1N5QA

Crystal structure of a monooxygenase from the gene actva-orf6 of streptomyces coelicolor in complex with dehydrated sancycline
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
112
structure length
112
Chain Sequence
AEVNDPRVGFVAVVTFPVDGPATQHKLVELATGGVQEWIREVPGFLSATYHASTDGTAVVNYAQWESEQAYRVNFGADPRSAELREALSSLPGLMGPPKAVFMTPRGAILPS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The structure of ActVA-Orf6, a novel type of monooxygenase involved in actinorhodin biosynthesis
pubmed doi rcsb
molecule keywords ActaVA-Orf6 monooxygenase
source organism Streptomyces coelicolor
molecule tags Oxidoreductase
total genus 28
structure length 112
sequence length 112
chains with identical sequence B
ec nomenclature
pdb deposition date 2002-11-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03992 ABM Antibiotic biosynthesis monooxygenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.100 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1n5qA00
1AFIA 5F0UA 2GGPA 3MCSA 5B0FA 1MWZA 1OQ6A 1RJJA 4A48A 5B0DA 2K1RA 1XBWA 2AJ0A 1VQSA 3DXSX 3KNGA 4Y2KA 1V3ZA 1KVJA 4OJ1A 3DCAA 4Y2MA 1S6OA 1Y0HA 4FNHA 2FIUA 2PGCA 1FESA 5A6WA 1X7VA 3GZ7A 4A46A 4DL0C 2BJEA 2GA7A 2HQIA 1TR0A 2IFXA 3BGUA 2EW9A 3BN7A 1R6YA 4HH1A 3HHLD 1AFJA 1P6TA 3BR8A 1P8GA 4F67A 1Q8LA 1OQ3A 4A4JA 2XMUA 1GXUA 1Y9OA 2QYCA 4Y2IA 3VTIA 2GGPB 1GXTA 4NPOA 1AW0A 1JK9B 3HF5A 2BJDA 3I9ZA 2W4CA 2ROGA 3TRGA 5K9FA 1OPZA 1TZ0A 5KAKA 2XMJA 1MWYA 5B0GA 2CRLA 2LDIA 2N4CA 3KG1A 2IYIA 2XMTA 4HI1A 2GV1A 1Q8BA 2HLTA 2K2PA 5B08A 1YJUA 1FEEA 2G9OA 4HI2A 4OJ3A 1K0VA 2OAUA 3BB5A 1ULRA 4NL5A 3TNVA 1QUPA 1U7LA 1WD6A 1Y3KA 2AP6A 4ZOSA 2GFFA 1LQ9A 1SB6A 2LQBA 2XMWA 3K7RA 2QLXA 1KQKA 2HFNA 3F44A 4QOTA 3QGPA 5B0AA 4A47A 2W4DA 1KVIA 2ZDPA 4OJHA 2KKHA 3WDOA 2OP5A 1FE0A 2BUNA 1YJVA 2OKQA 2ACYA 3BDEA 3IWXA 4FNIA 3KG0A 1N5VA 2K7KA 2VH7A 2OMOA 2AJ1A 2OD4A 2PD1A 3IWLA 4DPOA 1TL4A 2QLWA 3HHLC 1CC7A 3FGVA 1SQEA 4ZA1A 2XMKA 2FHMA 2QIFA 1CC8A 2GCFA 1Q53A 3LO3A 2BYCA 1APSA 5F0WA 1YJTA 3BM7A 1FE4A 2GO8A 5T7LB 1SI9A 1S6UA 4Q2MA 1Q4RA 2N4DA 4Q2LA 2RU9A 1N5TA 4DN9A 1FVSA 5T7LA 1W2IA 2OFHX 3LGNA 4YDXA 2HFOA 1TUVA 2ZDOA 2LQ9A 3LGMA 3BF4A 2KT2A 5B0CA 2W4PA 3HX9A 3T9NA 2L3MA 1N5SA 4OJGA 2XMMA 1FVQA 2AW0A 1N5QA 2OFGX 1JWWA 1YG0A 5A6PA 2BBEA 3HDSA 5B0EA 3TOQA 3HFKA 2XMVA 3UDCA 3FRYA 4U9RA 2KYZA 1Y3JA 1YJRA 2ASYA 2HLUA 2JDJA 2FB0A 5B0BA 3MZIA 1IUJA 3FMBA 3HHLB 1TL5A 3KKFA 2Q3PA 2OD6A 1URRA 2FTRA 5IXUA 1FD8A 4OIXA 2RILA 2HIQA 2LXFA 2ROPA 3HHLA 3CJKB 4EFAC 1YRXA 2RMLA 1CPZA 1VQYA 2IYGA 1OSDA 1X0PA 2KT3A 4YEAA 2VV5A 2ROEA 2N7YA 3E8OA 2K7JA 1X8DA 4HH0A 2RSQA 4HL9A 5B09A 2K1RB 3QMQA 3CJKA
chains in the Genus database with same CATH superfamily
1VBZA 4B3OA 2HVEA 2DNPA 3Q8PB 1CS4A 5JVHQ 1QLNA 1R7IA 1LEOA 2RF2A 1EJ7L 1HHQA 4C8NA 2COLA 4I2QB 2IHR1 3I55S 5KFWA 3LPYA 4ZN3A 2HVDA 2RQKA 1VJQA 3PEHA 4OQJA 4V19J 2WONB 3W9HA 1KNZA 1WHXA 3VAGA 1SJRA 3ADAC 2ZOMA 1FA0A 4NXNF 3L4BC 1UJ4A 3PIOQ 5D77A 3CJ5A 3GIKA 2RQ4A 1G7CB 1PC4A 2KXHA 1U1MA 2CJXB 1IR2A 3W2VB 2IVMA 3TZXA 1Q81T 4RW9B 4DR7F 1ZZFA 1RHJB 4K2JA 1GX5A 5ETVA 5IQ6A 3I0SA 1U2FA 5BJRA 4LMZA 5KFGA 3JS9A 4LF7J 1YRXA 2GMHA 4RBTA 2ZZTA 4K4SA 1AXQA 4M5KA 3KWMA 4HACB 2MY8A 4ZJLA 1SC4B 1RTJB 3EUNA 1S48A 2QO3A 2ATCB 1X4EA 2RQCA 1RAJA 1M5SA 3V6KA 5AJ3F 2I0XA 4ILRA 4NRTA 1S10A 1G6BA 1N56A 4PUOB 2W4CA 3TRGA 1F60B 3K0JA 1E6VB 1RTIB 1ULRA 4S0MA 4WBFA 3BO2A 2UUWA 4JI5F 4ETZA 1RBLA 1SJFA 4QR0A 2JEJA 4H4KA 2VFSA 2A18A 2VHGA 1UW4A 1NNDA 3RG6A 1UJ5A 1O5JA 1SV5B 3K17A 4Q2MA 3NAHA 4X4VA 1YWXA 5CCLA 3UPFA 3KTQA 4V1Ak 2Y1IA 4ES2A 4C11B 3HJVA 3PVXA 1WC5A 3NNHA 4HKQA 2EBEA 2VDIA 2ZC4A 2FVCA 1B4SA 3E3XA 3EVMA 4OX8A 2R8JA 3PKMA 2YNFB 2FZKB 1WTFA 4UOCA 1MROA 2YVSA 3ELHA 4DQIA 2BDPA 4C9DA 2J6SA 3AOCA 3H7HB 3NCRA 3ZNUA 2B51A 2CPYA 1OPZA 4PG6A 3KJVA 4ZN1A 5KFCA 3QT7A 1K73T 1S1VB 4LUBA 2E5JA 4WZQA 1FK9B 2GFFA 1EAYC 2RS2A 3FRZA 1JLFB 2N3LA 3CO0P 4L75A 1U6BA 2V8DA 5FLXY 1VOMA 3PHEA 4ECVA 2IRYA 1UVKA 4K0KF 3SQGB 1YLXA 4ZDNA 5JVGQ 2DH9A 3PO4A 4AL5A 1J5OA 1JWWA 3NY0A 3QGGA 2CJQA 2CPIA 4X62F 5E5NA 1TVRA 2HZAA 1HARA 5J1EA 2EKNA 4I56A 2RSQA 1E6YB 3C19A 3AQOA 4NASA 1RTDB 4UY8T 2HWHA 4AUKA 2KZMA 4Y2MA 4LBPA 2VBZA 1RB0A 2CQ0A 1NJZA 5A2QU 4W92B 1YHQS 4LRAA 2IPOB 4QIEA 3MGJA 2F7VA 2DY9A 4WTOB 2R42A 1BMQB 1DLOA 3SBMA 2HFSA 3UNYA 4TLQA 1FT8A 1FDAA 2M5YA 1MW7A 3BH7B 1WI8A 4DCOB 5L1LA 3L7OA 4YY3F 4YFUA 3M6WA 2GVZA 4HT5A 4FKYA 4DQRA 1VQPS 4F50A 5CZXA 1ROFA 1J5EF 2V4QA 2MKCA 3VAJA 4ES3A 1IWGA 4ERDA 2MJNA 2HWTA 4DDFA 1QAYA 1PBUA 4CLLA 1TTHB 3AHPA 1FWKA 5C42B 3O3LA 1RZMA 2VQFF 1RWUA 4CT9A 2WVEA 2KRBA 3H5XA 1SJ3P 2C3OA 3RR7A 3NKYA 3KLFA 3MPYA 4KO0A 3QSYB 4ZPVR 3MEGA 3W1YC 2X7IA 1HBUA 4PZVA 2AD9A 2HAFA 4B9TA 3HHDA 4B3SF 5CYQB 1S1TA 5CD4A 4KV8B 2IA6A 1VC5A 1LK5A 4MTPA 5HO4A 2JC1A 5F8MA 2QLXA 1S1TB 4FKXA 3UR3C 4QWEA 3LP2B 3BPSP 5JUMA 1JJCB 1FNOA 1FKAF 2FLNA 2V4RA 3R6LB 2IA0A 2ILZA 1N6QB 2JHEA 2N7CA 2U2FA 1DY3A 2PSZA 3VGUA 4IOAQ 2X51A 1S1XA 3C3LA 1MNEA 3I0RB 1WF1A 1PYTA 4HR2A 4K4UA 5I4MA 2XS7A 3IWNC 4DG1B 4CTAB 4YHHJ 3G71S 2JJ4D 3DDKA 3O6QA 2GZOA 2HFZA 1NO8A 2OEJA 3KMSA 1SC3B 4A8SA 3L09A 5CYJA 1IM4A 3MCOA 2ZVSA 3F41A 3LP0B 1TKZB 1JLGA 3BPDA 4DS4A 3C6TA 3T1AA 2E66A 4H54A 2HK2A 3T1YJ 2W7OA 2W01A 2JRSA 2WSEC 4KPYA 2HPUA 4DV3J 4LSZB 2MPUA 2RT3A 3OTOF 4DPTA 4X4SA 2W7AA 1WF0A 3CCWA 4JYAF 1Y00A 2AJ1A 2AT1B 1TQLA 1AYEA 2VC1A 2HHPA 4NI2B 2ZH3A 3UO0A 3ETOA 4URGA 1REGX 2BKOA 2MQNA 2LVWA 3CD6S 1KDNA 4F4YA 4J9QA 2EI5A 1FJCA 4FF3A 2XMVA 2DRDA 4C3MA 4DQSA 1JJ2R 5LXYA 4C8LA 3J7ZT 1YDLA 3HZEA 1UAWA 2KFYA 5FDLA 2I1RA 5ETRA 3HO1A 4DFPA 4GKJJ 3OLBA 2OPRB 2BKNA 4DOZA 2R7SA 2RVJA 4L74A 4RU2A 2ZEJA 4WU2A 3NOGA 3VZHA 5FDLB 5DETA 1NPRA 2VBXA 3W8PA 1T9WA 3QLHA 3FSIA 3HMJG 3PG9A 2CQDA 1D9FA 3MMCB 5B0GA 3SSSA 5HBMB 1IBKJ 1LXJA 3MWBA 1TKXA 4FVCA 2M8HA 3GV8B 3TUIC 2CPJA 1Q8IA 1ZOTA 4ANDA 1TELA 2QLWA 1PJ7A 2DO0A 4ECXA 5M2UA 4GVBA 5KFBA 1H7WA 4QBUA 3BSOA 3G8QA 4K4TA 2W9CA 4EBDA 2BQ3A 1QUVA 2EG2A 4Y00A 4LSLB 1ZYQA 3BSCA 3B4DA 2FTRA 4IQXA 3UDEA 1WSVA 3TJ9A 3OSNA 1XERA 2AJ0A 2DRAA 1KC8T 1M5HA 4CYUA 4X4NA 2XC9A 4ILMA 5C24A 4RNMA 3M2VA 2W2PP 3CXCR 2AEMA 1WF2A 4X4RA 3LF0A 1U1RA 3DRRA 2XMJA 2U1AA 2XQCA 1U2RA 4K50A 3MM8A 4DJBA 1DQAA 4N47A 3CVKA 4TY8A 3DRRB 2ACYA 3C14A 4FS2A 4N8OA 3MM8B 3M6VA 4OZ0A 1RLDA 4PG7A 2EK6A 3MAAB 4HLBA 3EZOA 4CM0A 2MMYA 1VQ8S 3R1LA 1FVSA 3THVA 1DURA 4ZHRA 3MM9A 4OI6A 1R0AA 3W60A 2MSSA 2LMIA 3TO8A 2AYBA 3KG4A 1VGYA 1UZHA 2XSJA 3THPA 3IGNA 1F9EB 2XB2D 3FEYB 2JWNA 3FK4A 5HLFA 4B9VA 1RA7A 4H4KC 2DGVA 3W64A 1PSDA 2JL9A 1QE1A 4JI7J 2ZM6F 3W7BA 1Q8LA 4A4JA 4J9SA 1VC6A 5A8RB 5DDRC 3KK3B 2J9CA 1B7YB 2E1AA 3FKBA 3HSDA 2V9KA 3TQEA 4DR2J 4J9RA 3CCLS 1PILA 2YTCA 1UPPA 4UY85 3P8BB 4I7FB 3C46A 2B9WA 3HVTB 2PMZD 1U1QA 3HD2A 3IAS9 4P10A 1H74A 2KI2A 1FRLA 3BKFA 2F8EX 5D4PA 3KJQB 1S59A 1HPZB 5H9FJ 3DGVA 1HKAA 3N28A 3HVWA 5A6PA 1U0HA 1YJWS 3JB9k 2J0XA 3ZNJ1 3MAQA 5GVQA 3FZ2A 1ELOA 3ONQA 2CWKA 1NLKL 2GX8A 3CCES 1GX6A 2UUCJ 2HEKA 4GKKF 2XWYA 2UU9J 2FJWA 1HMVB 4WU3A 4A48A 1JLAB 4MFBB 1QJHA 2CJBA 3IR5B 1YJ9S 2F40A 3NCPA 3TX8A 5C25B 4TYAA 4PXBA 1VLYA 4OX7A 3DLJA 3TAMB 5DM7Q 3CJ0A 2XY7A 1FDNA 3HCXA 1V5VA 3GV7B 3Q24A 4JOUA 1WC3A 3HSZA 4MK8A 1VBKA 4O0IA 1RLCL 4FYWB 2KXNB 3D1OA 3DKDA 3PRBA 3MR2A 2V4JB 4WXOA 1IKYA 3QRQA 3IRXB 4EYHB 1KVKA 4K4YA 1I5OB 4DCJB 3SSQA 3OBIA 1RWWB 1WHVA 5LSLA 1Q95G 1BWVA 8RUCA 1B99A 1RAGB 2FC9A 2K1RB 5KT5A 1HHSA 3P4UB 4OV6A 3VAKA 4P6QA 4QYZK 4DS5A 1HYSB 2GC8A 4X4TA 1VHFA 4OZJA 1PBAA 3EDRB 3M8SA 4BC9A 3K8WA 4CLFA 2CQ1A 4HYKA 2GIRA 2HFUA 1XMQJ 2AYEA 2ZH9A 1FNXH 3QFHA 4JI2J 4X4PA 4NLPA 3RBDA 3IBWA 2UUBJ 4O3PA 4ZS6A 3LP1B 1OIAA 4ZVSB 3JAMY 4DV1J 2C3PA 4DV5F 4UT4A 2FD2A 2HNDB 4G3IA 1M1KT 1TV6A 2VFUA 1UVNA 3SV4A 2YWHA 2J0WA 3TZWA 1CULA 4WE1B 2YWGA 2G2YA 4NA1A 4J37A 2H48B 1RWVB 5E0OA 5ETOA 3HHLA 3HZGA 2HBRB 2E5LJ 4QQBA 3H2LA 5KFPA 3X1LB 2ZOFA 5LJ3Y 3GIIA 3ZTQA 1WDDA 2R3VA 3MFHA 3PM9A 4Y2KA 4DU8A 2XLJA 1D8YA 4PQAA 4RPFA 4X2BA 3WIVA 4W90B 3POTA 1IR1A 2QMXA 4F8RA 1NH7A 3M32A 3UFCX 3J7Z5 3B54A 3TWZA 4ID5B 4WPAA 3LGHA 1WKLA 2IYIA 4M5LA 4QWCA 3JTOA 5HK4A 2HMIB 2UV8G 2YKPA 4LIRA 1JLCA 3M32B 2RHSB 2K7KA 2UXBJ 1HNVB 1SJ1A 2HVIA 2VKZG 4X65J 1B0VA 4NCGA 2Z0GA 4IH7A 1F1BB 4JUZA 4LFCJ 2HNYB 4QIWD 3G4SS 4KQZA 4X64F 1LOUA 4E98A 4XK8C 2R7UA 4N56A 2L3MA 3JSRA 5L1IA 1TUGB 4U7UK 1I94J 2RNEA 2IC3A 3FCVA 1YTYA 2KT3A 2HSEB 4WFZA 5KOXA 4IKAA 4HI1A 2BM1A 3VVTA 1NK9A 2OPPB 1DAXA 3DFEA 1VRTB 5KFEA 2OPQA 1NJXA 2OUGA 2K3IA 3ZXWA 1QDUB 2VG5A 4AFFA 4KC5A 4ED0A 2GQQA 2EFGA 2EWHA 3A3PB 5M2PA 1Y9OA 5LMUJ 1R8BA 4C7QA 5K8PA 1C0TB 2JVRA 1C2PA 1RHMB 3BB5A 3M8RA 5KG0A 2DNZA 2YKNA 2EK1A 3WDOA 2PD1A 1LWEB 3FGVA 1XMOJ 3QGHA 4F7VA 5KFDA 3B78A 1RTHA 1R0CB 1P27B 4P7TA 2BOPA 2FJBB 3LPEA 4O4RA 1RAOA 3KLEA 4QPTA 4EWTA 4TVAB 1GXLA 3C15B 4DV0F 1U1NA 4KKOA 1XR7A 3BN4A 1RAIB 3TUZC 1BQNA 3ET6B 3WX4A 1VLOA 3UWTA 4UZCA 3MM6B 5AT1B 1XR6A 2CRLA 4EU0A 3PX4A 2DHXA 4TN2A 1IKVA 5EWGA 2DTJA 2F4VJ 4K4XA 4AE5A 5KFFA 2CG8A 5D4NA 4ZVEA 3AJ1A 3UN3A 2E9TA 3W8GA 1CC7A 3MI7X 3MHYA 2AJ4A 3M9OB 3R5AA 3K58A 4IR9A 3WBZA 3DLGB 2C2MB 2VQEF 2M70A 4Y3CA 1PC5A 4OHVA 5IT0A 3IMQJ 4DN0A 4K7QA 2PI5A 4U9RA 1AZSB 3BGRA 2MQLA 1QTNB 3M30A 2QLJB 3A13A 2DGSA 2UVVA 4E2FB 4LRCA 2FY8A 4B3RJ 1IQZA 4N77A 2PN6A 1U6ZA 1X7VA 4DBQA 1B64A 1YGYA 3RBXA 3R7NB 2HHSA 1HWUA 2NUUG 3BBCA 2L41A 4X66J 3N5FA 2HBQB 4RBUA 1KONA 5DZ7A 4RUHA 1R8HA 1IBCB 4USVA 5BR8J 4ZPWR 1L3SA 3T5KA 1S6QA 2B6AA 2AGQA 3NMAA 3SZ2A 3ZC4A 2ZD1B 4FF2A 1FXDA 3OXGA 4JI8J 3J7YU 5HAOA 1RHRB 4DUZJ 1HNIA 2OO4A 5HQLA 3Q8SB 4HHUA 1S6QB 2I9SA 3UE2A 4OFZA 2N4DA 1AUSL 3FZBA 4Q45A 1XNQJ 5I3PA 1IWAA 3HHEA 4NLTA 4Y34A 5G0RB 3EVWA 1N88A 3DLLQ 1MMNA 1WKJA 2B7CB 1A7GE 4OX6A 3NXZA 3GSDA 2VONA 4LR9A 5EWEA 3QMQA 2KT5A 2UXDJ 2GGPA 3FFIA 2B3TB 1FCAA 3M05A 2XGQA 1V3ZA 3G96A 1U02A 2DPJA 2H54B 2C42A 3GFYA 4USMA 4PXEA 3H2UB 4FVMA 2GGPB 4IG3B 5H9EJ 3NNAA 1HWIA 3CGIA 1JXLA 2BOAA 2PC6A 3F73A 2ZHBA 4DFKA 2HIYA 1KHVA 5DM6Q 4LFAJ 2FC8A 1H73A 2W4DA 1QAIA 1S6PB 4ZVUB 4KHPJ 3ETMA 2KZZA 1LXNA 2CVIA 4YUDA 2OLWA 3DYAB 3SCIE 5HJYA 2DIUA 3MPUB 2DH7A 1FXRA 3BKTA 2DT9A 2ZKUA 3NGTA 2B9XA 3MUTP 2PDAA 1RACB 1TK0A 3DOKB 2BR0A 2BW2A 1BE4A 1N33J 1RWOB 4YDXA 5CYMA 4PEOA 1FTCA 3M1VA 1T02A 1VQ4S 3HDSA 1K9MT 3WZ0A 5DQGA 3KUHA 5J2MB 1W7WA 4LF7F 1HR0J 3G6VA 1UEKA 3S8SA 4NMLA 5KFSA 3CEDA 3NGDA 4M5HA 5K8NA 3EGWB 3C16A 2A2DA 1CJTA 4FZVA 3I4HX 4PG8A 3QYYA 5EHHA 1YSJA 2ZJQQ 2CQ2A 1KRPA 4CI0B 3C16B 1T94A 1CJTB 1GTEA 3E51A 3MM5B 2G1DA 3T1HJ 1MN7A 4IOBA 3AY0A 1D09B 1FEEA 1NK6A 3CDWA 1WC0A 4PQUB 2HHTA 3LAKA 4CLYA 3IWXA 2LDYA 3FBFA 3DM2B 2E5HA 3E01A 4ZPTR 4OI0A 1TFYA 3DLKA 1UVJA 4G1PA 1NEEA 4Q2LA 5HATA 4ZP9A 4NX9A 5GAHI 2OFHX 3OV7A 5A76A 5KFKA 1OS5A 3KHRA 3V6DA 3V4IB 4UW2A 2IJNA 5KG6A 1VR6A 5AXMA 1RWNB 1RTZA 4MK9A 5B09A 5A8WA 1TL3B 2OSRA 3QO9A 3TR5A 5IOLA 1S9GB 3CMAS 4OX9J 4EZ6A 2BACA 4EMDA 5HMZA 5ETKA 1VDHA 1TR0A 4DXLA 2OSQA 4CCHA 2VOPA 4KFBB 4PR6A 3HULA 5A8KA 1HQEA 1FF2A 2AQ4A 4O3OA 2ZH8A 4F4AA 2YKMB 3AH6A 3PW4A 2CNKB 2ADBA 2ZDPA 5C7PA 1LV5A 1YJVA 4KGZB 3RYLA 3V81A 1OWXA 4DX8H 3OR1A 3KYLA 3HHLC 1RBOB 2EVZA 1V5IB 2BYCA 1N0UA 3TUPA 3CB4A 2FLPA 3NMRA 4JV5J 1RWXB 3TVKA 3VGSA 4Q43A 3ZFVA 4O3NA 4F3QA 4JV2A 3CCRS 4LF5J 6FDRA 3CWJA 2IM1A 3KK1A 4CZCA 1VYAA 1HD0A 3MMAB 2N7YA 3Q8UA 3SIPB 2FHOB 3MEKA 1R8PA 2DXFA 2A2CA 5B0DA 1EHWA 5J2PA 2BEFA 5LT5A 3QWUA 1SJ4P 2MKYA 2ZE2A 3TEGA 3SSRA 2EG1A 1Q5VA 1GXTA 4KRWA 3W61A 1S9EB 1H7XA 2BRLA 1RT7A 3FQKA 4C0OC 1GFWB 4ZVPB 3RW7A 4ZOSA 4F4WA 2YNHB 4DF8A 2FQQB 3CIZA 1JLQA 4QOTA 1SC1B 5EN1A 4LSNB 1JJHA 2RS8A 5GAEI 4P52A 3W3SA 1CJUB 3VAHA 4DPWA 4CO3A 4FBUA 2XMAA 3VALA 4FF4A 4E0DA 2ZUAA 1HW8A 1KOOA 3AB2B 4I68A 3D28A 2HW3A 2F8MA 4G1QB 1NHUA 3NL0A 1X4GA 1FRXA 5B0EA 3RRHA 2BJ8A 3ULHA 1RT1B 1L3VA 1S79A 1M5VC 2YPZA 2I38A 3Q8RB 2IM0A 3TX0A 5J2QB 5F9LA 1OSDA 1DTTA 1FRKA 3Q86A 1C4AA 1IJEB 3OFGA 1X5OA 2XZDB 4WFBQ 1UFLA 3KLHA 4CLPA 1U47A 3DLHA 3JTNA 2F3JA 5DO2A 5HP1B 3U1MA 3DMJB 4OI3A 2QMWA 2FJXA 5M2RA 3FCWA 1SQGA 1WOOA 3OUYB 4R5PB 3JQJA 4CIOA 4C0HA 1FFSB 2ZZMA 2D3OR 3KK2A 3HJFA 1WNEA 1KQKA 2VG7B 2YPYA 2VDHA 2O3DA 4H4OB 4DL2A 5IC6B 4OZ1A 5I3UB 2XZTB 4LREA 4YMEA 4JI3J 1UTAA 4I2PA 5D0HA 2J9DA 3DRSB 3LW5C 3LGNA 4YB5A 4ID8A 1NM2A 3M8WA 4EBEA 5U47A 5KFHA 4IDKA 2KVIA 3Q8YA 3MEEB 1KSPA 2FZCB 4B3MJ 3H42A 3R7SB 2FPHX 1TK8A 4RKUC 3D5MA 1PKUA 2IMOA 4OYZA 1AUDA 3IG1B 2MB0B 3A8KA 2I5JA 4PPZA 4F3MA 3JXOA 2R2SA 1IJFB 3LAMA 3UQSA 2CKWA 1DZ5A 4DV3F 2J8SA 2OAUA 3FJ2A 3C6UA 2ACMA 2B4PA 3FSXA 3G9CA 3D6MB 3UD5A 4H4MB 4NZ6A 2A10A 4R0EA 4ZKAA 2WVDA 5LMNJ 4I67A 2IJFA 3MTJA 2JFDA 2ZUGA 4IQMA 1YQHA 4DL4A 1LWCB 5DDOC 3LWLA 3B4MA 2KG1A 2XI3A 4B9NA 3AA8A 3W5XA 4PG4A 4RNOA 1SH3A 2C2KB 3DOLA 5KG5A 1RHKB 2BANB 2EFOA 3L7UA 2W2QP 4AQYF 1APSA 4LF6J 4L76A 5HMXA 2ZJPQ 3M2RB 3WX8A 1IKWA 3UD4P 4LR7A 4J9KA 2CQ3A 2HNZA 3W62A 2CQCA 4ZCMA 2IBKA 3T3FA 1OQ3A 4EUVA 4ELTA 4RZRA 4LF9F 4B08A 2VG6A 2VPYB 3PO5A 1OYDA 3CCJS 2C2DA 3MM7A 2ZHAA 2D1CA 4F0HA 1MU2B 2VA3A 3VQTA 4KTQA 2OTJS 4BS2A 2AX1A 2AGOA 5BYQA 1WEXA 1H38A 3V4MA 4IH6A 1XTZA 2B4UA 3U02A 1NSKL 4DR3F 2KYXA 4RW8B 4TLRA 2DGOA 3PYFA 3FCHA 4NLVA 4RW4B 4YR0A 5D78A 3PHTA 3UCUP 1LW0A 1CEZA 3VZIA 3KJNB 5H1SV 3M7VA 5KFMA 1JNZB 2WK4A 5CABA 3IN5A 2XWXA 4OYBA 1HW9A 2J7WA 5E2QA 3IM8A 3QT6A 2B5JA 1PG5B 4CQ1A 2ZH1A 2P6TA 2W2MP 2NR0A 3RB4A 1FTRA 5L39A 2XMUA 2W9BA 4FS1A 2WSFC 1VBXA 3D3CJ 1HBNB 2V8GA 3ILLA 3O5TB 3OVBA 2K3KA 1MN9A 1O6XA 1X4AA 1YJ7A 2W9BB 3H5YA 2AJFE 3T5LA 2A6OA 3UD3P 2DGQA 2OP5A 4NA2A 3TI0A 4DQPA 4CRJA 4IG0A 1RT2A 3W65A 2ZNZA 4USJC 4EGLA 1S77D 4MYTA 3V5RA 4DV7J 3GSIA 4FYYB 3P5BP 2XNRA 5IFMA 3GWCA 2E9ZA 1LW2B 2M2BA 1TMJA 2MKSA 4WIQA 2CYYA 2GAHC 4ZITA 1RYSA 3DLEB 2IYGA 3L7PA 3M8YA 1FRHA 3CJ4A 4ZP7A 4F2RA 4P71A 2G2ZA 3CJKA 3A8IA 2DR7A 1H0HB 4PWDB 4M5DB 4TY9A 2LU2A 4LF8J 3M9NB 3ITHB 5I42B 4JI7F 1JLEB 1SUQA 5GAGI 3PDNA 1UP1A 3T9ZA 1ZAWA 4CLUA 3IS9B 3MURP 3I31A 4NE9C 3KG1A 7FDRA 3SCJE 2NSBA 3ICLA 4U7UD 2ZBRA 4ZCKA 2ZBQA 1NXIA 1WC1A 4DR4J 1R0BG 4LFBJ 3QFWA 3QZ8A 1WG5A 2ZVIA 2LQ5A 3D67A 3MEDB 1Q4RA 4CT8A 2V69A 3NNCA 4C3LA 2DR8A 1TL7B 4GO5X 5B0CA 4TU9A 4DSJA 5CA5A 5F3TA 2XNQA 2CNOB 1ZTWA 5L1KA 4JP8A 1JLBB 4C8KA 1S49A 2XCAA 2WAQD 2V0NA 3IGVA 2DNYA 2VV5A 4ZPDA 3UVJA 2HKEA 2Z58B 5F0UA 1J27A 4MKBA 2ASJA 4WXWA 2XYPB 2RUGA 1N52B 4HH1A 2W24A 1WI6A 2ABYA 2XHCA 2YX7A 2Y0SD 4EEYA 4KHRA 4KH1B 5IWAF 4R25A 2PEHA 1B3TA 1C1CB 5KT4A 4F4KA 3A1YG 2WBRA 1T9XA 2HVZA 2QFIA 3FMWA 1T3OA 2VPZB 1CJKB 2FHKA 1BY9A 5IC4B 5HROB 1VIXA 2C2ZB 4RX6A 1SKWA 1RT6A 2DPIA 4J9NA 4EI2A 4N5SA 1KP6A 2YNGB 3PYDA 5T7LA 5KG7A 4ZJOA 3SCKE 3KUEA 4CDIA 1DTQB 1YG0A 2DO4A 2C2OB 2E44A 2FHJA 1Z1ZA 5K5MA 2G0IA 5HSPA 2HURA 1UZDA 1RT5B 4Y65A 2DXEA 3J81Y 5K8MA 4A8OA 2G0JA 2QT7A 4DZ6A 2BQRA 4QIVA 5E3CA 2CDRB 4F3OA 1VQSA 2UV8A 3B6BA 3G87A 4WKYA 1HBMB 1TP7A 2YKAA 3BS9A 4X62J 2GQ2A 2VPWB 3JSMA 2NLWA 3BSNA 3DGPB 4C2MA 1RGVA 1NB7A 5IT4A 2GS8A 3MMBA 4C48A 4LVNP 2GQCA 4J5OA 1XMQF 3TNVA 1RT4B 4JI2F 3JSMB 3WC2A 1RKJA 2BXJA 2HGNA 2B8QA 5L9XA 3OT9A 4R8UA 2H5EA 3RBEA 4USIA 3CO9A 3DXBA 3KLIB 3T19A 3VR1A 1CC8A 3ILJA 4X4QA 4ANEA 2VF3A 3P3DA 1H3DA 1RAFB 4XDCA 3ZZZA 1VQ6S 2DEJA 3QIDA 4YY3J 1SBRA 3AFGA 1REVB 1ICEB 5LSOA 4OI4A 3HI9A 1B0TA 3IBCB 1CLFA 2GVDB 4WK1A 2YNIB 4O3RA 4B3TF 4NLUA 4OZ5A 3M2UB 9RUBA 2DGWA 1X8DA 5D3GA 1WORA 3MECA 1DQ8A 4DX5A 1GMWD 2YH0A 2DNMA 4ECZA 1URNA 2BQUA 4C8MA 3NGRA 2VQFJ 4KIAA 5J2NA 3NBPA 2DNQA 3KHLA 2GJIA 2E9RX 2DCLA 1JK9B 1WELA 2QRRA 1F2GA 4Q5VA 5IM0A 2FVSA 3DNCA 5AXKA 2LLZA 5GMDA 4DPUA 2HQDA 2YWEA 4NLGA 5CH7B 5C5JA 4HTJA 2C28A 1FD2A 2UXBF 3NLCA 5ETMA 4F0MA 1UETA 4X65F 4DSFA 1MMDA 1D9AA 4OYOA 4CNYA 4F26A 2R7WA 1RADB 3A12A 1YJNS 2KT2A 4ECWA 3C66A 1EIYB 1PCAA 2ZFHA 3QT5A 2ZJRQ 4ED3A 1TMMA 4DR5J 2XCPA 1TKTB 2XZWA 3KMQA 4RU9A 2KM8B 1WEYA 1UEVA 4B3OB 4GRSA 2XLIA 4GVLA 5KFXA 1CS4B 1D9DA 1F0XA 4X84A 4M63A 2RF2B 4M95A 4NOHA 3W5YA 3R3TA 5IT9U 2JSXA 5LMUF 3AOBA 1R6VA 3TANA 2B56A 1RHQB 4RW6A 3OR2A 4PPDA 4P72A 1HBOA 1N48A 3HT0A 1CQNA 1M0SA 1FRMA 2ASLA 3TEHB 3HPOA 1EETA 1UWBA 1XEZA 2CZ4A 4M5IA 1HI1A 2B4OA 3NS5A 1XMOF 3OPKA 1S1WA 1M5PC 4CH0S 3IXQA 1ZM4A 2HFOA 4W4MA 3QBCA 2DNOA 3CCQS 3I0SB 1BD6A 2IDLA 4PXDA 5LL6d 3R8YA 2ZH7A 2NUHA 2DNHA 2JC0A 4DFJA 1DRZA 4HL9A 4ATNA 4WZMA 2PFDA 2XY6A 1SIWB 2DCUB 2MLXA 1FRJA 5E3AA 4DL5A 4C6AA 2WHOA 4IFVA 3RUBL 3LANA 3KJFB 3A3OB 1XQIA 5K9FA 3SFUA 4DFMA 1VBYA 4G1IA 1UVMA 2XG8A 5ETSA 1RI7A 4LRFA 2F4VF 4N41A 1WOSA 4UQTA 1RT3A 3N0VA 1O0PA 3QIPA 3JSBA 4NMXA 3QRRA 4Y28C 5F8LA 3BGOP 5K14A 2RDIA 3UCGA 3DN9A 2NQPA 4NYPA 3AXKA 3VWSA 3UN2A 3H4DA 2F9DA 1LWFA 3HSJA 2ASYA 3MZIA 3VHQA 4WFXA 4MJKA 1N8RT 1IKXA 5A0YA 3VGVA 3HKWA 1HHTP 3CC7S 4HH0A 3JTPA 2XYHB 2MZJA 3GFZA 4PYDA 1MROB 1RP5A 3PACA 4HVZA 1YVFA 5DGBA 4OHYA 1ZAXA 3N6LA 4ER8A 4UOFA 3M8QA 4ILLA 5DGAA 1HL6A 4IRDA 5DQIA 1OY6A 3PCOB 3KJVB 3GJTB 2R7VA 3G82A 5THWA 1JKHA 2WB4A 2FVPA 2EC0A 1HA1A 2RKIA 3TP2A 2PFFB 2Q6BA 1WUUA 4RBVA 3BQ2A 4UUWA 2QG9B 5ETTA 4DPOA 3FBBA 2DIVA 4ZLJA 3DHWC 1WSRA 3RJMB 3SDEA 3ISNC 2NZ4A 2V9WA 1Q7YT 4OYPA 2W1BA 1J5OB 2KL8A 1XNQF 2UP1A 1XNRJ 3ILIA 1S7IA 1OMSA 1LK7A 2OFGX 5EX0A 2MDAA 4AL7A 3M8ZA 2OEKA 1TVRB 4USKA 5J1EB 3CJ2A 1SIZA 1EB0A 1H72C 3CT9A 4WP3A 5F9NA 3VF0B 1SPBP 2UXDF 3O2IA 2AJQA 1U48A 3MCNA 2VICA 1EP4A 3PW0A 5HANA 3FBEA 3N5BA 2AIRB 1RWMB 3HKZD 3W2WA 4L6V3 2HHQA 3D0IE 1DLOB 3CIMA 3GJSB 4MKAA 3MR6A 4HT7A 4NL5A 3OL8A 3OHAA 4ZK7M 2V8VA 2LA6A 2LQBA 1UKUA 2QA4G 4LFAF 2GVZB 1NK8A 2IVFB 4MT1A 1BXNA 3Q23A 2B0GA 4DHVA 1TUWA 4BCAA 3NEKA 5EWFA 3PW7A 1NDLA 4EO6A 2IBOA 3D3BJ 2B43A 4Q8EA 3X3UA 3OLAA 1PJ6A 2DKOB 4MK7A 1IXKA 3NS7B 5D0EA 2KFZA 1C0UA 4PG5A 1EX8A 1YJRA 1F5AA 2UVWA 4MIAA 3O1LA 1VQKS 1HR0F 4QU6A 4NLXA 3KLFB 3EX7B 4KO0B 1U1PA 3MEGB 2ZBIA 3HVAA 2POKA 1T03A 1HBUB 4MIBA 2BJ7A 2M3DA 1MWQA 4D3HA 1ITPA 4ZVTB 3FQLA 2CQ4A 4J91A 5GADI 1T05A 1VHIA 4XDDA 4F67A 5FIIA 4Y2IA 1L5UA 3MR7A 3CDBA 3R5BA 4QW9A 1BWEA 2DHGA 4KB7A 3D2WA 1G2EA 2GV1A 2B8PA 1G3OA 3ISZA 4RNFA 3AA9A 1W26A 1RU2A 2KFNA 1S0OA 4UF4A 1QSYA 2BUNA 4YB1P 2DGUA 2HGLA 5FD1A 3OFFA 1DARA 2MZRA 4CM2A 3JQMA 2XY5A 1EQ0A 1S1XB 4MKYA 1G4CA 3FEZA 2G2OA 1Y7PA 2MHEA 4QZVB 4OV1A 3EZ5A 4FBTA 4DUYF 3GJRB 2Q1LA 2WB1D 3DI6A 3MMJA 4PAAA 3I4PA 1KHWA 3HD1A 1Y4ZB 1HD1A 2MQMA 1JLGB 4PWWA 4C8ZA 1O51A 4P74A 2Z30B 3DU6A 3C6TB 2KDOA 3DI6B 4QIGA 4F4XA 1AFJA 2FZGB 2MKKA 2D3UA 3PYEA 3TJAA 4WWSA 2RHQB 1ACMB 3J80Y 2H9ZA 2MZTA 1HI8A 2K06A 4NWBA 4NXMJ 3CSKA 1U7LA 1KD1T 2AP6A 3KLGA 1N34F 2EFPA 1JB0C 3H25A 2PIIA 4ICLA 2BJ1A 3KG0A 1NHVA 4JI6F 1QAJA 3OL6A 1XJWB 1U1KA 5ITHA 1HNZF 4WFNQ 4QR1A 1FJGJ 4IOCQ 1JNRB 1NHKL 2Q43A 4JV5F 3CE8A 3K5PA 4OHZA 4LF5F 4DV5J 3RW6A 1NJWA 3KDNA 2HG4A 1TKDA 4Q0BA 1Q78A 3HXMA 2BE7D 1U24A 1VQYA 2ERRA 3H90A 2FVRA 3DLBA 2A3JA 1U25A 1VCTA 1NPPA 2CIMA 2GHWA 3BBBA 4USUA 3QLHB 1MG7A 1R6YA 3TVZA 1P8GA 3KFWX 3CPWR 3D9BA 4GO7X 2PT0A 1VRQC 4RUBA 2Z56B 3TYTA 1FEHA 3QATA 4ED4A 2LFVA 1TKXB 2ZH6A 5FLXU 2KM8C 2HQCA 1DJ0A 3DRPA 3OTBA 2OKQA 1NH8A 4GVBB 4NLOA 2C3UA 4DF4A 3CD7A 4NA3A 3NGKA 1X5TA 2W9CB 2ALYB 2E7XA 2Y3YA 5IT9Y 4NCBA 1YZ7A 3CULA 5E3QA 1FJ7A 1XIQA 2P9CA 1R89A 4EYIB 4ENOA 1N5YA 2JVOA 1SC6A 2NCKL 4ZLLA 4CYUB 1FNMA 2E1PA 1Y11A 5C24B 1H2TZ 1ZBTA 2IRUA 3M2VB 2N82B 5F3ZA 4E8UA 4I6AA 1FXLA 2R2UA 1FERA 4HHHA 2Z2ZA 2BJ3A 3BH6B 7FD1A 1RAEB 2LEBA 2ZC3A 2GIQA 4TY8B 4ZPCA 4OJ3A 1YI2S 3S7RA 4TU7A 3BV8A 1F3VA 3C14B 4MAKA 4HHJA 2WVFA 4EO8A 5AE3A 1B0PA 4IFYA 3QRPA 2MGZA 2VUGA 2W2OP 3D4JA 3NAIA 1BQMA 1OY8A 2QL7B 2Y1JA 1TL4A 3JYTA 4JI3F 1FKPA 1LFPA 2QIFA 4RW7A 4O44A 4ZHRB 4OYIA 5HL7Q 1KQSR 3MM9B 1R0AB 1TUVA 1NDCA 1IBLJ 1Y5NB 1U09A 2HHXA 1VQLS 3HHNB 4ED6A 2B9YA 4C8OA 4Q44A 2XSJB 2DHSA 3GG0A 4RNNA 2E1RA 1HQ2A 4IH5A 1QM9A 1X4BA 4DV6J 2RQMA 2NSCA 2V94A 5HLFB 1TL1A 3R2DJ 4MIWA 5IV4A 1NJIT 3OTCA 1YBTA 2HRTA 4ECTA 1OQ6A 1QE1B 1I3OB 5E3PA 3I9V9 1RABB 2IFXA 3HHLD 4P73A 1TL1B 5K8OA 2BVZA 4ZP6A 4DV0J 4L3NA 2E7WA 2FUG9 2QN6B 5KAKA 1W2BR 1GAOA 1GTHA 3O44A 2MKJA 2NXNA 5D6GA 1WJ9A 4OL8A 2LU1A 2F1FA 4DMZA 1C1BA 3LWMA 3TAQA 4DR1F 3RR8A 2HQFA 1HLWA 4JI1J 3EXYA 3TA0A 2WOMA 4RL1A 5EUHA 3MR3A 4XPEA 3AAWB 3HK2A 1HQUA 3FBCA 3CMQA 4DWIA 1WWHA 2RRAA 4CNZA 3BQ0A 4NCAA 1V9OA 1SL2A 9ATCB 1UL3A 1U0HB 3L95X 2MSTA 2QGFB 1CJVA 1HQUB 3MTKA 4NEZA 1HNWF 4LF1A 5KG3A 2BE2A 2Q66A 3R97A 3OTEA 5EX3A 2VFRA 1Q8KA 1RA6A 1TL5A 5IXUA 2DNGA 5D0GA 1KR4A 4LF6F 2H65B 2W25A 4FN5A 2AZ1A 1NZ8A 1KKHA 2PA8D 5F41A 4FNHA 2W9AA 3EDQB 3GILA 3AB4B 2YWKA 2ZH2A 2DY1A 2L9WA 4OZ2A 1Q5YA 2AJ2A 1SKSA 3HF5A 2V50A 1RISA 2OPSA 4DL3A 3I6PA 3PY8A 5L38A 2HLTA 2MJUA 4B9MA 3N6MA 4A47A 3BR9A 1U45A 5DS7A 5A2QY 1A9NB 3ZZUA 5CXTA 1VK8A 2WTFA 1VQNS 2XMKA 2WCXA 2CJ9A 1IKYB 2IY5B 1U6FA 2RU9A 1KN6A 4M5JA 3NCQA 2MQ8A 5KFNA 2OIHA 4WFAQ 3T9NA 2BZ2A 4OJGA 4TKTA 5ETNA 4YS2A 1LWXA 4L3KA 3WC0A 1N4LA 3FC9A 2VFTA 2YH1A 3LUYA 4ZLNA 3CC4S 4ZVHA 1AB8A 1FDBA 4LF4J 4LRDA 4ED1A 4A46A 4DV2F 4ZP8A 5DG8A 3QT8A 2GA7A 1QVGR 4XO0A 1L3UA 1YIJS 2HHWA 1FI4A 2Y0BB 4I2QA 4M1KA 4P2MA 3QGIA 3M9MB 2WONA 2RIJA 4P2FA 1ZM9A 2VB6A 3N4WA 1TV6B 2JFKA 4F0KA 3HVRA 3ZTOA 4DV7F 2UVRA 2XBPA 3DC2A 2L9DA 4U8YA 3W5ZA 3W2VA 3Q22A 1CULB 1S4EA 1D1UA 1NBEB 2HS3A 4RW9A 4LR8A 1NU4A 2KN4A 3RRKA 3HHLB 3W9JA 2Q6CA 4RWXA 4F02A 3H0PA 3PJWA 2HHVA 2O5DA 2GJ2A 2KXFA 3HFZB 2CWXA 1T7PA 1LNQA 1WACA 3H20A 4NLQA 4HACA 3POTB 4LF8F 4A8MP 2Q79A 1RTJA 1IBMJ 4CLSA 4LBHA 2H1YA 2P2CB 3R1HA 3I5CA 2HBZB 1YX2A 4NYOA 5F8HA 3VAMA 1Q8BA 4PUOA 4K4ZA 4DCPB 1JLCB 4TNOA 4CH1A 2D74B 2JX2A 4ZVRB 2GW8A 1E6VA 1RTIA 4DI6A 4XIUA 3HLUA 3PJXA 2JZ5A 3LQVA 4DR4F 2OMOA 3GPAA 3I32A 4NCGB 3D6FB 4U67Q 2BX6A 1I1GA 4LFBF 3I56S 2H5JB 2DK2A 2FY1A 1HNXF 5F8NA 4LQ9A 2ZITA 2V67A 5HI7A 3M4XA 4QIFA 3RTVA 3A8EA 5LJ5Y 4P2SA 4B02A 1SV5A 3LGMA 2X3GA 2KJWA 4WYLA 4FXVA 2BJ9A 2WW8A 3P49B 1Y5IB 2IC3B 4C11A 1UFKA 2LEAA 2MEWA 2PO4A 3N6NA 1VQ9S 2OPQB 4UUXA 2M7SA 5E3RA 5KFLA 3H5UA 2VG5B 5CD4H 5DRKA 2DR5A 2MY7A 1GMWA 1EARA 1N32J 1KTVA 3B82A 3K5MA 2YNFA 2EW9A 3NRBA 1XMBA 3HP6A 1FHTA 1NK7A 2M52A 1X5SA 2CNLB 1YRTA 1XWLA 2DYAA 3BGLA 4YN3B 2YKNB 2I8EA 2JEIA 1RHUB 5B0AA 1S1VA 1FK9A 1T95A 3EVOA 4F4ZA 2APOA 2GHVC 3CCSS 1JLFA 8AT1B 3CCTA 2ADCA 4URSA 1RTHB 3GCXP 4CO2A 3BJYA 3DRXA 2OI2A 1SKUB 1QAXA 1KS2A 3SQGA 1OPIA 3KLEB 2AW0A 2UUTA 4ECQA 3P6YC 3OTDA 4M8LA 2YX1A 2XYGB 5SZTA 3CUNA 2DITA 2OD6A 3QAUA 3ZZTA 4KKOB 3GE9A 2HYIB 1X9SA 4I4BA 1R43A 1R8AA 1E6YA 1FJEB 1R3NA 1RTDA 4QYZJ 1BQNB 4QPXA 4FYXB 1HFEL 3Q2SC 1U8WA 3U27A 1IKVB 1TZ0A 2GAGC 1K0TA 4HI2A 2ZZNA 1BC6A 3P96A 3CJ3A 3TUJC 1WG1A 5AXNA 2G4BA 3BDEA 2QA4S 4PRFA 2VH7A 1PGZA 3K2YA 1S0NA 3HM9A 4B9UA 2V2VA 3H4BA 1NDPA 4Q7AA 2EFVA 2MLZA 3DDNA 4OZ3A 4ZVOB 3BGRB 3VAIA 3M30B 3T6JA 2FB0A 5D4LA 1UFWA 5C42A 4C4WA 4EFAC 3GR0A 1JQGA 5KFZA 1YZ6A 2JLGA 1BUXA 4WIIA 3G8SA 1J2VA 2OTLS 1X5PA 2F9JA 2QLBB 1S1UA 5CCMA 2R8HA 3MD1A 1R8CA 4UQGA 1GQEA 3VTIA 2FYXA 3D0HE 2BJDA 5LOQA 5D8HB 1S1UB 3JAMU 2V34A 5CYQA 2J76E 1WEZA 1NDKA 4KV8A 1UPMB 2B6AB 1ZAVA 2MLYA 5F8JA 3AD9C 2HVHA 3GQCA 2XM3A 3CJTA 2GHPA 1HNIB 4YQWA 1S97A 3LP2A 2WVCA 5DJBA 1SVDA 1ZM2A 3PFOA 1L3KA 2GO8A 1VQMS 3R2CJ 4ECRA 1N6QA 1DFDA 5KFRA 4J9LA 2J0SD 4DLEA 4PABA 2DRBA 2LP4A 5C2GA 1K8AT 1EZZB 3I0RA 4DR5F 3GMGA 4I1TA 1H98A 4DG1A 4CTAA 1S7HA 4OLOA 2NYHA 3FFIB 3SI8A 4ITSA 2HZVA 2RD5C 2HQ3A 5DG7A 3DOMA 3VAFA 4NLWA 3GYXB 4WKRA 1U0SA 1WOPA 3CJQA 1UEUA 1X60A 1YKWA 1QSLA 3LP0A 2CAJA 1TKZA 2Y8YA 2I2YA 1PO6A 2LXIA 4AT1B 2V5HG 3DOMB 2CDQA 1V6HA 4U95A 2LDIA 2Z57B 2G9OA 3K59A 1X0FA 4MH8A 5CAAA 2LXUA 2KB2A 3CC2S 2QSFA 1ZM3A 2O67A 4OJHA 4MKVA 2IMWP 4Y6IA 3GB0A 4WTYA 4NI2A 4CO1A 2FGOA 1B70B 2P6SA 3EWGA 5CYMB 1Y5LB 1RWPB 1NSQA 5F8GA 3BSAA 5H9FK 3M1VB 4JB8B 3RGIA 3OW2R 1XC9A 4ED7A 3LALA 1AROP 4J9UE 2JOQA 3OL7A 3FRYA 2YY3A 3GTYX 4AD6A 4B9LA 2D9OA 3EM1A 2X1FA 1OJ4A 3P45B 1NKEA 2K7JA 2BKPA 5KT7A 4A8YA 5BYSA 5GMEA 4KGXB 4JI4J 2BE9B 2OPRA 5T41A 4DV4J 3F56A 4QJVA 4I6WA 4OYXA 1AW0A 1UCNA 4AQYJ 2CZ9A 4Z7YA 2VIHA 1NSPA 2BRKA 2N4CA 4J7CA 3MMCA 3AXMA 1YITS 2K2PA 4OYAA 4ZPBA 3DHXA 2RJZA 2EC2A 5HBMA 1SH0A 4RJVA 4PKDB 3QGPA 1T9UA 3E01B 1U49A 1SL0A 4LF9J 3WHIA 2R9LA 3PKYA 3DLKB 3J81j 4CO5A 3NG8A 2QZ8A 1QVFR 3R6GB 3PJ9A 2ZBPA 2XLKA 2DHHA 5ETQA 2HHHJ 2IAJA 4UZBA 2NS1B 3V6DB 2ZDOA 2ASDA 5HMYA 3HX9A 1VFJA 1Z4UA 3TZZA 4ES1A 1KQFB 4LRBA 1IUJA 4JBCA 3EMTA 4DR3J 2IAJB 3KKFA 1NJYA 5A8WB 4LSLA 5DQHA 3QO9B 4BC7A 2UUAJ 4K2XA 2XHWA 6FD1A 5B0FA 1ZETA 4J9OA 2QA1A 1GK8A 5A8KB 1HQEB 2K8GA 1C4CA 2MYFA 3Q89A 3QNWB 5JMNA 2MKIA 1X4CA 3IR6B 4AL6A 2XTJP 3TAPA 3OXFA 3G6ES 2G0CA 3G8TA 1A6LA 3RB3A 2LEPA 1S0VA 2CPFA 2E29A 3NWGA 3D1QA 3EXCX 3V81B 3ZTRA 3OR1B 4DPXA 3I5AA 4B9SA 4FYDA 1MLAA 1N36J 3K5LA 2AV5A 3MAAA 3QWPA 1N5TA 2EFQA 3GFHA 4Y0FA 2D3ZA 1XNRF 2R8GA 2J7KA 3BF4A 2V68A 3LOUA 3KK1B 4CO0A 2QE5A 4DX6A 4ECUA 1CBKA 1UA1A 2MZSA 3QJJA 1SJQA 2HZCA 2IVYA 3E8OA 5J2PB 2ZE2B 1ZZNA 4JV1A 2NZCA 2OMLA 1R27B 1IN0A 1RT7B 5A8RA 1VQ7S 3KK3A 1JLQB 1KBRA 2D3O1 3BQ1A 1F5CA 2MQOA 4UOGA 1EKRA 2EBGA 4I7FA 4FNIA 2QFJA 3HVTA 2LQ8A 4YR3A 2EXUA 4GC6A 3BM7A 2ZKTA 4Q8FA 1UVLA 4JI0J 2PMWA 4FPIA 3G6XA 2Y9HA 1HPZA 1P9QC 2CQIA 2R7OA 1Q86T 2CPZA 2KO1A 2B4VA 1DTTB 4ZVQB 2F63A 4U6PA 3HSGA 2DNRA 4IYQA 1HMVA 3LH2S 3BGFA 3KLHB 1JLAA 4MFBA 2M0GB 4YOEA 4LQ3A 4NZ0A 3KNAA 5C25A 3EPGA 2R8KA 3W63A 2J5AA 2W7PA 3GONA 1RXOB 4KAIA 4USTA 5ETLA 3TAMA 3KK2B 2CA9A 5J1NA 4A8FA 1NK0A 2A0FB 4DR6J 3KUGA 1G1XA 3KHGA 4P7VA 2ZH4A 3QAEA 3E2EA 4M94A 4TQSA 4I2PB 5IWAJ 4YHHF 1Q53A 2AF6A 3MPVA 5GAHU 2XI2A 4DN9A 2CPDA 2V4JA 3T5HA 3ZZYA 2R2RA 4DL6A 1GEHA 4DZDA 2YX4A 3MR5A 3W66A 4IDKB 3H2VE 3IRXA 3AD8C 4MYUA 1U8SA 2B7BB 4OIXA 5GMKa 2BW7A 1EKSA 3T1YF 1R31A 2AEJA 3B8HA 1RJJA 2K1RA 2I5JB 1FESA 1FX4A 3OQ2A 3KDOA 3U7JA 2HQIA 2KU7A 1WG4A 1F9HA 1HYSA 3ISND 1GXUA 2QYCA 3A4TA 1T9YA 2QC3A 4EK2A 3C6UB 1X4FA 4OHXA 4NXMF 2C3MA 4WJBA 4F04B 3Q83A 4OI1A 4YR2A 4XAKA 5LSRA 3MXHP 2C2RA 3LA0A 3ENQA 2HFNA 2KKHA 1GNKA 3CJSA 2V8HA 2X3DA 3IM9A 2HBYB 2C2NA 3G2XA 1FE4A 3LP1A 1FJGF 2FJAB 2HNDA 3VQSA 1LFWA 4IO1A 1U26A 3MPWA 4GKJF 1N5QA 3EYZA 3S01A 1Q1KA 3DOLB 1ZH5A 4O23A 3TVYA 1F6TA 4WE1A 1RDRA 1CPZA 2MTLA 3VV2B 2BA9A 2CQPA 5MLCV 3L9ZA 1IKWB 5ETPA 1RWKB 2HNZB 4K5RA 4F36A 3DDIA 5J1PA 1NCLA 1IBKF 2VKRA 1U4BA 4B3TJ 4C98A 2R7QA 2F8HA 2CVEA 3TARA 4ELVA 2VG6B 2YQ1A 5KG1A 3PIPQ 2XO6A 5BXIA 3MM7B 3D68A 4ID5A 2FJVA 3BBFA 4C97A 2DGXA 1WD6A 3GIJA 4I6YA 1UJ6A 3TZYA 2HMIA 2CG4A 1YBUA 5GAEU 3EPIA 2UXCJ 1ZPVA 1JMTA 2VC0A 1HNVA 1YJTA 3J7YI 3PEJA 1S5ZA 3MOJB 1CSJA 1LW0B 2DEIA 3OJUA 2HNYA 3NOCA 3K8VA 4ECSA 5CQGA 4KGVB 4LT6A 3CNQP 5JJBA 5I3QA 3EICA 1FWPA 1RSCA 2CPEA 4BHQA 1BQXA 2B5JB 3R5DA 4FF1A 1VIOA 4YEAA 3CDUA 3VVUA 2OEMA 3CW2C 1X9MA 3ILOA 2FHJD 2QLFB 2OPPA 1KVJA 2C22A 1VRTA 3D1HA 2BJEA 3CCZA 4AXIA 4DX7A 6AT1B 5H9EK 4YDDB 4ZJQA 1UA0A 1IR0A 2CFXA 1C0TA 1YJUA 1OY9A 2RAQA 4DSEA 4FXWA 4FPRA 3UCZP 3K7RA 3ENVA 4K4WA 4IG0B 1RT2B 1VRUA 2LECA 5L8RC 4NXNJ 3MD3A 2P8IA 1LWEA 1ZA2B 2O66A 3SQOP 5KFIA 3P5TL 1VRUB 2RDDA 1K1SA 5G4DA 4DR7J 3PW5A 3BO3A 2E1CA 2NPIA 4X4OA 1SXLA 1IBLF 4A8QA 2KYZA 5B0BA 2PA3A 5RUBA 3BO4A 2QJ3A 1B7FA 2A6MA 5AXLA 3H5SA 4DV6F 3CJKB 3V6HA 2WRMA 4V19X 2ROEA 4K8RA 4NLDA 3C15A 2IJRA 3OFEA 3MCSA 3PYGA 2P9GA 3DXSX 1SUQB 4DR2F 1H6KX 2FIUA 3MUMP 2CNNB 5AJ3J 1X9WA 3BGUA 1LKZA 2J0QD 4NPOA 2FVQA 4FYVB 3ET6A 4CH7A 5KFAA 1SL1A 1KFDA 3BYPA 4RWWA 4ECYA 3JSYA 3MM6A 3TA1A 4BDPA 4JI5J 1FFWB 3BEGB 1FRIA 1WKKA 1ZPWX 3AJDA 3Q8QB 1KVIA 4JI1F 4ETXA 1JXVA 1Z2LA 2OD4A 4WYWA 1TK5A 2IIHA 2WW4A 1I6JA 1A0OB 3MPDA 2JH3A 4Z2XA 1N0VC 5KOWA 1U1OA 3RAMA 2UUCF 2XSFA 4CP5A 2LQ9A 2UU9F 3DLGA 2OELA 5CZVA 3J7A1 4RR5A 1Q82T 2ZH5A 2FJEB 2VBYA 1M1GA 4ZCIA 2AYGA 2CQHA 3RZAA 5C2CA 1AZSA 1PAEX 3UVJB 5MAOA 4OZLA 2YXLA 4CLWA 3QJPA 3PZPA 1TAQA 1IM6A 1MWZA 2QL9B 4KYZA 1NAQA 1XBWA 4DQQA 3PTWA 4ZIWA 2KRRA 4DEZA 3VGTA 1GH8A 3IO1A 1W25A 3I96A 1UMJA 2F65A 5HJXA 3FSYA 5BYRA 1X4HA 3HFVA 3GJQB 1RUSA 1MSWD 3S1TA 1Y3KA 4OZNA 3CMES 4IRCA 1RT6B 3N01A 2HFVA 5DZ6A 3GR1A 2MKHA 2VD3A 2ZD1A 2RRBA 1RCOB 2MQPA 4LF2A 3KOAA 3SFGA 4K0KJ 5T7LB 2V2KA 3CCVS 2X1GA 2EEYA 2W8KA 5E7OB 1KLNA 5KFVA 3BDPA 4O0NA 2RUSA 2PEBA 3TJ8A 5G0RA 4QYRA 3PRDA 4LBIA 2ROPA 2H51B 1RQ0A 2DISA 1YK9A 4I69A 2QMUB 2XEXA 4A8WA 3DCAA 4LF4F 4DL0C 4OYMA 2DXDA 5HMWA 2L08A 1BHNA 3BKUA 4IUFA 3MMBB 2UUBF 3EGVA 1T11A 1WTBA 2YQ3A 4IG3A 3ZZOA 2D7SA 4DV1F 3MOZA 5DDQC 4KR0B 1RBAA 3R5CA 4YP3A 2LYVA 3ZTSA 1M5KC 1SB6A 4M5MA 4WCEQ 1N54B 1CQMA 4R8UB 5ADZA 2B9EA 3D6TB 2O1PA 2KVQE 1VK3A 2HS4A 1S6PA 2V2ZA 1DHMA 2WSCC 5F0WA 2MZ1A 2AKWB 1S76D 3DYAA 4DSLA 1J5EJ 2E5LF 2NPFA 3C8YA 1M5OC 1Q79A 3WIUA 3DOKA 4QWAA 1N5SA 5KG2A 5D3GB 3SCLE 5J2MA 2QTWA 3MECB 1AFIA 1Y10A 3U1LA 4XPCA 5J2NB 4M5NA 3IP0A 3NBPB 4KGMA 5GAGU 1IBMF 2QX0A 1RYRA 2RE1A 4B3SJ 2FLLA 2HRUA 5IM0B 2OHDA 4U96A 4IR1A 1MWYA 2XMTA 3RBZA 2JNJA 2KG0A 3PFEA 3MM5A 4TYBA 2CJKA 3AD7C 4OMFG 4LFCF 1NMEB 3OFHA 2JLFA 4WP8A 2PE8A 4KSEB 3MF5A 3A8JA 2WZ1A 4PQUA 4G6VB 5EGYA 4F25A 2RRNA 3DM2A 1D8ZA 2CADA 1SI9A 4BWMA 1I94F 5KFQA 3U1NA 2HHUA 3CDAA 5KT6A 1Q7LB 3IC1A 2AHOB 3OVAA 3CJ8A 3V4IA 1F9FA 4KJIA 1URRA 4ED5A 2HIQA 3KLVA 2L48A 4A8KA 4ANCA 2KTQA 1U1LA 1TL3A 1NB2A 1V3SA 5L1JA 1N32F 3N79A 2J8AA 4D3GA 4O4GA 3NGSA 1S9GA 2AYMA 3BR8A 2D9PA 4DUYJ 4N7TA 4RW6B 3OR2B 1TFWA 3K5NA 1FO1A 3FDSA 1FDDA 4KGKA 3EZUA 1QSSA 1HBOB 4KFBA 3G6YA 4O4GB 1T9VA 3FNNA 4DU7A 4ZPAA 3PX0A 4OHWA 4MMOA 4R0JA 2VJVA 3OTOJ 2PMHA 1RAHB 5KG4A 1EETB 2YKMA 4JYAJ 1DBDA 1UWBB 1H2VZ 3GIRA 4W98A 2DNNA 1S1WB 4KPCA 4KHMA 2GMLA 2GIFA 2X1BA 3OXLA 1N34J 2NXJA 1P9YA 2CJYB 4KE5A 2AMCB 4NEYA 4JI6J 1BLUA 2VA2A 4AYBD 4HDHA 1HNZJ 2O01C 4KT0C 2LXFA 3ZZRA 5IZHA 3OVSA 3MMAA 2HK3A 3V2UC 3KNGA 4IFVB 2WVBA 5EDWA 2LA4A 2J6TA 1T8EA 4RUAA 5LXRA 3MCMA 3SMZA 1KWMA 2ROGA 1QD1A 2RDJA 4PCQA 1S9EA 4I64A 4AXJA 3F0NA 1UVIA 1RT3B 4P2XA 5KFJA 3OL9A 3IR7B 3QIPB 2JEGA 3LTOA 3I87A 2YNHA 3G86A 4G65A 3CTRA 2ZWOA 3PNIA 4LSNA 5FJ4A 4J9PA 1Q0NA 4ZA1A 5K14B 3RAXA 1CJUA 1OO0B 2QSWA 3J81U 2V2QA 4B3RF 1W2IA 3R7BB 1LWFB 2KH9A 3HHKA 4PWUA 1QY7A 3UN5A 3GLJA 1VQOS 4G1QA 1Z2ZA 1UWAA 1Y3JA 2V8PA 3TQ1A 1IKXB 5A0YB 2V6AA 4XTTA 1RT1A 2Q3PA 5KFUA 4ED2A 5HVFA 1M1HA 2RILA 3BZQA 1RU1A 5DDPC 1RK8A 5J2QA 4X66F 2M88A 3GIMA 1GT8A 2OJ3A 3MAHA 5BR8F 2FJDB 3M8QB 5E33A 2FGCA 4CLTA 5LM7E 2G1HA 3G82B 1JKHB 3THTA 2IM2A 5HP1A 3DMJA 4WFYA 4JI8F 2VODA 2Z2LA 4DUZF 2RKIB 1K0VA 3OUYA 1RCXB 2NYIA 3EGZA 2CUYA 3ZZPA 3M6XA 4OYWA 4R5PA 1LQ9A 2Y1RI 3F44A 3UW1A 4ZLPA 2VG7A 1N5VA 3SDEB 2G13A 4KY3A 3Q8VA 3Q0AA 4H4OA 1AT1B 5I3UA 3CF5Q 3ZTPA 1K1QA 2J9EA 3CCMS 2CZVC 4NLYA 1VMBA 3H59A 4O3QA 3DRSA 3NS6A 3RRGA 2XMMA 3MFIA 2BMBA 2BBEA 3GP9A 2DJWA 3UDVA 1SKRA 2HRYA 2HWIA 2J9DE 3SEOA 1K47A 1V3RA 1FD8A 1RKIA 2E7VA 2MHNA 3EGNA 3MEEA 2WBMA 3D6HB 2XGPA 4YB6A 3OSPA 5HQ8A 5JXSA 1NKCA 1EP4B 2XO7A 4OJ1A 2PGCA 1VQ5S 2ZM6J 3W2WB 3L3CA 2FLOA 3VCDA 2NXCA 3IG1A 2H3EB 4Y2AA 4KHPF 2OH2A 1HWKA 2XS5A 2BABA 2AZ3A 1NZAA 2DVIA 3GYNA 3R9LA 1VC0A 3PR5B 1IQTA 2EKYA 4CWBA 1YBAA 3O8WA 2YKOA 1QUPA 1T9TA 5F8IA 1S72S 1N33F 2YKQA 3CDEA 5KFYA 1RE1B 1S57A 2DHAA 4KH0B 2ILYA 1EQMA 3US5A 4TQRA 5SUHA 2VFVA 3OD2A 4H4MA 1PIEA 1HWJA 2GCFA 3LO3A 3AQPA 3GV5B 4DR1J 2CPHA 1FFGB 1F2HA 2PI4A 1T0TV 2Z4PA 1C0UB 2HS0A 5HVGA 1LWCA 1X31C 4UTGA 2ATLA 1S4FA 3R27A 4DSKA 4J90A 4BBYA 2C2EA 1SCJB 3R5GA 4DPYA 1T03B 3ENWA 3C2PA 5D15A 4GKKJ 2SXLA 4CO4A 4HEA9 1HNWJ 2BANA 2P9EA 1WDTA 4KBIA 4RNHA 5L9NA 1Q16B 3T1HF 1T05B 4JI4F 2Z2YB 2GO9A 3M2RA 4BWJA 1S6OA 1WC6A 2AWZA 2W8LA 2AEFA 4DV4F 3D54A 1IVZA 1PYSB 1PJ5A 2R7RA 2J7UA 5DLGA 5HQMA 2E5GA 5DLFA 3JQKA 4NYZA 2DD8S 3BREA 2HAIA 1KFSA 1I51B 3GG1A 1PAUB 1D3WA 2BM0A 1KOHA 3MDFA 1WC4A 2CPXA 1NSAA 3IA0A 7AT1B 2L9NA 1MU2A 3PX6A 5AE2A 1D0EA 2FHMA 4C8YA 2DNLA 1X4DA 2QV6A 4ED8A 2C1EB 2HHHF 4ZVFA 3PV8A 2Y1LB 4RW8A 2V63A 2R8IA 3IBFB 4EZ9A 2HGMA 2IRXA 4NLRA 4IO9Q 3K89A 5KFTA 3UI3A 4RW4A 4OX9F 3RB0A 4GC7A 3FMBA 2CJAA 2NXEA 2AX0A 5IV3A 5DG9A 2RMLA 2MXYA 3D0GE 3CD0A 3QJLA 4M5GA 1NK4A 1FX2A 1JX4A 2MZQA 2UUAF 3MUVP 3I5BA 3D7SB 2GJFA 3RU0A 5T14A 3KHHA 1P6TA 4JV0A 4URQU 4NRUA 1KLMA 3ENAA 1O8BA 3GU0A 3R5JB 1HBNA 1CVJA 1ZA1B 1YRUA 3KLGB 1OYEA 4DV2J 2E5IA 4OLPA 1KLMB 4ICLB 1XN9A 3PW2A 3CCUS 2QA2A 2J6UA 1TAUA 2UVUA 4A8XA 1FWLA 3GCWP 4L72B 4J9MA 1S6UA 1N36F 4GMKA 1S0MA 5IS2A 2KHDA 2HQGA 2I6WA 2LCWA 2X1AA 2P5VA 3RB6A 4QCLA 1VI7A 4J9VA 5CHCB 4Q0BB 2JDJA 1LW2A 4DSIA 1NKBA 2CQBA 1ZTTA 2CXEA 1SQFA 3DLEA 4ZMMA 5HVHA 4P75A 2ZWPA 3CD5A 4PWDA 4Y2CA 4BLGA 3H40A 5HN0A 4M5DA 3GZ7A 2M9KA 2VPXB 3FEXB 4K59A 1L3TA 3ITHA 5I42A 1JLEA 1KQGB 3QSIA 4Z37A 2F5GA 3DRPB 4ZVGA 3IS9A 1ZS6A 5IQQA 3UDLA 3PXGa 1TU0B 2VL1A 5B7WA 8ATCB 1F5BA 1KEKA 5D0RA 2N3OA 4ELUA 2XS2A 3KXDA 3AT1B 3PR4A 1T3NA 5E41A 2QL5B 3FUYA 1JIHA 4JI0F 4F2SA 1UW9A 3MEDA 3ZZ0A 4X64J 1M90T 3M8PA 3WQPA 2W4PA 2JLEA 4LVOP 3HT3A 2OGUA 1TL7A 2VASA 1P1LA 3TOQA 2YQ0A 2W2NP 4TXSA 1MMLA 1HNXJ 4YB7A 1N5YB 1QTMA 4DLGA 1S99A 2Z2MA 4ZIVA 4O3SA 2BV3A 1JLBA 3M8PB 3J7AN 2ZHOA 2H4WB 1XR5A 3V6JA 2D69A 3T41A 2ZNYA 4RUCA 2Z8QA 5GADU 4B17A 1NK5A 1NPKA 5A6WA 3IRWP 3H8YA 2CQGA 1K44A 2DR6A 2FDNA 3I9ZA 4ZCLA 2DB1A 2LQJA 1H2UX 5B08A 2NREA 3T6BA 2JEFA 2RB7A 1BGXT 3TW0A 1C1CA 2NXUA 4IFYB 2MGZB 4K4VA 4WF9Q 4DR6F 3OJSA 2VJUA 1BQMB 2M8DB 1CJKA 2RU3A 3JYTB 1KTQA 1FKPB 4RW7B 4ALZA 4O44B 5HROA 5KTQA 4RO0A 2EPIA 3I82A 1AA1B 3BYRA 4P9SA 4B3MF 3NWRA 2F4FA 3EJMA 2YNGA 4PYAA 2H5IB 1NUEA 5KT2A 1FVQA 2R7TA 3UDCA 2VZ9A 2HLUA 1DTQA 2E1MC 4RLEA 4Z7CA 2IM3A 2D41A 1NRKA 2DH8A 5KT3A 3EE3A 3DRYA 4FXDA 4EBCA 3OHBA 4DUTA 1RT5A 2R7XA 1P1TA 1PYOB 4N76A 2QYGA 4L73A 4C3KA 2LKZA 2GNKA 4USHA 3BN7A 3TA2A 4U7CA 1F3FA 2C3YA 2QEXS 3NGUA 2DGTA 3QPIA 1HBMA 2MQQA 3K5OA 3SYZA 3DU5A 1C1BB 3IFEA 5LMNF 1S9FA 3DGPA 3IAM9 2M4MA 1HI0P 2WOMB 4HDGA 2XMWA 4USWA 3N9UC 1VS3A 1RT4A 3Q2TC 1JJ4A 4CLZA 2VU5A 3IWLA 3QZ7A 3CJRA 2ZBCA 1HIYA 3A3NB 2DBBA 1GMVA 1VJWA 4LJMA 3KLIA 4UOHA 2R4FA 4CLKA 3QQCD 1CJVB 2EFNA 2VQEJ 1GMUA 2RH3A 2DNKA 4NZ7A 2BE2B 3PRVA 4K5SA 1WHYA 2VBWA 4TU8A 4QWBA 1HWLA 1REVA 4QW8A 3T5JA 3AOAA 5AE1A 1FKOA 2GVDA 2YNIA 1U2CA 4DL7A 2UZAA 4WP9A 2YWWA 3M2UA 3H98A 3GYGA 3W9IA 3J80U 4HTIA 2A1BA 2VOOA 3ZO7A 2DR9A 1FKOB 4OI2A 3D66A 1Y0HA 4U8VA 4QR2A 1OSCA 2YWFA 4FP9A 3UR0A 3GFXA 4FDFA 5D4OA 3M6UA 4IRKA 3AODA 2OPSB 2R2TA 3RAQA 2YBVA 3SXLA 4X4UA 1SH2A 4I0WA 5K20B 4PXCA 5L46A 1VISA 2Y8WA 3FVYA 4QWDA 1FE0A 2KJVA 1WHWA 2UXCF 2KHCA 2ZOGA 1SQEA 3SV3A 3NP5A 3K57A 1JXEA 2AU0A 4LIWA 1RAAB 2IDEA 2XULA 4N8NA 1CG2A 3S6EA 1DQ9A 3HFKA 1XK8A 4WK3A 5KFOA 4C0BA 1S12A 4NLSA 2ALZA 2GMJA 1TKTA 4QU7A 1X0PA 2H4YB 3UNGC 3AJ2A 2AGPA
chains in the Genus database with same CATH topology
5KFSA 3CEDA 3NGDA 1VBZA 2HNZB 4B3OA 4K5RA 5K8NA 3EGWB 2DNPA 2MQMA 1JLGB 3Q8PB 2A2DA 5J1PA 4C8ZA 1IBKF 4FZVA 3I4HX 1O51A 2VKRA 1U4BA 4PG8A 3DU6A 4C98A 3QYYA 2R7QA 3C6TB 5JVHQ 2KDOA 1QLNA 1R7IA 2CVEA 2F8HA 3DI6B 5EHHA 3TARA 4QIGA 1YSJA 4F4XA 4ELVA 2RF2A 1AFJA 2MKKA 2ZJQQ 2VG6B 2CQ2A 1KRPA 2D3UA 4CI0B 4C8NA 2COLA 1T94A 5KG1A 3PIPQ 4I2QB 2IHR1 1GTEA 3E51A 3I55S 3J80Y 5KFWA 2H9ZA 2MZTA 3LPYA 3MM5B 1HI8A 2G1DA 2RQKA 3PEHA 3MM7B 4NWBA 4OQJA 4IOBA 3AY0A 1FEEA 4ID5A 2FJVA 1NK6A 3CDWA 4V19J 3CSKA 4C97A 1U7LA 2DGXA 1WD6A 3GIJA 2WONB 1KD1T 2AP6A 1UJ6A 4I6YA 1KNZA 3KLGA 1N34F 1WHXA 2EFPA 4PQUB 2HMIA 1JB0C 3H25A 3VAGA 2PIIA 2HHTA 4ICLA 3LAKA 2CG4A 5GAEU 3IWXA 2LDYA 1SJRA 3KG0A 3DM2B 3EPIA 2E5HA 2ZOMA 3E01A 1FA0A 1NHVA 4JI6F 1QAJA 3OL6A 1ZPVA 4ZPTR 4OI0A 1U1KA 4NXNF 1TFYA 1UJ4A 3PIOQ 5D77A 3DLKA 1JMTA 3CJ5A 5ITHA 2VC0A 3GIKA 1HNVA 1YJTA 4WFNQ 3J7YI 4QR1A 1HNZF 1UVJA 3PEJA 4G1PA 2RQ4A 1G7CB 1NEEA 4Q2LA 4ZP9A 1PC4A 2KXHA 4NX9A 1JNRB 4IOCQ 1U1MA 3MOJB 5GAHI 1CSJA 2OFHX 2IVMA 3W2VB 3OV7A 5KFKA 1Q81T 1OS5A 2Q43A 1LW0B 4RW9B 4JV5F 4DR7F 3KHRA 3OJUA 2HNYA 3V6DA 1TFWA 3CE8A 1ZZFA 3K8VA 4ECSA 5CQGA 3V4IB 3K5PA 4OHZA 4UW2A 4LT6A 4LF5F 1GX5A 3RW6A 5JJBA 2IJNA 5IQ6A 5KG6A 3I0SA 5I3QA 1U2FA 5AXMA 1NJWA 5BJRA 2HG4A 1TKDA 4Q0BA 4LMZA 5KFGA 1Q78A 3HXMA 2CPEA 4BHQA 1BQXA 1YRXA 1U24A 2GMHA 2B5JB 1VQYA 4MK9A 3R5DA 2ERRA 4RBTA 4FF1A 1VIOA 4YEAA 3CDUA 2FVRA 5B09A 5A8WA 4K4SA 3DLBA 1AXQA 3KWMA 2A3JA 1TL3B 1U25A 1X9MA 2MY8A 2OSRA 3QO9A 3TR5A 1RTJB 2FHJD 3EUNA 1S48A 2OPPA 2QO3A 1KVJA 1S9GB 1X4EA 2RQCA 3CMAS 2C22A 1RAJA 1VRTA 4EZ6A 2BACA 2CIMA 1M5SA 3V6KA 3D1HA 5HMZA 2GHWA 5AJ3F 2BJEA 3QLHB 1TR0A 1R6YA 2I0XA 2OSQA 3TVZA 3CCZA 1P8GA 3KFWX 4AXIA 4CCHA 3CPWR 2VOPA 4GO7X 4ILRA 4NRTA 4KFBB 4PR6A 1S10A 5A8KA 1HQEA 1G6BA 2PT0A 4YDDB 1FF2A 2AQ4A 1UA0A 1N56A 4PUOB 2W4CA 3TRGA 1F60B 3TYTA 1FEHA 4O3OA 1IR0A 2CFXA 2ZH8A 1C0TA 1TKXB 2ZH6A 3K0JA 2KM8C 1E6VB 1YJUA 1DJ0A 1RTIB 1ULRA 3BO2A 2YKMB 3DRPA 2UUWA 4FXWA 4DSEA 4JI5F 4FPRA 4ETZA 3AH6A 3UCZP 1SJFA 4QR0A 2JEJA 3PW4A 3K7RA 4H4KA 3ENVA 2ADBA 2VFSA 2ZDPA 3OTBA 4K4WA 2A18A 4IG0B 1RT2B 1YJVA 2OKQA 1LV5A 3RYLA 1UW4A 1VRUA 3V81A 1OWXA 4DX8H 2LECA 1NNDA 1NH8A 3OR1A 5L8RC 3KYLA 4NLOA 3HHLC 1UJ5A 2C3UA 1O5JA 2EVZA 4DF4A 3CD7A 3MD3A 4NA3A 2BYCA 1N0UA 1SV5B 1LWEA 4Q2MA 3NGKA 3NAHA 2O66A 1X5TA 5KFIA 2W9CB 4X4VA 1YWXA 3P5TL 5CCLA 2E7XA 3CB4A 1VRUB 2FLPA 5IT9Y 4NCBA 3UPFA 3NMRA 1K1SA 3KTQA 5G4DA 3TVKA 3BO3A 3PW5A 2Y1IA 2E1CA 2NPIA 4X4OA 4ES2A 4Q43A 1SXLA 1IBLF 4A8QA 4C11B 3CULA 3ZFVA 4O3NA 4F3QA 4JV2A 3CCRS 2KYZA 5E3QA 1FJ7A 5B0BA 6FDRA 3CWJA 3PVXA 2PA3A 2IM1A 3KK1A 3BO4A 2P9CA 3NNHA 1B7FA 4CZCA 1R89A 4EYIB 5AXLA 3H5SA 4DV6F 3CJKB 3V6HA 1N5YA 4HKQA 2WRMA 4V19X 1HD0A 3MMAB 2ROEA 2EBEA 2N7YA 2ZC4A 4NLDA 2FVCA 2JVOA 1SC6A 2FHOB 1R8PA 3E3XA 3MEKA 3OFEA 4OX8A 3MCSA 2A2CA 1FNMA 2R8JA 3PKMA 5B0DA 2P9GA 5C24B 2YNFB 3DXSX 5J2PA 5LT5A 1H2TZ 1SUQB 1WTFA 3QWUA 4DR2F 1SJ4P 1H6KX 2FIUA 1ZBTA 4UOCA 2IRUA 1MROA 3MUMP 2YVSA 2ZE2A 4DQIA 3M2VB 1X9WA 2BDPA 3BGUA 3SSRA 2N82B 1LKZA 5F3ZA 2J6SA 4E8UA 4C9DA 2EG1A 4I6AA 1FXLA 2R2UA 1FERA 2J0QD 1GXTA 4NPOA 7FD1A 3NCRA 4KRWA 2FVQA 2B51A 4CH7A 2CPYA 2LEBA 1S9EB 5KFAA 1OPZA 1SL1A 1KFDA 1H7XA 4PG6A 4RWWA 4ECYA 2BRLA 3KJVA 1RT7A 3JSYA 2ZC3A 2GIQA 3FQKA 3MM6A 4OJ3A 4TY8B 4ZPCA 4C0OC 5KFCA 3RW7A 3TA1A 4BDPA 1YI2S 3S7RA 4TU7A 1K73T 1S1VB 3BEGB 2E5JA 4LUBA 4WZQA 1FK9B 4ZOSA 4F4WA 1FRIA 2GFFA 2YNHB 1ZPWX 4DF8A 3CIZA 4MAKA 2RS2A 4HHJA 1JLQA 4QOTA 3FRZA 3Q8QB 5EN1A 1KVIA 4EO8A 5AE3A 1B0PA 4JI1F 1JLFB 1JJHA 4IFYA 4LSNB 2RS8A 2VUGA 2N3LA 4ETXA 2MGZA 3NAIA 1Z2LA 1BQMA 2OD4A 4WYWA 5GAEI 1TK5A 3W3SA 2Y1JA 1I6JA 1TL4A 3VAHA 3JYTA 1U6BA 4JI3F 2JH3A 1FKPA 1LFPA 2V8DA 4Z2XA 4CO3A 2QIFA 4RW7A 5FLXY 1VOMA 1N0VC 3PHEA 5KOWA 2IRYA 4O44A 4ECVA 4FBUA 1UVKA 4K0KF 3VALA 4FF4A 4ZHRB 5HL7Q 3SQGB 3AB2B 1HW8A 1KOOA 3MM9B 1KQSR 1U1OA 4E0DA 4I68A 3RAMA 2UUCF 2XSFA 3D28A 4ZDNA 1R0AB 5JVGQ 2DH9A 3PO4A 1TUVA 2LQ9A 2HW3A 2F8MA 2UU9F 4G1QB 4AL5A 3DLGA 5CZVA 1NHUA 1J5OA 3NL0A 1X4GA 1FRXA 1JWWA 1Y5NB 1U09A 1Q82T 5B0EA 3RRHA 3ULHA 2ZH5A 1VQLS 3HHNB 3J7A1 2FJEB 1RT1B 3QGGA 4ED6A 2B9YA 1L3VA 1S79A 2VBYA 2CJQA 2XSJB 4Q44A 2DHSA 3GG0A 4RNNA 4C8OA 2E1RA 1M5VC 4ZCIA 2I38A 3Q8RB 2CQHA 3RZAA 2AYGA 4IH5A 2CPIA 2IM0A 4X62F 1QM9A 1X4BA 2RQMA 5MAOA 5E5NA 2NSCA 2V94A 1TVRA 5J2QB 5F9LA 1OSDA 1HARA 1DTTA 5J1EA 4OZLA 1FRKA 5HLFB 1TL1A 2RSQA 4I56A 1E6YB 1C4AA 3QJPA 3AQOA 4MIWA 1RTDB 1NJIT 3PZPA 1TAQA 3OTCA 4ECTA 1IJEB 1MWZA 1OQ6A 1QE1B 3OFGA 1NAQA 4UY8T 1X5OA 1XBWA 4DQQA 2HWHA 4AUKA 2KZMA 4Y2MA 5E3PA 2KRRA 4DEZA 2VBZA 3I9V9 2IFXA 4WFBQ 3HHLD 1UFLA 1GH8A 2CQ0A 1TL1B 1NJZA 3KLHA 3IO1A 1U47A 1W25A 5K8OA 3DLHA 3I96A 3JTNA 2F3JA 1UMJA 5DO2A 5HP1B 2BVZA 3DMJB 4ZP6A 3U1MA 4OI3A 1YHQS 4W92B 3FSYA 4L3NA 2E7WA 2QMWA 4QIEA 5BYRA 5M2RA 2FJXA 1X4HA 2FUG9 3MGJA 2F7VA 3OUYB 5KAKA 1W2BR 1GAOA 1GTHA 3O44A 2MKJA 1DLOA 5D6GA 4OL8A 4R5PB 1MSWD 2LU1A 2F1FA 4DMZA 4CIOA 1C1BA 4TLQA 3S1TA 4C0HA 1FT8A 1FDAA 2M5YA 3LWMA 1Y3KA 3TAQA 2D3OR 2ZZMA 4OZNA 3KK2A 1MW7A 1WI8A 3CMES 4IRCA 3HJFA 4DR1F 3RR8A 1WNEA 1KQKA 2VG7B 5L1LA 3L7OA 3EXYA 3TA0A 2WOMA 4YY3F 1RT6B 3N01A 4YFUA 5EUHA 2O3DA 3MR3A 3M6WA 4H4OB 4XPEA 4DL2A 3GR1A 3AAWB 4HT5A 3HK2A 2MKHA 1HQUA 4OZ1A 5I3UB 2VD3A 4YMEA 2ZD1A 2RRBA 4DWIA 2MQPA 4DQRA 3KOAA 4I2PA 3SFGA 5T7LB 1WWHA 2RRAA 2V2KA 2J9DA 1VQPS 4F50A 3CCVS 2X1GA 4CNZA 5CZXA 3DRSB 2W8KA 3BQ0A 4NCAA 1V9OA 1ROFA 1SL2A 1J5EF 3LW5C 2V4QA 1UL3A 2MKCA 3VAJA 3LGNA 4YB5A 5E7OB 4ES3A 3L95X 4ERDA 2MSTA 2MJNA 1KLNA 2HWTA 3MTKA 4DDFA 1HQUB 1QAYA 5KFVA 1HNWF 4ID8A 3BDPA 5KG3A 2BE2A 2Q66A 4EBEA 5U47A 3AHPA 5G0RA 5KFHA 3OTEA 5C42B 4IDKA 5EX3A 2KVIA 2VFRA 3O3LA 1RA6A 4QYRA 2VQFF 1TL5A 3MEEB 5IXUA 1RWUA 2DNGA 3PRDA 4CT9A 1KSPA 2ROPA 2KRBA 3H5XA 2FPHX 1TK8A 1KR4A 4RKUC 1RQ0A 2C3OA 1SJ3P 2DISA 3RR7A 3NKYA 4LF6F 3KLFA 2W25A 3D5MA 3MPYA 4FN5A 4KO0A 4I69A 2PA8D 5F41A 4ZPVR 3MEGA 2XEXA 1HBUA 3DCAA 4A8WA 2IMOA 4FNHA 4LF4F 1AUDA 3IG1B 2MB0B 2W9AA 4DL0C 2AD9A 3GILA 3AB4B 2I5JA 2YWKA 4PPZA 5HMWA 2ZH2A 2L08A 4F3MA 2L9WA 4B9TA 2R2SA 4IUFA 3HHDA 1IJFB 3LAMA 3MMBB 1SKSA 5CYQB 2UUBF 4B3SF 1S1TA 3UQSA 2CKWA 3HF5A 4KV8B 1WTBA 1DZ5A 2YQ3A 2IA6A 1RISA 2OPSA 4DL3A 4IG3A 3ZZOA 3I6PA 4DV3F 2D7SA 4DV1F 5L38A 3PY8A 3MOZA 5DDQC 2HLTA 2MJUA 1VC5A 1LK5A 4KR0B 2OAUA 3R5CA 3FJ2A 4YP3A 3C6UA 2LYVA 4MTPA 5HO4A 2JC1A 4B9MA 2B4PA 1M5KC 3FSXA 3N6MA 3G9CA 1SB6A 5F8MA 2QLXA 1S1TB 3BR9A 1N54B 4A47A 4WCEQ 1U45A 3UR3C 1CQMA 4R8UB 5DS7A 5ADZA 5A2QY 4QWEA 3LP2B 4H4MB 2O1PA 4NZ6A 5JUMA 2A10A 4R0EA 1A9NB 1FNOA 3ZZUA 1FKAF 2FLNA 5CXTA 2V4RA 1VK3A 1VK8A 2HS4A 1S6PA 2IA0A 4ZKAA 4I67A 2ILZA 2WTFA 1VQNS 2XMKA 2IJFA 2WCXA 1DHMA 2CJ9A 2JHEA 1N6QB 3MTJA 2N7CA 2WSCC 5F0WA 1IKYB 2MZ1A 1S76D 3DYAA 2JFDA 2ZUGA 1U6FA 2U2FA 4IQMA 1VBYA 1YQHA 2RU9A 2PSZA 4DSLA 1KN6A 2E5LF 3NCQA 2NPFA 5KFNA 2OIHA 3C8YA 1M5OC 4DL4A 4IOAQ 1LWCB 5DDOC 3LWLA 3B4MA 1Q79A 2X51A 4WFAQ 1S1XA 3T9NA 1MNEA 3DOKA 1WF1A 2BZ2A 1N5SA 3I0RB 4OJGA 4TKTA 4QWAA 5KG2A 4K4UA 5I4MA 2XS7A 2KG1A 2XI3A 3IWNC 4DG1B 4CTAB 4B9NA