1N5QA

Crystal structure of a monooxygenase from the gene actva-orf6 of streptomyces coelicolor in complex with dehydrated sancycline
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
112
structure length
112
Chain Sequence
AEVNDPRVGFVAVVTFPVDGPATQHKLVELATGGVQEWIREVPGFLSATYHASTDGTAVVNYAQWESEQAYRVNFGADPRSAELREALSSLPGLMGPPKAVFMTPRGAILPS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The structure of ActVA-Orf6, a novel type of monooxygenase involved in actinorhodin biosynthesis
pubmed doi rcsb
source organism Streptomyces coelicolor
molecule tags Oxidoreductase
molecule keywords ActaVA-Orf6 monooxygenase
total genus 28
structure length 112
sequence length 112
chains with identical sequence B
ec nomenclature
pdb deposition date 2002-11-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03992 ABM Antibiotic biosynthesis monooxygenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.100 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1n5qA00
2XMMA 3WDOA 1U7LA 2XMJA 2K7KA 2GCFA 1S6UA 5B09A 3IWXA 5B0GA 1WD6A 1RJJA 1P6TA 5B0AA 2FTRA 1X8DA 2XMWA 1N5QA 3HF5A 2K2PA 3TOQA 3F44A 2BJEA 5F0UA 3GZ7A 2RILA 2OFGX 1CC7A 4OJ3A 2XMVA 3IWLA 1OQ3A 2GA7A 1VQSA 2BJDA 4Y2MA 4YEAA 2W4PA 2ZDOA 3HFKA 2XMUA 3KNGA 3KG0A 2FIUA 5IXUA 1X7VA 2HIQA 2GGPA 3BN7A 1S6OA 1MWZA 2HFOA 2ROEA 5B0CA 1TL4A 2ACYA 1YG0A 3MCSA 3HHLA 5A6WA 2ROGA 2AW0A 3TNVA 4A48A 3VTIA 2AJ1A 4YDXA 3HDSA 2N7YA 2XMKA 1AW0A 1KQKA 4OJ1A 1KVIA 2RSQA 4ZOSA 5B0EA 1QUPA 1FD8A 3I9ZA 3HX9A 1URRA 1N5VA 3FGVA 2OMOA 2KT2A 5A6PA 1YRXA 1OQ6A 1N5SA 2OD6A 1ULRA 3UDCA 5B0DA 1XBWA 2EW9A 2G9OA 1TR0A 1N5TA 1V3ZA 3BDEA 1JK9B 3K7RA 2KYZA 2ASYA 1Y0HA 5K9FA 4A46A 1Q8LA 2HLTA 4HI2A 2IYIA 3MZIA 4Y2KA 3HHLC 4EFAC 2LDIA 2N4CA 4Y2IA 3FRYA 3BGUA 2GGPB 4ZA1A 4HH0A 2CRLA 5B0FA 1JWWA 2QLWA 1W2IA 1VQYA 1P8GA 2HFNA 1FE0A 2L3MA 3HHLB 2OP5A 3FMBA 2OAUA 1YJTA 3BF4A 1SI9A 3KKFA 4OJHA 2HQIA 1SQEA 2LQBA 4DL0C 3LO3A 3HHLD 4HI1A 4OJGA 1TZ0A 4DPOA 3DXSX 1FEEA 3BR8A 1Y3JA 1OPZA 5B0BA 2GO8A 1CPZA 2FB0A 2VV5A 1FVSA 2FHMA 1KVJA 4Q2MA 2N4DA 1TL5A 2IFXA 5KAKA 2PGCA 1APSA 4A4JA 2W4CA 4NL5A 1YJVA 1K0VA 2JDJA 1Q8BA 4HH1A 1X0PA 4DN9A 3CJKA 2BUNA 2Q3PA 3QGPA 3TRGA 5B08A 4QOTA 4NPOA 2LQ9A 5T7LB 2QIFA 2KT3A 1CC8A 2LXFA 2OD4A 2PD1A 1FE4A 2GV1A 2K1RB 1LQ9A 2BYCA 2QLXA 1YJUA 3LGMA 3QMQA 4Q2LA 5F0WA 3T9NA 1Y9OA 1FESA 2K1RA 1YJRA 1Y3KA 3E8OA 2IYGA 1IUJA 1GXTA 4HL9A 2K7JA 2OKQA 4OIXA 4U9RA 1Q4RA 2ROPA 4FNIA 2HLUA 1GXUA 3BB5A 1AFJA 4F67A 2KKHA 2QYCA 3KG1A 1MWYA 3LGNA 3CJKB 4A47A 2AJ0A 2RMLA 2BBEA 2OFHX 1Q53A 1R6YA 2W4DA 2ZDPA 1OSDA 1TUVA 2VH7A 2XMTA 3DCAA 1FVQA 2GFFA 5T7LA 2RU9A 4FNHA 3BM7A 2AP6A 1SB6A 1AFIA
chains in the Genus database with same CATH superfamily
3W2VA 1U7LA 4DQQA 4QCLA 1L3UA 1O5JA 2NPFA 3TO8A 3UN2A 4V19J 4B3RF 2V69A 5B0AA 4KO0B 3GFZA 2IM3A 2C3UA 3TI0A 2HQGA 2Y0SD 5F9NA 1TMMA 1U02A 2HAFA 3THTA 3V6KA 1TP7A 4GO5X 4O3PA 4Y28C 3GQCA 2QA4S 4NI2B 1XIQA 3GP9A 3MDFA 4I64A 1OIAA 2OSQA 2R7VA 4OHZA 2YNFB 3TYTA 2APOA 4A8YA 4MK7A 4DSEA 1CJVA 8RUCA 2AJ2A 4C8MA 4DBQA 3EXYA 1RAJA 2AJ1A 2IMOA 2Q43A 4Y65A 5K8OA 2WK4A 5HO4A 1T9UA 2B9EA 2CG4A 2YNGA 1F2GA 3LGHA 4GVBA 2M52A 3R5AA 3VAMA 3M8SA 1F5AA 3BBFA 2UUCJ 2OD6A 3IBFB 4LIRA 4J9OA 1KRPA 1XK8A 2YKNA 3H42A 4NLXA 5EX0A 3RJMB 4KGKA 4DN0A 2YH1A 2HHHF 4ETZA 5KG7A 1QE1A 3VWSA 1RWUA 2HFUA 2NUUG 1RBAA 3ENWA 3CCQS 4WFAQ 1NJYA 3CCTA 1FWKA 4ZP6A 1HQEA 3I82A 1RKIA 1U0SA 1KN6A 2WVFA 1TKZB 2PIIA 1S10A 1KTQA 4O0IA 2VONA 4GVBB 1YJ9S 3IN5A 3JYTB 2OELA 4KQZA 4OYAA 3HVRA 4WKRA 1KVKA 2ZVSA 2WVEA 2YQ0A 4C0OC 3SMZA 2CRLA 4DQRA 1RHKB 4A8SA 1WSVA 2RB7A 2DHSA 1F9HA 2DO0A 5K8NA 1D9FA 3HHLB 1WTFA 3FFIA 1MROB 3FMBA 1RI7A 5KFBA 4XK8C 1KD1T 3NOGA 1N4LA 2HNYA 3D1HA 4JI8F 2P5VA 3UE2A 3DLHA 1F5CA 1G7CB 3DN9A 4NCGB 3LO3A 3HHLD 2UXDF 4LFBF 3WQPA 4C9DA 3HULA 3EJMA 3PYDA 3MR6A 1EKRA 3MPDA 1HD1A 3M1VA 2ABYA 4LF6J 3N6NA 2ZJPQ 2A2CA 1ITPA 1SIZA 1SV5A 3AXMA 4M5HA 1SKWA 3EICA 3H59A 2CKWA 4USKA 4O4GB 4MMOA 3C16A 2FJXA 1APSA 3QGGA 1FJEB 2VZ9A 1GK8A 2WHOA 3K5NA 3LP1A 3DLLQ 2JDJA 3MPYA 4F02A 2BABA 3QAEA 3DM2B 1FXRA 2FVPA 4QOTA 2XY7A 1QTMA 4FS2A 3L9ZA 2CPDA 3W65A 3W63A 3IA0A 2VBXA 3D68A 4YB5A 4BBYA 5J1EB 3V6JA 5U47A 3LWLA 2PD1A 1BE4A 2UXBJ 2AGOA 1LV5A 2WZ1A 2J6TA 2MQQA 1T9XA 2H5JB 3C19A 3V4IB 5KFVA 3D3BJ 2R7OA 4RWWA 4YR0A 2CQDA 4KYZA 3CSKA 3E8OA 1NH7A 2DYAA 4USJC 3T1HF 1P27B 1PJ7A 2MSTA 5DJBA 1AT1B 3M2RA 5K8MA 5D4OA 3BB5A 4YY3J 4WTOB 1KHWA 4E98A 2Y8YA 2HS0A 3CDBA 2E1AA 1R0CB 1MU2B 1SJ4P 2CPYA 1UMJA 2BVZA 2DPIA 2NYHA 2QLJB 3VAJA 1P1TA 4Y2IA 4N8NA 4CI0B 1NJIT 1AFIA 4QBUA 4RO0A 1N33F 4CLTA 2FC9A 2GNKA 1JLAB 3TVZA 5FLXY 3OJSA 1U1NA 1ZM9A 3D0GE 3GE9A 5J2MA 1IJEB 1IBKF 4FPIA 1G1XA 4FF2A 3MR2A 1EAYC 5B0GA 2NR0A 3SCJE 4F26A 4OZ0A 2OI2A 2VG5A 2E5LF 2WAQD 1YTYA 2GJFA 2DH9A 3GIRA 2C2KB 3UNGC 5H9EJ 5IOLA 1HNZF 3MEGB 5CXTA 1HYSB 3OLBA 3SV3A 3SQGB 3RZAA 1VJQA 2W4PA 2BA9A 2YNIA 5CYQB 1HMVA 2CA9A 4PUOB 2IY5B 1G4CA 4WP3A 5THWA 5A2QU 3EDRB 1S9EB 4OYXA 3NGKA 3CT9A 1K47A 2EFOA 2MJNA 2CQBA 3GFXA 1V3SA 3MMAA 3NKYA 3CUNA 4BCAA 2IC3A 1PGZA 2HGNA 1RA7A 1PIEA 2A10A 1XR7A 2ZHOA 3IGVA 3IS9A 3JQKA 1IN0A 1DTTB 1JLGB 1J5EF 3M9MB 2IIHA 3V4IA 4QR1A 1U2FA 2HHWA 5JMNA 4JOUA 1QUPA 3GCWP 5CA5A 3HM9A 4URQU 3TZXA 4HLBA 4WFXA 1Q86T 2JEJA 2UVVA 1U45A 2D7SA 2J0QD 2EK6A 1HWJA 3SXLA 4ZKAA 4U7CA 5KFCA 3PIPQ 5J2PB 3EGVA 3OLAA 2E9TA 3GV7B 1RYSA 2YKAA 3CO0P 5D0RA 3RBXA 2KYZA 3GMGA 4M63A 3KOAA 1RK8A 3R5JB 2Z58B 3C6UA 1FEHA 1LWCB 3DHXA 1NPKA 5GAHU 2IHR1 2QA4G 2QRRA 4KPYA 4EFAC 4ALZA 2ASJA 2GJ2A 4ZCLA 3FRYA 5F9LA 2HQFA 1Q5YA 2LKZA 3I6PA 4F36A 1RCXB 2C2NA 4USTA 5I3PA 4C7QA 2J76E 1FRKA 4WFZA 2KG1A 1KFDA 4F3QA 4O3SA 3V81A 4B3OB 2CYYA 3FSYA 5HVFA 1EX8A 5KFPA 1EARA 2RKIB 2AGQA 4IG3A 1S0MA 3V6DB 2DITA 4TKTA 3RB4A 1EQMA 4HI1A 1IKYB 1YGYA 2LEBA 1N0VC 2OPSA 2P2CB 3E3XA 1RCOB 1S1VA 2CVEA 2V5HG 3MMCB 1M1GA 2UUTA 1FTRA 1M5VC 4QU6A 2RF2B 2OIHA 3I4HX 1Y10A 1UJ4A 2DRAA 5IV4A 4LR7A 3IRXB 3DLJA 4NZ0A 5C24A 1VQKS 2WSFC 4W92B 4CZCA 1VIOA 3PG9A 5K14A 3AJ2A 3QIPA 5FIIA 5A8KA 1Q7YT 1Q8BA 3ILOA 2JLFA 4U96A 4DV4J 3MAHA 2VQFF 1UVNA 5L46A 2BMBA 2KN4A 4KGMA 1Q7LB 2WB1D 3MTKA 1Q78A 4DQIA 2HHTA 2PA3A 3PM9A 2HS4A 4AL7A 2GVZA 3CD7A 2JHEA 4RU9A 4DSKA 2ERRA 4ZJOA 3ETMA 1OY8A 3JS9A 1UA0A 2VICA 4CLLA 3GJSB 3MEEA 1HHSA 1JLCB 1FNMA 2B56A 1KTVA 2F7VA 1YJNS 1PCAA 2HIYA 3CDEA 3PR4A 2XYGB 4UOFA 1PJ6A 1TTHB 2FZCB 2V2QA 1TU0B 5KFNA 2F3JA 3SEOA 3FSIA 4DUZF 1J5EJ 4NXMJ 1I6JA 4FYYB 3THPA 2BEFA 4Q0BA 3CCSS 2I2YA 3VQSA 1B64A 4ZHRA 8AT1B 3H4DA 2LCWA 1P9YA 4PEOA 3DCAA 3CEDA 3CMAS 2W9CB 2UU9F 4FXWA 2RU9A 3GYGA 3KHGA 2LXIA 1NHKL 3O1LA 1IWAA 1OY6A 3EX7B 3WDOA 4RJVA 4TNOA 1RAOA 2P6TA 4OZLA 5GADU 3TZYA 2J8AA 2SXLA 2JEFA 5HBMA 1HNZJ 4X62F 2VPXB 1NK6A 2BJ9A 3MM6B 3D3CJ 3VGSA 2XMWA 3GIIA 1FJCA 1VQ9S 5KG1A 1SC1B 4DZ6A 2DHHA 3KJFB 3CCUS 5GAEI 5ETQA 1T9WA 4PQUB 3M8QB 2P9EA 1DQ8A 5D3GA 1WKLA 4OHVA 2D3ZA 2FGOA 4JUZA 1DTQB 2DTJA 3NS7B 5EHHA 4XO0A 1R0AA 1ZYQA 2FIUA 2D69A 4QPTA 1X7VA 4LFAF 2KO1A 3L09A 4B3RJ 2YNHA 3DOKA 4RL1A 3RG6A 4N5SA 3I87A 2FGCA 4C0HA 2JLEA 2VG6A 2NQPA 4ZVFA 4ERDA 2AZ1A 3O5TB 1H73A 2ZNZA 4AD6A 1VQ8S 4C8LA 4CCHA 4QYZJ 3HDSA 1R8AA 3T5KA 1GMWD 4MTPA 1AW0A 3FCWA 1X9MA 4OX9F 2HVIA 2J9DA 2DXFA 2ZWOA 4FN5A 3VAGA 1N6QA 3VAFA 3PYFA 3G4SS 3ZZPA 1OQ6A 4KJIA 1LNQA 3Q8YA 1A9NB 1EIYB 5E3QA 2PEBA 3G82B 5HVGA 1PC4A 1Q8KA 5HMXA 4HHHA 3VF0B 4WWSA 1WKJA 2VD3A 3PJ9A 5K9FA 4ANEA 2QA1A 3W9IA 3BQ1A 4OLOA 2G13A 4DX7A 2IDLA 3BYPA 3Q23A 1G6BA 3DOMA 3K5MA 4DPWA 4N76A 1HBUA 1O0PA 3K8VA 2UUBJ 2H5IB 3NL0A 2F8EX 3MR5A 2KVQE 1H2VZ 1P8GA 2CZVC 1HW9A 2I9SA 2Y1RI 1M1KT 1UVMA 2BV3A 1UJ6A 1C4AA 2CPXA 3EZOA 4ECYA 4YB7A 1V3RA 1IR0A 1RZMA 1VYAA 3EVWA 5IFMA 2YKPA 1X9WA 4D3HA 1YVFA 3T5LA 1QAYA 4XIUA 1M5PC 3ZTRA 2Z30B 1RABB 1SC3B 4IOBA 1OPZA 4TLQA 1WOSA 2C42A 1RT4B 2CNKB 4N7TA 1K1QA 5J2QA 1YRUA 2CDQA 2W9CA 4HACA 1TELA 2CQ1A 1JXLA 1JJ2R 4EZ6A 1HHTP 4WPAA 5KFAA 4X4OA 4KFBB 3MR3A 3TR5A 2DHGA 2DH7A 4Z2XA 4X66J 4WP8A 1UPMB 4RW6B 4NPOA 4Q7AA 3QFHA 3TX0A 1EHWA 2VHGA 4TVAB 3BQ0A 4ED2A 2MLZA 4IFVA 3J81j 1U49A 1IKVB 4ECXA 4RNHA 1GH8A 4DG1B 3M2VB 1U8SA 1YQHA 3UI3A 3MM7A 4QWBA 3KJVB 3QMQA 1T3OA 3UNYA 3AY0A 1MN9A 3DRRB 4ZP7A 5IT0A 3G8SA 2W8LA 3RR8A 1XQIA 1FWLA 3BKUA 5BXIA 3D1OA 2ZBCA 4JI6J 4DFKA 4ED5A 3H2UB 2IVMA 5AXLA 3TP2A 2G0CA 5LMUJ 3WIVA 3MPWA 4Y2CA 2XGPA 4F25A 4DR5J 3TQ1A 2C22A 4C48A 1HQUB 4RKUC 3RAMA 2FYXA 5ETNA 3MM7B 4L75A 2WRMA 2AJ0A 2MZ1A 3IWNC 3BSOA 4DG1A 3OQ2A 4PWDB 1KC8T 3Q2TC 1IKVA 3NS6A 3OTEA 1NZAA 2CJ9A 2XSJA 4OYOA 4AL5A 2CNOB 3ZTSA 2BXJA 3JSYA 1OY9A 4DDFA 5KFQA 1H98A 2M3DA 1RT4A 2JWNA 4U67Q 1YI2S 1N8RT 3IR6B 2RU3A 3EGWB 4HACB 1I94F 5D0HA 1YKWA 2DGXA 4JI5F 1YIJS 1HBMA 2H65B 3SIPB 2XZTB 2WW8A 2ZEJA 3O44A 4ES2A 2M9KA 1NRKA 4C3KA 1IXKA 3DMJA 4CO1A 5BYSA 3VZIA 5HLFA 1JLFA 2DHXA 2CQGA 1JJHA 2RQMA 3V81B 4LBPA 2PMHA 2HWTA 1VFJA 4NCAA 2RQCA 3P45B 2ZZNA 1AA1B 1UWBB 3A3PB 3R27A 3G8TA 3CD6S 3S7RA 4JP8A 3D9BA 2PI5A 1XNQJ 2HHUA 4UY8T 3OHAA 2BJ1A 4GKKJ 3ZNJ1 1NK7A 1PYOB 2ROGA 4ZPWR 5ETVA 3K5LA 4FXVA 1B3TA 1LWCA 3MD1A 3IAM9 3N6MA 4C0BA 3EWGA 1S6PA 1KQKA 3LOUA 1QY7A 3MR7A 4I7FA 4NEYA 5CQGA 3SBMA 4BS2A 1HBUB 2K3KA 2I1RA 1FD8A 3E01B 5DM7Q 4LF7F 1HWLA 1H74A 1WSRA 3GJRB 2IVFB 2F5GA 4K4WA 1XMOF 1J5OA 1D0EA 4BC9A 3QLHA 1XEZA 3P96A 4FVMA 4KC5A 3ET6B 3J80Y 2DNNA 2QN6B 4OLPA 3H0PA 1XMQF 2RUGA 2V4JA 3MPUB 3D67A 5ETSA 3VVUA 5MAOA 5AXKA 4ED1A 3QJLA 1K44A 3MI7X 3CCVS 2EVZA 4NLUA 1F3FA 4DUYF 4ILLA 2A3JA 3CCWA 4I6AA 5FDLB 2DISA 1KLNA 2ZKTA 4WIQA 3UN5A 2LDIA 2LQJA 2WVBA 4Y3CA 1C4CA 5B0FA 1FDNA 2JX2A 1JNRB 2U2FA 4AXJA 3QT8A 1LW0B 1JLQB 3BBBA 2B5JA 2IM2A 2YWWA 1FE0A 1L5UA 4K0KJ 4WBFA 4KE5A 1NK9A 1PJ5A 2VG6B 3UN3A 3C46A 3SDEB 1HYSA 3KLGA 1KBRA 3JXOA 4U7UK 2CQPA 3KDOA 3KKFA 3TVKA 2ZH3A 2HQIA 4DF4A 2G2OA 2NXEA 2HBYB 4DR7J 2NZ4A 1N0UA 3GR1A 4LF2A 3HSDA 4NYZA 2AX1A 1H3DA 4FKYA 8ATCB 4M5DA 2P9GA 2PN6A 1N56A 2P6SA 4DLEA 2UV8G 5AJ3F 2DR7A 2FZGB 3TJ8A 3IG1A 2CPHA 4OI0A 2KDOA 2ATCB 4WIIA 4B3TF 3N28A 5SUHA 1RT2A 2DGOA 2KZZA 5KFRA 4KGXB 3PFEA 2GHWA 2AEJA 1CBKA 2GX8A 2MLYA 4NA2A 3WBZA 1N34F 4Q0BB 3OR1A 4JV0A 1N52B 2Q3PA 4O23A 4DUYJ 5C5JA 4DV6F 4PQAA 2NCKL 4B9UA 4PRFA 2AIRB 2VFSA 5DDOC 1VQMS 2KRBA 1NPPA 4M5MA 3CW2C 3JTOA 3EPGA 4DJBA 1U1MA 2HPUA 3R9LA 1XMQJ 1IQTA 3LANA 3NNCA 5L1JA 3A1YG 3MECA 4BHQA 4N41A 4L3NA 1HWUA 4X4RA 1U26A 4ELVA 2FVSA 4CLKA 3ZZTA 3SZ2A 2V8VA 4ZVQB 4P74A 1QD1A 2JZ5A 2OEJA 1Q79A 3PEHA 3W1YC 1NHVA 1FX2A 3CJKB 2ADCA 2CWKA 3G6XA 4HDHA 2R7SA 5EDWA 3CDAA 2HRYA 4H4OA 3H5SA 4OX9J 2DNHA 4OL8A 3IRXA 4TU9A 1WG5A 4ZLPA 4FNHA 1O8BA 1R27B 1K0TA 1NB7A 2XMMA 3A8KA 3P6YC 4OZ3A 1V5IB 1MMLA 1FKPB 5HAOA 5K14B 1S6UA 4QIVA 2BZ2A 3HD2A 4ZVPB 5CCMA 3IWXA 3OTOF 2ATLA 2MB0B 1P6TA 4LFAJ 1K8AT 1X8DA 5KT5A 2RUSA 4R5PA 1MW7A 3I5CA 3QRPA 1UZHA 5F0UA 5KFTA 4OJ3A 1SCJB 4ZCKA 1WHXA 1IWGA 1UW9A 1VQSA 2WSEC 2YPZA 4O44B 1ZPVA 4NX9A 3FBBA 4OI3A 1VQLS 1UVIA 4FF3A 1KDNA 1PO6A 1REVA 1U6ZA 1ZZFA 3LQVA 2YKMA 3PHTA 2D9PA 2HIQA 3VAHA 3T9ZA 1MWZA 5EWFA 2ZH6A 3JYTA 2OTLS 4B3MF 4OZ1A 2XQCA 5A6WA 5L9XA 4B9SA 1VJWA 3WHIA 1JLQA 1LW0A 1RAIB 3TAMA 1HLWA 4ZJQA 4DV5J 2VDHA 4OJ1A 4XDCA 2RSQA 4DL4A 1H38A 4DR4F 1B0PA 4C98A 4QJVA 3ET6A 3I9V9 3FDSA 4EZ9A 2OMOA 1S1TA 1YRXA 4UQTA 1WEXA 1LXNA 3IO1A 4ICLA 4LSLA 4NYOA 3ILJA 2HBRB 2QLBB 2EW9A 3QWUA 3LP0A 5T14A 4YHHJ 3PW0A 2HHXA 1OO0B 3KMQA 2DGSA 1X4FA 3HT0A 2ZKUA 1N36J 4DR3J 1XR6A 3OT9A 4DV3F 3H4BA 4JI3J 2ASYA 4RX6A 5KTQA 1U1KA 1Q5VA 3V4MA 1S1WB 3FCHA 4AFFA 4X66F 4IUFA 2R7XA 3AFGA 3HSZA 2LVWA 3QRQA 4Y2KA 1TAUA 3MEDB 5GMKa 4ZIWA 2H54B 2V2VA 3GIKA 5A8RB 4DV7F 4KV8B 5DLFA 2LECA 2IRYA 4NRTA 1OYDA 1QVGR 2WBMA 2YKOA 1GXLA 2ZC3A 5CYQA 3T6JA 1S0OA 2IC3B 3SQGA 3C14A 2UXCF 1GT8A 5HLFB 1HNWJ 1M1HA 1RLDA 1YK9A 3UD4P 1RTIB 2DH8A 2MPUA 1BQXA 2XYHB 4X65J 4KHPJ 1S9EA 4LF5F 5CABA 3CB4A 2MQMA 2ZNYA 1IJFB 2M70A 2HGLA 2PE8A 3DXSX 3DI6A 4OYBA 1HBOB 4R0JA 5KG0A 2OTJS 3OXFA 4CO2A 4NCBA 2CFXA 1K9MT 1E6YA 2ZZMA 5A76A 3C6TA 2XC9A 3KLHA 4ES3A 3PIOQ 2CQHA 1TKXB 3MURP 5C7PA 1TKDA 3DRSA 1T94A 4J9NA 1WUUA 3S1TA 3EZ5A 1U1LA 2FJVA 2OH2A 2VOPA 4JI2F 1T0TV 1T9VA 2U1AA 3FBCA 5I3UB 2ZH9A 2FVRA 5D0GA 2JJ4D 3UDLA 5DQHA 3M2RB 4NASA 3BSNA 2QIFA 2XSJB 4IDKA 2W9BA 2MZJA 2LXFA 3GCXP 2MKKA 4LR8A 4XPCA 2D3UA 4NA3A 4RW8A 5AE2A 4O3QA 4J5OA 4J9QA 1FXDA 2PFDA 3NOCA 2XY5A 5F0WA 3CC7S 2NPIA 1AROP 5SZTA 1FESA 3T5HA 1AYEA 1RAGB 2J5AA 2VBZA 3GYNA 4LRFA 4NLRA 3LUYA 4NLPA 5IC4B 2XGQA 3ULHA 2E5JA 5KFWA 2VPZB 1JB0C 2BX6A 3ETOA 3MUTP 4F4KA 5KFSA 1HI0P 4KFBA 1FFWB 1DFDA 2OFHX 4QYRA 2AJQA 2YX7A 1XN9A 5T41A 3MF5A 1YZ6A 2EFNA 2ZWPA 4CLFA 4RUBA 4ED3A 3H25A 2XZDB 1RWMB 4P72A 1RE1B 1KHVA 1D3WA 3OR1B 3PX6A 4HT7A 2E7XA 3MHYA 4DL6A 2MLXA 4IO9Q 2J0SD 3D2WA 3KHLA 4DR1F 3UD3P 1L3SA 2BRLA 2HURA 4IG0B 3C16B 3OPKA 3QGHA 3M30B 3R7NB 1AZSA 3PCOB 4YDDB 3SSRA 4RUCA 4CLWA 2DPJA 2VA3A 5J1PA 1FA0A 5DGAA 1MROA 3ZNUA 5B7WA 3O3LA 3IWLA 2VJVA 3KK1B 1OQ3A 3D1QA 4UUWA 4LF8J 4O3NA 5LL6d 4F0MA 4IR9A 4K2XA 3MCMA 3JQMA 2GHPA 1LWFB 5L1LA 3IM8A 2UU9J 2VPWB 1DARA 1NLKL 3IC1A 3R3TA 3AA9A 4ECZA 4HDGA 2J0WA 2C2RA 5HJYA 2B5JB 4DLGA 1N33J 1FERA 4LRBA 1VQPS 3N5BA 4PABA 4KY3A 3W8GA 4KHMA 3QPIA 1F1BB 3POTB 1UVJA 2W7OA 3J7YU 4HYKA 3Q8SB 5KG3A 3ISND 2XI2A 3QT7A 3EZUA 4V19X 2BJ7A 2Z2LA 4ENOA 4X64J 2HS3A 2ZFHA 4IRCA 1LWXA 2N7CA 1JXVA 3FBFA 3PO5A 4M5IA 2XHCA 1D8ZA 3DLEA 2DRBA 3G6VA 5H9FK 1C2PA 3R1HA 2YQ3A 4MK9A 5F8GA 3AOCA 3P5TL 1R8PA 3OR2A 3MXHP 3POTA 2R8GA 3AJDA 2YNHB 3DOKB 3KYLA 4ID5B 4HR2A 2KTQA 4AL6A 2D1CA 1RT5B 3OW2R 2ADBA 3GR0A 4J9LA 3RB6A 1HR0J 3PV8A 2LFVA 3BKFA 2LMIA 1RHRB 3M8QA 1UFLA 2V63A 4NMXA 4GRSA 5IM0B 4J91A 3CJ5A 5LXYA 4EUVA 5E3CA 4I67A 1UWBA 1GAOA 3EGNA 1KWMA 2DGWA 4PR6A 3W9HA 4Z7CA 3AJ1A 1CG2A 1Y5LB 3C66A 3CJ2A 4M8LA 4JV5J 2WVDA 1X4AA 2Q6CA 4CLSA 5KG4A 2FJAB 2JC1A 3HHEA 2VV5A 2WSCC 2VBYA 3QZ8A 2IFXA 2VG7B 3R6GB 2M7SA 3D4JA 1SUQB 4IG0A 1GTHA 2JH3A 4X65F 1FJ7A 4USVA 1HQ2A 1I51B 2CNNB 1SQFA 3ZZUA 2WB4A 2BE9B 2IJRA 3GJQB 1CULA 4MIWA 5AXNA 4PG7A 1B4SA 1U2RA 2V8DA 2R7RA 3X1LB 1Y4ZB 3NGRA 4M5GA 5HI7A 4Z37A 1DJ0A 1RU2A 2C2ZB 2RHQB 3TX8A 2KT3A 4MK8A 4DV7J 1FDBA 1CC8A 1UEUA 2CQ3A 1CJUA 1TL1B 2VFTA 2MKSA 5AXMA 1FE4A 4ZHRB 4IQXA 4DXLA 2QLXA 3LGMA 5CH7B 1RTHA 4F4YA 2X1GA 5GAGI 3FKBA 3MMBA 4YB6A 5J2NA 1T03B 4CO4A 5E33A 3TZZA 2B51A 2B8QA 5HJXA 4DV3J 4OHYA 4URGA 1GXTA 1R8CA 3P3DA 4P2XA 2PMZD 3D6HB 4Q5VA 1NSAA 2KHCA 1P1LA 2DGUA 4J9SA 4XDDA 2GMHA 2OUGA 2V68A 2VB6A 3KG1A 4A47A 1RGVA 4RW8B 1Q53A 1L3TA 2X3DA 5LSRA 1VLYA 2C2DA 3R2CJ 2W2OP 5CD4H 3DLKA 1RWKB 2AWZA 2CVIA 1TKTB 2LQ5A 2J6SA 3RBZA 2RF2A 5CAAA 3JTNA 4KH0B 1HBOA 2W7AA 3HD1A 1FKOB 4J90A 3M4XA 2A18A 1NPRA 4FPRA 5F8HA 5CD4A 2RRAA 4FXDA 1T02A 3CJ8A 4NLDA 2HNZB 5I3QA 3UD5A 5CYMB 2MSSA 3ZTQA 4M1KA 4C8ZA 3TZWA 3K59A 3BJYA 3T1AA 3F0NA 3VAKA 2BJDA 3TWZA 4QWEA 3AAWB 4DWIA 3K2YA 2EXUA 2VU5A 5IXUA 1TK8A 3B78A 5HATA 5A0YB 4P9SA 2UUAJ 1VRUB 5I4MA 1NJZA 3OFEA 1YG0A 1S1XB 2XWXA 4USUA 4EWTA 3C14B 2DNPA 1FFSB 5DG9A 4YDXA 3H40A 2N7YA 2AJFE 2CPEA 3KWMA 2MQ8A 3TA1A 1S77D 5A8RA 5GAGU 4M95A 4ZS6A 1CJKA 3ITHB 2XLIA 4NZ6A 2Y1JA 2KFZA 4EI2A 1U0HB 4ZITA 1UCNA 2BW7A 1S4EA 2V34A 4ICLB 5HVHA 2X1AA 4UUXA 3TW0A 3CDWA 4DX8H 4X4QA 1JK9B 4URSA 1VK3A 3NGTA 2CG8A 3KLFA 4C6AA 1DQ9A 3J7A1 4WE1B 2DRDA 2KFYA 1NH8A 4JI1F 2QL7B 2OPQB 3DYAB 1S9GA 1PBUA 5L39A 2PDAA 2YVSA 2DIVA 1FF2A 2QX0A 2BE2A 2CJAA 3G86A 5A2QY 2Q1LA 1WWHA 2GGPB 1NB2A 2YKMB 3ZZZA 4A8QA 1KP6A 2HWHA 3FBEA 4R25A 5FLXU 4PUOA 1HHQA 3KFWX 4W4MA 2MXYA 1SXLA 2C3MA 2L3MA 1N34J 1EP4A 2XO6A 4O44A 2JVRA 1EKSA 3MEGA 2QG9B 3C15A 3NBPB 2UXDJ 1RT7A 4CYUA 3PJWA 4WU3A 3U02A 3RAXA 1R3NA 3TUIC 4LF5J 4JI8J 4LRDA 4E2FB 5AJ3J 1HMVB 2IA0A 1ZTWA 1HNWF 1TV6B 1Y5IB 1VI7A 3HFVA 4QIWD 3LPYA 2L41A 2GO8A 3RTVA 3QRRA 2IM1A 1XC9A 3R97A 4ZCIA 1JKHB 2EWHA 2FHMA 3VGVA 2RNEA 4Q2MA 2MQOA 3V5RA 4A8FA 2VJUA 3OJUA 3B82A 4FBUA 2AMCB 3SV4A 2KXHA 3MAAB 2VKRA 1MU2A 1SVDA 1OYEA 2ZM6F 4P7TA 3MM5B 1JJ4A 2IBOA 1BHNA 1P9QC 2E9RX 4DN9A 3BO2A 3KUHA 2BUNA 3CJKA 3QGPA 1DRZA 3DRPA 4HTIA 1KQGB 2UVRA 1O51A 5HP1A 2C2OB 4YN3B 2LQ9A 3MTJA 4DR3F 1M0SA 3Q8UA 1PG5B 1YRTA 2FJBB 3N5FA 1NK8A 2KZMA 4KT0C 1AUDA 2F4VF 2DNZA 4KKOA 3KUEA 1FD2A 3WZ0A 2K1RA 1NSPA 4F4AA 3D54A 5KG5A 1YHQS 4DHVA 1IQZA 1TL7A 5LSOA 2VBWA 1IM4A 1Q4RA 2ROPA 2DXEA 3I4PA 5C42B 3D66A 3BDPA 4TYBA 2CQ2A 4FKXA 3T1YF 1UZDA 1X4CA 3MM5A 1PKUA 2BBEA 4RW7B 4B9MA 1TUVA 3MAAA 4DCOB 2DR9A 2A0FB 3BGFA 3CJRA 3DKDA 4O4GA 3C2PA 5HP1B 6AT1B 1SV5B 1AUSL 3DRPB 1SB6A 3LAKA 4X4SA 3A8EA 3H2VE 3KG4A 4CT8A 2LA6A 4GKKF 4ECTA 3IRWP 5D0EA 5C2GA 3H7HB 1XNQF 4JYAJ 4CNYA 2HFZA 1FX4A 2CQCA 3PNIA 2CJBA 4A8XA 3PTWA 1UA1A 1NJXA 3OFGA 3CDUA 1X5SA 1PBAA 4M5DB 2BRKA 3HKWA 4YEAA 1H6KX 1V5VA 2MZTA 4KBIA 5L9NA 1YBUA 4RNMA 1NK0A 4B9TA 3CULA 1N5YA 2YTCA 3DGPB 3CMES 1RWXB 3L7PA 2W7PA 3IR7B 4UY85 4IG3B 3N0VA 3I96A 1TL4A 2D3O1 3KK3A 3HHNB 5DDQC 4EK2A 4Q44A 3ENQA 2AYGA 2EG1A 1D1UA 2HW3A 1ZAVA 3DDNA 3M8YA 1YWXA 5AE3A 1VQNS 4FDFA 5M2PA 2CZ9A 3Q0AA 4K50A 4ZOSA 2C2MB 1U47A 1S6QB 2BE2B 3RGIA 2A6OA 3I9ZA 1SBRA 1DLOA 1V6HA 2B4VA 1TKZA 5KOWA 3T1YJ 1F60B 1N5SA 1Q95G 4LBIA 4MT1A 3JSMB 2BOPA 3C6UB 1N32J 3HHDA 3LPEA 1ZH5A 2Z56B 4M5JA 2VOOA 1H2TZ 2XWYA 3D28A 5KFUA 2V8GA 5ETPA 2PT0A 3W7BA 3VALA 1U6FA 1KOHA 3QLHB 3JAMU 2MY7A 3SFGA 4ZP9A 3DFEA 1NDKA 1C1CA 1ZOTA 2IYIA 3ADAC 1U0HA 2FHJA 2MMYA 3CWJA 3M6VA 5ETTA 3J7ZT 1CS4A 3H5YA 1RT3A 4F50A 1ZETA 2ZBRA 3BGUA 4GVLA 1QUVA 2YY3A 4L3KA 1ACMB 2EPIA 1BQNA 2E5IA 3EDQB 4M5KA 1EETA 2X3GA 2ZBPA 2ZM6J 2MZRA 3DMJB 2B8PA 3HJFA 1NNDA 2G0JA 4EGLA 2F8MA 3KXDA 5KFZA 2JRSA 4WP9A 4OX6A 4L73A 3FK4A 4ILRA 2WONB 3W61A 1FFGB 4NI2A 5ITHA 2W2NP 4NEZA 2IJFA 2MQLA 3PKYA 4DL3A 2BR0A 4O4RA 4PXDA 2FLLA 1IR2A 4FYXB 4RBUA 1VK8A 1KQFB 2PGCA 1X4EA 2CADA 5E3PA 3G6YA 3RW7A 1VBXA 1X5OA 4LF9J 1Y11A 3AHPA 2KT5A 1KLMB 4PYDA 5CZVA 3RU0A 3KHRA 1RTJA 1TL3A 1VGYA 1I5OB 4MKVA 4UZBA 4YQWA 4GKJJ 3MM9B 1N48A 4AUKA 1VIXA 1WEYA 4CO3A 4USIA 4PWDA 2YPYA 5HL7Q 2FVQA 1WC5A 4FVCA 4OYZA 2I5JA 2QYGA 1IM6A 4IFYA 4CO0A 1RSCA 3M2VA 2GIRA 1LOUA 1NU4A 3W5XA 5DETA 1MNEA 5M2UA 1KEKA 4L72B 5HROB 3BSAA 2C28A 4FYVB 2DGVA 4USHA 5IT4A 3CJSA 1JNZB 4RW4B 2QYCA 3FZ2A 1MWYA 4DR6F 1CULB 2DNLA 2PO4A 4QIFA 1KLMA 2E44A 3NG8A 4XPEA 1VQ4S 4GMKA 2AEMA 2EKNA 3I5AA 1RADB 4LF1A 3J7AN 4CDIA 3TAQA 1RTZA 5GAHI 2AZ3A 2VG7A 5T7LA 3A8JA 1WC4A 4RW6A 3CVKA 1R7IA 4TXSA 1TL3B 1RTJB 2ILYA 2H1YA 2LXUA 1HPZB 2ZH5A 2K8GA 2FVCA 3DGVA 4DX5A 3R6LB 3LALA 2CDRB 5KFKA 2ASDA 4ELTA 1QLNA 5KT3A 3AB2B 4RPFA 2ALZA 1WD6A 4CLYA 3F73A 3BR9A 3PYEA 3GSDA 3H5XA 3HF5A 2K2PA 3D7SB 2IVYA 3TOQA 2AT1B 1S48A 2ZH7A 2OFGX 4I2QB 4HTJA 1DZ5A 1FWPA 3L7OA 2AQ4A 2OPPA 3M8ZA 4NXNJ 4DU7A 1B0TA 1CJTB 2HRTA 2JL9A 3SI8A 1HNVA 2EEYA 1O6XA 3Q8VA 1Q82T 3L4BC 4P71A 1RT5A 1CQNA 5F8IA 3BO3A 3NGDA 4F4ZA 4ID5A 5F8LA 3BPSP 1S6OA 1T11A 4X62J 4H4MA 4MJKA 4DS5A 3RB0A 4JI7J 5JJBA 2L9NA 2C3OA 1A6LA 4WK1A 4BLGA 1EETB 4KR0B 4CNZA 4CLPA 1HWKA 3PW5A 2L9DA 3KNAA 1C0TB 1GMWA 3M2UB 1DURA 1RU1A 2Z8QA 4ECQA 2KXNB 2AV5A 4DL2A 3PW4A 1KVIA 4I1TA 2W25A 1SH2A 3OTBA 4U7UD 3IMQJ 1WDTA 5A6PA 1S97A 3LH2S 5E2QA 3CPWR 4J9VA 4YUDA 5IWAF 2IBKA 2EK1A 1ZM2A 5HQLA 2HHHJ 2NXUA 1V3ZA 2EG2A 2B4PA 2DEJA 3HZGA 1E6VA 3K7RA 4K5SA 4LBHA 4LJMA 5HANA 4A46A 3EM1A 2QL5B 2J9EA 4A8OA 3HP6A 1MSWD 1VQOS 2FY8A 4B3SF 5HMZA 3BN4A 5C25B 1C0UA 1OWXA 3K58A 5GAEU 4J9UE 4C11B 3PHEA 4YR2A 4OHWA 4PZVA 1S0VA 1JLBB 4P75A 3DGPA 3M8RA 1LWFA 3DDIA 3M2UA 4TLRA 1C0TA 1TMJA 5BYQA 3NS5A 4O0NA 5ETOA 3JTPA 4HT5A 4PQUA 3KK3B 1G2EA 4DL5A 2AU0A 2OAUA 1YJTA 3HSGA 4ECUA 2AYMA 4MAKA 4CO5A 2FDNA 2LU1A 1DTQA 1Y5NB 4IOCQ 3KLIA 2GC8A 2OEKA 2R8HA 1R0AB 2VA2A 4K4SA 2J9DE 4L6V3 3BR8A 2N82B 4JV2A 1BQMB 4MIBA 2C2EA 4ITSA 4KPCA 1YJ7A 4I56A 1L3KA 2R4FA 1QDUB 4KO0A 4C3MA 2PSZA 3S01A 2BJ3A 3TEHB 5CCLA 2UUBF 3SQOP 3FCVA 2R2TA 1R89A 3RR7A 2CAJA 1K0VA 1G3OA 3DU5A 2E1MC 2AYEA 1X0PA 1JJCB 2MKIA 2EFVA 2N3LA 3Q22A 4FYWB 3TUZC 1HR0F 4F8RA 3SSQA 2NXNA 3SCKE 3U1NA 1S59A 2HBQB 1TL7B 4DFMA 3NAIA 2ZH8A 2DNMA 3FJ2A 4OZJA 2FJDB 2RIJA 2M88A 4C97A 7AT1B 4X2BA 1ZA1B 5EN1A 1DHMA 2FHJD 2RRBA 2WBRA 4TU7A 5KT7A 4UW2A 1GEHA 3DNCA 4UOCA 4C2MA 2QTWA 5C42A 4QU7A 1YJRA 1N54B 1DY3A 1HI1A 3FNNA 3HMJG 2WVCA 2E7WA 2DB1A 2OKQA 3CE8A 3H8YA 3BGRA 2UV8A 4U9RA 4DV2F 2M8DB 3FVYA 3C3LA 3IBCB 5I3UA 1X31C 2UP1A 1NHUA 3KLVA 3QO9A 2HQ3A 4RNNA 2ZH2A 2W9BB 5CYJA 3W9JA 2GFFA 4F4WA 1HI8A 2IA6A 5FD1A 1UP1A 2MQNA 3BM7A 4NRUA 3HLUA 4JI0J 1SJ1A 2MDAA 2LLZA 2NS1B 3NGUA 4YMEA 3QIPB 5D77A 1S1VB 2GCFA 5HK4A 5KFLA 5HN0A 4UQGA 1KSPA 3DRSB 4ED4A 3KLEA 3MFIA 1IKYA 2BOAA 1TKXA 1QVFR 3JSRA 4TYAA 4WK3A 2GQCA 1WC6A 2V9KA 3H2LA 3C6TB 3KHHA 2MZSA 4ZN1A 3W5ZA 3IGNA 2RVJA 2E5GA 4LF8F 2CPIA 3W2WB 4LRCA 4MIAA 2IDEA 3MUVP 3I56S 1VMBA 2DXDA 5BYRA 3ELHA 4RUHA 4J9PA 1RTDA 5G4DA 1MLAA 2GGPA 3ISNC 1WORA 2HNDB 3Q89A 4KGVB 3UVJA 1LW2A 2YWHA 3NMRA 4KGZB 4U95A 1RAFB 2EFPA 3ZTPA 4F3OA 4KAIA 4JI0F 1S1WA 5JXSA 4ED6A 5IT9U 3W3SA 3B54A 2COLA 4NXMF 2KL8A 1RHJB 4CRJA 2AX0A 1RT3B 2BM0A 2F1FA 3MEDA 4LFCF 1T7PA 4EO6A 1FTCA 1URRA 3BO4A 2QLFB 3BZQA 1J2VA 1WG1A 3UDCA 4AXIA 1KQSR 1N88A 4ECSA 2GMJA 4USMA 1CVJA 2CWXA 4OI1A 3DRXA 2KRRA 5BR8F 5L1IA 1UAWA 5IQ6A 2BW2A 4CIOA 1VBKA 1JMTA 2IM0A 2HLTA 5J2PA 2ASLA 2GQQA 5AT1B 1TVRA 4PAAA 4EO8A 1JIHA 4EBEA 1A0OB 1LW2B 3NEKA 1K73T 1VRUA 2UXBF 3JAMY 2HHSA 4HH0A 3CCJS 3GG1A 1FDDA 1WHVA 4XTTA 4DL7A 5E3AA 4JI2J 2HSEB 5KOXA 4CH1A 2E1RA 1YBTA 3SCIE 5KFIA 3ZZ0A 1JLFB 6FD1A 1S1XA 2DEIA 2HEKA 1ZPWX 3AODA 3CJQA 4EMDA 3JB9k 3G71S 1X9SA 1SI9A 1VOMA 2R8KA 1QSSA 1BXNA 3OTCA 4NLTA 3W64A 3HO1A 2VG5B 4QR0A 1J27A 2I8EA 3MD3A 5HMYA 1FK9A 2XCPA 3MWBA 2YNIB 5DG7A 2QO3A 2P9CA 1MMDA 2RT3A 3VR1A 4MKBA 2HMIB 3IM9A 5F41A 4CLUA 2VQEJ 2ACMA 2F9DA 1IKXA 4ZLJA 2BANB 2W24A 2Z57B 5IQQA 3M8WA 1SL2A 1GQEA 3W8PA 4LFBJ 4A4JA 3KLEB 2IAJB 5A8WA 3HSJA 4X4VA 1SC6A 2WTFA 3T5JA 1D09B 3H5UA 1TKTA 2NUHA 3IR5B 3OL9A 5F3TA 1X4DA 4X64F 2M0GB 2OD4A 1GX5A 4HEA9 2O67A 4ZPCA 1LQ9A 3GV8B 2BYCA 1SJ3P 2Y3YA 4Q2LA 1FO1A 1T03A 4D3GA 1YZ7A 3N9UC 3M9OB 2E66A 3W60A 2MKJA 1NKEA 2CIMA 4W98A 2M2BA 1CEZA 1OMSA 7FDRA 3EGZA 4C8KA 2G0IA 3VZHA 3LGNA 1DQAA 2E5HA 2XB2D 2W4DA 2HK3A 2VH7A 2PA8D 2YXLA 3DLGB 3IP0A 3VGUA 4CH0S 4DR4J 2V67A 2I6WA 1SJFA 4ILMA 1UEKA 3EVOA 3IG1B 1FRJA 9ATCB 1HBNB 3T3FA 3FRZA 3MOJB 1NCLA 3AQOA 1RBLA 1VC0A 1YBAA 2XMJA 3CIMA 2VUGA 3LF0A 2VKZG 2NSCA 2VFRA 2NREA 1X4BA 3T19A 1VRTB 2MKYA 3EUNA 2E5LJ 2AKWB 1SH3A 2IMWP 2LU2A 2YH0A 4TY8B 2MGZB 2BACA 1BGXT 1JKHA 1W2BR 2XS5A 1CC7A 1YJWS 1SKRA 1WEZA 1RT6A 2XMVA 3M1VB 3MOZA 4PPZA 4CQ1A 4NXNF 2RHSB 3T6BA 2V4QA 1KFSA 1NZ8A 3NNAA 5HQMA 2G2ZA 2XTJP 3BH7B 3A3OB 3KDNA 5DLGA 4MYTA 2DK2A 3DRYA 3I31A 2CXEA 1RQ0A 2EFQA 4IH6A 4NCGA 3BN7A 3HCXA 3HVTA 4P2FA 1ZM4A 1QAXA 4RW9B 5G0RA 5IS2A 2ROEA 4NLWA 3OR2B 2H51B 3LA0A 4FYDA 3D6FB 4B9NA 4MFBA 2MQPA 4LF4J 2ILZA 5DRKA 2DY9A 3DLEB 4S0MA 3EYZA 3NNHA 5K8PA 1NXIA 1PYSB 4DV2J 1URNA 3QJPA 1JLBA 1H2UX 1ZBTA 4WJBA 3R7SB 3MAQA 2Z2YB 1RYRA 3SSSA 3T1HJ 2V94A 3GV5B 1WELA 2KYXA 3MM8B 3QSIA 2YKNB 3R5CA 3I55S 2J8SA 1S9GB 5FDLA 3P8BB 3CC2S 2DNQA 2Z2ZA 4IRKA 1LEOA 1BUXA 1MWQA 1S1UB 1YDLA 4P6QA 1U6BA 1TR0A 2ZOMA 2CPZA 2V4JB 3R5DA 3BDEA 4J9RA 2NLWA 5DDRC 2CJYB 1DBDA 4QR2A 3HFZB 1R8BA 3BPDA 1HKAA 2GIFA 4HI2A 3CCMS 2XS7A 3HHLC 2UVWA 1CLFA 2N4CA 5E3RA 4WYLA 1CJKB 1WF2A 3ITHA 5M2RA 5KFXA 3M9NB 1F3VA 2W1BA 4EEYA 1SJRA 4MYUA 1R8HA 1F9FA 3TA0A 2DIUA 1FHTA 2X1BA 4U8YA 3GIMA 1JWWA 1BLUA 4AQYJ 2R42A 3P5BP 4ZLNA 3WC2A 1NSQA 4TQRA 2V50A 2NYIA 3IAS9 5D3GB 1DAXA 2NXJA 2OPPB 1NMEB 3CTRA 3VGTA 2AD9A 2PEHA 3TVYA 4OJHA 3ZTOA 4B3TJ 5D15A 1RDRA 5BJRA 1HBMB 4B9VA 4AE5A 4KHPF 1SH0A 3D6TB 4RZRA 1FEEA 1RBOB 2CPJA 3CF5Q 3AD7C 4JV1A 2UXCJ 4YOEA 2ZBQA 1YSJA 4NE9C 2FB0A 1Y7PA 3UDVA 5ADZA 4FBTA 4PCQA 1TL5A 2J0XA 4LQ3A 2OEMA 3B8HA 3CJ0A 3QSYB 2OPRB 4ANDA 1VHIA 3AOAA 3A13A 4HH1A 4G1IA 5DDPC 1HPZA 2H48B 3H98A 4DR2J 4B3SJ 1EQ0A 2E1PA 1FCAA 2EKYA 3TUPA 2Q66A 2CQ4A 2HWIA 4PPDA 5T7LB 5HROA 4JI3F 1W25A 3QAUA 2GV1A 2B4OA 1S12A 2BM1A 3IXQA 4DSFA 2KXFA 3DRRA 4QWCA 1EB0A 4M5NA 3PX4A 2UUCF 1XR5A 1X5TA 2X1FA 1RT1B 2IYGA 3DXBA 4B08A 1IUJA 2W2QP 3QGIA 2GVDB 3CD5A 1HNXJ 3NMAA 3GSIA 3FC9A 5GMDA 2I0XA 2Y1LB 4L76A 1Q81T 1WF0A 1HNIB 4LSNA 5DZ7A 3KJVA 2NSBA 4X4PA 4LF7J 5HQ8A 4Q8EA 4YS2A 4ZVEA 5HSPA 2FJWA 1U8WA 1FRXA 2Y0BB 1R31A 4I2PB 4DS4A 4WZMA 2KH9A 2RQ4A 4F0KA 4TN2A 2BANA 2GAHC 1IBMJ 1VBZA 4PWUA 2C3YA 3KLHB 1ZZNA 3FGVA 4J9KA 5E0OA 1T9YA 3RAQA 1B7YB 2RD5C 1H0HB 4USWA 4DSIA 2H3EB 3BH6B 5LMNF 4F04B 3DI6B 2OPRA 1SUQA 4HKQA 5E7OB 3BYRA 3ILLA 4OQJA 2KM8C 3PY8A 3OTOJ 1RUSA 1VCTA 4Y6IA 1UW4A 3NLCA 4DCPB 3GB0A 3VAIA 1NKBA 3PXGa 2XO7A 2I38A 2JVOA 2FPHX 2GJIA 2VC1A 3BGLA 4J37A 2CQ0A 2JSXA 2QE5A 2ZOFA 4LVOP 3R2DJ 2KI2A 3CCZA 1EZZB 4CWBA 4DU8A 3NP5A 2HGMA 3ISZA 3TQEA 4EU0A 3GIJA 1FJGJ 4NLGA 1CS4B 2XHWA 3LP2B 2QC3A 4I68A 3MCSA 1RLCL 4N47A 2Y1IA 1TVRB 4JBCA 1WF1A 4DR6J 3ZO7A 4IKAA 4R8UB 2KVIA 3CO9A 4ZVHA 1GMUA 5LT5A 1NO8A 2XMKA 3A8IA 4K5RA 3J80U 5KT6A 2HVEA 2POKA 3MPVA 3M32A 1NAQA 1OJ4A 1S1UA 3DOMB 3Q24A 1C1CB 2XEXA 1F0XA 3CJ3A 4OV1A 3W66A 1EJ7L 4CP5A 2H4WB 2GS8A 1ULRA 3JSMA 5D8HB 1S1TB 3NY0A 3ZZYA 4DUTA 4DR5F 1M5KC 1OPIA 2YWGA 4ZJLA 4DPYA 5LMUF 4P52A 2XLJA 2HK2A 2DT9A 2VDIA 5FJ4A 2E9ZA 3F41A 3TAMB 2J9CA 3E51A 5KFDA 4DV6J 1A7GE 3PJXA 2UUWA 4KHRA 3KJQB 2X7IA 1U09A 3MM8A 3NRBA 1WHYA 3CMQA 4ECVA 1HFEL 3OXLA 2HNDA 1VQ6S 1VHFA 1IKWA 2RS8A 4KIAA 4RW9A 1Z2ZA 4ZA1A 4DCJB 3OL6A 2GO9A 1REVB 3GYXB 4DV0F 1UETA 1RTDB 1XNRF 1TFYA 4OYWA 2LEPA 1Y00A 4IQMA 3J81Y 1SKSA 5GVQA 3U1MA 1RT6B 1VDHA 3D0HE 4DZDA 1MN7A 2HHPA 2LDYA 2MHNA 2QSWA 3NGSA 3VHQA 4RNFA 2LQBA 4R5PB 2HKEA 2O3DA 1JLEA 4OJGA 2GHVC 4RUAA 1FRIA 4HHJA 2Y8WA 3VQTA 1TFWA 1PYTA 3CD0A 4OI2A 1QAJA 4DSLA 1Z2LA 2G4BA 5KFHA 4K0KF 4PG5A 4DQSA 2WOMB 4TQSA 2B4UA 2Z4PA 2AF6A 2VFUA 4OX8A 4PKDB 3K5OA 1KVJA 3G8QA 1RA6A 1LK7A 2EI5A 5DM6Q 4WCEQ 4MH8A 1WNEA 5KFGA 3GLJA 3M6XA 5KFJA 2B6AB 4PG6A 4RNOA 4GO7X 2H9ZA 4AQYF 3EPIA 2HAIA 3L95X 3BGRB 3B4DA 4I6WA 2R2UA 2XBPA 3CJTA 4H4OB 1UEVA 2FZKB 2ZD1B 1FDAA 4JI4J 4QWDA 4RW7A 4ZDNA 3T9NA 1N32F 1RXOB 2F4FA 1KNZA 1X0FA 2DNRA 2JLGA 1VC6A 2DKOB 1Y3KA 4FF4A 3HJVA 4NZ7A 4A8KA 4OIXA 1JX4A 4N8OA 3WC0A 2Z2MA 1GXUA 3QQCD 2FHOB 1AFJA 3BGOP 4Y34A 1BC6A 1JLCA 2F40A 1T05A 1RAAB 1WC1A 2RMLA 2RRNA 3BKTA 3F56A 1I1GA 1UFWA 3I5BA 1OSDA 3LP1B 3N79A 4NLOA 2ZD1A 1PAUB 2YX1A 3ICLA 2QFJA 4LF6F 3PZPA 3CCES 1M5HA 2QMXA 1R43A 1IKXB 2HRUA 2O1PA 2ZUGA 4LF4F 1CSJA 4NWBA 1HD0A 2B7BB 3NCRA 4EYIB 5C24B 3Q83A 3GONA 3B4MA 1RJJA 2UUAF 3R5BA 4ZPBA 4ZVUB 3AH6A 3V6DA 4JI5J 3F44A 5JVGQ 4JYAF 2RKIA 3A3NB 3KJNB 3KLGB 5LMNJ 2HZAA 3L3CA 3QJJA 3MGJA 2B7CB 2QGFB 1RB0A 5EGYA 1PAEX 2OPSB 5LM7E 3KNGA 1RAHB 4ZLLA 3Q8RB 1IBMF 1K1SA 1REGX 5DQGA 2HHQA 3SFUA 1WKKA 4C11A 4K4UA 4WFNQ 3SDEA 2UZAA 2ZC4A 3TNVA 5LOQA 4YR3A 1I94J 1HQEB 4K4YA 1WI8A 2DO4A 3AQPA 4LT6A 2ZZTA 2KM8B 3PYGA 1S99A 5D78A 1KKHA 2GW8A 4B17A 1ZTTA 1ZA2B 4C8YA 4ANCA 2C3PA 2R7TA 1HA1A 2L9WA 3OSNA 1D9DA 3S8SA 1GTEA 3DYAA 2KFNA 3BV8A 5KT2A 2XI3A 4WE1A 2F65A 4DUZJ 5F8MA 2O66A 3RW6A 1ZS6A 1DTTA 3CC4S 1NKCA 3LP0B 3IS9B 1J5OB 4LSLB 2XYPB 1FRLA 1CJVB 1Q1KA 4ZP8A 2N3OA 2CUYA 4OYIA 5AE1A 4Q45A 2YWFA 4I6YA 3WX4A 4H4MB 3OL7A 4X4UA 5KFYA 3TJ9A 4I7FB 3OFHA 5IC6B 4NLVA 2Q79A 2L08A 3EMTA 4RBVA 1FRMA 3RRKA 4P2SA 3WIUA 2RS2A 1UKUA 2EFGA 2QLWA 1W2IA 1NBEB 1HNVB 4MKAA 5LXRA 5DZ6A 1HWIA 3UDEA 4PXBA 3PR5B 2VQFJ 1RWOB 2FD2A 3HKZD 1H7WA 2MHEA 4F2SA 4Q8FA 2LP4A 3LP2A 4I69A 3GJTB 4ECRA 2EC0A 1AB8A 1PILA 2LA4A 1UPPA 2RDDA 4DL0C 3CCRS 3FQKA 4KH1B 1S72S 1RWVB 3ONQA 4JV5F 1JLAA 1S5ZA 2HVDA 1PC5A 2BE7D 3Q86A 1RHMB 3K89A 1KONA 1FNXH 3AD8C 5HMWA 1W7WA 1QTNB 1XWLA 2DBBA 1SC4B 3O6QA 5IV3A 2ZH4A 4EYHB 4X4NA 3GU0A 2V2ZA 3FZBA 2DNGA 4WZQA 5GMEA 4JI1J 4WKYA 1UWAA 3PRDA 2ZHAA 2V0NA 2XULA 4LRAA 1RT1A 5ETRA 2D41A 2R7UA 2AYBA 9RUBA 2V4RA 1QAIA 4IFYB 2QT7A 3K57A 2CJXB 4CH7A 1IVZA 5ETMA 1Y9OA 1SIWB 3NAHA 3PVXA 2CJQA 2YQ1A 1HW8A 3EXCX 3K5PA 5KFMA 5BR8J 4IFVB 5D6GA 3OHBA 1LFWA 4M5LA 3AT1B 2DR8A 2DVIA 2JC0A 3UPFA 4H54A 2W8KA 3SCLE 2KKHA 3OVAA 2QSFA 4N56A 4DI6A 2HBZB 4FS1A 2D74B 3LW5C 4IO1A 4DFPA 3OUYA 3QT6A 4LFCJ 2MY8A 4G6VB 3Q8PB 1B7FA 4B9LA 2BQ3A 3OV7A 2EC2A 1YX2A 5IT9Y 1TAQA 2AP6A 1F2HA 1OS5A 1VRQC 3R1LA 2DR6A 1WTBA 3GILA 1BQMA 2HFVA 2F63A 2VIHA 2B43A 2F9JA 3M6UA 3I32A 4L74A 4UT4A 2KG0A 1QSYA 1ZM3A 2W2MP 2WONA 4E8UA 2PFFB 1RT2B 2RJZA 2R8JA 2WW4A 4F7VA 2HNYB 3U7JA 5J2QB 2A2DA 1H72C 1I3OB 2BJEA 2RILA 3GZ7A 3O8WA 2MEWA 3FEZA 3MEKA 5DS7A 3TARA 4C8OA 4F2RA 2FQQB 3QNWB 1AXQA 3R7BB 2YKQA 4JB8B 4F0HA 1BQNB 4ZPDA 3HFKA 2HQCA 3K17A 2OMLA 3NCPA 2M5YA 2KB2A 1UVLA 2NXCA 3HT3A 2ALYB 4F3MA 5MLCV 3G96A 2W01A 4DR1J 4K59A 3HPOA 1Z1ZA 1IBKJ 1TUGB 3M6WA 2MJUA 3VTIA 1TK0A 3MMJA 5I42A 4QW9A 4CTAB 1E6VB 2XS2A 2DJWA 3WX8A 4OHXA 4CT9A 1RP5A 3CCLS 2VC0A 3DU6A 2C1EB 2QEXS 5B0EA 3B6BA 3HK2A 1C0UB 1N5VA 2VFVA 4UOHA 1HARA 1UFKA 2HQDA 4G1QA 4O3OA 5C25A 2R2SA 5B0DA 4YY3F 1XBWA 4DF8A 2ZOGA 1DLOB 1BWEA 1NEEA 2QZ8A 1S6QA 2YNGB 3S6EA 3J7YI 1JXEA 3AB4B 1QE1B 2IRUA 2XG8A 3DDKA 3P4UB 1S9FA 1LKZA 3LTOA 5K5MA 5I42B 1XTZA 4MFBB 4DV4F 4G1QB 3MZIA 4ED0A 3GFHA 1HL6A 4NLYA 1N6QB 4XAKA 2ZJRQ 3JSBA 2CZ4A 1SQGA 3DC2A 4WTYA 2M4MA 2JFDA 2OSRA 4CTAA 4QIEA 2BJ8A 2J7KA 1S4FA 4C8NA 4LMZA 2VQEF 1VS3A 3UO0A 2HFNA 2ZE2B 2B9YA 4OI6A 4DMZA 3QWPA 4FZVA 3CNQP 1UTAA 2OP5A 3RUBL 2GZOA 5KG2A 3HVTB 5G0RB 1XJWB 2QJ3A 1AZSB 2QA2A 3QATA 1VRTA 3CGIA 4U8VA 4DPOA 4EBCA 3J81U 1U1RA 2K06A 1WACA 5HBMB 4KSEB 2QMWA 3KK1A 1CPZA 3R8YA 1H7XA 1S0NA 3W2VB 1M5SA 3OTDA 4EBDA 4C4WA 3UCGA 4DSJA 1RHQB 1U25A 3M8PB 3M30A 3US5A 5F8NA 2OLWA 3MM6A 4RBTA 2LEAA 2W4CA 5DO2A 3OUYB 3M05A 4NL5A 1V9OA 1YJVA 1X4GA 3PX0A 1RACB 3G9CA 2VL1A 4QW8A 1OSCA 1HIYA 4G1PA 4RW4A 3FQLA 1HBNA 4ATNA 3QIDA 4DPXA 2ZHBA 4OX7A 3BBCA 4I2PA 4QPXA 4ER8A 2QV6A 1QJHA 2K1RB 1FT8A 5H9EK 3QYYA 1HNIA 1YJUA 2AJ4A 3NCQA 4LSNB 4F4XA 3CJ4A 3NWRA 4AYBD 3G6ES 1M5OC 4LIWA 1GNKA 2CJKA 2YWEA 5L1KA 2GVDA 2AGPA 1N36F 1U1OA 2BDPA 4GC6A 2GVZB 1RAEB 4Z7YA 4OI4A 2CQIA 1F5BA 2I5JB 1BY9A 2V6AA 4CM2A 2OHDA 4F67A 4ZVRB 2JEGA 3HVAA 3MEEB 6FDRA 1IR1A 2IRXA 2ZDPA 4BWMA 2XMTA 2DY1A 3OVBA 4IDKB 1FI4A 1TUWA 4ID8A 3DOLB 3H90A 4ZCMA 5JUMA 1U4BA 1VQ5S 1U24A 4PXCA 4DV5F 2OO4A 2FLPA 3I0RB 5D4NA 2QMUB 4K4ZA 2V9WA 4K4TA 1E6YB 4CLZA 5K20B 1SL0A 2HHVA 1T8EA 2PI4A 4OV6A 5KT4A 2K7KA 1NJWA 4JI7F 5B09A 2J7UA 3PACA 4Y2AA 2IAJA 4B3MJ 1FK9B 2XMAA 1NK5A 1C1BA 2LYVA 3D0IE 2ZH1A 3ZZOA 3OSPA 1N5QA 1RT7B 2XNQA 4CYUB 2XM3A 3UCUP 1SL1A 3C15B 3BEGB 2EBEA 1Q8IA 1R6VA 1ZAWA 1GMVA 2YBVA 1NUEA 3ENAA 4HVZA 4RWXA 5E41A 4RR5A 2GA7A 3M7VA 1NDLA 3AD9C 3MMCA 4LVNP 1S57A 2GQ2A 4Y2MA 3RYLA 3LWMA 2R8IA 4LSZB 3RBEA 2XMUA 4ZVSB 3W5YA 4BC7A 2E1CA 3KG0A 2EBGA 3BREA 4KV8A 4Y00A 2UVUA 3TAPA 1RTIA 2G1HA 3FEYB 4KB7A 2HFOA 4OFZA 5B0CA 2GAGC 3OD2A 1JQGA 5KFOA 1B99A 2V2KA 2DNOA 2XCAA 3KK2B 4B3OA 2OPQA 1L3VA 2FY1A 4IRDA 2G2YA 4WXWA 4OZ5A 5D4LA 5L38A 2DR5A 3AXKA 1U1PA 2M8HA 4K4XA 3ENVA 4A8WA 1UVKA 3HI9A 3HX9A 1XERA 3HVWA 4OZ2A 5C2CA 2KT2A 4ED7A 3RRHA 2J6UA 2KJWA 4ELUA 2FLNA 2R2RA 3EE3A 2XLKA 3GPAA 5KG6A 2MZQA 2DCLA 3X3UA 2H5EA 4YP3A 3QBCA 1N5TA 4G65A 3ZC4A 3G82A 4NLQA 4LREA 2W9AA 3BQ2A 2E7VA 1LWEB 1Y0HA 1JLGA 3QZ7A 4ECWA 1Q8LA 2CPFA 1RISA 2DHAA 2RE1A 2RDIA 3EVMA 1QM9A 2MTLA 4OYPA 3KK2A 2DNKA 3OXGA 3AOBA 1T3NA 4ZN3A 3UWTA 5KFEA 2R9LA 2HZVA 4WFYA 1TK5A 1PSDA 1FRHA 4ZK7M 1Q0NA 2L48A 1BMQB 3DHWC 4P10A 4X84A 3ZZRA 3FSXA 4ZMMA 2D3OR 1N5YB 2JEIA 5DGBA 1NM2A 4B02A 1WJ9A 1M90T 3MMAB 4I0WA 3UVJB 3BF4A 4C3LA 2VF3A 3A4TA 4U6PA 2HNZA 1W26A 4P2MA 4R0EA 2XSFA 3TANA 2O5DA 1TZ0A 4DFJA 3I0SA 1KS2A 2HZCA 3PRVA 5JVHQ 2OJ3A 1FKPA 3PDNA 5J2MB 5DG8A 5J1NA 1T95A 2JOQA 2BKOA 1IBLJ 5H9FJ 4BDPA 3SYZA 3K0JA 1FNOA 4TY8A 2N4DA 2MGZA 4DR7F 3N01A 3E2EA 1ICEB 2G1DA 5KAKA 4QIGA 3RBDA 1ZAXA 4DV1F 3KTQA 3QO9B 1S79A 2ZJQQ 1T05B 4K8RA 5DQIA 1XMBA 1S7HA 1LXJA 2RAQA 5LJ5Y 3OL8A 2RDJA 2FC8A 1WC3A 2B9WA 2KHDA 3KUGA 4DV0J 1XNRJ 2ZUAA 4DPUA 4WF9Q 1KOOA 4J9MA 3DLGA 4N77A 1X60A 7FD1A 2H4YB 2CNLB 3HXMA 2BQUA 5IWAJ 2DCUB 4JI6F 3C8YA 4KKOB 4ZVTB 1R0BG 4YHHF 1RTHB 4ZIVA 3JQJA 3UR3C 3MECB 4RU2A 4YFUA 3RB3A 4NOHA 4QZVB 3TUJC 1CJUB 3D5MA 5J1EA 2FLOA 1GX6A 2E29A 2K7JA 3R5GA 5IZHA 4FNIA 4E0DA 4UTGA 3UR0A 3GTYX 2HFSA 4Y0FA 3PO4A 2BKNA 1XMOJ 2FJEB 3IFEA 2HVZA 3CIZA 2RQKA 1GFWB 1BWVA 3DM2A 4K7QA 4WXOA 4ZVGA 1YLXA 2D9OA 5H1SV 5KFFA 2VODA 4IOAQ 3FMWA 3NXZA 2MKCA 3M8PA 1TQLA 4CM0A 3OBIA 2QL9B 2WOMA 4OYMA 3MFHA 2B3TB 3PW2A 3TA2A 1KR4A 2R3VA 3K8WA 2B6AA 5A8KB 3FUYA 2MYFA 3N4WA 4ZVOB 5A8WB 4TU8A 3DLBA 1FJGF 3VVTA 3MCNA 1JLEB 1B70B 3TJAA 1WDDA 4ES1A 5F3ZA 2FTRA 3MUMP 3NWGA 3QT5A 3NBPA 2XZWA 4Q43A 1U48A 3HHKA 4A8MP 4W90B 4BWJA 3GG0A 3Q8QB 3PW7A 1VISA 5IM0A 2A6MA 2KJVA 1EP4B 2Q6BA 2HMIA 2ZE2A 1TV6A 3U1LA 4H4KA 1RKJA 2GMLA 2ZDOA 3KLIB 3I0SB 4NLSA 3LAMA 2A1BA 4DEZA 3UW1A 1RWNB 1U1QA 1S7IA 4OMFG 1WC0A 3ZFVA 1BD6A 2FUG9 3GFYA 2HYIB 4NYPA 2ACYA 4IH7A 4X4TA 2LQ8A 3FFIB 1X4HA 3HHLA 3BSCA 2AW0A 2JNJA 4A48A 1S76D 1RWPB 3UFCX 1S49A 2WCXA 3P49B 1D8YA 5CHCB 2HG4A 4IR1A 3KLFB 5EX3A 1LWEA 4IYQA 2DGQA 1IKWB 4HHUA 5RUBA 1FKAF 3U27A 2B9XA 2YX4A 2BQRA 4G3IA 5EUHA 1F9EB 4ZPAA 1VLOA 1WOOA 1WI6A 4QWAA 4DQPA 4KRWA 3HZEA 2B0GA 2F8HA 2G9OA 3M32B 4ZPTR 5GADI 3UQSA 3V6HA 1HNXF 4JI4F 3ILIA 4GC7A 1VBYA 1NK4A 1Q16B 1RWWB 4GKJF 1MG7A 2DD8S 1WHWA 4YB1P 1Z4UA 3UCZP 2R7WA 4R8UA 5EWGA 5CZXA 1UL3A 4TY9A 5LSLA 3THVA 3J7Z5 4ETXA 2F4VJ 4LF9F 3E01A 4PXEA 1ROFA 2IPOB 2YNFA 2O01C 1LFPA 2RH3A 3FEXB 4WFBQ 1YITS 3G87A 1S6PB 4DX6A 2XNRA 3O2IA 1VQYA 2NZCA 3PEJA 4FP9A 4DR2F 3W62A 2Z0GA 1MMNA 3G2XA 4IH5A 2AEFA 3OFFA 4FF1A 3QFWA 3N6LA 4OZNA 2VPYB 2YWKA 4DV1J 5A0YA 5D4PA 1SQEA 2QFIA 2ZBIA 3V2UC 1FXLA 1VR6A 3A12A 5EWEA 4UF4A 1LK5A 1ELOA 2J7WA 4V1Ak 4DOZA 1VC5A 1FKOA 1T9TA 1B0VA 1CJTA 3D6MB 3GWCA 4P7VA 1IBLF 1Y3JA 5B0BA 3W2WA 2AHOB 2DNYA 2FHKA 4I2QA 1FVSA 5CYMA 1NDCA 2P8IA 4UZCA 1WOPA 5E5NA 2MKHA 4PWWA 2XY6A 4QYZK 3DLKB 1NDPA 4DPTA 1C1BB 3CXCR 1NSKL 1SKUB 2ZVIA 3H20A 4WYWA 4ZPVR 3VCDA 1SPBP 3BS9A 3IBWA 4M94A 3PRBA 1CQMA 4QQBA 1HQUA 5B08A 4K2JA 1QSLA 3TRGA 4O3RA 4NA1A 4RLEA 3I0RA 2JFKA 1X5PA 2IJNA 3DOLA 3TEGA 2W2PP 2X51A 1SJQA 4LUBA 1D9AA 1UJ5A 4I4BA 1IBCB 2K3IA 5ETKA 3ZXWA 3PKMA 1RHUB 4PG8A 4NMLA 5J2NB 2DGTA 2VASA 4PG4A 3PFOA 5L8RC 2GIQA 5ETLA 3OVSA 4AT1B 4P73A 1TL1A 2PC6A 4HL9A 2PMWA 2V8HA 3MM9A 3Q2SC 4MKYA 4LQ9A 2HLUA 3T41A 4H4KC 3MMBB 3VV2B 2V8PA 1U2CA 2ZITA 3RRGA 2OGUA 3MCOA 4PYAA 1VQ7S 5F8JA 3AA8A 2HVHA 1R6YA 4ED8A 5LJ3Y 2BKPA 4WU2A 4KTQA 4LR9A 1WG4A 2KU7A 1FVQA 4J7CA 3KMSA 1F6TA 2R7QA 4UOGA 3L7UA 4K4VA 2Y9HA
chains in the Genus database with same CATH topology
3W2VA 1U7LA 4DQQA 4QCLA 1L3UA 1O5JA 2NPFA 3TO8A 4V19J 4B3RF 5B0AA 4KO0B 3GFZA 2IM3A 2C3UA 3TI0A 2Y0SD 5F9NA 3THTA 3V6KA 1TP7A 4GO5X 4O3PA 4Y28C 3GQCA 2QA4S 3MDFA 4I64A 1OIAA 2OSQA 4OHZA 2YNFB 3TYTA 2APOA 4A8YA 4MK7A 4DSEA 4C8MA 4DBQA 3EXYA 1RAJA 2AJ1A 2IMOA 2Q43A 4Y65A 5K8OA 2WK4A 5HO4A 2CG4A 2YNGA 1F2GA 2M52A 3R5AA 3VAMA 3M8SA 1F5AA 2OD6A 4LIRA 4J9OA 1KRPA 1XK8A 2YKNA 5EX0A 4NLXA 2YH1A 4KGKA 4DN0A 4ETZA 5KG7A 1QE1A 3VWSA 1RWUA 2NUUG 3ENWA 3CCQS 1NJYA 4WFAQ 3CCTA 4ZP6A 1HQEA 3I82A 1RKIA 1KN6A 1TKZB 2PIIA 1S10A 1KTQA 4O0IA 2VONA 1YJ9S 3IN5A 3JYTB 4KQZA 3HVRA 4WKRA 2ZVSA 4C0OC 3SMZA 2CRLA 4DQRA 4A8SA 2RB7A 2DHSA 2DO0A 5K8NA 1D9FA 3HHLB 1WTFA 3FFIA 1MROB 3FMBA 1RI7A 5KFBA 4XK8C 1KD1T 1N4LA 2HNYA 3D1HA 4JI8F 2P5VA 3UE2A 3DLHA 1F5CA 1G7CB 3DN9A 4NCGB 3LO3A 3HHLD 2UXDF 4LFBF 4C9DA 3MR6A 1HD1A 3M1VA 2ABYA 3N6NA 2ZJPQ 2A2CA 1SIZA 1SV5A 1SKWA 3H59A 2CKWA 4O4GB 4MMOA 2FJXA 1APSA 3QGGA 1FJEB 2VZ9A 2WHOA 3K5NA 3LP1A 3DLLQ 2JDJA 3MPYA 4F02A 2BABA 3QAEA 3DM2B 1FXRA 2FVPA 4QOTA 2XY7A 1QTMA 4FS2A 2CPDA 3IA0A 2VBXA 4YB5A 4BBYA 5J1EB 3V6JA 5U47A 3LWLA 2PD1A 2AGOA 1LV5A 2J6TA 2MQQA 5KFVA 2R7OA 4RWWA 4YR0A 2CQDA 3CSKA 3E8OA 1NH7A 4USJC 3T1HF 1P27B 2MSTA 5DJBA 3M2RA 5K8MA 5D4OA 3BB5A 1KHWA 4E98A 2HS0A 3CDBA 2E1AA 1MU2B 1SJ4P 2CPYA 1UMJA 2BVZA 2DPIA 3VAJA 1P1TA 4Y2IA 4N8NA 4CI0B 1AFIA 4QBUA 1N33F 2FC9A 2GNKA 1JLAB 3TVZA 5FLXY 3OJSA 1U1NA 1ZM9A 3D0GE 3GE9A 5J2MA 1IJEB 1IBKF 1G1XA 4FF2A 3MR2A 5B0GA 2NR0A 3SCJE 4F26A 4OZ0A 2VG5A 2E5LF 2WAQD 1YTYA 2DH9A 3UNGC 5H9EJ 1HNZF 3MEGB 5CXTA 1HYSB 3OLBA 3SV3A 3SQGB 3RZAA 2W4PA 5CYQB 2BA9A 2YNIA 1HMVA 4PUOB 5THWA 1S9EB 3NGKA 3CT9A 2EFOA 2MJNA 3GFXA 2CQBA 3MMAA 1V3SA 3NKYA 3CUNA 4BCAA 2IC3A 1PGZA 2HGNA 1RA7A 2A10A 2ZHOA 1XR7A 3IS9A 3IGVA 1IN0A 1DTTB 1JLGB 1J5EF 3M9MB 3V4IA 4QR1A 1U2FA 2HHWA 4JOUA 1QUPA 5CA5A 3HM9A 1Q86T 4URQU 4HLBA 4WFXA 2JEJA 2UVVA 1U45A 2D7SA 2J0QD 2EK6A 1HWJA 3SXLA 4ZKAA 4U7CA 5KFCA 3PIPQ 5J2PB 3OLAA 1NK0A 2E9TA 3GV7B 1RYSA 2YKAA 2KYZA 3GMGA 4M63A 3KOAA 1RK8A 3C6UA 3DHXA 1FEHA 1LWCB 5GAHU 2IHR1 2QA4G 2QRRA 4KPYA 4EFAC 4ALZA 2ASJA 2GJ2A 4ZCLA 3FRYA 5F9LA 2LKZA 3I6PA 5I3PA 4C7QA 2J76E 1FRKA 4WFZA 2KG1A 1KFDA 4F3QA 4O3SA 3V81A 4B3OB 2CYYA 3FSYA 5KFPA 2AGQA 2RKIB 4IG3A 1S0MA 3V6DB 2DITA 4TKTA 3RB4A 4HI1A 1IKYB 1YGYA 2LEBA 1N0VC 2OPSA 3E3XA 2CVEA 1S1VA 2V5HG 3MMCB 4QU6A 2UUTA 1FTRA 1M5VC 2RF2B 2OIHA 3I4HX 1UJ4A 2DRAA 3IRXB 3DLJA 4NZ0A 5C24A 1VQKS 2WSFC 4W92B 4CZCA 1VIOA 5K14A 3AJ2A 3QIPA 5FIIA 5A8KA 1Q7YT 1Q8BA 2JLFA 3MAHA 2VQFF 1UVNA 3E2EA 2KN4A 4KGMA 1Q7LB 2WB1D 3MTKA 1Q78A 4DQIA 2HHTA 2PA3A 3PM9A 2HS4A 4AL7A 3CD7A 2JHEA 4RU9A 4DSKA 2ERRA 1UA0A 3MEEA 1HHSA 1JLCB 1FNMA 2B56A 1KTVA 2F7VA 1YJNS 3CDEA 3PR4A 5KFNA 2F3JA 3SEOA 3FSIA 4DUZF 1I6JA 3THPA 4Q0BA 3CCSS 2I2YA 3VQSA 1B64A 4ZHRA 3H4DA 2LCWA 3DCAA 3CEDA 3CMAS 2W9CB 2UU9F 4FXWA 2RU9A 3KHGA 2LXIA 3O1LA 3EX7B 3WDOA 4TNOA 4OZLA 2P6TA 5GADU 2J8AA 2SXLA 2JEFA 5HBMA 4X62F 2VPXB 1NK6A 3MM6B 3GIIA 2XMWA 1FJCA 1VQ9S 5KG1A 3CCUS 5GAEI 4PQUB 3M8QB 2P9EA 1DQ8A 5D3GA 4OHVA 2D3ZA 2FGOA 4JUZA 1DTQB 2DTJA 5EHHA 1R0AA 4XO0A 1ZYQA 2FIUA 4QPTA 1X7VA 4LFAF 2KO1A 3L09A 2YNHA 3DOKA 4N5SA 3I87A 2FGCA 4C0HA 2JLEA 2VG6A 2NQPA 4ZVFA 4ERDA 4C8LA 3O5TB 1VQ8S 2ZNZA 4CCHA 4QYZJ 3HDSA 1R8AA 3T5KA 1AW0A 4MTPA 1X9MA 4OX9F 2HVIA 2J9DA 3VAGA 4FN5A 1N6QA 3VAFA 3G4SS 3ZZPA 1OQ6A 4KJIA 1A9NB 5E3QA 1PC4A 5HMXA 3VF0B 2VD3A 5K9FA 3BQ1A 2QA1A 4OLOA 2G13A 3Q23A 1G6BA 3DOMA 3K5MA 4N76A 1HBUA 1O0PA 3K8VA 3NL0A 2F8EX 3MR5A 1H2VZ 1P8GA 2CZVC 1HW9A 2I9SA 2Y1RI 1M1KT 1UVMA 2BV3A 1UJ6A 1C4AA 2CPXA 4ECYA 4YB7A 1V3RA 1IR0A 5IFMA 2YKPA 1X9WA 4D3HA 1YVFA 3T5LA 1QAYA 1M5PC 4IOBA 1OPZA 4TLQA 2C42A 1RT4B 5J2QA 1K1QA 1YRUA 2CDQA 2W9CA 2CQ1A 1JXLA 1JJ2R 4EZ6A 1HHTP 5KFAA 4X4OA 4KFBB 3MR3A 3TR5A 2DHGA 2DH7A 4Z2XA 4RW6B 4NPOA 4Q7AA 4ED2A 3BQ0A 4IFVA 1U49A 1IKVB 4ECXA 4RNHA 1GH8A 4DG1B 3M2VB 1U8SA 1YQHA 3UI3A 3MM7A 4QWBA 3KJVB 3QMQA 1T3OA 3AY0A 5IT0A 3DRRB 4ZP7A 2W8LA 3G8SA 3RR8A 3D1OA 2ZBCA 4ED5A 4DFKA 3H2UB 2IVMA 5AXLA 3TP2A 2G0CA 3MPWA 4Y2CA 2XGPA 4F25A 3TQ1A 2C22A 1HQUB 4RKUC 3RAMA 4NCAA 4FF3A 3MM7B 2MZ1A 2WRMA 2AJ0A 3IWNC 3BSOA 4DG1A 3OQ2A 4PWDB 1KC8T 3Q2TC 1IKVA 3NS6A 3OTEA 1NZAA 2CJ9A 2XSJA 4AL5A 4DDFA 2BXJA 3JSYA 5KFQA 1YI2S 1L5UA 1H98A 2M3DA 1RT4A 2JWNA 4U67Q 1N8RT 3IR6B 2RU3A 3EGWB 2DGXA 4JI5F 1YIJS 1HBMA 2WW8A 3O44A 4ES2A 2M9KA 1NRKA 4C3KA 1IXKA 3DMJA 4CO1A 5BYSA 3VZIA 5HLFA 1JLFA 2DHXA 2RQMA 1JJHA 2CQGA 3V81B 2PMHA 2HWTA 1VFJA 2RQCA 2ZZNA 1UWBB 3R27A 3G8TA 3CD6S 3S7RA 2HHUA 2PI5A 4UY8T 3OHAA 1NK7A 2ROGA 4ZPWR 4FXVA 1LWCA 3MD1A 3IAM9 3N6MA 4C0BA 1S6PA 1KQKA 3LOUA 1QY7A 4I7FA 5CQGA 4BS2A 1HBUB 2K3KA 2I1RA 1FD8A 3E01B 5DM7Q 4LF7F 1HWLA 2IVFB 4K4WA 1XMOF 1D0EA 1J5OA 4BC9A 3QLHA 1XEZA 3P96A 4FVMA 4KC5A 3J80Y 2DNNA 4OLPA 1XMQF 2RUGA 2V4JA 5MAOA 4ED1A 5AXKA 3QJLA 3MI7X 3CCVS 2EVZA 4NLUA 4DUYF 2A3JA 3CCWA 4I6AA 5FDLB 2DISA 1KLNA 2ZKTA 2LDIA 2LQJA 4Y3CA 1C4CA 5B0FA 1FDNA 2JX2A 1JNRB 2U2FA 4AXJA 1LW0B 1JLQB 2B5JA 2IM2A 1FE0A 1NK9A 4KE5A 3C46A 2VG6B 1HYSA 3SDEB 3KLGA 4U7UK 2CQPA 3KKFA 3TVKA 2ZH3A 2HQIA 4DF4A 2NZ4A 1N0UA 3GR1A 4NYZA 2AX1A 1H3DA 4M5DA 2P9GA 2PN6A 1N56A 2P6SA 4DLEA 2UV8G 5AJ3F 2DR7A 3IG1A 2CPHA 4OI0A 2KDOA 4WIIA 4B3TF 3N28A 5SUHA 1RT2A 2DGOA 2KZZA 5KFRA 3PFEA 2GHWA 3WBZA 2GX8A 4NA2A 1N34F 4Q0BB 3OR1A 4JV0A 1N52B 2Q3PA 4O23A 4DV6F 5C5JA 4PRFA 4PQAA 4B9UA 2VFSA 1VQMS 5DDOC 2KRBA 3JTOA 3EPGA 1IQTA 4DJBA 1U1MA 2HPUA 3LANA 3NNCA 5L1JA 3A1YG 3MECA 4BHQA 4N41A 4L3NA 1HWUA 4X4RA 1U26A 4ELVA 2FVSA 3ZZTA 3SZ2A 2V8VA 2JZ5A 3PEHA 1Q79A 1NHVA 3CJKB 2ADCA 3G6XA 4HDHA 2R7SA 5EDWA 3CDAA 2HRYA 4H4OA 3H5SA 4OL8A 2DNHA 3IRXA 4TU9A 1WG5A 4ZLPA 4FNHA 1R27B 1O8BA 1K0TA 1NB7A 2XMMA 3P6YC 1MMLA 1FKPB 5K14B 1S6UA 4QIVA 2BZ2A 5CCMA 3OTOF 2ATLA 3IWXA 2MB0B 1P6TA 1K8AT 1X8DA 5KT5A 4R5PA 1MW7A 3I5CA 5F0UA 5KFTA 4OJ3A 4ZCKA 1WHXA 4O44B 4EU0A 1VQSA 2WSEC 1UVIA 4OI3A 1ZPVA 4NX9A 1VQLS 1PO6A 1REVA 1U6ZA 1ZZFA 3LQVA 2YKMA 3VAHA 2D9PA 2HIQA 3T9ZA 1MWZA 5EWFA 2ZH6A 3JYTA 4B3MF 4OZ1A 5A6WA 5L9XA 4B9SA 1VJWA 1JLQA 1LW0A 3TAMA 4XDCA 4OJ1A 1H38A 2RSQA 4DL4A 4DR4F 1B0PA 4C98A 4QJVA 3I9V9 3FDSA 4EZ9A 2OMOA 1S1TA 1YRXA 4UQTA 1WEXA 1LXNA 3IO1A 4ICLA 4LSLA 4NYOA 5T14A 3K5LA 3PW0A 2EW9A 3QWUA 3LP0A 2HHXA 1OO0B 3KMQA 2DGSA 1X4FA 2ZKUA 1XR6A 4DV3F 3H4BA 2ASYA 4RX6A 5KTQA 1U1KA 3V4MA 4AFFA 1S1WB 3FCHA 4X66F 4IUFA 2R7XA 2LVWA 4Y2KA 1TAUA 3MEDB 5GMKa 3GIKA 5A8RB 4DV7F 4KV8B 5DLFA 2LECA 2IRYA 4NRTA 1QVGR 2WBMA 2YKOA 1GXLA 2ZC3A 5CYQA 3T6JA 1S0OA 2IC3B 3SQGA 2UXCF 1GT8A 5HLFB 3UD4P 1RTIB 2DH8A 2MPUA 1BQXA 1S9EA 4LF5F 3CB4A 2MQMA 2ZNYA 1IJFB 2M70A 2HGLA 2PE8A 3DXSX 3DI6A 1HBOB 4R0JA 5KG0A 2OTJS 3OXFA 4CO2A 4NCBA 2CFXA 1K9MT 1E6YA 2ZZMA 3C6TA 2XC9A 3KLHA 4ES3A 3PIOQ 2CQHA 1TKXB 3MURP 1TKDA 3DRSA 1T94A 4J9NA 3S1TA 3EZ5A 1U1LA 2FJVA 2OH2A 2VOPA 4JI2F 5I3UB 2U1AA 2ZH9A 2FVRA 2JJ4D 3UDLA 5DQHA 3M2RB 3BSNA 2QIFA 2XSJB 4IDKA 2W9BA 2MZJA 2LXFA 2MKKA 4XPCA 2D3UA 4NA3A 4RW8A 5AE2A 4O3QA 4J5OA 4J9QA 1FXDA 2XY5A 3CC7S 5F0WA 2NPIA 1AROP 5SZTA 1FESA 3T5HA 2J5AA 2VBZA 3GYNA