA 2VV5A 2XMWA 5KAKA 1OPZA 3KG0A 1SB6A 3QMQA 1MWYA 2HFNA 1FE4A 5B0GA 5F0UA 2RMLA 2ROEA 2OKQA 1KQKA 3BF4A 1X7VA 3BM7A 1FD8A 3KKFA 3TRGA 2CRLA 4FNHA 2K2PA 2XMTA 2N4DA 3FMBA 2ROGA 3LGNA 5T7LB 2IYIA 1FEEA
chains in the Genus database with same CATH superfamily
5GMDA 4LRDA 3QGGA 2MHEA 1YJ7A 3CCLS 1PC5A 5FLXU 2R8IA 5FIIA 4DI6A 3B6BA 2DCUB 3SBMA 2H5JB 4I56A 5E33A 1NH7A 5L38A 2FHJD 2JHEA 2W01A 2MKKA 3X1LB 1LW0B 4NLDA 4JI1J 1RAIB 2LQ5A 3BBFA 2FHMA 2V9KA 5K8OA 3DOMB 3M1VA 3EX7B 4ID8A 4ZN3A 2RILA 4R0EA 3CCES 4LBPA 3OL8A 2GV1A 1LKZA 1N5SA 3AY0A 3O6QA 4WIIA 3EWGA 3HVTA 4O23A 3IBCB 2V63A 2BKOA 3OXGA 1K0VA 2ALYB 4PQUA 1KBRA 2AJFE 3D66A 3ITHA 2OI2A 2UZAA 1HWLA 2FC8A 3I4HX 4DL6A 2HWHA 2OUGA 2J9DE 2VPWB 4IOCQ 2DRAA 1UCNA 2R9LA 1HBOB 3JYTB 4NZ7A 3NGRA 3QWUA 3HSGA 4LSLA 1TL3A 2E5LJ 4C0BA 5J2MB 3BO2A 2JNJA 2EXUA 3GE9A 1ZS6A 2L9WA 4IDKA 1TZ0A 2V94A 1VDHA 4IRCA 2ZH6A 2ZM6F 4LFAJ 3MPUB 4WJBA 4B9VA 1FI4A 2E7XA 2QA4S 2CQ2A 4URSA 1U6BA 2BACA 3MTKA 2PEHA 2B0GA 4YP3A 1SJ1A 4LFCJ 1AZSB 2IVYA 5MAOA 3FRZA 2HBYB 3WX4A 4KAIA 3I0RA 2IHR1 3V4MA 2FLLA 2A1BA 2VDIA 4DFKA 3HSJA 1FCAA 1M1GA 2DNQA 2ZBQA 2G2ZA 3M8PA 5KFKA 3A8EA 5HMWA 4N41A 5KG1A 1UA0A 1I6JA 2UXBJ 1N33F 2ZWOA 5E3AA 2ZKUA 4O3RA 3LW5C 4RUCA 3OHAA 2RSQA 4FYXB 4X4PA 1MWYA 5J2NA 1RTDB 3BV8A 1FNMA 3VF0B 2D3O1 4GKKJ 4QIWD 3PHTA 1L5UA 3DDNA 4JI7J 1M1KT 2BDPA 4I7FB 4AT1B 4H54A 2NXCA 3PJ9A 3QJJA 3WDOA 3OVBA 2ZEJA 2GX8A 3HPOA 3UVJB 4LVNP 4YR2A 1VQOS 3NS6A 2EFQA 1RGVA 2F1FA 1M5OC 1P9QC 2H3EB 5IC6B 2YKOA 4N7TA 4AQYJ 2ILZA 1FJGF 1VLYA 3MUVP 3FZBA 1WC5A 4ECWA 3FEXB 4KGKA 4DLGA 5F41A 4WP8A 4IFYB 2ZNYA 3CEDA 1TMMA 2HRYA 2EFNA 4EMDA 1KFDA 2ZVSA 2GAHC 4I69A 5B09A 2YH1A 4C3KA 2G2OA 4U8VA 4RU9A 3G86A 1CPZA 3T6BA 5F3ZA 5KG5A 4ZITA 2AU0A 4HEA9 3NRBA 2H65B 1YI2S 2FHKA 4GRSA 1B64A 4NLGA 4DJBA 1V6HA 1S6OA 4ENOA 1U2CA 1KC8T 2E1MC 1HI1A 5IT9U 2HSEB 1A0OB 2HIQA 3IAM9 1S6UA 3N6LA 1RYSA 1OIAA 3D5MA 3DGPB 3JSBA 3VAMA 2JVOA 3K58A 4ZP8A 2VPZB 2FLNA 2AEMA 2OEMA 4GKJF 4LSNA 2DR8A 4F3QA 3HT0A 4RW4A 3B4MA 2FYXA 4NCGA 1TL1B 4KBIA 1ZAXA 2YNFA 2KI2A 4JV0A 4URQU 1C0TB 2BEFA 2Y1RI 2DTJA 3K5LA 3R1LA 1RWOB 2LQ8A 3SZ2A 2RF2A 5AE3A 2Z2ZA 1WOOA 1KVJA 4WIQA 3PO5A 4G3IA 4M5KA 1LWEA 1UAWA 5C2CA 3TA2A 2HHTA 4MTPA 2RKIA 2BJ9A 2BM0A 5CH7B 3CJRA 2RUGA 3HLUA 2NXNA 4K2JA 2XI3A 1TAUA 2D3ZA 3CJ2A 5DDPC 1RT5A 1X4HA 2Z2YB 3I87A 3C6TB 1R3NA 4ED1A 4PXDA 4M5IA 1ZPVA 3D6MB 2BJ7A 4FVMA 3KUGA 3MEEB 2Z2LA 3KK2A 2PEBA 1Y00A 5C7PA 2IM2A 3K17A 2Q43A 4UOCA 4PPZA 1DAXA 2GVZA 2HZCA 1C1CB 4TU9A 4C8ZA 3MCSA 4MFBA 3NAHA 3Q0AA 4EZ9A 2X3GA 3ZTRA 2DGVA 2DITA 2ZC3A 4TU7A 1M90T 3S8SA 3LP1B 1PYOB 1WHVA 1VJQA 4CYUB 2RE1A 3GB0A 3ILLA 2XB2D 3IA0A 5KFGA 2VB6A 1RTIB 2MYFA 1R0CB 1U1PA 4C8YA 4C8LA 3KTQA 3TARA 1JNRB 4HI1A 3MM8B 4NRUA 3PXGa 3ENVA 4QZVB 2FTRA 4PXBA 4KHMA 1SKUB 2AKWB 3LUYA 5GADU 4OYPA 1FRKA 4EZ6A 1FEHA 3E51A 2HHHF 5EWEA 3ISZA 4P2MA 2ASJA 2BQUA 4KTQA 2LXIA 2X1FA 2ZOMA 3H90A 3OL9A 1NCLA 1RAAB 2VG6A 4DPYA 1VRQC 3DM2A 4NL5A 1HNWJ 3M32B 1TKTB 4P72A 1PJ5A 3B4DA 2GHPA 1OSCA 2YPYA 1RBAA 2P6SA 3TEHB 2AV5A 3PYFA 4URGA 1SB6A 3MMAA 1U8WA 4C98A 1NZAA 3EZ5A 1FEEA 4J9UE 4PUOA 5F8NA 3FQKA 3BSAA 1Q7LB 4P2SA 3DLJA 3MUTP 3ET6A 2KT3A 1FDAA 2LA4A 2CUYA 1B3TA 3A3NB 2ZH9A 3TZXA 4PABA 2DY9A 4PG8A 1ZTTA 4HH0A 1GFWB 4ZVSB 3M30B 1FRIA 3PYDA 1N6QB 2HS3A 3EVMA 1SXLA 4WU2A 3BYRA 1N32F 5KFWA 2HGNA 1LWFA 1FWPA 4DG1A 5ETPA 1QSSA 4ECVA 4F4ZA 3RAMA 4OI1A 4HHUA 3NY0A 3QIPA 4QWCA 1KN6A 4X4UA 3TQEA 1HNXJ 5ETKA 1QM9A 1JJ4A 4F4AA 3HD2A 4YDDB 1D9FA 1U8SA 2QMWA 3K57A 3CC7S 4WF9Q 2QIFA 2BMBA 3IBFB 2HEKA 1A7GE 5F8IA 4ZN1A 3PX6A 2LU2A 5A8KA 5GAEI 2OTLS 2XO6A 2VG7B 3TP2A 1IKVA 1PCAA 3I0SA 2X1GA 5J2QA 4CNYA 1RADB 1NHVA 2J5AA 2DGSA 3JQKA 2P9EA 3QT8A 4K5RA 2BANA 4I2QB 1VQ5S 3MEDB 4ZVHA 2NZCA 4DR2J 1K0TA 2YWWA 1N34F 3AH6A 2VG5A 5CD4H 1Q1KA 3W60A 4RW8B 2EFVA 4WFNQ 3TVYA 3GSIA 1SJRA 4QJVA 4OJGA 1H2TZ 4L72B 4ALZA 3W2WB 2ZH2A 1E6YB 1P1TA 2CJAA 3GJTB 1B0PA 2HHWA 1ZOTA 3P6YC 1XIQA 2UUAJ 4DX5A 3PW4A 4ZVPB 3CJ4A 1MMDA 2CJYB 1S1VB 3FNNA 2C1EB 2V4JB 1X4AA 2GJIA 2R7UA 2HHVA 4JI8J 5C42A 2QL9B 3J7ZT 5LJ5Y 3W66A 2J6SA 4ZCLA 3ENWA 1Y5LB 3R6LB 3CVKA 3RGIA 3M9OB 2YKNB 2ZBIA 4Q8EA 4R25A 3ILJA 4A8WA 2OPSB 1T9TA 1S1UB 4RWXA 2WTFA 2YKMB 1B99A 4OYAA 1TU0B 1U1NA 1AXQA 1OWXA 4OI6A 3SV3A 3OL6A 2BE7D 1KEKA 3OXFA 1U1MA 1OSDA 2UUWA 3GFYA 1FKOB 5HJYA 3LH2S 2NSCA 4A47A 3PRDA 1CULB 3C15B 4HH1A 4DL3A 1WC0A 1N5YB 2F7VA 4N47A 4BDPA 1IR0A 3KHHA 2VKRA 4HT5A 1HBNB 2ACMA 1RU2A 4H4MA 2RQCA 4JI0F 3AFGA 1URNA 2IBOA 1S1WB 4UUWA 4J9SA 2UVRA 4W92B 2ROEA 3RRHA 3E3XA 3IWNC 4KV8B 1I94F 1WI8A 2ROGA 3D1HA 3JSMA 1GXLA 3QGHA 2DK2A 3ZTOA 4W98A 3QT6A 2VHGA 2DGXA 1CVJA 2FDNA 5CABA 5H9EJ 4CWBA 1HPZB 1WJ9A 5DGAA 1XMQJ 2XHWA 3GZ7A 3H98A 3T9ZA 2F4VJ 2J76E 4CLTA 4QYZJ 3SYZA 4DPXA 3BN7A 2P2CB 3TAQA 2DHAA 1Q4RA 1RHJB 2DCLA 3ZZZA 2HBRB 3NNHA 1U1RA 3AODA 2QA4G 3R9LA 3VVUA 3IXQA 3N0VA 4JI5J 2IC3A 5DM6Q 4J37A 4USTA 2DXFA 1NPRA 1GXTA 1H72C 2E9TA 3N6NA 2GFFA 5B0AA 5KT5A 4HL9A 4DSKA 1QJHA 1Z1ZA 3PW2A 5DG8A 1ZM9A 2BJ1A 1KP6A 2XULA 2V8GA 4LF8J 3G8TA 3Q8VA 5FDLA 4F2SA 2KT2A 2HHPA 3OFHA 4LREA 1VRTA 2IYIA 4B3OA 4DHVA 3MD1A 3CPWR 4K5SA 1SV5A 2A2DA 2PFDA 1CC7A 1KNZA 4ZPTR 2CWKA 2W9CA 1WF2A 1VQ9S 2LQBA 2CZ4A 3SSSA 4AYBD 2AX0A 4NZ6A 5F8GA 2A2CA 2NUUG 5FLXY 5LSRA 2VQEF 4MK7A 1TAQA 3N6MA 4D3GA 4MKAA 4P73A 1NPPA 1HHQA 4F26A 4HHHA 2HLTA 2AGPA 2F40A 1WI6A 1TL7A 1RA6A 5DG9A 1SVDA 2QFIA 1V3RA 3QWPA 1SJQA 3QT5A 3HSDA 2JRSA 1W7WA 5KT3A 3CO0P 2UU9J 3OTCA 4WWSA 4ZKAA 5T41A 3KLHB 1ZBTA 1XR6A 1NAQA 4M8LA 1FDDA 3DI6B 4XDCA 4LF4F 3BGOP 2IIHA 3P96A 3JAMU 3IBWA 2LCWA 4DX7A 2HS0A 2ZKTA 1WF1A 3HHDA 3QSYB 1C1BB 1D8ZA 5LMNF 1FFWB 1X4BA 1IKYA 5HLFA 2ZJQQ 2J8SA 4XPCA 3VAHA 2W7AA 1R6YA 2SXLA 2MZ1A 2E5JA 1RWVB 3PM9A 4DV7J 4LIRA 1T9YA 2YQ3A 4RW6A 5DZ6A 2W4PA 3UD5A 2W25A 1FVSA 2AZ3A 3C66A 4AD6A 5DS7A 4DSLA 2W7PA 2ZDPA 1G1XA 2IM1A 3H7HB 4DPOA 1FFSB 2BE2B 5HVGA 1N0UA 1LNQA 1HYSA 3W9HA 3I5AA 4M5NA 3G71S 1QAJA 2RS8A 4RPFA 3IN5A 2ASLA 2Y0BB 3DCAA 1X0PA 4QR1A 4K0KJ 1UPPA 4DV2F 2VBXA 4CI0B 2I9SA 4DPTA 2ZHAA 1XR5A 5GAHI 4EBEA 4YY3J 1LW2B 3ETMA 1G6BA 2KN4A 3KUEA 3ZNUA 2CPDA 1BQNA 2IFXA 3V6DA 4ED0A 4DR1F 4B9MA 1DZ5A 2HHXA 1NSQA 2M7SA 5AJ3J 1X4CA 4DR5F 2V2VA 1R8CA 3BPDA 1K1SA 2MY7A 4N5SA 5G4DA 4NLRA 2WVBA 4UW2A 3NBPB 4ED5A 1JKHB 2G0IA 5IWAJ 3MFIA 4K4UA 4C2MA 4CZCA 2LQJA 1SJFA 5HMZA 3RB6A 1S4EA 3QAEA 5D0EA 1NSPA 4PR6A 2D69A 2MKHA 4EYIB 4EBDA 2IAJB 1DBDA 1VQLS 3PW5A 3LGMA 1IBLF 2W4CA 2A0FB 3W5YA 2LLZA 2VPXB 1LEOA 3I56S 1RU1A 1EIYB 1JLQA 2OP5A 1RE1B 1M1HA 4FXVA 3M8SA 2DRBA 4OYXA 2B51A 1HD0A 3TJ9A 1EJ7L 4CLYA 1JLAB 5K9FA 3HMJG 1SQEA 3MHYA 1MN7A 3MEEA 3QRPA 1YHQS 4TYAA 1NB2A 4H4KA 4ED4A 1T0TV 2GIRA 3GJRB 1XN9A 1D9DA 2MJNA 2DNOA 1KD1T 4OZ3A 3EICA 3JTOA 2YWKA 5DDOC 4FYWB 1WDDA 4HVZA 1HWKA 2ATLA 5DQGA 2DNKA 3V2UC 4DQQA 3KLIB 3DRSB 2CJBA 1N56A 3D28A 3G9CA 2O66A 4HACB 1U49A 4ILRA 4CYUA 4LF9F 2B8QA 1AFIA 1YQHA 3C14A 1RTIA 2MKCA 5CYMB 1C4AA 1GTHA 2O67A 3HHKA 3Q22A 1E6VB 1XR7A 2BZ2A 3QYYA 4J9NA 2AYBA 4ZIWA 3IG1A 3TZWA 1VQSA 2YY3A 5A8RA 3Q8QB 3N5BA 4G1IA 4YMEA 2ROPA 1JLBB 4E8UA 4KR0B 4WZMA 4JI1F 5F8LA 2WSEC 1UEKA 4MT1A 2JSXA 5HBMB 1YLXA 5B0DA 1FKPB 2DNPA 5E7OB 1F5AA 5IT4A 2EFPA 3M6VA 3AHPA 1TKTA 1Y4ZB 1MU2A 1OPIA 1XQIA 2XMTA 4DV3J 3GU0A 1BQMA 1OJ4A 4ED6A 4K8RA 2W1BA 1SKSA 2BRKA 1FTCA 1BC6A 4OHYA 1YK9A 4NLSA 1F2HA 2QTWA 4B3TF 4JI3F 3UD4P 1VMBA 3BN4A 1REVA 1U45A 3PR5B 3M8QA 3VZIA 2ZZNA 3NGKA 1UTAA 3JS9A 2ZZMA 1RT6A 4EBCA 2N7YA 1N6QA 1ELOA 5IM0A 4AXIA 4ECUA 3VAKA 4RU2A 2E5LF 3ULHA 1VI7A 1F3VA 1IBMF 1JLFB 1MWQA 1XWLA 2FJDB 1P6TA 3D7SB 2GA7A 3PRVA 7FD1A 4LFAF 4ILLA 1XMOJ 4YOEA 1SL1A 4IUFA 1FVQA 1VIOA 2JLFA 2RHSB 2FIUA 1CS4A 1NK8A 2VV5A 3JSYA 5JJBA 2DT9A 4LFCF 5F0UA 5ADZA 3EXCX 2G1DA 2OO4A 5JXSA 4A8QA 4Y2MA 2C2DA 1UPMB 1GQEA 5A2QU 3FRYA 2RU9A 3KLVA 1TUVA 2GQQA 1RWXB 3WBZA 4LF5J 1XC9A 4KIAA 1KLMA 3PIPQ 3RU0A 4I6YA 4CIOA 1PGZA 3MTJA 3HKZD 5LM7E 1HBMA 3WIVA 4JI7F 2OTJS 3LPEA 2CG4A 5LMUF 1S1TA 5KFDA 2KG0A 4PXEA 2F8MA 4OIXA 5CAAA 4DX8H 1VHFA 2ZH3A 2GS8A 1RWUA 4B9UA 3QPIA 2HYIB 1CJUA 4DV5J 3PW7A 3DDIA 2FC9A 1BMQB 1VQKS 1C2PA 3MECA 1T9VA 1X7VA 2BW2A 4ECYA 1GNKA 4B3MJ 4JI4J 3LGHA 1CJVB 3LWMA 4NOHA 2HAFA 2BYCA 4AQYF 4XTTA 4QWDA 3KLFB 2XC9A 3OTOJ 3BB5A 1WEYA 4ILMA 5HVHA 3A3PB 3K5MA 1PC4A 5DLGA 1LQ9A 3IGVA 4Q2LA 3EGVA 1H3DA 2HZVA 1KHVA 3MEGB 3E8OA 2C3MA 4IR1A 4OYOA 1WDTA 3CMAS 1YDLA 1QSLA 2M70A 2YKMA 2MGZB 2GIFA 1LK5A 3HT3A 2Z8QA 3DRXA 3HHLA 3BJYA 1XNQF 3D0IE 4WFZA 4MK8A 2CPIA 4DV1J 3MMCA 3MR6A 2IA0A 3JXOA 4PWDB 5KFAA 1T11A 1CULA 4CCHA 2BOAA 1IWAA 1PILA 4MAKA 1ACMB 1U47A 1N5YA 4TY8B 3MPVA 2R7RA 2GQ2A 1LXNA 4P7TA 3Q86A 3RAQA 3B8HA 3GJQB 2NS1B 4FF2A 3T41A 4ZOSA 2B7BB 3CCVS 3NMAA 3R5BA 3KNGA 3Q23A 1OY9A 4CP5A 2OSQA 1Y7PA 1RT4A 2VFRA 2XYGB 2YNGB 5J1EB 3ZTQA 3CCZA 4F4WA 1L3TA 1BLUA 3QIDA 3R27A 4AXJA 2CAJA 1PSDA 1GMWA 2JLGA 2FJEB 4YFUA 1RHKB 4IH5A 4FPRA 3CD5A 1S0VA 3F73A 5GVQA 4YB7A 1QTNB 4PPDA 1U02A 1C4CA 3C8YA 4P2FA 1GEHA 2BA9A 2CNNB 2VFSA 4NWBA 1HQUA 2D9PA 4R0JA 5F9NA 3G87A 3PX4A 4IO9Q 2W4DA 3UCZP 1K1QA 3DHXA 4DL2A 2PO4A 3PYEA 2VFUA 4WE1B 3DLLQ 5GMKa 3NOGA 2FHJA 5D6GA 2HVEA 2DR9A 3LP0A 3MCNA 4ZCIA 2DVIA 1Z2LA 4KQZA 2YKPA 1T9WA 3OPKA 2CPZA 1VBKA 3D1OA 3CWJA 4PWUA 1RT3B 4QPTA 3TUJC 4ES3A 2NCKL 2WONB 5ETRA 2LDYA 2PN6A 5G0RB 3PFEA 3PDNA 2JLEA 2KL8A 3FCHA 4XK8C 2V5HG 5B7WA 2B4PA 2ZH7A 4B08A 2OD6A 4C48A 1CSJA 1HA1A 5EX3A 4MKBA 4C0HA 3DLBA 5HVFA 2WW4A 5I3PA 2CQGA 1S79A 3RTVA 1SC6A 1F9HA 2MKSA 4MH8A 1J2VA 1L3VA 2ZC4A 2DNHA 3L9ZA 3BBBA 1SC3B 3TRGA 2U1AA 3DI6A 1UP1A 2PSZA 4OX9J 3M1VB 1H0HB 3PRBA 5F9LA 4PG4A 4U6PA 3AT1B 4OJ3A 2HMIA 5IT0A 3SCKE 3M2VB 4RUHA 1N52B 3TAMA 1C1BA 2H5EA 1P27B 1MG7A 3CJ5A 3HVTB 3RRKA 4QOTA 4G1PA 3W9IA 4HTIA 4PQUB 2M8DB 3ITHB 2IM3A 2E5HA 1WHYA 3NCRA 4O3SA 1SKWA 4FVCA 2VBWA 2YX4A 2Y8WA 5LSOA 3BQ2A 1NXIA 3CJ0A 3HSZA 1R8BA 1ZM3A 5K8NA 2IVFB 2BE2A 1TL3B 2ZVIA 5CA5A 2DNYA 2MZRA 3LALA 5LJ3Y 2RT3A 3SSRA 2KJVA 4OZLA 4KHPJ 4LF7F 3QFHA 4ZP7A 1WC6A 1UMJA 4LMZA 1WHXA 1HWIA 2OGUA 1RT7B 4DR3F 3MOJB 5KG4A 4DPUA 4QIEA 3R5JB 3W9JA 2W9BA 3I0RB 5H9FK 5HAOA 2LMIA 4CLZA 1S57A 1QUVA 3M8PB 2PMZD 4KGMA 1VR6A 4X66J 2W2OP 1U2RA 3HKWA 5CQGA 3HDSA 4X4VA 1EKRA 7FDRA 3JSRA 3D54A 4B9SA 2D7SA 2LYVA 2E1RA 2E7WA 5LXYA 1FTRA 2IAJA 4WFAQ 1MWZA 2VDHA 2VQFJ 4A8YA 3IS9A 3CCSS 1N54B 2N4CA 1LWCA 3DRPA 3CJTA 2WSCC 3CJKA 3HHEA 3HULA 3FBEA 2DH8A 4DR2F 1KVIA 3IAS9 3RAXA 6AT1B 3G6YA 4F2RA 3LA0A 1JMTA 4OHVA 2KZMA 3QJPA 2DGTA 4P52A 1QTMA 2R8KA 4WBFA 1KQSR 1Z4UA 4DR6J 1RK8A 3JAMY 2DXEA 2DO0A 2QSFA 1SIWB 1XK8A 1VQ8S 1VK3A 5KFTA 5HROA 2JEIA 2ZE2A 1IUJA 3R7SB 2QA2A 4LFBF 2C2ZB 5DG7A 2R7OA 2R42A 2J0WA 2KM8B 3EUNA 4F36A 1VQYA 1ZM4A 4PEOA 1B70B 3MAAA 4JI8F 2UXCJ 3KLIA 2LEBA 4LQ9A 3DRSA 5B0CA 3SEOA 1UEUA 4MIWA 1CJTB 4EFAC 3RRGA 2KH9A 2M4MA 4HACA 3DMJB 1X5SA 2C28A 1JNZB 3MR7A 2D3UA 1S72S 3SQOP 2I5JA 2VH7A 1TKZB 3E01A 1RHUB 3MAQA 1AUSL 2GW8A 2Y3YA 3H25A 2XS5A 3H0PA 3DRRA 3NLCA 2A3JA 2M9KA 1U1LA 4A4JA 2OPPA 4ETZA 3NOCA 2HAIA 4L75A 3A12A 4ED7A 3FGVA 3W5ZA 1CEZA 4OZJA 3TX8A 1YJUA 5KAKA 1M5VC 5D8HB 3HCXA 1YIJS 1UZHA 5C25A 4ZVRB 4RBVA 4UZCA 5KFUA 1DRZA 1BWEA 3IRXB 1VC5A 4CO5A 3AA8A 1UVIA 4DV4F 3HHLC 1TVRB 3CDAA 4R5PA 4ZP9A 4TKTA 2CJ9A 2HLUA 2CQ1A 3VAIA 2NYHA 4ZMMA 2BKPA 2JFKA 2J0SD 1NSKL 1T95A 2FB0A 4LSNB 1YWXA 2KT5A 4ZCKA 5IV3A 2O3DA 2QRRA 1S6QA 2HFVA 5DQIA 4RW4B 3OHBA 4NCGB 4FKYA 4ITSA 4UF4A 2RDDA 4LRCA 1ZH5A 5KFIA 1QUPA 4NLVA 1T94A 4KH1B 1NHKL 3R6GB 1XMQF 2L08A 4V1Ak 4TYBA 4QWBA 2HVIA 2RF2B 2CADA 4GVBA 2F4VF 1LWEB 4CO0A 4FZVA 2RKIB 4AUKA 1K9MT 3PW0A 4KKOA 2W9AA 1KQFB 2BKNA 3OSNA 3M7VA 4ED8A 1NSAA 4WFBQ 3A13A 4J9PA 1RT5B 4PG7A 3CIMA 1NHUA 1WEZA 2L9NA 2FJXA 2R7VA 3KK1A 1DTQA 3D2WA 5JVGQ 3GV7B 3PO4A 3KK2B 2ACYA 3GG0A 1Q8BA 2KKHA 4ECTA 3HFVA 3RBZA 4WYWA 3O2IA 2GVZB 1S7IA 2VF3A 4ES2A 4K59A 4C8OA 1FX2A 4MFBB 1NH8A 4A8FA 4CM0A 3ZZYA 3J80U 3FBCA 1O51A 3H2VE 1TK5A 1EHWA 5IV4A 4Q8FA 3CUNA 1KDNA 2HNYB 4DUZF 2YKAA 1YRXA 3PHEA 3NS5A 3S01A 4F50A 1KSPA 3RBEA 1X9MA 1FXRA 4NYOA 4RJVA 2FY1A 2WVEA 2L48A 5HK4A 2XTJP 1VFJA 4JI2J 3NWRA 3H42A 1NJZA 1SC4B 1H7WA 3LANA 3WHIA 2I1RA 3GYNA 1FXLA 1S12A 2VZ9A 3T5LA 1N0VC 1R27B 2PA3A 1RQ0A 1PG5B 2VG6B 1T8EA 2Z4PA 3DM2B 1CJVA 4TQRA 3RW7A 4CQ1A 2W8LA 1TP7A 2RDIA 4F25A 4Y2IA 1VQ6S 2NZ4A 1WSVA 3DDKA 5DO2A 1UW4A 2MPUA 2BABA 1SIZA 3D0GE 3ENQA 3KOAA 2APOA 4OLOA 2E7VA 3LWLA 3QLHA 4ERDA 3MUMP 4PUOB 3LP2B 3HHNB 2IBKA 3THPA 3U27A 3GPAA 4YEAA 4L3NA 3TI0A 3W7BA 3I82A 2E1PA 3R7NB 3H4DA 1TKXA 1BUXA 3K8WA 3N79A 4GC6A 3CE8A 2RRAA 2ZFHA 1LWFB 4DG1B 3CC2S 3BKFA 4BHQA 2G4BA 1WOPA 4CH0S 4FP9A 4TY8A 4YY3F 5ETOA 1O0PA 2YWFA 3DN9A 4Q0BB 4HI2A 2QMXA 3NS7B 4PG5A 3QIPB 1XEZA 4EK2A 4IG0B 5A2QY 2YNHA 3DOKB 1IWGA 2JFDA 3LTOA 3H5SA 3P5BP 5AXNA 2XWXA 2R8GA 2HNDB 5FD1A 2XG8A 1N4LA 2CPJA 2D3OR 5IWAF 3MM6A 3R2CJ 2WOMA 2ZUGA 2DR7A 3KFWX 2UV8A 3MMBA 3PKMA 5J2PB 1N33J 3T1HF 1IKVB 3I0SB 3SCIE 4X4OA 5J2QB 4RL1A 1X5TA 1RCXB 1F3FA 2VKZG 3MURP 1C0UB 2VG5B 2DNRA 2FZKB 1VISA 4KY3A 1S10A 2OEKA 5DDQC 1AFJA 3AQPA 3K8VA 2ZOFA 4ZLPA 5LL6d 2X1AA 2V8PA 1PBAA 1WHWA 1Q8IA 1DHMA 2ZD1A 4LRFA 2W2NP 4O4GA 3RR7A 2VIHA 4LRAA 4Y65A 1RSCA 4K2XA 4IOBA 2ZH1A 2M8HA 3T5HA 3OVSA 2ZDOA 3A8KA 2R7TA 5C42B 2C22A 3TZYA 1EAYC 2OPRA 2P9GA 2KXHA 3ZNJ1 2M2BA 3IR6B 3P3DA 1NK7A 3SQGA 1UVLA 2CJXB 1MSWD 1D09B 1UJ4A 2PD1A 1S99A 3FVYA 2GC8A 2DPIA 1WNEA 8RUCA 2QC3A 3GCXP 4ZJQA 1HL6A 2YQ1A 1JLCB 3HD1A 2EBGA 3CJQA 1AB8A 3JQMA 4O0IA 2DR6A 4O4RA 3PEJA 1NJXA 2OELA 1PO6A 5KFNA 4E98A 4C3MA 3R5DA 1RTHA 3W1YC 3C16B 5KFMA 5ETVA 3U02A 2M5YA 3UFCX 3GFXA 4ECRA 5D0HA 4H4MB 2U2FA 2GJ2A 3M2VA 1UEVA 2OFHX 4DV3F 1EKSA 3POTA 5KG6A 3C3LA 2CPFA 1PAUB 3CC4S 1FO1A 3JSMB 2V69A 3QJLA 2Q3PA 1KOOA 2DJWA 2XEXA 5CXTA 4KSEB 4RO0A 2EKNA 1UL3A 3OXLA 3PFOA 1SUQA 5L1IA 4BC7A 1GX5A 3IR7B 4DSEA 3OT9A 1TQLA 2MXYA 1R0BG 4U8YA 3GG1A 4NXNJ 4W4MA 2Y1LB 2RD5C 2RMLA 3BZQA 1T3NA 1Y5NB 3Q24A 4FS1A 2YX7A 1DQAA 3LGNA 2UUCJ 2EG2A 2PA8D 1VBXA 2UVVA 4FF3A 1RDRA 4DFJA 3CDWA 3EYZA 2IC3B 2R8HA 1XMOF 2LEAA 4Z37A 3M9NB 4ZPDA 2IDEA 2OMLA 1RT7A 4JBCA 1RHRB 2GQCA 5HI7A 2AWZA 3BYPA 2G2YA 5KG3A 3UCUP 3G8QA 1TMJA 5FDLB 1FA0A 1RHQB 2VA3A 2FLOA 3BSCA 2KFNA 2KVQE 4USJC 1AT1B 3KJQB 5KTQA 4FNIA 1VRTB 3UDEA 4LF5F 1P9YA 3BQ0A 4B3OB 1SV5B 2AHOB 5GADI 4LT6A 4RWWA 4FPIA 2VJUA 3UN3A 2R7WA 3UPFA 2W9CB 1IJEB 3GYGA 1S9GA 1GT8A 2Y8YA 3GCWP 4ETXA 4CDIA 5K14A 1YX2A 2GVDA 5B0FA 3JQJA 2EC0A 2HQDA 2BRLA 2OKQA 4U96A 2B6AB 1Y5IB 1TL7B 2CNKB 1Q7YT 1JJ2R 4DDFA 1LXJA 3Q89A 5CCMA 1HNVA 2FQQB 4V19X 3K0JA 4OZ0A 2IRXA 3OVAA 2WK4A 4DV5F 2RRBA 4TLRA 2MQOA 1IR1A 2B9YA 4C4WA 1AW0A 3GIMA 3GIRA 1P8GA 3WQPA 2VUGA 2LEPA 3HX9A 4FDFA 4O44A 4DLEA 4M95A 4L73A 3THVA 1G7CB 2BUNA 5D15A 1KS2A 4B3MF 1FESA 3A8JA 1R8PA 4QW8A 5E41A 2BE9B 2GAGC 1YJVA 1U7LA 5I3QA 3A3OB 1CJTA 1YRTA 3OTOF 1IKYB 5HLFB 1M5HA 3EZOA 1WSRA 1TL4A 4ATNA 3CJ8A 4NI2A 3IO1A 3DMJA 4DU8A 1XNRJ 5F0WA 3I55S 4J91A 1N5TA 4RW6B 3J7YU 3V4IA 1TKZA 1X4FA 2RAQA 2YNIB 2DRDA 3DFEA 2GJFA 1YVFA 4B3SJ 4ZVTB 2VBYA 3DLGA 3ICLA 1HYSB 3J7A1 4Z7CA 4U7UD 3DXSX 2MMYA 3KMQA 2DBBA 4ED2A 1NDPA 2CYYA 2XZTB 3M05A 3BEGB 5KFBA 4EU0A 3IRXA 3M4XA 1HWJA 3DLHA 3M6WA 1JLGA 4YN3B 1BQNB 3DNCA 3O1LA 3V6DB 1X4DA 4E0DA 1TVRA 3BGFA 3OJSA 2K8GA 2QT7A 1O8BA 1KR4A 4NEYA 1UVKA 4EGLA 3RB3A 2IYGA 5HQLA 1OYDA 4U95A 5KFPA 1WTBA 1I1GA 2GGPA 5D4NA 2HQFA 3NP5A 5A6PA 1XTZA 3DKDA 4BS2A 1S0NA 2QLXA 1P1LA 1T03A 1U0HA 1N5VA 2MZQA 4NLQA 4WP9A 2EKYA 3OTBA 3G4SS 3DHWC 3FUYA 2Y1IA 3MM5A 4WPAA 4QIGA 2MKYA 3C46A 2XHCA 2AGQA 2VODA 4F4YA 3W3SA 5F8HA 3TJAA 2BW7A 3VTIA 1JLQB 4HT7A 3LO3A 2I0XA 1R31A 4QPXA 4U7UK 4CO2A 4KB7A 1B7YB 4ID5A 2XI2A 2Q1LA 4KC5A 1Q5VA 3K7RA 2OPQA 1R8AA 2EWHA 3OUYB 4WKYA 1RI7A 1F1BB 5DZ7A 3GFZA 3PACA 3MF5A 3KLEA 1HI8A 3EDRB 4ICLA 1WG5A 3P49B 4QWEA 5KFLA 4UOGA 2XSJB 4NE9C 4ZJLA 1ZAWA 1NM2A 2XCPA 3QFWA 3RB0A 3CULA 4PYDA 1ITPA 3C14B 3VAFA 4AL6A 2HNYA 5L1JA 1IVZA 4N77A 1IR2A 3GIKA 3OLBA 3SDEA 2QZ8A 1WG1A 1FD8A 2VC1A 2K2PA 4RNFA 4AL7A 2A18A 3RUBL 2KFZA 3IG1B 4J9LA 4EWTA 3SMZA 4RNMA 1SL0A 4Q45A 1H2VZ 4ZLJA 2P8IA 5A8RB 4J9KA 4P9SA 1I3OB 3Q8RB 1FRMA 4OZ1A 4WCEQ 1X0FA 5SUHA 1RTJA 2V67A 2AGOA 4RZRA 1LFWA 4PAAA 2MLXA 2HBQB 2ALZA 1MU2B 3GV8B 3FKBA 2ASDA 2HZAA 1G3OA 2HRUA 1BQMB 2YTCA 1T7PA 2GHWA 4F3MA 1BY9A 3T9NA 3GWCA 1F5BA 1HLWA 3LP2A 2DGWA 1REVB 2V2ZA 5LT5A 3M8QB 2RU3A 3MAHA 2MQMA 2B7CB 3OD2A 4USUA 1FRJA 1DY3A 1RP5A 2V2QA 4FNHA 4DX6A 4C8KA 4Q43A 1RT6B 1X4GA 2V4QA 4FF4A 3QGPA 3NCPA 2CJQA 4HR2A 3BH6B 4DR4J 5IM0B 3BSOA 3HI9A 2O5DA 2JL9A 2YKQA 3D3CJ 4ES1A 4CLKA 1GTEA 3KUHA 4DXLA 4KHPF 1Q79A 2JX2A 3K89A 4Q0BA 3SCJE 2LECA 2N7CA 4HLBA 2KB2A 2KXFA 1CS4B 4IG0A 3UNGC 3T1YJ 3DOKA 1YKWA 4RLEA 4NLTA 4I2PA 3DOLB 5CYQB 3H40A 4HKQA 2HNDA 4NZ0A 4LR8A 2UUTA 4WTYA 4C0OC 2GMJA 4H4OA 3ZTSA 4MJKA 2IDLA 5CD4A 2KVIA 1XERA 4XIUA 3HVRA 4MIAA 4RNNA 4C8NA 2R8JA 3M8YA 1KLMB 5KFZA 3H8YA 5HANA 1XMBA 3NXZA 2IJRA 3L95X 4PKDB 2ATCB 5J2PA 3TUZC 2RJZA 1Q86T 2FUG9 1F60B 1WKKA 2AF6A 1WACA 2JEGA 9ATCB 2VQFF 2B43A 2J7WA 1L3SA 3I5BA 1HBMB 1ZETA 3H5UA 1LV5A 2V9WA 3ZO7A 2KZZA 4NYPA 3KJVA 5E0OA 1C0UA 1M5KC 4JB8B 1GK8A 1VQ7S 2IMWP 1HMVA 2HURA 1S1TB 4QWAA 1AROP 3T1AA 5D0GA 4LF1A 4UTGA 5E3QA 4DR6F 1CJUB 2QLJB 1KLNA 3V81B 1NEEA 5F8MA 5D4PA 3LOUA 1DURA 2JEJA 3I32A 1SJ3P 3MECB 3O5TB 4DBQA 2CDRB 4ZJOA 4CM2A 3F41A 2PMHA 3B78A 5D4LA 4DL4A 2ZNZA 2NYIA 5E3RA 3UN5A 2QSWA 4ZHRA 5L46A 1KWMA 2B56A 4LF4J 4FKXA 3CSKA 3I4PA 4A46A 1Q8LA 4ECZA 4UUXA 2K1RA 3GJSB 2LFVA 4E2FB 2F8EX 3QATA 4NMLA 1RAOA 1WG4A 1R43A 3ZZPA 4IRKA 1WUUA 3BH7B 3CW2C 4RUAA 1QAIA 3QRRA 3KKFA 2N4DA 3EDQB 3ENAA 3HHLB 1JLCA 3OL7A 1X60A 2IVMA 1FNOA 3AAWB 3MMCB 1ROFA 3OQ2A 3FSXA 1XJWB 5MLCV 4DL7A 2LU1A 2RQKA 2FPHX 4PZVA 1DLOA 4YB6A 3C16A 4Y00A 5D0RA 1OQ6A 3M2RA 4J9RA 1SPBP 2HHUA 1R89A 1YZ6A 2OMOA 3FCVA 1NB7A 3AD7C 3T6JA 3V6HA 1J27A 3MCMA 2MQNA 2YBVA 3JTPA 5KFEA 3BREA 2GCFA 1RHMB 1QVFR 2DH9A 2H51B 2ZJPQ 4LJMA 4NA1A 4P7VA 2ZBPA 1RT4B 1HIYA 1S9EA 2QLFB 3R5GA 2OD4A 2DHXA 3UQSA 1K47A 3QZ8A 1DTTB 4MMOA 1Q82T 3UWTA 5ETMA 1DQ9A 4CLFA 5ETNA 3P5TL 2XLIA 1Q8KA 1SL2A 3GTYX 3Q8YA 4IOAQ 4RW9B 1JJCB 3DLEA 4FN5A 3FDSA 2R3VA 4CO3A 2LVWA 2XLJA 2P6TA 3MM7A 2Q6BA 3LPYA 2V8HA 5KG0A 1VBZA 5CHCB 5HP1B 5CYJA 2WZ1A 1HQUB 3BGRA 1UW9A 4OQJA 1IKWA 3HP6A 1TTHB 4ED3A 1NNDA 2PC6A 1NJIT 2E1AA 5GAGI 2KYXA 1EQ0A 3K59A 5D77A 4YUDA 4CLUA 2CPHA 3G82B 2F8HA 3CTRA 2IMOA 1J5EF 1K44A 1S1XA 1QE1A 5IQ6A 3LP0B 1MMNA 4B17A 4RX6A 3W2VA 1KKHA 2ZBCA 1JQGA 4ANDA 2HS4A 5HATA 4CLSA 1EB0A 1Y9OA 4ZPWR 1RAHB 3GR0A 4IKAA 4X65F 4QYZK 3NCQA 3UR3C 4F3OA 4N8OA 4USVA 2VONA 2B6AA 3UN2A 5ETLA 4NLWA 3R2DJ 4IR9A 3OR2A 2Z57B 3EE3A 2PDAA 4YQWA 1VC0A 4OYWA 4JI2F 3CCQS 3EGNA 1WF0A 4PQAA 2WCXA 3VQTA 2V0NA 5CCLA 4DS4A 3KJNB 3CCWA 2YH0A 1UWBA 4RNHA 3GQCA 2DNGA 1PBUA 9RUBA 4NXMJ 3CMES 1L3KA 1HR0J 3RB4A 5D4OA 2HMIB 3TANA 2ZJRQ 2ZZTA 4O3NA 3TAMB 2HQIA 5U47A 5BR8J 3G6VA 2E9RX 3L09A 1HWUA 3EVOA 2CZVC 1YJNS 4M5GA 3TQ1A 2P5VA 3ISND 2FVRA 4A48A 2YNIA 4WFYA 4B3TJ 4NX9A 1YRUA 4JI3J 4DV0F 2WW8A 1TKDA 2CQHA 1ZAVA 5AXMA 1N48A 4O3PA 1FDNA 4DFMA 1SKRA 3E2EA 4O3QA 2IY5B 3QBCA 1MROA 1DQ8A 1VYAA 3BKTA 3MDFA 1U25A 1CQMA 3QAUA 1RTZA 5KFOA 2QL7B 3AQOA 4OYBA 2KXNB 1IBMJ 4F0MA 4PCQA 1ZTWA 4X62J 3CJ3A 2EI5A 4RBUA 4P2XA 3CDBA 2M0GB 2RHQB 2LKZA 2LXUA 2MTLA 3BSNA 3TUIC 3FK4A 2W9BB 2MLZA 4NLUA 4F67A 3IWXA 2F65A 2H4WB 4OI2A 4KGZB 4KPYA 4NMXA 4K4VA 4NRTA 3S7RA 2EFOA 2JJ4D 3PVXA 3FSYA 2GNKA 4DV6J 2DIUA 3FFIB 2W8KA 2CQIA 4G1QB 4P71A 2E44A 1RT2A 1SQGA 3IS9B 5KFRA 1LWCB 1KRPA 3DRPB 2N82B 3NAIA 2NREA 1FRXA 3CJKB 4MYTA 1QD1A 4A8OA 1PYSB 3HVWA 1S49A 5LMUJ 1GH8A 2J7UA 2MZSA 1HARA 1GXUA 2I8EA 4X4SA 2FVCA 1G4CA 2P9CA 3OUYA 5HROB 3MPYA 5L9XA 3KG1A 4ZS6A 3UR0A 1SH3A 2ZE2B 3NNAA 3BO3A 2UUBF 2DNNA 2VA2A 1EP4A 3RYLA 4B02A 3VGVA 3MAAB 3VALA 2NPIA 2XSJA 5L1KA 2LP4A 4R8UA 3NEKA 2C3UA 1YBTA 1FNXH 2WHOA 4UOHA 2B9WA 5RUBA 4IFVA 1HBUB 3PX0A 4LF6F 2JWNA 5BYSA 3TAPA 3MD3A 1N5QA 3W8GA 4ZVEA 2VASA 3W62A 4CO1A 2I5JB 2XBPA 1YJWS 4CNZA 2MJUA 3E01B 1WOSA 4ANEA 5C2GA 2EK6A 3K5NA 3PV8A 1FXDA 2AEFA 1GX6A 3DRRB 3Q2TC 4DS5A 3GILA 5IT9Y 4JV5J 2OPPB 4QCLA 2VJVA 3HVAA 3TA1A 4DSIA 4UY85 1LWXA 2OHDA 1XNQJ 2YQ0A 2CQBA 2E9ZA 5C25B 1WD6A 3AOCA 2DHGA 3HO1A 4DFPA 3GLJA 1CJKB 1NK0A 1ZPWX 3LAKA 3CGIA 2NUHA 2HRTA 1B7FA 4R5PB 3U1NA 2PIIA 4I68A 1V3SA 2QJ3A 1OO0B 3N28A 5HMYA 1NKBA 4YR0A 1T05A 2XYPB 1EQMA 2IRYA 1S6QB 2HGLA 4ELTA 1KQKA 3K5OA 1TV6A 4CT9A 1U48A 2NSBA 3CD7A 2CPYA 2O1PA 4KHRA 3KG4A 2G1HA 1F9FA 1NDCA 3QNWB 2FJBB 2HNZA 1IXKA 2C2RA 4JYAJ 2HQ3A 4OV6A 1MW7A 1YITS 4GVBB 4TY9A 1O5JA 2BBEA 4NXNF 4CH1A 3HM9A 2MQPA 1X8DA 2B8PA 2UUCF 4OZNA 1WEXA 2CQ4A 4FYVB 4KKOB 4DN9A 3UCGA 3OV7A 1UA1A 4K4ZA 1EX8A 1U24A 4HTJA 1YJ9S 2AW0A 3PIOQ 1H73A 2EFGA 3KK1B 3OTDA 1DTQB 1EETA 1HNZJ 1IQZA 4S0MA 3KHRA 5DETA 3Q83A 3DOLA 5CYQA 1JX4A 3UW1A 2RRNA 1FDBA 4JV2A 2FJWA 3AB4B 1VQPS 4OFZA 2C2NA 2RVJA 5C24B 2R4FA 2UXBF 1L3UA 3BM7A 3MR5A 1F5CA 4GO5X 5DM7Q 3QO9B 2KJWA 2CPEA 1WORA 3G6ES 4GKKF 2UXDJ 4USWA 4K4XA 4XAKA 4L76A 3U7JA 2OSRA 2H4YB 2E1CA 3TX0A 1YJTA 3Q8PB 3TEGA 4FF1A 5LOQA 3VGTA 2CQCA 2C3YA 3KK3A 2C2EA 2XMVA 5T7LA 4X84A 2OEJA 5KFFA 1V5IB 1NDLA 3AXKA 1VQMS 4BC9A 3OJUA 2DGOA 3V81A 1S0MA 3LAMA 3D67A 4IH7A 4L74A 3MR2A 3BDEA 2DO4A 2XCAA 4WTOB 1RT1B 3RBDA 1JIHA 2C2KB 4FXDA 3BR9A 1R0AA 3PNIA 2HWTA 2D1CA 2AP6A 5KFQA 2ADCA 4DL5A 1I51B 3CCTA 3TW0A 5THWA 1H98A 5B0GA 2H54B 1M5PC 4W90B 4DOZA 3I9V9 4OX6A 4QIFA 3J81j 4PG6A 3M6XA 3NGSA 4CT8A 3QLHB 1DARA 5I42B 4DR7J 1XNRF 1VK8A 1BXNA 2IPOB 4J7CA 2BJ8A 4J9OA 3KNAA 2NR0A 4LIWA 1D8YA 3PYGA 4M5DA 5T14A 4DN0A 2F9DA 3QQCD 4M94A 3HZEA 2YWHA 4B3SF 1TKXB 1IKXA 4N8NA 2B9XA 2V6AA 1QAXA 3CCUS 3R3TA 2G0JA 2UP1A 4QYRA 1Z2ZA 4Z7YA 4X4TA 3D4JA 5L1LA 3ZXWA 5K20B 1RAEB 1QSYA 3G6XA 4KO0B 5F3TA 1RUSA 1NK9A 4NLXA 1RKJA 1D1UA 2HHSA 1TUGB 3OR1A 4IO1A 2BVZA 4OLPA 4LF7J 1MLAA 2RDJA 2V68A 5K8MA 4ZCMA 4FBTA 2YNHB 1HNIA 1BWVA 3C6UA 4PXCA 2Q79A 1RWWB 2MSSA 1FF2A 3EPGA 4DR3J 5BJRA 4TNOA 3MM6B 4DCOB 4ZLLA 2H48B 2WOMB 1DTTA 3OFGA 3M2UA 1RKIA 3AD8C 3GV5B 2RNEA 2AMCB 3MMBB 5ETSA 2NQPA 2WBRA 4FS2A 4M5MA 4RW9A 4L3KA 3CNQP 2AZ1A 3T3FA 3MPDA 5E3PA 3BS9A 4KE5A 1S4FA 1N8RT 4X64J 4OHZA 2ADBA 5KG2A 3KHGA 3CCRS 4A8MP 4IG3A 5A76A 4DQSA 3VZHA 4WK3A 1NJWA 1RCOB 5HP1A 2HVZA 1VOMA 2XQCA 1RISA 1J5OB 4K4WA 1RAGB 4C11B 1S6PB 2ZBRA 4MKVA 3R5AA 2QGFB 2ZHOA 3U1LA 3ILIA 5M2RA 5DGBA 1D9AA 1T9UA 1WKLA 3RJMB 2GO9A 1SBRA 2BJ3A 3VWSA 1NKEA 4G6VB 4M1KA 1IN0A 3G82A 3KLGA 1YTYA 1VGYA 1S9FA 2X1BA 2RQMA 2ZD1B 1PYTA 3AD9C 4O4GB 4TQSA 3TO8A 1OY8A 3KXDA 3QMQA 2POKA 4JI6J 1EARA 5KFSA 2XY5A 2J7KA 5KFXA 2C42A 4LFBJ 2G13A 3VQSA 4J9MA 1RXOB 1IBKJ 2OPRB 3BPSP 4J9QA 3WZ0A 5D3GB 1RA7A 2KO1A 2ZHBA 5JUMA 5A8WA 4DUYJ 3SQGB 2KHDA 2DXDA 2CKWA 4BLGA 4ZPCA 3SFUA 3DLKB 2YXLA 1S0OA 4TU8A 2D9OA 4HYKA 1W2IA 2GHVC 4UZBA 1X5PA 3SIPB 4DZ6A 4ANCA 2CDQA 2MQ8A 3PZPA 2NLWA 2KM8C 2DEJA 1X9SA 1F6TA 4USIA 1QDUB 4AE5A 4B3RJ 2AJ1A 1FJCA 1B0VA 3ONQA 3D6FB 3I9ZA 1RTHB 3L7UA 3ZZRA 2CZ9A 4AFFA 3DU5A 3D68A 4OHXA 4QR2A 2Y0SD 3N01A 3FCWA 1HNWF 4NPOA 4XPEA 1LW0A 1AYEA 3N5FA 1YSJA 1YBUA 3GONA 3POTB 3DOMA 4ZK7M 2HQGA 4DV4J 5EX0A 3R8YA 2XLKA 2DISA 1GAOA 2J0XA 1N36J 1H7XA 3LF0A 4QBUA 3CF5Q 4K7QA 3KMSA 3US5A 2HHQA 3D3BJ 5KT6A 3F0NA 3VR1A 1SUQB 1WELA 3R1HA 4Q5VA 5JMNA 4CLLA 2D41A 4UT4A 4N56A 5EGYA 3VCDA 4DR4F 1MNEA 1O6XA 2HIYA 4B9NA 1HBOA 3KYLA 4LRBA 5IC4B 3JYTA 4HDHA 5KT2A 3J81U 2RUSA 1S77D 3NNCA 3FSIA 3O44A 4M63A 1URRA 5J2MA 4DSFA 4J90A 1RBLA 4NCAA 3G2XA 4BWMA 3MXHP 2DD8S 2MZJA 4JP8A 2C2MB 3VAGA 1K73T 1UFLA 4K4YA 2QYCA 1HNXF 4TLQA 1NMEB 3T1YF 1HQ2A 1U1KA 2BQ3A 2XMWA 3MWBA 5I4MA 1OPZA 2HFNA 2FGCA 1ZYQA 4KYZA 1ICEB 2VPYB 3RZAA 1AZSA 2EBEA 1IM6A 3PEHA 3ZZTA 4LSZB 4F7VA 2BQRA 1CC8A 2YPZA 5KOXA 1JWWA 3NMRA 3L4BC 2MLYA 4J9VA 4WXOA 2LQ9A 3FFIA 5IS2A 4G1QA 1S9GB 1ZM2A 4JOUA 1JLEB 5K14B 8AT1B 2XS2A 1RTDA 1HW9A 5IFMA 2GVDB 2HFUA 2VFVA 4DCJB 1VBYA 3DGVA 4OZ2A 2WVCA 1HFEL 2FY8A 2ZH8A 1M5SA 3H59A 3JTNA 4DUZJ 2F63A 2C3OA 4P75A 3CO9A 1HNVB 2XS7A 4X4RA 2R2RA 5DJBA 4AL5A 3TUPA 1CLFA 2VBZA 4I7FA 4DPWA 2X51A 2CWXA 5GAEU 1VHIA 4O44B 4YHHJ 2UUAF 1REGX 4KFBB 4OHWA 3N9UC 3NL0A 3H4BA 2RS2A 3UVJA 2QO3A 4DMZA 4ZVOB 2Y1JA 3WC2A 1U0SA 3CJSA 3BR8A 1WWHA 2CQ3A 3IM8A 3IR5B 2WVDA 2Q66A 1HW8A 2AD9A 2D74B 4NI2B 1HBUA 1QVGR 3NKYA 4JUZA 4KJIA 1RWNB 2NPFA 4RW7B 4IFYA 3V4IB 3IGNA 3PJWA 2XGQA 2W2MP 4I64A 1TR0A 2K7KA 4RBTA 3NGTA 1BQXA 3L7OA 3DLGB 3HK2A 3D6TB 1SI9A 4U9RA 2HPUA 4NEZA 1NJYA 3IP0A 2H1YA 1RLCL 4C7QA 1UJ5A 4KGVB 4XDDA 3NG8A 2AX1A 3AXMA 5EHHA 2ABYA 1CJKA 3T5KA 4ER8A 5BYRA 1X5OA 1JLGB 2CPXA 1Q0NA 3K5PA 4P6QA 2W24A 3KG0A 1TFYA 3EGZA 2HW3A 4B9LA 4BCAA 1FE4A 3FBBA 4DWIA 3ZZUA 4QR0A 2EC2A 1W26A 2Z0GA 2GGPB 5CZXA 3DGPA 1U4BA 3MPWA 4IQMA 2WVFA 1OQ3A 1PJ6A 2HGMA 3O8WA 4DQPA 4GMKA 5EN1A 3UDLA 1T03B 5IQQA 1U0HB 5HJXA 4ECSA 4ZVUB 1TL1A 2PT0A 1GMUA 2CQ0A 4NASA 3MM5B 1TK8A 1SH2A 2XMMA 3TZZA 1UZDA 1C0TA 4YDXA 1RBOB 4Y34A 3EMTA 4KT0C 5DQHA 3T1HJ 1RWKB 2ASYA 1FK9B 1QAYA 2R2SA 2AJ2A 3I96A 3H20A 3QZ7A 1Q16B 4JI5F 2VU5A 4ID5B 5IXUA 5DLFA 4LR9A 1JXLA 5HMXA 2OAUA 2IJFA 4DUTA 2CFXA 3MMJA 2OPQB 4LF8F 4N76A 1F0XA 4OX8A 1W2BR 1VS3A 3C6TA 3W8PA 2HFZA 3KDNA 3MFHA 1EZZB 1KQGB 2PI4A 3W63A 3NGDA 1YBAA 1KTQA 3KLEB 4ICLB 5C24A 2WAQD 4B9TA 3VGSA 2LA6A 3A4TA 4HHJA 4RKUC 3EPIA 1VQNS 2Z30B 4WU3A 3QO9A 1C1CA 3CMQA 4PWWA 2VD3A 3W5XA 1KOHA 1R8HA 3CD6S 2F4FA 2ZWPA 4ZVFA 4Y6IA 3FMWA 5LXRA 4XO0A 1U1OA 3GSDA 4IYQA 5GAGU 3HF5A 3ZFVA 2FVPA 2M88A 3LP1A 3K2YA 3F44A 3SDEB 1JJHA 2FGOA 1HKAA 2DNLA 1WC3A 6FD1A 2DY1A 3FC9A 3EVWA 4OI0A 5HL7Q 4V19J 1PIEA 2C2OB 4MKYA 3I31A 3MM8A 1JXVA 2JEFA 4TXSA 1FE0A 1VLOA 2AJQA 2UU9F 1RAJA 4WZQA 1RTJB 3ELHA 4K4TA 1HQEB 4D3HA 1RT1A 2FJAB 4QQBA 4NLPA 2KHCA 4NXMF 2LDIA 2NXEA 1HR0F 2KDOA 3AOAA 4QU7A 2XZDB 3IM9A 3R7BB 2YWEA 1U26A 4F0KA 3M32A 3BO4A 3UD3P 1YGYA 4F02A 5I42A 2YWGA 2V8DA 5BR8F 4DV7F 1V5VA 1WTFA 3O3LA 4Z2XA 4OJ1A 1FRHA 1AUDA 1YG0A 5M2UA 1ZZNA 3HFZB 3JB9k 1Q53A 1YZ7A 3W61A 4OI4A 2FHOB 3WIUA 2Q6CA 2GMHA 3PG9A 2WB1D 2A10A 4OYMA 4DF8A 3CCMS 3BGLA 2J6UA 2IRUA 3AB2B 2AQ4A 2BOPA 3M30A 4K0KF 5A0YB 3V5RA 2GO8A 1OYEA 1Q95G 4KO0A 4ZA1A 2H9ZA 1SC1B 1FJ7A 4UQTA 2FD2A 5BXIA 4A8KA 2HG4A 1UVMA 1D0EA 3CDEA 4X62F 2ZM6J 5AJ3F 4L6V3 2MZTA 2A6OA 7AT1B 2J0QD 3EGWB 1RACB 2J9DA 4I2PB 2AJ4A 4WP3A 3T19A 3AOBA 4X4NA 4F8RA 4H4OB 2AJ0A 3M9MB 2NXJA 2ERRA 4U7CA 4DV6F 2I6WA 2AT1B 4KPCA 2M3DA 2XNRA 2N3OA 1RLDA 5GAHU 5DDRC 2DKOB 2NXUA 1Y10A 1RWPB 1KTVA 1FJEB 4I4BA 2VFTA 2MSTA 4YR3A 4Y2AA 2VG7A 1DFDA 1U6FA 3KJVB 5IOLA 1HMVB 3J7AN 1FD2A 2J8AA 4CTAB 5L39A 5KFJA 1W25A 1J5OA 3HJFA 3GIJA 4C11A 4I2QA 1S6PA 5KFHA 3HZGA 3MEDA 3CXCR 2DR5A 1NDKA 4X2BA 2FVQA 3P4UB 3T5JA 2XM3A 1DJ0A 1UVNA 3V6KA 4RW8A 2UVUA 2GMLA 3TYTA 4M5LA 1NPKA 4CO4A 3W2WA 3J7YI 2CQDA 1E6YA 1FX4A 4CH7A 4RR5A 4ECQA 3UDCA 4ZPVR 4ZHRB 4F4XA 1S1VA 3KDOA 2UVWA 3FBFA 4NA3A 5FJ4A 2PGCA 2K1RB 2V4JA 5D3GA 5B0BA 3DU6A 1MMLA 1FJGJ 2EVZA 4ZPAA 3WC0A 2K7JA 2F9JA 3DLKA 2YKNA 1VRUB 3ILOA 1WC4A 1HI0P 4K4SA 3I5CA 3EM1A 3IFEA 3IRWP 1H38A 5HQMA 2OPSA 3P45B 5EDWA 3L7PA 5I3UB 1S1UA 2ZITA 2KRBA 2R2TA 3M8RA 4JV5F 1RZMA 1SCJB 2JZ5A 2X3DA 2CNOB 2HBZB 1RB0A 1UWAA 3DYAB 2B9EA 4IRDA 1DLOB 4YB5A 1FKOA 3M2RB 5LSLA 2WRMA 4M5HA 3C15A 4PRFA 3W64A 4FYYB 5B08A 4USKA 4WXWA 2CG8A 3MM9B 2QG9B 2KYZA 3X3UA 2B3TB 2OIHA 1N88A 1F2GA 1HBNA 2CVEA 2DEIA 4KRWA 4C9DA 2R7QA 4I6AA 2HWIA 1S9EB 3NWGA 1S1WA 1X4EA 3HFKA 4GKJJ 1TK0A 3M8WA 5E2QA 3DRYA 4KV8A 2MKJA 2QYGA 2DYAA 2Z56B 2YVSA 1RAFB 4JYAF 1TL5A 4HDGA 4GC7A 1RABB 3G96A 3DLEB 1HPZA 1T02A 2IM0A 8ATCB 1K8AT 2K3KA 3MM7B 2HQCA 4BWJA 3VGUA 1NRKA 4YB1P 1UFWA 4F0HA 2IA6A 3BGRB 4UOFA 1FKAF 1IKWB 2MEWA 2QE5A 1NK6A 1HNZF 3QSIA 1APSA 1FERA 2KFYA 1NLKL 4NLOA 2PMWA 3B82A 1S1XB 5M2PA 1QE1B 2B5JB 2OJ3A 2G9OA 2H5IB 1H74A 2PE8A 2YX1A 1F9EB 1VJWA 3GYXB 3W2VB 4LF2A 3SV4A 2DB1A 1BHNA 1NO8A 1KFSA 4Y3CA 1FFGB 2UXDF 4PYAA 1JLEA 1Y0HA 4LUBA 1Y3KA 3C19A 2QEXS 4BBYA 2RQ4A 3FZ2A 3GR1A 2DHHA 2A6MA 4I67A 4OV1A 2JC0A 1NU4A 3OR2B 2L9DA 4UY8T 1IQTA 4H4KC 2DNMA 3THTA 3BDPA 2VOPA 2MDAA 2DH7A 2CRLA 2CNLB 4KGXB 4DQRA 3A1YG 5KT4A 1UJ6A 3D9BA 1UWBB 4KFBA 2HHHJ 2FZCB 1KHWA 2N3LA 2XSFA 4JI4F 1PKUA 1NBEB 2XMKA 4OZ5A 2WBMA 2OLWA 2RH3A 3KLHA 3OFEA 4MYUA 1WKJA 2V50A 3MI7X 2BJEA 2CXEA 4TN2A 4A8XA 4M5JA 1A6LA 4DR7F 4P10A 3PKYA 4DL0C 4NA2A 4RW7A 2MHNA 2BXJA 3RW6A 5H9FJ 5KG7A 3J7Z5 3WX8A 3J81Y 1CQNA 4DQIA 4DV1F 3FEYB 1JXEA 3QT7A 2C3PA 4ZP6A 2ZH4A 2CA9A 2K3IA 1MROB 5KOWA 4NLYA 3Q2SC 3A8IA 4LSLB 4RUBA 1UETA 4USMA 1V9OA 3PR4A 2MQLA 3H2UB 1TELA 1N32J 3DC2A 4YS2A 1JK9B 3H5XA 5J1PA 4IDKB 2K06A 3UDVA 4EYHB 3Q8UA 3ZC4A 1T9XA 1FT8A 1LW2A 5AXLA 3ETOA 5HSPA 1NK4A 3VV2B 1ZZFA 2MQQA 4G65A 4I6WA 2E29A 2B4UA 3EZUA 3F56A 5AT1B 1XBWA 5KFYA 1VIXA 1NKCA 1Y3JA 1V3ZA 3SFGA 4Q2MA 1I5OB 1BE4A 3UO0A 2UV8G 3TJ8A 4I1TA 4CLWA 4Y2CA 2CJKA 1SQFA 4MK9A 5ETQA 3NBPA 3I6PA 3D1QA 1JKHA 1HHSA 1PAEX 3SSQA 1QLNA 5KFCA 1VCTA 1RT2B 2VL1A 2Y9HA 3FJ2A 5J2NB 4X64F 3H5YA 1SH0A 1FK9A 5BYQA 1G2EA 4DF4A 2HFOA 3GP9A 2QL5B 5K5MA 3DXBA 1A9NB 2AEJA 2BX6A 4A8SA 3PY8A 4QU6A 1UVJA 3V6JA 4FBUA 2DNZA 3FMBA 1Q5YA 1N34J 1R7IA 2LXFA 2EPIA 2I2YA 1FRLA 2XMJA 1JLAA 2FZGB 3U1MA 4NCBA 2XGPA 4J5OA 3OFFA 4LQ3A 3M8ZA 4CRJA 4ZIVA 5CZVA 4LR7A 3D6HB 2BJDA 4JI6F 1U09A 3TNVA 2KRRA 1EP4B 1ZA2B 5F8JA 2Z58B 2QA1A 4ZDNA 2EEYA 1VC6A 2XO7A 3OTEA 1U1QA 2G0CA 4RNOA 1UKUA 3RG6A 2V34A 5AE2A 2QV6A 3KWMA 4R8UB 5C5JA 2W2PP 1IBKF 1IM4A 3VAJA 1RYRA 4IFVB 4DUYF 1LK7A 1FWKA 1QY7A 3L3CA 2AIRB 4EO6A 1NUEA 4UQGA 1FHTA 4DZDA 3EXYA 1H2UX 4EO8A 2R7XA 5K8PA 5CYMA 2XMAA 4ECXA 2ZUAA 4GO7X 3AA9A 2MB0B 1E6VA 2WB4A 5L9NA 4EI2A 4B3RF 3C2PA 3LQVA 1OMSA 2FVSA 4ZLNA 3BBCA 4OYZA 2JH3A 4USHA 1HQEA 1S48A 3SXLA 1HD1A 4OX9F 4F04B 2JC1A 1JLBA 2GZOA 3OW2R 3MEKA 5HBMA 1FKPA 1T05B 4JI0J 1N36F 4ZVGA 3MCOA 4ELUA 2GIQA 1IBCB 1LFPA 1TV6B 3CD0A 3ZTPA 3RR8A 1BD6A 1JB0C 4QW9A 1I94J 4ZPBA 1S76D 2HNZB 2XYHB 2YNFB 1MN9A 1YJRA 5IZHA 3OSPA 2CQPA 3CT9A 4IH6A 4P74A 2V2KA 4GVLA 5EUHA 5A0YA 4I0WA 1SJ4P 2CVIA 2RB7A 2ILYA 4ZVQB 1JLFA 2QLWA 1RJJA 3P8BB 1KVKA 3CCJS 4TVAB 2QN6B 1EETB 2E66A 4LBIA 4Y28C 2F3JA 1D3WA 4Y0FA 3H2LA 3UNYA 4WYLA 3J80Y 2DIVA 4F4KA 6FDRA 2HVDA 5AE1A 4X66F 3KHLA 4C6AA 1BGXT 3TA0A 2BR0A 3FQLA 2HVHA 2R7SA 4U67Q 4NYZA 1J5EJ 2OH2A 3TOQA 3IMQJ 5HO4A 1AA1B 3GIIA 1CG2A 1TFWA 3VHQA 1CBKA 1S97A 2HFSA 2QMUB 2QLBB 2AYEA 2EK1A 4QIVA 2OFGX 1Y11A 5L8RC 4X65J 3SI8A 1S59A 1Q81T 2BM1A 4LVOP 1UFKA 4CTAA 3KK3B 2VQEJ 2DGQA 4DU7A 3FEZA 3MGJA 5J1NA 5T7LB 3BQ1A 1OS5A 2Z2MA 2I38A 3QGIA 2MKIA 1H6KX 3ZZOA 5EWFA 5ETTA 3CDUA 4X4QA 2VICA 1LOUA 2ZOGA 3Q8SB 3MOZA 4YHHF 3OBIA 1ULRA 2VC0A 2DGUA 1R0AB 3R5CA 5D78A 3QRQA 3MZIA 3UE2A 2UXCF 3HJVA 3ISNC 3VVTA 5B0EA 3KLFA 3NGUA 5LMNJ 3HXMA 3OLAA 2AYMA 3SCLE 3ADAC 1ZA1B 2IJNA 3MMAB 3UI3A 4M5DB 1HHTP 1FWLA 1VRUA 2JDJA 2R2UA 4C97A 3MEGA 4OYIA 5GMEA 5I3UA 3AJDA 1RWMB 2XWYA 3KJFB 3MR3A 4OMFG 2MGZA 2DPJA 1IKXB 1PJ7A 3ET6B 4C8MA 2RIJA 3BF4A 2M52A 3BKUA 2XY6A 4DV0J 2CIMA 4DSJA 2BV3A 3PJXA 3DYAA 1WC1A 4O0NA 4PWDA 1NZ8A 4JV1A 3IWLA 5ITHA 1GMVA 2FJVA 3OR1B 4DV2J 4LBHA 3M6UA 2V4RA 2XZWA 3MM9A 5H1SV 2E5IA 4OX7A 1HNIB 1X9WA 4WK1A 2J9CA 4DCPB 3C6UB 4DR1J 2XMUA 4O3OA 1R6VA 2JOQA 3R97A 4DR5J 1S5ZA 2E5GA 3IC1A 3EJMA 5HQ8A 4DEZA 2XNQA 2PFFB 4C3LA 3TVKA 4WKRA 3S1TA 3M2UB 4OL8A 1X31C 3ZZ0A 2O01C 3HHLD 2HK2A 1Q78A 2YNGA 3S6EA 5KT7A 3RBXA 5J1EA 4OJHA 3B54A 4Q44A 5A6WA 2WSFC 2MY8A 4K50A 2F5GA 4EUVA 2QX0A 5A8KB 3CB4A 1KONA 5JVHQ 1M0SA 3BGUA 1TUWA 2PI5A 2B4VA 2J9EA 3GFHA 5KFVA 2X7IA 2W2QP 3TWZA 3G8SA 2B4OA 4IG3B 4KH0B 1IBLJ 4Q7AA 2KU7A 5E3CA 2QFJA 5DRKA 3D0HE 2BANB 2EG1A 4Y2KA 1NK5A 1OY6A 2J6TA 4FYDA 5AXKA 2DHSA 2COLA 1U6ZA 3TVZA 2XY7A 2FLPA 3AJ2A 5HN0A 2ZH5A 3KLGB 2JVRA 4WFXA 3N4WA 2B5JA 3PTWA 4EEYA 5E5NA 1VQ4S 4OI3A 3PCOB 2KTQA 2VOOA 1B0TA 5H9EK 3TR5A 3CIZA 1U2FA 4CLPA 5SZTA 2EW9A 4WE1A 4ELVA 2L3MA 4MIBA 5EWGA 2HKEA 2UUBJ 3AJ1A 3GMGA 2KG1A 1IJFB 1GMWD 1T3OA 5A8WB 1RT3A 1B4SA 3W65A 4FXWA 2WONA 1S7HA 4IQXA 5G0RA 2HK3A 2L41A 2W7OA 4LF9J 2V8VA 4LF6J 2AYGA
chains in the Genus database with same CATH topology
3WC2A 2KFZA 3LWMA 4NOHA 3IG1B 3BR8A 2BYCA 1WWHA 4AQYF 4J9LA 2CQ3A 4EWTA 3QGGA 2MHEA 3SMZA 3IR5B 4RNMA 4QWDA 1PC5A 3CCLS 1SL0A 3KLFB 2Q66A 2XC9A 4Q45A 1HW8A 1H2VZ 5A8RB 4J9KA 3BB5A 2R8IA 2AD9A 1WEYA 5FIIA 2D74B 4ILMA 1HBUA 2DCUB 1QVGR 3Q8RB 1FRMA 4I56A 3K5MA 1PC4A 5DLGA 1LQ9A 3IGVA 5E33A 1NH7A 4Q2LA 4OZ1A 5L38A 5D3GA 4WCEQ 2FHJD 3NKYA 1X0FA 5SUHA 1RTJA 1H3DA 2JHEA 2AGOA 4JUZA 4KJIA 2MKKA 4RZRA 2NPFA 1KHVA 3MEGB 4RW7B 3X1LB 4IFYA 3E8OA 2C3MA 3V4IB 4IR1A 1LW0B 1LFWA 4NLDA 3IGNA 3CMAS 1QSLA 2M70A 3PJWA 2YKMA 2XGQA 2MGZB 2LQ5A 4I64A 1LK5A 1TR0A 2K7KA 3HT3A 2Z8QA 3DRXA 3HHLA 2FHMA 2V9KA 5K8OA 3M1VA 2ALZA 3EX7B 4ID8A 3BJYA 1MU2B 3GV8B 4RBTA 2RILA 1BQXA 4R0EA 3L7OA 2ASDA 3D0IE 3DLGB 4MK8A 2CPIA 4WFZA 1XNQF 3CCES 3HK2A 1G3OA 1SI9A 4U9RA 2HRUA 3OL8A 2HPUA 1NJYA 1BQMB 2GV1A 2YTCA 3MMCA 1T7PA 4C7QA 1LKZA 1UJ5A 2GHWA 1N5SA 4F3MA 1BY9A 3T9NA 3MR6A 3AY0A 4XDDA 3GWCA 1F5BA 3O6QA 3NG8A 2AX1A 2IA0A 4WIIA 4PWDB 3HVTA 4O23A 5EHHA 5KFAA 2ABYA 3T5KA 4CCHA 3OXGA 5BYRA 1K0VA 3LP2A 2DGWA 1X5OA 1PILA 4PQUA 1REVB 1JLGB 2CPXA 2AJFE 4MAKA 3K5PA 3ITHA 1U47A 1N5YA 5LT5A 4TY8B 3M8QB 4P6QA 2W24A 2RU3A 3KG0A 2UZAA 1TFYA 3EGZA 3MAHA 2HW3A 1HWLA 2MQMA 2B7CB 3MPVA 4B9LA 2FC8A 4BCAA 1FE4A 1FRJA 3I4HX 4DL6A 2HWHA 2J9DE 2R7RA 2VPWB 2GQ2A 1LXNA 4IOCQ 1RP5A 2DRAA 4FNHA 4C8KA 4P7TA 4Q43A 1RT6B 1X4GA 2V4QA 4FF4A 4DWIA 2R9LA 3ZZUA 3RAQA 3B8HA 3QGPA 3NCPA 1HBOB 2CJQA 4QR0A 3JYTB 2NS1B 5IM0B 4NZ7A 3BSOA 3HI9A 4FF2A 4ZOSA 3QWUA 2O5DA 2B7BB 2JL9A 2Z0GA 2GGPB 4LSLA 5CZXA 3CCVS 1TL3A 2YKQA 3DGPA 1U4BA 3NMAA 3MPWA 3R5BA 3KNGA 4ES1A 3Q23A 4C0BA 4IQMA 5J2MB 3BO2A 1GTEA 1Y7PA 2OSQA 1OQ3A 2HGMA 3O8WA 4DQPA 4GMKA 1RT4A 3GE9A 2VFRA 2YNGB 4KHPF 5EN1A 2L9WA 4IDKA 3UDLA 1Q79A 1TZ0A 5IQQA 5J1EB 2JX2A 2V94A 1T03B 4Q0BA 3SCJE 2LECA 4IRCA 3CCZA 2N7CA 2ZH6A 4ECSA 2ZM6F 1TL1A 4HLBA 4F4WA 1L3TA 2KB2A 2KXFA 2PT0A 4WJBA 2CQ0A 4IG0A 4B9VA 3MM5B 2E7XA 1TK8A 1BLUA 2CQ2A 3QIDA 3UNGC 2QA4S 4URSA 1SH2A 1U6BA 2XMMA 3R27A 4AXJA 2BACA 3MTKA 1C0TA 4YDXA 2PEHA 3DOKA 2B0GA 1PSDA 4YP3A 4RLEA 4NLTA 1SJ1A 2JLGA 2FJEB 4YFUA 4I2PA 3DOLB 5CYQB 4Y34A 4IH5A 4FPRA 2IVYA 5MAOA 3FRZA 3H40A 4KT0C 4HKQA 2HNDA 3WX4A 4NZ0A 4KAIA 3CD5A 5DQHA 1S0VA 3I0RA 2UUTA 4WTYA 2IHR1 3F73A 2ASYA 3V4MA 4C0OC 1FK9B 2A1BA 1QAYA 2GMJA 2R2SA 4H4OA 5GVQA 4DFKA 4YB7A 3I96A 1FCAA 4PPDA 3H20A 3QZ7A 1C4CA 3C8YA 1Q16B 4MJKA 4JI5F 2DNQA 2BA9A 3M8PA 5KFKA 4ID5B 2KVIA 1XERA 2VFSA 3A8EA 5HMWA 5IXUA 4XIUA 3HVRA 4MIAA 5DLFA 4RNNA 5KG1A 4C8NA 2R8JA 1UA0A 1JXLA 4NWBA 5HMXA 1KLMB 5KFZA 1I6JA 3H8YA 1HQUA 2D9PA 4R0JA 5F9NA 1XMBA 1N33F 2OAUA 2IJFA 5E3AA 3PX4A 2ZKUA 4IO9Q 3L95X 2CFXA 4PKDB 3MMJA 2OPQB 5J2PA 3TUZC 4O3RA 2W4DA 3LW5C 4RUCA 3OHAA 2RJZA 4LF8F 2RSQA 3UCZP 4X4PA 4N76A 1K1QA 1Q86T 2FUG9 1F60B 1MWYA 2AF6A 5J2NA 1F0XA 1WACA 4OX8A 1W2BR 1RTDB 1VS3A 2JEGA 2VQFF 3DHXA 4DL2A 1FNMA 3VF0B 3C6TA 2PO4A 2B43A 2HFZA 3MFHA 2J7WA 1L3SA 3I5BA 1HBMB 4QIWD 1KQGB 1ZETA 3H5UA 2PI4A 1LV5A 2FLLA 2V9WA 3NGDA 1YBAA 1KTQA 3KLEB 2KZZA 4ICLB 2VFUA 5C24A 4NYPA 1L5UA 3KJVA 4WE1B 3DDNA 3DLLQ 2WAQD 5GMKa 5E0OA 4B9TA 1C0UA 2FHJA 5D6GA 1M5KC 2DR9A 1VQ7S 2IMWP 1HMVA 3LP0A 1M1KT 1S1TB 2BDPA 4ZCIA 4QWAA 1AROP 2DVIA 2LA6A 1Z2LA 3T1AA 4K0KF 4HHJA 4RKUC 3EPIA 1VQNS 4KQZA 2YKPA 4WU3A 3QO9A 1C1CA 3OPKA 2CPZA 2VD3A 4I7FB 3D1OA 3CWJA 4PWUA 1KOHA 1R8HA 4H54A 1RT3B 4QPTA 3TUJC 4ES3A 3CD6S 5E3QA 4DR6F 4ZVFA 4Y6IA 2WONB 1KLNA 3FMWA 3QJJA 3V81B 1NEEA 5F8MA 5LXRA 4XO0A 5D4PA 3WDOA 1U1OA 3OVBA 2LDYA 3LOUA 1DURA 2PN6A 2JEJA 5G0RB 3I32A 3PFEA 1SJ3P 3GSDA 4IYQA 5GAGU 2GX8A 3MECB 3O5TB 3HF5A 3PDNA 3ZFVA 4DBQA 2M88A 3LP1A 2FVPA 3HPOA 3K2YA 4LVNP 3F44A 3SDEB 4YR2A 2JLEA 3FCHA 3F41A 2PMHA 4XK8C 1JJHA 3NS6A 1VQOS 2V5HG 3B78A 2FGOA 5D4LA 4DL4A 2DNLA 2EFQA 5B7WA 1RGVA 6FD1A 2B4PA 2ZH7A 2F1FA 2ZNZA 4B08A 4OI0A 1M5OC 2OD6A 2NYIA 5HL7Q 4V19J 5E3RA 1P9QC 1CSJA 2YKOA 1HA1A 2QSWA 4MKBA 5EX3A 4ZHRA 2B56A 4MKYA 3I31A 4C0HA 3MM8A 3DLBA 3CSKA 2JEFA 2ILZA 3I4PA 4A46A 1Q8LA 5I3PA 4UUXA 4ECZA 4TXSA 2K1RA 1VLYA 3MUVP 1FE0A 1FJGF 2AJQA 2CQGA 3FZBA 1S79A 3RTVA 2UU9F 1RAJA 1SC6A 4ECWA 3FEXB 2MKSA 2F8EX 4MH8A 4KGKA 4DLGA 1J2VA 4WZQA 1RTJB 4NMLA 1L3VA 5F41A 2ZC4A 2DNHA 1WG4A 4K4TA 1R43A 4IFYB 1HQEB 2ZNYA 3CEDA 1RT1A 3ZZPA 4D3HA 4Q8FA 4IRKA 2FJAB 4QQBA 4RUAA 1QAIA 3KKFA 3TRGA 2HRYA 4NLPA 2EFNA 2KHCA 2N4DA 4NXMF 1KFDA 2LDIA 2U1AA 3DI6A 2KDOA 1HR0F 1UP1A 2PSZA 3HHLB 2ZVSA 1JLCA 3M1VB 3OL7A 4QU7A 1H0HB 3PRBA 5F9LA 4I69A 2IVMA 5B09A 1FNOA 4PG4A 4U6PA 4OJ3A 2HMIA 2YH1A 4C3KA 5IT0A 3AAWB 3SCKE 3MMCB 1ROFA 4RU9A 3OQ2A 2YWEA 1U26A 3M2VB 4RUHA 3G86A 1CPZA 1N52B 3T6BA 3FSXA 5F3ZA 3TAMA 1C1BA 3M32A 2H5EA 3BO4A 1P27B 5KG5A 3UD3P 1YGYA 4F02A 5I42A 3CJ5A 2YWGA 5MLCV 2V8DA 4DL7A 5BR8F 3HVTB 2AU0A 2LU1A 3RRKA 4QOTA 4HEA9 4G1PA 3NRBA 4DV7F 1YI2S 2FHKA 2RQKA 4HTIA 4PQUB 1B64A 1WTFA 4NLGA 2FPHX 2M8DB 4DJBA 3O3LA 1DLOA 4Z2XA 4OJ1A 1FRHA 4YB6A 3ITHB 1AUDA 2IM3A 1YG0A 2E5HA 4Y00A 1WHYA 5M2UA 3NCRA 1ZZNA 1OQ6A 1S6OA 1V6HA 1SKWA 4O3SA 3M2RA 4J9RA 1KC8T 2E1MC 3JB9k 4FVCA 2VBWA 1Q53A 2HHUA 1HI1A 1R89A 2YX4A 4OI4A 5LSOA 2OMOA 2FHOB 2HIQA 3IAM9 1NB7A 1S6UA 3N6LA 3T6JA 3V6HA 2Q6CA 2GMHA 2WB1D 3BQ2A 2A10A 2MQNA 1RYSA 1OIAA 3JTPA 3D5MA 3BREA 5KFEA 4DF8A 3CJ0A 2GCFA 1R8BA 3BGLA 1ZM3A 3CCMS 5K8NA 2IVFB 2BE2A 1TL3B 2J6UA 2IRUA 1QVFR 3AB2B 2DH9A 5CA5A 3JSBA 3VAMA 2ZJPQ 2JVOA 2DNYA 2AQ4A 3M30A 5A0YB 4ZP8A 2MZRA 3K58A 4LJMA 3LALA 4NA1A 2VPZB 4P7VA 2GO8A 3V5RA 2FLNA 4GKJF 1RT4B 4LSNA 1S9EA 2DR8A 4KO0A 4ZA1A 5LJ3Y 2H9ZA 2RT3A 2OD4A 4F3QA 2DHXA 1FJ7A 4UQTA 3SSRA 3UQSA 2FD2A 2KJVA 4RW4A 3B4MA 3QZ8A 1DTTB 4A8KA 4OZLA 4NCGA 4MMOA 2HG4A 1TL1B 3UWTA 1Q82T 4KBIA 4LF7F 1DQ9A 1UVMA 1ZAXA 2YNFA 1D0EA 3CDEA 3P5TL 4X62F 2XLIA 2KI2A 1SL2A 5AJ3F 4ZP7A 4JV0A 4L6V3 2MZTA 4URQU 2J0QD 1UMJA 4LMZA 1C0TB 1WHXA 3EGWB 1HWIA 1RT7B 4DR3F 4IOAQ 2J9DA 4RW9B 2Y1RI 2DTJA 3K5LA 3MOJB 4I2PB 5KG4A 3R1LA 3DLEA 4FN5A 4QIEA 3FDSA 4CO3A 3SZ2A 2AJ4A 2RF2A 5AE3A 2LVWA 2W9BA 1KVJA 2XLJA 2P6TA 3I0RB 3MM7A 3T19A 2Q6BA 4X4NA 3PO5A 4G3IA 4F8RA 4H4OB 1LWEA 3LPYA 2BOPA 2LMIA 1UAWA 3TA2A 2AJ0A 2V8HA 3M9MB 2HHTA 1QUVA 4MTPA 3M8PB 2PMZD 4KGMA 5KG0A 2RKIA 4U7CA 2ERRA 1VBZA 5CHCB 2BM0A 5HP1B 5CH7B 1U2RA 3HKWA 5CQGA 4DV6F 3HDSA 4X4VA 5CYJA 1HQUB 3BGRA 4OQJA 2RUGA 1IKWA 3HP6A 3HLUA 2M3DA 4ED3A 2XNRA 1NNDA 2PC6A 7FDRA 3JSRA 2N3OA 1NJIT 5GAHU 2E1AA 3D54A 2XI3A 5DDRC 4B9SA 5GAGI 2NXUA 1TAUA 2D7SA 2KYXA 2D3ZA 2LYVA 3K59A 3CJ2A 1KTVA 5D77A 1RT5A 5DDPC 1FJEB 1X4HA 2E1RA 3I87A 4I4BA 2E7WA 3C6TB 1R3NA 5LXYA 1FTRA 4ED1A 2IAJA 4PXDA 4YUDA 4WFAQ 2VFTA 1ZPVA 1MWZA 2CPHA 2MSTA 4YR3A 4FVMA 3MEEB 4A8YA 3IS9A 3CCSS 1N54B 4Y2AA 2F8HA 2VG7A 2Z2LA 1DFDA 3CTRA 2IMOA 2N4CA 1J5EF 3KK2A 1LWCA 1U6FA 1S1XA 3DRPA 3KJVB 1QE1A 1Y00A 5IQ6A 2WSCC 3CJKA 3HHEA 2IM2A 1HMVB 3LP0B 1FD2A 1MMNA 2J8AA 2Q43A 4UOCA 4CTAB 2DH8A 4PPZA 1W25A 5L39A 5KFJA 4DR2F 4B17A 1J5OA 3HJFA 1KVIA 3GIJA 3IAS9 4C11A 4I2QA 1DAXA 1S6PA 3RAXA 2HZCA 4RX6A 3W2VA 5KFHA 3HZGA 1C1CB 2ZBCA 3MEDA 3CXCR 3G6YA 4TU9A 2DR5A 4F2RA 4X2BA 2HS4A 2FVQA 1JMTA 2KFNA 4OHVA 2KZMA 3T5JA 4C8ZA 3MCSA 4MFBA 3NAHA