1N5QA

Crystal structure of a monooxygenase from the gene actva-orf6 of streptomyces coelicolor in complex with dehydrated sancycline
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
112
structure length
112
Chain Sequence
AEVNDPRVGFVAVVTFPVDGPATQHKLVELATGGVQEWIREVPGFLSATYHASTDGTAVVNYAQWESEQAYRVNFGADPRSAELREALSSLPGLMGPPKAVFMTPRGAILPS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The structure of ActVA-Orf6, a novel type of monooxygenase involved in actinorhodin biosynthesis
pubmed doi rcsb
source organism Streptomyces coelicolor
molecule tags Oxidoreductase
molecule keywords ActaVA-Orf6 monooxygenase
total genus 28
structure length 112
sequence length 112
chains with identical sequence B
ec nomenclature
pdb deposition date 2002-11-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03992 ABM Antibiotic biosynthesis monooxygenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.100 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1n5qA00
1P6TA 2FHMA 1SB6A 1TR0A 2HLTA 2IYIA 2QLXA 1KVJA 1RJJA 2KYZA 2K2PA 4DN9A 2EW9A 2RILA 2HIQA 2CRLA 2GCFA 1TL5A 2GGPB 3KNGA 3T9NA 1JWWA 2XMTA 4HH1A 5B0AA 4F67A 1FVSA 2AW0A 1VQSA 2OMOA 1P8GA 4Y2MA 1OQ3A 1Y3JA 3K7RA 3TNVA 1OSDA 2N4DA 1Q53A 1Y9OA 2AP6A 1X8DA 4HI1A 5B0CA 5B0DA 3HHLD 4Y2KA 2XMMA 3KG0A 4HL9A 3HHLC 5B0FA 4ZA1A 1YJTA 3UDCA 1S6UA 2Q3PA 2OFGX 2VH7A 1Y0HA 3HDSA 3BDEA 4ZOSA 2GV1A 1TL4A 1X0PA 5IXUA 1N5VA 1OPZA 2IFXA 2PD1A 1FESA 2PGCA 3F44A 2K1RB 2XMUA 5F0WA 5B09A 2GFFA 3BR8A 4OJ3A 3VTIA 3HFKA 2ROGA 3LO3A 2ASYA 2LXFA 1ULRA 2KT3A 1YG0A 3FMBA 3IWLA 2OD6A 4OJ1A 4YDXA 1V3ZA 2XMKA 4OJGA 2JDJA 3MCSA 3FGVA 2QLWA 3BF4A 2GO8A 3DCAA 4A47A 4DPOA 2OKQA 2BJEA 4EFAC 1S6OA 3QMQA 1TUVA 2ZDOA 3FRYA 1N5TA 4FNHA 3BGUA 3HF5A 1XBWA 2FB0A 3HHLB 2QYCA 1FEEA 5B0BA 2ZDPA 2HLUA 4Q2LA 4DL0C 4QOTA 2HQIA 3CJKA 1Y3KA 1JK9B 1W2IA 1MWYA 2OP5A 1VQYA 2OFHX 4YEAA 3TOQA 3WDOA 2GA7A 1KQKA 2G9OA 1MWZA 2RU9A 2FTRA 1CPZA 2BJDA 4NL5A 1APSA 2W4PA 1CC8A 1Q4RA 1TZ0A 2ROEA 1FE0A 1N5QA 1N5SA 1SQEA 2W4DA 3BM7A 3HHLA 3IWXA 1AFIA 2OD4A 3QGPA 1AW0A 2RMLA 2IYGA 5B0EA 4Q2MA 3TRGA 2N4CA 1FD8A 2HFOA 1QUPA 3GZ7A 1R6YA 2W4CA 2K7KA 1URRA 3KG1A 1FE4A 2KT2A 4A46A 2QIFA 4OIXA 3DXSX 5A6WA 2GGPA 3LGNA 2BBEA 2K1RA 1CC7A 5A6PA 2XMJA 1K0VA 2OAUA 5KAKA 2RSQA 2AJ0A 1IUJA 5F0UA 4U9RA 1YRXA 1YJUA 1Q8BA 2AJ1A 2LDIA 2LQ9A 2ROPA 1Q8LA 2VV5A 2XMVA 3CJKB 4OJHA 1YJRA 5T7LA 5K9FA 3BB5A 2KKHA 2HFNA 2LQBA 3MZIA 1AFJA 5B08A 1GXUA 2XMWA 4HI2A 1U7LA 5B0GA 5T7LB 3HX9A 4A4JA 1X7VA 4HH0A 4FNIA 1SI9A 2BYCA 3E8OA 3BN7A 1FVQA 2N7YA 3KKFA 1LQ9A 1OQ6A 2K7JA 1YJVA 4NPOA 1KVIA 2L3MA 1WD6A 2BUNA 3I9ZA 4Y2IA 3LGMA 2FIUA 4A48A 2ACYA 1GXTA
chains in the Genus database with same CATH superfamily
4DSIA 2QLBB 1JLQA 3AD8C 1D9FA 4DBQA 1Y11A 3VV2B 2GZOA 3MAHA 3W65A 2B5JB 2MHNA 2JEGA 1RJJA 2DNOA 2ZKTA 1HHSA 2EW9A 2ZC4A 2MQPA 2CRLA 1XR7A 2V4JA 3OUYA 3G6XA 3CCSS 5B0AA 2Q79A 3TI0A 2E5GA 5D77A 3SSSA 2HBQB 1HQUB 1JJCB 5KT4A 1W2BR 3DLEA 3PRVA 1N8RT 4K4SA 1N52B 1TUGB 1Y3JA 2CQ0A 3VAIA 1AYEA 2F9JA 4I0WA 3DXBA 2FJVA 2V5HG 3SMZA 4K4VA 3BSCA 1NK0A 2HGLA 1WC1A 2DR6A 3MM8B 4NRUA 1S1VA 3T6BA 4ZIVA 1U8WA 5K14A 3GYNA 1FRJA 1X5OA 1S1XA 2DPIA 4ZP9A 3T1AA 1Y0HA 1D9DA 3QRQA 3DRPB 1D8YA 3OR2B 1X4FA 4JV5F 3GWCA 3LP2B 3GR1A 4DR2J 5L9NA 1JB0C 4NMXA 5F0WA 4DV4F 2GMHA 2IM0A 1C4CA 3NGDA 2QA4S 4LF7J 1XR6A 4DUYJ 3KLEA 2E9ZA 4D3GA 4KO0A 5CYQA 3LO3A 5IT9Y 1VDHA 2PI5A 4PQUA 2CQBA 2KN4A 2ZH3A 4KQZA 4AD6A 2IAJA 4WK3A 3ZZUA 1SJFA 2YY3A 3C6TA 2ZBIA 3WHIA 2AHOB 4LMZA 4RW6B 2M2BA 4EBDA 1ZZFA 2XTJP 4MKVA 2G1HA 1C0TB 1L3VA 5KFVA 3SFGA 2BXJA 1NK7A 5CD4H 4M5DB 3KTQA 4UY85 3N6NA 3HVWA 4MK7A 2QT7A 2IA0A 2QYCA 2HQDA 3UVJA 4OZ3A 4CQ1A 4EBCA 4OI0A 4J9UE 4QOTA 2ZHBA 2YX7A 4LF8J 3MPDA 4LRAA 4Q8EA 4P2MA 4TQRA 2C28A 5KFZA 4NXMJ 4ZJOA 2DNKA 2Y0BB 3WQPA 2I38A 1Q4RA 2HSEB 4DMZA 1HNIA 5JMNA 4IQMA 3TAQA 1RXOB 2U2FA 3M6VA 1U2CA 2C3UA 3UE2A 1WUUA 2L08A 3I96A 1S1UA 5KFTA 3PJ9A 1KD1T 4CLTA 1ZAVA 3CDWA 4KO0B 3QAUA 1RWKB 4B3SJ 5DLFA 2YNGB 5D78A 2W01A 3HKZD 2LXUA 4F3QA 4LQ3A 3BKTA 3U1LA 3H40A 4H4OA 3LPYA 1JLEA 3QT8A 2YXLA 4OIXA 5A2QU 1DQ9A 3RRGA 3NWGA 2GGPA 3HXMA 4P73A 2LQ8A 2VBXA 4C8NA 2K1RA 1WHXA 2F5GA 2MKYA 1R8PA 1EETA 2ALYB 3NS6A 4ED8A 1U1QA 1M1HA 4L72B 2RUSA 3GMGA 1DJ0A 4DSKA 1LXJA 2XEXA 2JEIA 3CJTA 1LFPA 1EP4B 3H25A 4DQPA 4KAIA 3KOAA 3HSDA 1CQNA 2OLWA 3VCDA 5B08A 1G1XA 2EEYA 4MK8A 1HYSB 3MR6A 5EWFA 3HT3A 1V6HA 4CTAB 1S6PA 3BO3A 2MXYA 2FD2A 4KV8B 5HAOA 4EYIB 4OYXA 2BYCA 3R6LB 3DRYA 1RWVB 4JI1F 2YKQA 3FUYA 5GMDA 4OI6A 1FWLA 1MU2A 4LR9A 1WHVA 5K8PA 3KLFA 5I3UA 3BV8A 2DR7A 4A48A 2YKNA 3CJ5A 3U02A 2OPPA 4Q8FA 2UXCF 4C4WA 1ZYQA 3BREA 1HNWF 3PW7A 3RUBL 3I5CA 1HWJA 4IG3B 1OSCA 4NLVA 3OFHA 3K8VA 1VQ4S 3KNGA 1RAAB 2NXJA 2OPPB 3V6DB 3D1HA 5A76A 1P9QC 4P2SA 1NEEA 1VMBA 2CDQA 2IHR1 3CC4S 2HRYA 2DRDA 4J37A 2HZCA 3K7RA 2FVSA 1OSDA 3BYPA 3IM8A 2E1MC 3R9LA 2BANB 2X3GA 2Y9HA 3PVXA 3FEZA 4ICLA 2VBZA 2XNQA 1KP6A 2CJBA 4W4MA 3M8ZA 5B0DA 2DITA 2NCKL 2XYGB 2XG8A 2KG1A 5HQLA 1HR0F 1D8ZA 1RBLA 1S6UA 3AY0A 4UOFA 1SL0A 1TK8A 3M8PA 2X1FA 2IRUA 4C3LA 1F3FA 3LP0A 4X64J 2FYXA 3CNQP 4L76A 4RR5A 2BKOA 2EKNA 1XNQF 4CO3A 1K0TA 3UQSA 1U8SA 4ATNA 4DV7J 1FX4A 4KT0C 4DUZJ 2YNIA 3B54A 1DAXA 2YKMA 3MM5A 2UVUA 4USMA 2XS2A 1O8BA 4ID5B 3BR8A 3RRKA 4ED1A 3J81Y 2ADCA 4N5SA 2PN6A 4QR2A 4RWWA 4XDCA 4K0KF 1RT5B 1FXLA 3B4DA 1GAOA 3JSBA 2F9DA 3BN4A 3ZZZA 3T1YJ 1EKSA 3ELHA 4GKKF 5C25A 1MG7A 5DDRC 4R8UB 3FCVA 4H4KA 4ZCLA 3V6DA 1HR0J 4G65A 1Q78A 3DCAA 3KK2A 3MMAB 4DS4A 3IP0A 5HANA 3AD9C 3RW7A 3HVTB 4X64F 2Z2LA 5C25B 2ZVIA 3PHTA 4BC9A 5G0RB 1YDLA 3BKUA 3TZWA 3V6JA 3SCKE 2FZKB 4M5HA 1KS2A 5EN1A 3PIOQ 4BCAA 3CIMA 3TA1A 4TQSA 1MN9A 2YX1A 3EGVA 2VKZG 3TOQA 2BR0A 2G9OA 2H4YB 3TUIC 1VRTA 3FZ2A 2DCUB 2C2MB 1BE4A 3MPUB 4LRBA 4JP8A 3UWTA 2KXNB 2B4UA 1R8BA 1ELOA 4O3QA 3K5LA 4CTAA 2OSQA 4ZVOB 3LWMA 3RB6A 2FC9A 1T3NA 4JV5J 5IWAF 5CABA 3D66A 3D1OA 4LF1A 2W9AA 4DV6J 4MT1A 2R8KA 1R8HA 4MH8A 3PX4A 1ZM3A 4M5MA 4KB7A 1RHJB 4WBFA 4ER8A 5ETKA 4J9NA 3C6TB 1RYSA 2CJYB 4HDHA 3C19A 4MK9A 1YQHA 2EK1A 5CYMA 3UW1A 4DV1F 5GAGU 2ATCB 3RAXA 4B9VA 4TLRA 3LWLA 2AGOA 1RWUA 2EI5A 2HURA 4TYBA 3FSIA 4IOCQ 1DQAA 2RHQB 1JXLA 4ELVA 2H9ZA 4K4XA 4DR6J 1ICEB 4K4YA 1V5VA 1REVA 2DH8A 1D9AA 3RTVA 2CQIA 2KL8A 2R7RA 2VA3A 1RSCA 1HQEB 2NSCA 4KYZA 4M5NA 4RNOA 1WC3A 2EBEA 4S0MA 3OR2A 3QJPA 3H7HB 3NMAA 1Q8LA 4L75A 2RAQA 3BB5A 4NLRA 2HFNA 2GVDB 3EZOA 3MZIA 3EZ5A 1F9FA 2D69A 3KJFB 1Q8KA 2P9CA 5HMWA 4NXMF 4B3MJ 1FWKA 1KOOA 1XJWB 3IM9A 5B0GA 4LF9F 1CLFA 3EVMA 1NH8A 1FRIA 4HH0A 4FVCA 4G6VB 4FKXA 5KFFA 1X4BA 2O01C 3E8OA 3M30B 3MM5B 2DCLA 2NXNA 1FVQA 5D4PA 3T9ZA 4F0HA 3W9IA 1U49A 2VG5B 2XS5A 1YJNS 4ZLLA 1QAJA 1FHTA 2JZ5A 1CULA 4KTQA 3ZZTA 1SVDA 4WKRA 2ACYA 3CB4A 2OTLS 4O3PA 2MQMA 4WP8A 1QDUB 1FO1A 5KFAA 3FBCA 4JI4F 1KFDA 1FKPB 1KTQA 1R89A 1WJ9A 1KEKA 3SZ2A 1U1NA 3JSMB 2BANA 2GCFA 4QYZJ 2PFDA 1JLQB 2KXHA 2QZ8A 1VBZA 5T41A 1S49A 4F67A 2A6OA 1SV5B 5EWGA 2A3JA 4QBUA 2QGFB 4ZPAA 3WIVA 3AOBA 5L38A 4DU8A 2F1FA 1F0XA 2PA8D 3ENAA 4CZCA 4Y0FA 2XM3A 3UDVA 3D68A 1SJ3P 1HBOA 2WVFA 1X4AA 2YWGA 4HT5A 2QLJB 2UUBJ 1VJWA 1S1UB 1DY3A 3K5OA 4YB5A 1CG2A 2LA6A 4ES1A 2Y1IA 2EFPA 1C4AA 4OX6A 3KLHA 3DN9A 4DN0A 3U1NA 4DFPA 1NJZA 1M5VC 3AXKA 2Q3PA 4ETXA 5GMKa 5FLXU 1MWQA 5J2QB 4DWIA 1QJHA 2GHVC 1T8EA 3R6GB 3MM8A 3UNYA 2MLYA 4C3MA 3V2UC 1P1TA 2GFFA 1HNZJ 4OYIA 5CAAA 4BDPA 1C0UB 4UF4A 2WAQD 3M05A 3Q8YA 2F8EX 2MTLA 4RBTA 1RHMB 2XMKA 4RZRA 4AYBD 3O1LA 1EP4A 2QMUB 3MCSA 2VHGA 3W60A 3BF4A 3GJTB 4ZP7A 3ILIA 3QLHB 4IH6A 3UDLA 2VBWA 2QFIA 2ZDOA 9ATCB 4USJC 5KFGA 1NB2A 3I32A 3QWPA 3AJDA 3IR7B 1RHQB 2G0JA 2DR9A 1IR1A 1XERA 1FEEA 2GVDA 4CNZA 3IBFB 2HZVA 3DRXA 2VQEF 2Z2MA 4DR1J 1PBUA 2PE8A 1FA0A 4RBUA 1N36J 3WC2A 2MKIA 1YX2A 3FEYB 3K0JA 1J5EJ 4P52A 4ZVFA 4K4ZA 4DV2J 1HBMA 2BOPA 2AZ3A 2B9EA 1HBNB 4YDDB 5DDPC 1AFIA 2Z8QA 4C11A 4DQSA 3MUTP 1B3TA 2MQ8A 5KG5A 1S97A 3JYTB 1DHMA 3QGHA 4IR1A 1IBKF 2HHWA 1RYRA 4PQAA 5FDLB 3UD5A 5F8HA 5E3PA 4TU9A 3M9MB 1R3NA 2IBOA 3GG1A 5JUMA 3Q8RB 2LCWA 4F3OA 3DHWC 2G0IA 1HNXF 4CIOA 2V4JB 4NLWA 4JYAJ 5D8HB 2CPDA 2DO4A 3CDEA 1VRUB 3K17A 3TYTA 2M88A 2HWTA 4WTOB 3S01A 4V19J 1K44A 3ISND 4DPXA 2JL9A 1R27B 3GONA 1YJRA 3K2YA 1HNZF 3TAMA 5HP1B 4H4MA 3GPAA 4H4OB 1B7FA 1FNOA 1EAYC 5DG9A 7FD1A 3L7PA 3H2UB 2RNEA 1I51B 4G1QB 3PR5B 1TV6B 3TJAA 4JV0A 3MMAA 4F0KA 1UFKA 5CQGA 1NK4A 2KJWA 3W61A 4OZ5A 1U1RA 1AT1B 4C8KA 3KG4A 3LP2A 4F02A 5H1SV 1TKZB 2JFDA 4OHZA 1OIAA 4F4XA 4GC6A 4DQIA 5AE3A 4B9LA 1V5IB 4F50A 1N6QB 1X60A 2OPSA 2DTJA 3MPWA 3I56S 5M2UA 4DR6F 2X1BA 3M6XA 3K58A 2HVEA 2I5JB 3MECA 2V9WA 4KKOA 1SJ4P 2A18A 1NZAA 2E7VA 2RQ4A 2YKNB 2ZZTA 1FK9A 4RBVA 2ZD1B 2Y0SD 5KFLA 4DV5J 5I3UB 2BM0A 2EPIA 2AD9A 4DU7A 4LF4J 2M52A 2VONA 1N33J 2V68A 1OS5A 2RF2B 3HT0A 1VQNS 2QN6B 3BPSP 3TX0A 2NXUA 2RQKA 2RS8A 3N9UC 5BXIA 1EKRA 3B6BA 4DV0J 2RDJA 4WXOA 4ETZA 2V94A 5FLXY 2Q43A 2W1BA 2I8EA 4YMEA 5HQ8A 1YJ9S 1WSRA 1Y10A 1C1BA 1H0HB 1TAQA 2RE1A 2V6AA 4K5RA 2J8SA 3M8QB 4DG1B 1JLAB 4KHPF 3CCZA 5EGYA 1RWOB 3Q86A 2MSTA 1EETB 3ILLA 3JQMA 4O4GB 3RBDA 2C3PA 2J9DA 2DISA 2K1RB 1SUQA 3EXCX 5E5NA 5LXYA 4ZLJA 5DQGA 4OJ3A 4RNHA 3CCMS 1PC4A 3DRPA 2V8PA 5F8IA 1FJEB 4IOBA 1SJQA 5KG2A 1DTTA 1RAJA 4YR3A 2ASYA 1T05B 4C0OC 2QA4G 3FMBA 1WNEA 4Y2AA 2OD6A 3ZZOA 2MY8A 4NE9C 2YQ0A 1FDAA 2PT0A 4Z7CA 4I6WA 2KHCA 2AYGA 5KT5A 2XGQA 4FYXB 4A47A 1S6PB 3G8QA 1CS4B 3MM9A 3CCQS 1BXNA 3HPOA 1MMLA 1FX2A 4NLSA 1PCAA 2VASA 3FRYA 4NRTA 4YP3A 1S1TB 2VFVA 3QZ7A 3G8SA 1ZTWA 3ZXWA 3CJ8A 2DRAA 5HP1A 2ZH2A 3FVYA 2DKOB 1F1BB 2OPRA 4DL0C 1TP7A 3KK1B 3R1LA 3SV4A 4MYUA 3TWZA 3M9OB 4ZVHA 2OFHX 1YLXA 2XLKA 1FKPA 4NLTA 2XZWA 1VQKS 3DDKA 4NL5A 4P9SA 2R2UA 4KBIA 2W4DA 3BBCA 3FRZA 4KGVB 2CXEA 2GQCA 2HNYA 2ZOMA 2V2ZA 2IM3A 3PDNA 4WFNQ 1U1MA 1N54B 2YQ1A 1AW0A 4QIVA 2AQ4A 4X4SA 4ZCKA 1IBMJ 1NJXA 4UOGA 4K5SA 5K8NA 4ZPWR 1QUPA 3VAGA 1Y00A 2W4CA 4PXEA 1T0TV 2CWKA 2DB1A 5KFWA 1OY6A 2CPFA 1RHKB 2OSRA 4DXLA 2MZSA 2ZBCA 3DXSX 5IQ6A 5A6WA 4DG1A 1SL1A 2P6SA 3DGPA 3VZHA 2CG8A 2OHDA 1UFLA 1CC7A 1UEVA 3IFEA 1CEZA 2XSJB 2ZE2B 4ES2A 2VKRA 1Q8BA 2YWHA 4QIEA 3OVAA 3LF0A 1SH3A 4WYLA 2B9YA 3BKFA 2FJXA 2QL7B 4LJMA 5K9FA 3R7SB 2DNZA 3L7UA 4AE5A 4BC7A 2CZ4A 2EG2A 2XULA 2OGUA 5L8RC 4Y28C 2B6AA 2KRBA 1FRKA 4NCGB 4J90A 3SFUA 3G71S 2MZJA 4A4JA 4E2FB 1U47A 2NXCA 4F4AA 1VQ8S 5AXMA 1U0HA 2W9CA 4I69A 4ZVSB 2RKIB 3TW0A 2ZNYA 3GR0A 3BQ0A 4LIWA 1GX5A 2XY6A 1KOHA 2KM8B 2HIYA 4JI8J 3VQTA 2KM8C 5KT2A 3W7BA 3M8RA 2DY9A 1GXTA 1MROA 2C2OB 5ETVA 1GH8A 3KLEB 4CO0A 2PIIA 4MFBA 4PG6A 4DZDA 1NZ8A 4F8RA 3HVAA 3VHQA 1M5KC 2QLXA 2V0NA 1FNMA 3KJVB 4HYKA 3T1YF 1GK8A 3W2VB 2H5IB 3A13A 3OTDA 2XWYA 1PKUA 1H7XA 3BQ1A 4DHVA 4GKJF 1VQSA 3K8WA 1HWLA 1G4CA 1LNQA 2B51A 4BS2A 3P49B 5F8JA 3MPVA 4NI2A 2XC9A 5F3TA 4KH0B 3SCJE 4N8NA 5BYRA 3I4PA 4MKBA 4EWTA 4RNMA 1X8DA 1H73A 3NCRA 1O5JA 3P45B 4HR2A 1UVMA 2E5JA 5HSPA 1SV5A 2EKYA 4P2XA 1WKKA 5IC6B 3ENQA 4NYOA 1UW4A 1RBAA 2VH7A 4AL6A 1WDDA 2DGVA 2R7OA 2RQCA 1VYAA 1H74A 2IFXA 5KFXA 2JC1A 1XWLA 5B09A 1UEKA 2Z2YB 3MTKA 3I0RB 4X84A 2AGQA 1XMOJ 4O3SA 2UXDF 1B7YB 1BMQB 4QW9A 2AWZA 4LRCA 4LF8F 3KFWX 3RRHA 5KFSA 1ULRA 3B78A 3RAQA 1VQ9S 1V3ZA 3CSKA 3MPYA 1WOSA 5HMYA 4QIFA 3FK4A 2H4WB 3HZEA 4NYPA 1RKJA 3LANA 4X4QA 3B8HA 2CUYA 1SC6A 1RTIA 1S6OA 2HAIA 2CQ1A 3A3PB 3VVUA 5C7PA 3QT7A 1NKCA 3HK2A 3THPA 2VJVA 2I2YA 2W9BB 1CSJA 2DNRA 3QRPA 1XMQF 3FFIB 2IRYA 1VK8A 1M5PC 5CCMA 1N48A 2E1PA 2D1CA 2AIRB 3HZGA 4PWDB 5AE2A 2ZJRQ 3BH6B 1XQIA 4B9TA 1Y4ZB 4C7QA 1EHWA 1HPZB 3QBCA 2AZ1A 4ZK7M 3N6MA 3TP2A 2RKIA 2AX0A 3I0SB 5KFEA 3F73A 3C2PA 4OL8A 2BX6A 1APSA 2W7PA 1AUDA 4U67Q 1DLOB 5D15A 2J6TA 5DGAA 3ET6B 1X4EA 3RG6A 3S8SA 4ZCIA 4CRJA 1H7WA 1NM2A 2GNKA 4LSZB 3DKDA 1J5OA 3GLJA 2AMCB 1FD8A 4HHHA 5DQHA 3GZ7A 4QR1A 3DLBA 3S6EA 2C2EA 2GVZA 4C8OA 1FFWB 5KFIA 3HJFA 2QA1A 1Z2LA 2KDOA 4PABA 3TA0A 3K5NA 4JI4J 2SXLA 3TJ8A 2DIUA 4RU9A 3MR2A 4B9NA 2XHWA 4NLOA 3QJJA 3OUYB 3PYGA 1CJVA 3G82B 1S99A 4YY3J 3OHBA 3RZAA 3W5XA 5KAKA 2MGZB 1G6BA 1JKHA 5J2NA 2G2OA 1K1QA 2OPQA 4ERDA 3UO0A 2JJ4D 3D1QA 2WW4A 3CO0P 3QFWA 5ITHA 1JLCA 1WSVA 4HLBA 2UP1A 1VBYA 2UUBF 1RB0A 2A0FB 2FDNA 2IIHA 4FN5A 4NASA 4ECWA 5E3CA 1K8AT 2NS1B 4BWJA 3G6ES 1T9TA 1NHKL 3I6PA 1FWPA 4CYUB 4QPTA 2MKKA 4I56A 2VPYB 1KC8T 1KQFB 3NOGA 2DVIA 1JLGA 1LW2B 2K7JA 1S9GB 2JHEA 2QLFB 1YJVA 3ILOA 4BWMA 2I6WA 3CWJA 2BUNA 4Y2IA 4WFZA 3A8JA 2OPRB 2HYIB 2C22A 3GG0A 2XNRA 2LQ5A 2VOOA 3IXQA 2LECA 4R0JA 2B3TB 5HATA 5D4NA 2PFFB 4DV6F 3ENWA 2L48A 4QJVA 1CS4A 3MM9B 4HACA 5CD4A 1KLNA 4Q0BB 3QIPA 5SZTA 2RU3A 4ZN3A 1ITPA 1HLWA 3D6TB 2F8HA 2OMOA 3CCUS 4PXBA 1K9MT 3DYAB 2DIVA 2DRBA 4JI3J 2W2OP 3W2WA 3C15B 3JB9k 2E44A 1RLCL 4KHRA 3TUJC 3OJSA 1ROFA 3CC2S 3QAEA 3POTB 4J9QA 3TJ9A 3HHLD 2HVZA 5F9LA 4AXJA 2E5HA 1TL1A 4WFXA 2AJ4A 2QL5B 3IRXA 2GIFA 1JMTA 1RT4B 2OFGX 3NAHA 2HMIB 5CZVA 1GMVA 4HEA9 1N0UA 4ZOSA 2QRRA 4ED4A 1R0AA 2FVQA 1WOOA 2UVVA 2M5YA 1SQGA 4F4ZA 5DG7A 1UVNA 1X4CA 2WONA 3NBPA 4Q43A 3G4SS 2J76E 1GTEA 3KHGA 2DH7A 2ROGA 4WU2A 2LYVA 3H4BA 2Y1JA 3N5FA 2VDHA 3H42A 1T03A 2B6AB 2L9WA 2VB6A 2BE9B 5DS7A 5EHHA 5HMZA 2ZJQQ 2GVZB 2WW8A 2R8JA 1L3KA 3JQJA 3D9BA 3LW5C 3D67A 5IWAJ 4F2RA 1H3DA 3MECB 3NKYA 2XSJA 1SIWB 2CWXA 4LVOP 2CVIA 1N5TA 3G2XA 3LTOA 3TVYA 4Q45A 2XMAA 3PYDA 4X65F 1HBUA 4OI4A 2FGOA 4DV7F 4GC7A 4PG8A 1JNZB 3VZIA 4MMOA 4ECXA 3RB4A 4NA3A 1W2IA 2MZRA 1MWYA 4OZLA 1S1TA 2ZUAA 5J2PB 2BEFA 1U6BA 2GAHC 4HTJA 3W9HA 1OO0B 2A10A 2J8AA 2KO1A 4I6AA 4M8LA 5LM7E 1E6YB 4M5LA 4DCPB 4DDFA 2VQEJ 1MN7A 2LU1A 4I2QA 1FFSB 4DR2F 2DHGA 3DLGA 3PYEA 4IO1A 2LKZA 5HI7A 4CH7A 4CO1A 2KFYA 4DS5A 2OH2A 5IFMA 2IYGA 2KJVA 4OYOA 4TY8A 1TKXA 7AT1B 1TMJA 3PX0A 2H1YA 3MD1A 2FUG9 1RE1B 1NJWA 2HBZB 3K59A 5L39A 4A8WA 1R6YA 1QE1B 4DX7A 1RISA 1S59A 4ANCA 2F63A 3G82A 1CJVB 1HI1A 1RT3A 1FE4A 2VBYA 3PO5A 1V3SA 3FC9A 3FQLA 2IMWP 2ZBPA 2XS7A 3MCOA 2D74B 1NDCA 3LPEA 1JLFB 3O2IA 3MTJA 3AFGA 3T5HA 4QU7A 1Q82T 4LF4F 3DHXA 1YJUA 1S7IA 1LW0A 4WJBA 1LWFB 2CZVC 3FSYA 3M7VA 4I7FA 5D3GB 2DGXA 1SL2A 3JAMY 4WP9A 4ZS6A 4OHYA 1Z1ZA 3M2VA 5IOLA 1VBXA 2HVHA 1IM6A 1YKWA 3AJ1A 2CNKB 4Y2CA 5T7LB 3MMJA 5L1JA 2XGPA 1KNZA 2YH0A 3MFIA 3R8YA 3GILA 1KTVA 2BABA 2J0XA 2NLWA 3RBXA 3KKFA 1LQ9A 1NK8A 3G96A 1FJ7A 4F7VA 5DETA 1C2PA 1FRHA 3ISNC 4RL1A 4B3SF 4FYVB 1N5YA 2R7UA 3ICLA 4RW7B 3FFIA 1WI6A 2VD3A 3DFEA 1G2EA 1U0SA 4RO0A 5L46A 1SC1B 1GX6A 4AUKA 3A8KA 5K5MA 3SYZA 4IRDA 2ZM6J 4HTIA 1OYEA 5KFKA 4TLQA 2DH9A 4NWBA 4OYZA 1FTRA 4Y2MA 2MKHA 1OQ3A 1Q5YA 3N0VA 4OYPA 5K8MA 1VGYA 2FZCB 3C14B 2PMZD 2EXUA 1BGXT 2M8HA 3HKWA 2ZHOA 2W9CB 2HQCA 2HGNA 3DC2A 1J5OB 2B7BB 1URNA 3Q2TC 3MMCA 1S0NA 1BQNB 4NX9A 2DXEA 3KDNA 3HHLC 4JI2F 2I1RA 3W5YA 5C24B 2BW7A 3GTYX 1NK6A 1U2RA 4HT7A 3J80U 2ACMA 5C2CA 2ZH4A 2OTJS 5FJ4A 4ILLA 3MCMA 5KG1A 3R7NB 4F3MA 3GQCA 4ALZA 3CDAA 4C97A 4ANEA 4EK2A 2IDEA 2GHWA 5J2MA 2D3O1 2W2MP 2B5JA 4OV6A 3G6YA 2DNLA 2AX1A 3BGLA 4U6PA 3CMES 5E3AA 2UUCJ 4M5GA 2UXCJ 1TAUA 1SCJB 1DTQB 3HFKA 4LIRA 4NMLA 3SIPB 2FLPA 1I94F 1NH7A 2V8VA 5A8WA 1Q79A 1W25A 4NLYA 4DUTA 3PO4A 1N33F 2MLXA 3EDRB 1U1PA 1UEUA 1KRPA 1TL3A 4OJGA 2E1RA 2GO8A 4MKAA 3TUZC 4DPYA 2B8PA 4GVLA 3QQCD 4ZHRB 1FKAF 3J7A1 2EC0A 2YKMB 3QMQA 1NSQA 2R8GA 2YWKA 4FNHA 3M9NB 4GMKA 1VRUA 1KHWA 3O3LA 4O23A 4LF9J 4JBCA 5KFRA 2GQQA 3D0IE 3TVKA 2LEAA 1V3RA 3T5LA 1X5TA 1LWCA 1PJ6A 4Q2LA 3M8PB 3AD7C 1OY8A 3OTOF 2HQIA 4TNOA 1MW7A 1GXLA 3NXZA 3CJKA 2V8GA 2F7VA 2NPFA 1UP1A 5HBMA 1YBAA 1MWZA 2ADBA 2FTRA 1NK9A 2ILZA 2WVBA 2H51B 3KLIB 3VWSA 2MQQA 1XNQJ 2VFUA 1N5SA 3KK1A 1NRKA 1B99A 3FJ2A 4A8MP 3C8YA 2JWNA 1NK5A 4YS2A 1RT3B 4PQUB 2R7SA 2QYGA 2BZ2A 3C16B 3UI3A 3CCVS 4UY8T 2RMLA 3CT9A 3OHAA 4I67A 1RWPB 2MDAA 3CJSA 4RKUC 1IKVA 2BV3A 4RWXA 2R2RA 3C14A 3OTEA 3PM9A 1PO6A 3NOCA 3KMQA 3EWGA 4B17A 5C5JA 4JV1A 1LKZA 1KVKA 2FY8A 1NUEA 5E3RA 7FDRA 2XZTB 4OI2A 1S5ZA 3MEEA 4FPIA 4FF4A 4WE1B 1NU4A 3L09A 1WI8A 2RB7A 4OI3A 3VGTA 4YHHF 1RTJA 1WC5A 1OJ4A 1LWXA 4Z7YA 4C98A 1OPIA 1WTFA 2G0CA 2V69A 3H0PA 3SCIE 1YWXA 3OV7A 2RDIA 2HPUA 2Q1LA 1IUJA 5ETQA 1YIJS 1N4LA 4B3TJ 3HHKA 4LF5F 4X4NA 3I87A 2VV5A 4OJHA 1TV6A 3AOCA 1TFWA 3K57A 2HG4A 4DR7F 4IFYB 1F5CA 1FRLA 3EUNA 5DLGA 1FKOA 1RTZA 2DHAA 1U1LA 4A8FA 3D7SB 1XNRJ 3NNCA 2BE2A 4LQ9A 4JI5F 3HX9A 1L5UA 3CCWA 2ZH9A 1VLOA 2JVOA 2Z57B 2QMWA 5IV3A 2X51A 2KRRA 5L1KA 2L3MA 3OT9A 3HSZA 4FVMA 1Y5NB 1Y5IB 2FIUA 4LSNB 4USWA 3KG0A 5A0YB 2ZH7A 3GFHA 1BQXA 3P5BP 1SB6A 3QIPB 3I82A 2MEWA 5CXTA 2XCAA 3HP6A 4U8VA 2RVJA 5IC4B 1ACMB 3DRRA 2HHHF 4CO2A 1GEHA 2HWHA 1VHIA 4MKYA 4NLUA 1KVJA 3T1HF 2F3JA 3OTBA 2HIQA 2DHXA 1PJ7A 3RGIA 5GAEI 4LREA 1HI0P 1WF1A 2XMTA 2WOMA 1UW9A 1RT2B 2D3ZA 1HHTP 1WHWA 2AJFE 3NY0A 3A1YG 1HBNA 3CD7A 2NZ4A 3MR3A 5JXSA 4BLGA 5A2QY 3KWMA 4ECRA 2Z0GA 4IRCA 3DLLQ 3N4WA 3W2VA 3BZQA 4C48A 3HSJA 1T9YA 3KJVA 2J7WA 4IG0B 5IM0B 3ZNJ1 3J80Y 4DF8A 3IGNA 1JLCB 5CYJA 4FBUA 2PMWA 2O67A 3KHLA 2CJXB 1J5EF 3T1HJ 2HHVA 4ED5A 1VIXA 1XIQA 2GMJA 2GV1A 3RBZA 2CA9A 2MGZA 2C2DA 2Y1LB 3GCXP 5I42B 3M1VA 3X1LB 1C0TA 2C3YA 4UTGA 3ZO7A 1HNXJ 2OEJA 5ADZA 1QY7A 3HVRA 4I6YA 2J9DE 3CTRA 4KGXB 4USKA 3TANA 3FCWA 1IKYA 2R4FA 3OFEA 3PCOB 3US5A 3PR4A 1SJ1A 3EJMA 3LP1B 3TARA 2FJWA 3CJ3A 5HROA 1S9FA 1IJEB 4KRWA 2W7OA 4ID8A 1DZ5A 3AAWB 2JDJA 3E51A 5FDLA 1M1KT 2YNHA 3IG1A 2ZNZA 3NP5A 3AQPA 1HARA 3DM2B 3NS5A 4YB6A 1YITS 4O0IA 2OKQA 1XN9A 3BSAA 4ILRA 1FFGB 4XTTA 3MUVP 5ETTA 4USVA 1TK5A 5M2PA 3MEDA 4DL2A 4QYZK 3BSOA 1C1CB 1DQ8A 3HFZB 3V6KA 1HBMB 4XIUA 5J2NB 3OSNA 2FVCA 5HVGA 4L3KA 4ECZA 2ZEJA 2IC3A 5IT9U 3E01A 4U8YA 2GA7A 2KT5A 2RU9A 3ULHA 1JJHA 3ETMA 4O4GA 4CT8A 5HVFA 2V2KA 4IKAA 4G3IA 3RAMA 3IGVA 3NAIA 8RUCA 5DQIA 2W25A 1TQLA 4RJVA 3BPDA 3JAMU 4G1QA 3MEGA 5KT7A 1QAYA 1T9VA 2GS8A 1R6VA 1VBKA 2DGTA 3RB3A 5KFBA 1NKEA 2V67A 3C66A 3MAAB 1Q7YT 4K50A 3AB4B 2FVRA 1JX4A 3EMTA 3OL7A 2ZVSA 1RAEB 2YH1A 2HK2A 2MKJA 4R5PA 2E7WA 3ET6A 2HAFA 2KXFA 2PEBA 4ITSA 4KPCA 1FT8A 4O3OA 5KFQA 1IN0A 5B7WA 4YQWA 4B3TF 4QR0A 4I7FB 1L3UA 5D3GA 1S1WA 1RT7B 1VFJA 2HRTA 3IR6B 4EZ6A 4EO8A 3C46A 2EG1A 1CJTB 2XMJA 2OAUA 5HBMB 5GAGI 4Y6IA 2CQHA 2EWHA 2ERRA 1XNRF 3OTOJ 3V4IA 2LDIA 2E9RX 2JH3A 3RW6A 3D0GE 4ECUA 1T7PA 2J9CA 4Y65A 1RWNB 3BDPA 2BQUA 2FY1A 3MI7X 2VOPA 4IYQA 3HHDA 3V5RA 2M3DA 4ZPVR 4JI0F 2XYHB 4WPAA 2F4VF 3MM7B 5H9FJ 4DCJB 2YNFB 4LSLB 2PI4A 3EE3A 3CCLS 3FDSA 2HS4A 3BN7A 4FXVA 4UZCA 1ZH5A 1OQ6A 2HFSA 4ZVRB 4ZP8A 1UL3A 3DRRB 5ETRA 5LJ3Y 3QT5A 2KH9A 4A8YA 3NCQA 1X9WA 4X4RA 4X4OA 4E0DA 3TO8A 3KHRA 4OQJA 3ZTRA 1RHUB 2CJAA 1TR0A 2M9KA 3QRRA 1N32F 3J7AN 3IR5B 4O4RA 2Z58B 3V81B 4CCHA 1S0MA 5J2PA 4ICLB 1RT6A 5AXKA 4DR5J 3D6HB 2ASJA 1IKWA 1Q1KA 1TUWA 2CQPA 2V2QA 3T9NA 2AJ2A 5KG0A 4HHUA 3NGKA 1GQEA 1LK7A 3QGIA 4ES3A 2JLGA 5AJ3F 1VQ6S 4HVZA 1G7CB 2HNZB 4FS1A 1FKOB 2E7XA 1BQNA 1O6XA 2BKNA 4XDDA 4FP9A 3CO9A 4N8OA 2R2SA 1UPPA 2VC1A 3CCES 4F4KA 4FF3A 3K5PA 1Q53A 2CQ4A 2DXDA 3KXDA 5DZ7A 3D2WA 4IG3A 5BR8J 2HKEA 4C11B 3CGIA 2VF3A 5KOWA 5H9EK 2UUAJ 3EVWA 1RAFB 4MIBA 2A1BA 4LBPA 2CAJA 1Q95G 2B4OA 2VG6A 4OZNA 4URQU 4CH1A 1TKZA 3SEOA 1MU2B 4PWWA 4B3RF 1OPZA 3AA8A 3FCHA 4RW8B 5K8OA 4QWDA 3HSGA 4DI6A 2XHCA 3FNNA 5DRKA 2D3UA 2YNHB 1RT4A 3F0NA 2HMIA 2UU9F 3HFVA 4WKYA 2FPHX 3NGTA 3NL0A 4OJ1A 1F3VA 3MEKA 1RADB 3OXLA 3VAFA 3JSRA 3JS9A 2ASLA 3TQEA 4JB8B 1AA1B 3UNGC 1RDRA 1ZPVA 4NCGA 3M2RB 4CLWA 1RBOB 4Q5VA 1P1LA 1HWIA 1WEZA 4DV0F 2KYXA 3HHLB 4NZ0A 4B3OB 1OWXA 2J9EA 4YR2A 4OX8A 4TVAB 5I4MA 2BQRA 2MQLA 3WX8A 1JJ2R 3NMRA 1LWFA 3HO1A 3WDOA 1M1GA 1VQYA 2EBGA 3PJWA 4PG5A 4DFJA 1TMMA 5HN0A 1CPZA 1WF0A 3OFFA 4OI1A 3T19A 1N6QA 3CUNA 3Q8SB 4QWBA 4ZHRA 2EFNA 3BEGB 2GJFA 4TN2A 5DDQC 3AT1B 1RAGB 2KFZA 1RT1A 3MGJA 4XK8C 1NSPA 2IJFA 1SBRA 1ZBTA 2QL9B 1U24A 2DJWA 4TYAA 5D4OA 3SQGA 3EPGA 1S9GA 1JLGB 1LW2A 5B0EA 2WOMB 1RT1B 5CA5A 2CNNB 2CPXA 2W7AA 4ELTA 2WVEA 3BH7B 5HK4A 3PIPQ 1VQMS 3H5UA 2YWEA 3R5BA 1KFSA 2PEHA 4J9KA 2XY7A 2W2QP 4H4MB 3LH2S 3I5AA 2RRAA 3QIDA 4PAAA 1F2HA 2VG6B 1JKHB 2YKPA 2RRBA 5DJBA 4C8ZA 1S1VB 3A3OB 4FZVA 2WVCA 4M5DA 2JLFA 2CPJA 2Q66A 5IS2A 2BW2A 1FD2A 5F0UA 1EJ7L 2EFOA 4ZITA 2Z30B 1YRXA 2XMVA 3JXOA 5HO4A 2ZH5A 1H98A 2DNGA 3CJ4A 5FD1A 3GIJA 4DSLA 3QWUA 3W63A 2KKHA 4P71A 5C42B 2FJDB 4DL6A 5L1LA 5MLCV 1WF2A 1GXUA 3MEGB 3Q8UA 2BRLA 3PFEA 2MKSA 2NREA 2V8DA 4DF4A 3Q24A 4JI2J 4UQGA 4JV2A 4X65J 2RH3A 3IO1A 4FNIA 4NZ7A 5EUHA 1VCTA 3WIUA 4JI3F 2VJUA 1NPRA 1D0EA 4ENOA 4FDFA 5GVQA 3PW5A 4B9UA 1WD6A 2IY5B 2A6MA 3A8IA 2CQGA 3B82A 3OFGA 1JLEB 4HDGA 4NLQA 2DGWA 3MEDB 3ZTPA 3ZZ0A 4UOHA 1SJRA 4RNFA 5KFCA 3T5KA 1ZZNA 2PMHA 2KTQA 1GMWA 5KFYA 4C8MA 4AL5A 3BGFA 2V4RA 4CLYA 2GAGC 3RR8A 1FEHA 2FJEB 3H2LA 1U6ZA 4HH1A 3AA9A 2BJ8A 1C1BB 3W1YC 5E33A 2E29A 2FC8A 4B08A 1OMSA 1K73T 5CYMB 1RTIB 5GMEA 1D3WA 1FDDA 2CQ2A 3TNVA 2VC0A 3IBWA 4A8KA 2N82B 2HNDA 2WSFC 2OJ3A 4K0KJ 4KJIA 1N0VC 4QIWD 3SCLE 1SC3B 5DGBA 4Y2KA 1RQ0A 2ZOGA 2CZ9A 3KUEA 3PACA 3HD2A 1HNWJ 2YQ3A 4ZLPA 2R2TA 1FK9B 2DBBA 2VG7A 1PGZA 2RIJA 4OYMA 4LFBF 1TL4A 2VIHA 1HIYA 1X0PA 2O1PA 1VIOA 2EFVA 5F3ZA 2X7IA 2OPSB 3MM6A 2PGCA 4IG0A 4L74A 4N7TA 5J1EA 1F5BA 3O5TB 3MOJB 4UUWA 2Z4PA 1KLMB 2JOQA 3ZZRA 3CC7S 1Y5LB 2KI2A 1TKXB 2C2KB 2H54B 2HFUA 5MAOA 3SDEB 3TX8A 2V34A 4Z37A 5F8GA 3CJRA 1RU2A 2B7CB 1UA1A 4KPYA 2AGPA 3SQOP 4DZ6A 4C8YA 3H5XA 3GIMA 1FNXH 2QTWA 2J6SA 4K4UA 1MMDA 2AYMA 5E41A 2QLWA 2BMBA 1DTQA 1S10A 3JYTA 2QJ3A 4WFBQ 4P6QA 4KIAA 5A8KA 1TUVA 3O44A 9RUBA 3E01B 3R3TA 2AF6A 3W62A 1XBWA 2A2DA 4QPXA 2D9OA 3L9ZA 4YR0A 4DL7A 1S1XB 1XR5A 3D54A 2QE5A 2OPQB 5A0YA 4PG4A 4F36A 2QG9B 3JSMA 1WORA 4YEAA 2PO4A 1QM9A 3KK3A 4F25A 1JLBA 2HS3A 2DNPA 1W7WA 2GIRA 1PC5A 3GFYA 4MFBB 1TKTB 2YKAA 1N5QA 5GAEU 3PFOA 2L41A 3MFHA 3AH6A 2D7SA 1CJKB 2QV6A 2AV5A 1SC4B 2VG5A 4DV2F 2VL1A 1QSSA 1UAWA 2BACA 1F9HA 2E66A 2MQNA 2CPZA 3FZBA 3M30A 4P10A 3TZXA 1KHVA 2N4CA 4KH1B 1A7GE 1AROP 1Q86T 3OVBA 2IAJB 2DNQA 2WB1D 4WU3A 4ECSA 4ZP6A 2XWXA 4M5KA 1WEXA 3VVTA 3PXGa 1NAQA 1R0CB 3OXFA 4YUDA 2X3DA 1S48A 4FYWB 1C1CA 2H5JB 3IS9B 1X4DA 3MR7A 4KKOB 1IJFB 2RDDA 1HL6A 1TL1B 2LEPA 3PKMA 2QO3A 4FF1A 5G0RA 3R2CJ 4K59A 3PJXA 1XMQJ 2WHOA 3LA0A 2RSQA 1IR0A 1WACA 1REGX 2AJ0A 4RW8A 4MAKA 3IA0A 1IWGA 3IS9A 5T7LA 4LF6J 2NPIA 4NLPA 1QLNA 2FHJD 3M2UB 1S79A 2DGUA 2IMOA 3AOAA 3UN3A 1RAIB 4DV1J 1N32J 3EGZA 2VA2A 2EFGA 4X62J 2C2RA 1X7VA 2ZUGA 4F4YA 4NCAA 2HVIA 4WFAQ 4M94A 3T6JA 2X1AA 1HHQA 1UETA 4FS2A 3W8GA 3GYGA 4JI7F 2NUHA 2H48B 1O0PA 1T9WA 2HS0A 2O3DA 1MNEA 4P7VA 3UR0A 4NA1A 1P6TA 1YSJA 3HMJG 4ED7A 1U45A 4UOCA 1K0VA 1HMVB 2XO7A 2AEFA 2RD5C 4I2PA 3GFXA 3NRBA 5D0RA 3RB0A 1IWAA 3M8SA 2ZKUA 3IAM9 3Q8PB 5E3QA 2OI2A 2GGPB 1TL5A 2Q6CA 2XYPB 3JTOA 3CXCR 1VQ7S 3MF5A 4AFFA 1TL3B 1U0HB 2NQPA 4A8SA 2MLZA 3BBFA 3CJ0A 3CMQA 3MD3A 5C2GA 3HVTA 4I2QB 1WHYA 2PDAA 1S57A 1U2FA 2FGCA 2ZWPA 4WIIA 4WWSA 5LSRA 2DPJA 1NBEB 3EPIA 4NA2A 5EX3A 4ZJQA 2XCPA 3O8WA 3H4DA 4MYTA 4XPCA 2C3MA 4GO5X 2CYYA 2FHOB 2F4FA 3PRDA 2IC3B 2JEFA 5F41A 5J1PA 3KNAA 1QUVA 1WWHA 3DOKA 3QATA 3SQGB 1Z2ZA 3OXGA 3V4MA 2PA3A 2IM1A 3OSPA 1H2TZ 2XY5A 1WKJA 2FZGB 3ZZYA 5KFPA 4LF5J 3M8WA 4IO9Q 4DV3F 3KLFB 3IN5A 5IXUA 4OFZA 4P2FA 3NG8A 4O3RA 3CDUA 4WFYA 1Q0NA 1HMVA 2YWFA 3BGRB 4RW4A 3ONQA 4QW8A 1JLAA 2V8HA 5F8LA 2E5LJ 1YRUA 2AEMA 3UVJB 2QMXA 2LXFA 1UA0A 4IDKB 3X3UA 4J9RA 3I4HX 1U09A 4I68A 2BJ3A 3CMAS 4F4WA 1TELA 2HNDB 3ETOA 1A9NB 2GW8A 4ZVQB 2WONB 3NBPB 2D3OR 4YN3B 3UR3C 4YB1P 5BJRA 2JSXA 1L3TA 3UFCX 5LMNJ 1ZAXA 2VU5A 2FJBB 3DRSB 2FHKA 2QC3A 4YOEA 3Q23A 1P9YA 4USIA 8AT1B 2MZTA 3QGGA 1TKTA 1Y3KA 4CLKA 4EMDA 2I9SA 5E0OA 2ZE2A 5KFNA 4CDIA 2VQFJ 1FJCA 4Y3CA 2VFTA 1NNDA 3B4MA 2HVDA 4R0EA 4V1Ak 2HFVA 2P9EA 2GMLA 3R7BB 4GVBB 3WZ0A 5HJYA 1S76D 1TFYA 3UCUP 3GFZA 1SKWA 5J2QA 3GV8B 3MM7A 1NXIA 3OTCA 2WTFA 5LMUJ 5D6GA 1ZM9A 5ETOA 4USUA 4EGLA 1VQ5S 3D5MA 4CM2A 1HNVB 2JNJA 3AJ2A 3UN5A 5A8WB 4KGKA 2VODA 1WELA 1FXDA 1ZM2A 2OMLA 4Q2MA 5U47A 3TRGA 2WRMA 1HD1A 3LGHA 4ED2A 3WX4A 1H38A 4EYHB 1QVGR 3G8TA 2K3IA 4JI5J 5CCLA 2ZWOA 3TEHB 3KG1A 2KT2A 3JQKA 4DX5A 4FPRA 5HMXA 3ZZPA 4A46A 2DY1A 3JSYA 4ZCMA 3ZTOA 4J5OA 3FBEA 1LWCB 5ETLA 4BBYA 4LFCJ 1NJYA 1KN6A 4DSJA 4P72A 2R9LA 4PCQA 1VQPS 1U1KA 2KZZA 5J1EB 1FCAA 3T3FA 4OX7A 3EXYA 4B3MF 1G3OA 3BJYA 2LA4A 2HHHJ 1ZAWA 3GIRA 5T14A 1S0OA 1T94A 2ABYA 1CULB 2VPXB 5D0HA 1SIZA 4ZLNA 2APOA 2XMWA 3MAQA 4QYRA 3U7JA 2FLNA 4Q44A 3GB0A 1IKXB 2HWIA 2HQ3A 1F5AA 2E1AA 3OL6A 1KQGB 3UDEA 3HJVA 1S0VA 1WC4A 4N47A 3VR1A 3DNCA 3I9ZA 2OO4A 3IBCB 5KOXA 4ECQA 1U48A 4L6V3 2WVDA 3CJ2A 3G87A 4LBIA 2HLTA 1CBKA 2OEMA 4W98A 1RWWB 2CIMA 2MJNA 2Q6BA 4IH7A 4NZ6A 4GRSA 3BS9A 2MY7A 2DNMA 1REVB 3KLGB 1FJGJ 4OHXA 1JWWA 5A8RA 1K1SA 5SUHA 4IR9A 3D6FB 3IG1B 1WKLA 2W8LA 3Q22A 3VGSA 1SKSA 1UWBA 4FKYA 2RJZA 3R5GA 4MJKA 2YPZA 2ZH6A 3PW4A 2B0GA 4Z2XA 1YGYA 3T41A 1IBLJ 1T11A 1HD0A 4RW6A 1IKWB 4KE5A 1O51A 1RT6B 4O44B 3BQ2A 1UJ6A 3KJQB 5IQQA 1XMOF 2K3KA 1T95A 5B0FA 1L3SA 4OYWA 1QSYA 2UVWA 1YTYA 3ZNUA 2QEXS 3H90A 1H2UX 4DPTA 3CW2C 3NS7B 3BSNA 1T9UA 3BGRA 2UUCF 1EZZB 2WSCC 4RW4B 3BO2A 2UUAF 4LFAF 4PKDB 3UPFA 2J0WA 1ZOTA 2A2CA 5IM0A 1HQ2A 2YPYA 3F44A 2FVPA 3DOLA 2K8GA 2R8HA 1VRQC 1IQZA 4JYAF 4JI0J 1IBLF 5DO2A 1DFDA 2XLJA 1UKUA 2CG4A 1UPMB 2UXDJ 4PG7A 3DYAA 4DR3F 3G9CA 2B43A 1S9EB 2UV8G 3J7Z5 1YZ6A 4CH0S 2IBKA 3O6QA 2YNGA 3NNHA 2P9GA 2MKCA 5HLFB 1VI7A 5L1IA 1DURA 1HBOB 4OV1A 4KHPJ 2BE7D 5ETPA 2HHSA 3NCPA 3P96A 3BGUA 1SQFA 1TL7B 2JVRA 1S1WB 2FB0A 2M70A 4ZVUB 1XEZA 3SDEA 4OHVA 1RTDA 3PKYA 1EB0A 4N41A 2G4BA 8ATCB 3KLVA 3HULA 1N34J 1YI2S 3MM6B 3RJMB 2P6TA 3SI8A 5I42A 2R7XA 5L9XA 2J6UA 4WYWA 4X4VA 5IZHA 2FLOA 4X4PA 2VUGA 4J9LA 2ROEA 3NGRA 1SQEA 2CKWA 1RKIA 3MAAA 1J27A 3CD5A 3GJRB 3HHLA 4B3OA 1FF2A 3IC1A 2P8IA 4PXCA 3Q0AA 3IRWP 3SBMA 2CVEA 1DTTB 3P8BB 4CP5A 2IVFB 4F26A 2J0QD 4IRKA 2FHJA 2AU0A 2COLA 2KVQE 1R8AA 5D4LA 1M5SA 2DEJA 1AXQA 1KWMA 2WCXA 3OPKA 4TU8A 1W26A 2K7KA 2RQMA 4RPFA 3J7ZT 1RABB 3TQ1A 2QIFA 1XC9A 5KFJA 1AZSB 2R3VA 4R25A 1S12A 2NYIA 2V50A 3LGNA 3OW2R 1BC6A 4F0MA 2GQ2A 3CCRS 2IVYA 4IUFA 2J5AA 2HBRB 5CZXA 1ZPWX 4IOAQ 1B0TA 1LEOA 2IJNA 5DM7Q 3NGUA 2YBVA 5EDWA 3OD2A 3F41A 5EWEA 2B4VA 4DL4A 3QO9A 1NSKL 4KGMA 3A8EA 4DL5A 1ZA2B 4C0HA 4FXDA 4HI2A 3GSDA 2IJRA 2AT1B 1X4GA 4DOZA 4WZQA 4PEOA 4D3HA 1QVFR 3MR5A 1YBUA 2DYAA 2FJAB 1LW0B 2W24A 2FLLA 1QTNB 2B8QA 4DR3J 2JRSA 3L3CA 1ZS6A 1RU1A 1S77D 1HYSA 3BBBA 2BKPA 3H5YA 1KVIA 3EVOA 2Y3YA 2D41A 4DX8H 3MURP 3RBEA 1R0AB 1IBKJ 4PUOB 2RT3A 1FJGF 2DHHA 1HKAA 1JXVA 1M0SA 1NHUA 2LP4A 2MJUA 2QFJA 5KFOA 1FXRA 4X4UA 2IYIA 3L95X 2CPEA 1F60B 1LK5A 4L3NA 4RUHA 3SV3A 3PX6A 3KK3B 4C9DA 3D28A 4P7TA 4A8XA 3CPWR 1GFWB 4U7CA 1R7IA 2KFNA 2R7VA 3DOMB 1N5YB 4KSEB 2AW0A 4EU0A 2CNOB 4RNNA 2WZ1A 2UUTA 1P8GA 3DGVA 1M5HA 4ZPTR 3PW2A 2HHXA 3QJLA 4X4TA 2N4DA 4AQYJ 1EIYB 4Q0BA 2BJ1A 1Q8IA 4LT6A 2YNFA 1IKVB 1I3OB 3M6UA 3MHYA 3BYRA 4LSLA 1UJ4A 4HI1A 3ZC4A 1U26A 2MMYA 1WG5A 5KFUA 5LSOA 5DZ6A 1B0VA 3KMSA 4ZA1A 4OYAA 3ENVA 2PC6A 3C6UB 2ZOFA 4DR5F 2CFXA 3BDEA 1PILA 3ITHB 4LSNA 4TY9A 3FBFA 4NXNJ 1E6VB 3HM9A 3QSYB 1EQMA 1RWXB 3MMCB 5DG8A 3V81A 2MB0B 4KGZB 4PWUA 4ZVPB 2XB2D 1RT7A 4HKQA 3TZZA 3H8YA 4U7UD 4DLEA 3EYZA 5HLFA 2Z56B 2CPHA 3ILJA 2XI3A 2LMIA 2LFVA 2WB4A 2R8IA 1EQ0A 4J9PA 4ANDA 4R5PB 2HW3A 3TVZA 2FQQB 3FBBA 3QZ8A 2WBRA 3FGVA 4CWBA 3GCWP 3MMBB 2AKWB 1X5SA 4DPOA 3F56A 3CIZA 3DMJA 1BWEA 2BJEA 4EFAC 1LXNA 4ZPCA 1NMEB 1BQMB 2V9KA 2P5VA 4CLLA 1T02A 4DLGA 1NJIT 4GO7X 4IQXA 4Y34A 5B0BA 1BWVA 1LFWA 1YBTA 1BY9A 2HLUA 3EGNA 4J91A 4OLPA 1NCLA 4RW9A 4YB7A 5F8MA 5GAHU 1U4BA 2GJIA 2L9NA 3ADAC 3PEHA 2ZITA 2LDYA 1HQEA 1X9MA 4CLPA 4USTA 5KTQA 1MSWD 1CJUA 4C0BA 2ZJPQ 1JNRB 4AT1B 4NEYA 2L9DA 4LFAJ 3H2VE 3BM7A 2M4MA 3C15A 1RI7A 4K2JA 1Q5VA 4USHA 2KU7A 1S7HA 3I31A 4TXSA 3E3XA 3CCJS 1NB7A 3M2VB 4URSA 1SH2A 4WP3A 4LRDA 3T5JA 2O66A 4NEZA 3H98A 3P5TL 2R7TA 3KLGA 1H2VZ 1SH0A 5KG6A 3AQOA 4DX6A 3CULA 1BUXA 1RUSA 1I1GA 2W8KA 3H5SA 4IFYA 2KVIA 2IDLA 3OLBA 4DUZF 2DGQA 1FI4A 3IAS9 1QAIA 1HWUA 2EC2A 1UVLA 2BJ9A 3OBIA 2NUUG 5A6PA 4WCEQ 1V9OA 2WK4A 5F8NA 2MSSA 3OQ2A 3KUHA 1YZ7A 3I5BA 4U9RA 2AJ1A 5IT0A 2LQ9A 2ROPA 3J7YI 1VK3A 4M5JA 3THTA 4FYYB 4CLZA 4WE1A 5DM6Q 3VAHA 3IMQJ 4NXNF 2MYFA 2NXEA 1VC6A 4YFUA 4ZVEA 2VQFF 1AB8A 2HNYB 3TUPA 3GP9A 4JI8F 4B9SA 4IFVB 4NCBA 4G1IA 1QSLA 1UMJA 4CNYA 1PBAA 4OLOA 4PPZA 4EBEA 5JVHQ 1D09B 2QSWA 4KR0B 4XO0A 3HHNB 4M63A 4OMFG 2JC0A 1IBCB 1RT2A 3EX7B 3LGMA 4ED0A 1RTDB 2ALZA 2CPIA 2DHSA 4P74A 4JI7J 1Q81T 1KLMA 1OYDA 2IPOB 4NYZA 2MZ1A 1X5PA 3D6MB 2IVMA 4G1PA 4KHMA 2HFZA 4KFBA 2LQJA 5AJ3J 2Y1RI 2GIQA 4EEYA 3U1MA 3VGUA 1PSDA 5HL7Q 1BHNA 2K2PA 2CPYA 1KR4A 5M2RA 4CT9A 4A8QA 2B9WA 4CLUA 3G86A 3NEKA 5KT6A 2IA6A 3HI9A 2RUGA 1WDTA 4EI2A 4N76A 3W3SA 3FQKA 4DFKA 3CJQA 1QE1A 2VPZB 2C2NA 4CLSA 2ZBQA 2V2VA 3FSXA 4JI6J 4CYUA 2BQ3A 1PYOB 2AP6A 4ZVTB 5B0CA 3D3BJ 2KHDA 4HL9A 1EX8A 2LXIA 3C3LA 5JVGQ 1MMNA 5CHCB 1KSPA 3N5BA 5F9NA 4OYBA 4LR7A 4DV4J 1AZSA 1MROB 3HHEA 4QQBA 2QA2A 3SSRA 1WEYA 2ZH8A 1PJ5A 1F6TA 2ZFHA 3GJQB 1E6YA 4J9MA 1YJWS 3QNWB 4EUVA 3KJNB 1HW9A 2UU9J 1R31A 1PG5B 1WOPA 2VFRA 3CDBA 4QWCA 2XSFA 4ECYA 3QYYA 4X62F 5DDOC 3VAMA 1LWEB 2B56A 2UVRA 2RS2A 2AJQA 2Y8WA 1YG0A 1H72C 2GO9A 3JTPA 4YDXA 1B70B 4ZKAA 5LJ5Y 3CF5Q 3UD3P 1GNKA 3QSIA 3CCTA 2K06A 3QO9B 3A12A 4HHJA 4X66J 4CLFA 5GAHI 3J81j 1S6QB 2LU2A 2HK3A 3NWRA 4LUBA 3A4TA 4ZDNA 4I4BA 4U96A 4K8RA 5EX0A 3DLEB 4C3KA 3MOZA 4DEZA 4LFBJ 3R2DJ 3GYXB 5HROB 3HCXA 3GE9A 3M8YA 1DLOA 2HQGA 2POKA 3QFHA 4YHHJ 2F40A 1A6LA 3H20A 1M5OC 4OX9F 3J7YU 2ATLA 1QTMA 1VQOS 1JK9B 2OP5A 3KLHB 2HGMA 1CQMA 3DLJA 5AE1A 1RZMA 2J7KA 1Y7PA 3D4JA 2R42A 1RHRB 3M1VB 3GV7B 3KHHA 2BOAA 5LXRA 4DFMA 1FERA 1HWKA 3MEEB 3R5AA 3MXHP 4DJBA 6AT1B 2M0GB 4ED3A 4CM0A 3QGPA 1JIHA 2Z2ZA 1RT5A 1UVKA 3LUYA 4LF6F 2V63A 1RTHA 3D3CJ 4MTPA 3MMBA 2H65B 2XLIA 2HFOA 4OZ2A 1SKRA 1XTZA 3W2WB 1NDPA 1GMUA 2UUWA 1URRA 4I2PB 2ZH1A 2CDRB 3PZPA 2ZZNA 3NNAA 1X4HA 2YWWA 1K47A 3W5ZA 2YX4A 4UT4A 4QIGA 6FD1A 5AXNA 4K4TA 4DSFA 3PW0A 4C8LA 2HQFA 4HACB 1HBUB 5LT5A 1BLUA 3EM1A 3DLKB 3VQSA 3G6VA 1M90T 1FRMA 4J7CA 2VICA 4ILMA 1E6VA 3PHEA 3R97A 3MUMP 2CQDA 4O3NA 5GADI 1HA1A 2P2CB 2CQCA 4ECTA 2B9XA 3QT6A 2LLZA 2DEIA 3D0HE 1AFJA 1S9EA 2BA9A 3R5DA 1PAUB 5C24A 3K89A 1U6FA 4KY3A 5LOQA 1VC0A 4NLGA 4FYDA 2KG0A 4JI1J 4LBHA 5KG7A 2I5JA 1SI9A 4TY8B 4QWEA 2N3LA 3VAKA 1J2VA 4DSEA 3ISZA 3THVA 4MIAA 5D0GA 4NPOA 4DCOB 3KDOA 3N01A 4JOUA 3W9JA 4ZVGA 3M8QA 4WXWA 5LL6d 1UVJA 2D9PA 3CD6S 2XBPA 1HW8A 2DR5A 2DGOA 3VGVA 2DXFA 2KYZA 3OR1B 4W90B 1T3OA 3POTA 3LOUA 1RA6A 3DMJB 1RTJB 5FIIA 4IH5A 4DN9A 4ELUA 1RK8A 4OX9J 3P6YC 3M4XA 2UXBJ 4LRFA 4WK1A 2W2PP 4OHWA 4JI6F 4YY3F 2HHQA 4V19X 3PEJA 1TU0B 3LALA 4M95A 4ED6A 5C42A 3TAMB 2U1AA 1UCNA 3EICA 1NDLA 1YJ7A 3M32B 4PZVA 4DV5F 3DM2A 1Q7LB 4CO5A 1PYTA 1Y9OA 2HBYB 1U1OA 4RU2A 1F2GA 2QX0A 1XK8A 1NPKA 2XMMA 2NZCA 4DPWA 1WC0A 2JX2A 3N6LA 3UDCA 3LP1A 5KG4A 3OVSA 1LOUA 2V4QA 2DO0A 1N34F 2H5EA 3HLUA 2HRUA 4NOHA 1H6KX 1D1UA 4ZPBA 4QCLA 1KKHA 3HDSA 2HZAA 3P4UB 3LAKA 3KLIA 5ETNA 3TR5A 4E98A 2G2YA 4QWAA 3I55S 4ECVA 1N5VA 5ETMA 1TTHB 3S7RA 4TU7A 3DU6A 3DLKA 5KFHA 4M5IA 2RRNA 2GHPA 4GKKJ 2AEJA 1XMBA 3KK2B 4RW7A 2DNNA 4N77A 3UCGA 1JJ4A 1HNVA 1PYSB 4CI0B 3TZYA 3AODA 5KFMA 2KT3A 1RGVA 3GU0A 5AXLA 5THWA 4J9VA 3CD0A 3GV5B 2W9BA 1BQMA 2DD8S 3V6HA 1VLYA 2E1CA 1VS3A 4N56A 1X9SA 5K20B 1R43A 2OIHA 1FDNA 2NR0A 3LAMA 1IQTA 1N88A 3FEXB 4FF2A 2C2ZB 4O0NA 1B64A 2H3EB 2NSBA 3VF0B 2GC8A 3TAPA 3N28A 2HHTA 1DBDA 3DLGB 4H4KC 3W8PA 3AB2B 4ZIWA 1WG4A 1FTCA 2VG7B 4RUAA 5G4DA 3PY8A 2O5DA 4PUOA 4NLXA 6FDRA 2PSZA 3V4IB 3PV8A 1KQKA 1CJTA 3M2RA 4UQTA 3UCZP 1A0OB 2VZ9A 4K7QA 4LF2A 2BJDA 4PXDA 5CH7B 4U95A 5J2MB 3SSQA 3J81U 1HI8A 1VQLS 1TZ0A 2F4VJ 1FE0A 2UXBF 1FRXA 3L4BC 1NDKA 1RCOB 2M8DB 4WZMA 1SXLA 1IR2A 2RF2A 3BGOP 3IWXA 3RU0A 5J1NA 2AYBA 4JUZA 1FDBA 1P27B 1C0UA 3CVKA 3MCNA 4E8UA 4DL3A 2ZZMA 5H9FK 1RAHB 3EGWB 1S6QA 3R5JB 1VJQA 3M32A 3N79A 1UZHA 2CQ3A 4X66F 4CO4A 1VISA 3MWBA 1VHFA 1S4EA 1UWAA 1T05A 3S1TA 1N36F 1IBMF 2J0SD 3Q8QB 2DNYA 1NPPA 4UZBA 3CEDA 5K14B 5I3QA 3DOKB 3UN2A 1TVRB 5BYSA 2MZQA 5KFDA 1DRZA 2BBEA 4F04B 1SUQB 4ZMMA 2UZAA 3PRBA 4GKJJ 3BR9A 5IT4A 3NLCA 1KQSR 4KV8A 1TVRA 3FKBA 2YKOA 3EDQB 4Q7AA 4PR6A 5D0EA 1X31C 3OLAA 4DV3J 2IM2A 4LR8A 1I6JA 2Y8YA 3P3DA 1HQUA 1CJKA 2HNZA 3PG9A 1Z4UA 1RWMB 4AXIA 5E7OB 4IDKA 4DPUA 5BR8F 3KYLA 3WBZA 5RUBA 4XPEA 3H59A 4O44A 2XZDB 4DQRA 2C1EB 3DLHA 3JTNA 4XAKA 2N7CA 3R1HA 2J7UA 4BHQA 1IXKA 5H9EJ 3C16A 4DR4J 1GMWD 1GTHA 4B3RJ 1ZETA 4WF9Q 4PRFA 5HVHA 1LWEA 2BDPA 4RUBA 2FHMA 2R7WA 4F2SA 4H54A 2DT9A 2RHSB 5A8RB 1B4SA 3I0SA 3GJSB 2I0XA 3Q8VA 3W66A 2M7SA 1CJUB 3DI6A 1HPZA 5JJBA 4DR7J 2HHUA 2BVZA 5BYQA 3SXLA 2ZM6F 1TKDA 4ZPDA 1JLFA 4NLDA 4WTYA 2GJ2A 2RILA 3DGPB 2MQOA 3U27A 4AL7A 4QU6A 1QAXA 2YTCA 4ZJLA 3IRXB 1FVSA 4L73A 1F9EB 2ILYA 2WBMA 1VR6A 2QSFA 2XI2A 1YHQS 2OELA 3FMWA 3W64A 2C42A 1B0PA 2JEJA 4C2MA 3DOMA 3UD4P 5LMUF 3EZUA 3ZFVA 1YVFA 1RTHB 5IV4A 3DDNA 4OZ0A 4GVBA 2YNIB 2OUGA 3TEGA 3Q89A 1YJTA 2ZHAA 2HHPA 4AQYF 5HJXA 1U25A 2KB2A 1RCXB 4J9OA 1RACB 4Y00A 3ZTSA 1RP5A 3Q83A 4LVNP 4A8OA 2KZMA 4RLEA 2PD1A 4W92B 1BD6A 1FESA 1KONA 3L7OA 4KFBB 2XMUA 2E9TA 1RA7A 3AHPA 4LFCF 1CVJA 3VTIA 2EK6A 3ITHA 1S4FA 3QLHA 1N56A 4RX6A 2BJ7A 1S72S 1RAOA 1NKBA 2DR8A 3C6UA 3PNIA 1GT8A 3IWLA 4B9MA 4EO6A 4EZ9A 3M2UA 4KC5A 4DUYF 2ZD1A 1EARA 1UWBB 2JLEA 1WG1A 4UW2A 1T9XA 5CYQB 1SPBP 2BM1A 2R7QA 1WTBA 2YVSA 2CNLB 1RLDA 4MIWA 2BE2B 1VRTB 1JQGA 2CJ9A 4I64A 2MHEA 4NI2B 4PPDA 1VC5A 2G1DA 1UZDA 3HF5A 4J9SA 3VALA 2F65A 4B02A 1T03B 1YK9A 2ZDPA 1UVIA 4I1TA 3ZTQA 4QZVB 3OL8A 1JXEA 1QD1A 2XO6A 2N3OA 3OR1A 1MLAA 2IRXA 3HD1A 2EFQA 2F8MA 2MPUA 3OL9A 1ZM4A 2ZBRA 5A8KB 1NLKL 3KUGA 1IVZA 2W4PA 1CC8A 2G13A 1ZTTA 2CJQA 1IKXA 3MDFA 4RW9B 5KT3A 5ETSA 1X0FA 4ZN1A 3DRSA 2OD4A 2LVWA 4K2XA 4OZJA 1SKUB 2NYHA 2C3OA 3GSIA 1IKYB 4DQQA 3LQVA 2E5LF 2VDIA 1IM4A 2EVZA 2GX8A 3GIIA 1WC6A 2E5IA 4ID5A 4U7UK 1TK0A 2CJKA 1NSAA 4UUXA 1JLBB 3DDIA 2AYEA 5I3PA 3WC0A 3Q2SC 2W2NP 4C6AA 3OJUA 4FBTA 3IWNC 1PAEX 4FXWA 1KBRA 2VFSA 1NO8A 2HEKA 3PTWA 5KG3A 3E2EA 3I9V9 2ZC3A 4X2BA 2OEKA 3GIKA 3DU5A 1PIEA 2CADA 1R8CA 5E2QA 3PYFA 1AUSL 1TL7A 3VAJA 4K4WA 3TA2A 4PYDA 1ZA1B 3I0RA 5LMNF 2UV8A 2DK2A 4RUCA 4PYAA 2G2ZA 2X1GA 4M1KA 5LSLA 3R5CA 4TKTA 4PWDA 2B4PA 3CJKB 4WIQA 4DR1F 2WSEC 3RYLA 5HQMA 1YRTA 2XQCA 2VPWB 4R8UA 1Q16B 2ASDA 2LQBA 4OZ1A 4URGA 1I94J 4LF7F 1VOMA 1LV5A 1HFEL 1U7LA 1UTAA 1KDNA 2DGSA 5AT1B 3K5MA 4DR4F 3QPIA 1R0BG 1HNIB 3RR7A 3A3NB 3M6WA 1I5OB 1U02A 3R27A 5GADU 2JFKA 2DNHA 3DOLB 2LEBA 2N7YA 4IFVA 1UJ5A 3DI6B 4P75A 1OY9A 1NHVA 3NGSA 3BO4A 2BRKA 1UFWA 3AXMA 3CE8A 1DARA 3LP0B
chains in the Genus database with same CATH topology
4DSIA 1JLQA 1D9FA 4DBQA 3MAHA 2B5JB 2MHNA 2JEGA 1RJJA 2DNOA 2ZKTA 1HHSA 2EW9A 2ZC4A 2MQPA 2CRLA 1XR7A 2V4JA 3OUYA 3G6XA 3CCSS 5B0AA 2Q79A 3TI0A 2E5GA 5D77A 3SSSA 1HQUB 5KT4A 1W2BR 3DLEA 1N8RT 4K4SA 1N52B 1Y3JA 2CQ0A 3VAIA 2F9JA 4I0WA 3DXBA 2FJVA 2V5HG 3SMZA 4K4VA 3BSCA 1NK0A 2HGLA 3MM8B 4NRUA 3T6BA 1S1VA 5K14A 3GYNA 1FRJA 1X5OA 1S1XA 2DPIA 4ZP9A 3T1AA 1Y0HA 1D9DA 3DRPB 1D8YA 3OR2B 1X4FA 4JV5F 3GWCA 3LP2B 3GR1A 5L9NA 1JB0C 5F0WA 4DV4F 2GMHA 2IM0A 1C4CA 3NGDA 2QA4S 1XR6A 3KLEA 2E9ZA 4D3GA 4KO0A 5CYQA 3LO3A 5IT9Y 4PQUA 2PI5A 2CQBA 2KN4A 2ZH3A 4KQZA 2IAJA 4WK3A 3ZZUA 1SJFA 2YY3A 3C6TA 2ZBIA 4LMZA 4RW6B 2M2BA 4EBDA 1ZZFA 1C0TB 1L3VA 5KFVA 3SFGA 2BXJA 1NK7A 5CD4H 4M5DB 3KTQA 4UY85 3N6NA 3HVWA 4MK7A 2QT7A 2IA0A 2QYCA 4CQ1A 4EBCA 4OI0A 4QOTA 2ZHBA 2YX7A 4Q8EA 4TQRA 2C28A 5KFZA 4DMZA 2DNKA 3EGZA 2I38A 1Q4RA 1HNIA 4IQMA 3TAQA 2U2FA 3M6VA 2C3UA 3UE2A 2L08A 3I96A 1S1UA 5KFTA 1KD1T 1ZAVA 3CDWA 4KO0B 3QAUA 5DLFA 2YNGB 5D78A 3HKZD 4F3QA 2LXUA 4LQ3A 3U1LA 3H40A 4H4OA 3LPYA 1JLEA 4OIXA 3RRGA 1DQ9A 3NWGA 2GGPA 3HXMA 2VBXA 4C8NA 2K1RA 1WHXA 1R8PA 1EETA 3NS6A 4ED8A 1U1QA 4L72B 3GMGA 1DJ0A 4DSKA 1LXJA 2XEXA 2JEIA 1LFPA 1EP4B 3H25A 4DQPA 4KAIA 3KOAA 1CQNA 2OLWA 3VCDA 5B08A 1G1XA 4MK8A 1HYSB 3MR6A 5EWFA 3HT3A 1V6HA 4CTAB 1S6PA 3BO3A 2MXYA 2FD2A 4KV8B 4EYIB 2BYCA 3DRYA 4JI1F 2YKQA 5K8PA 3KLFA 4OI6A 1MU2A 5I3UA 1WHVA 2DR7A 4A48A 2YKNA 3CJ5A 3U02A 2OPPA 4Q8FA 2UXCF 4C4WA 1ZYQA 3BREA 1HNWF 3PW7A 3I5CA 1HWJA 4IG3B 1OSCA 4NLVA 3OFHA 3K8VA 1VQ4S 3KNGA 2OPPB 3V6DB 3D1HA 1P9QC 4P2SA 1NEEA 1VMBA 2CDQA 2IHR1 3CC4S 2HRYA 4J37A 2HZCA 3K7RA 2FVSA 1OSDA 2E1MC 2BANB 2X3GA 3PVXA 3FEZA 4ICLA 2VBZA 2XNQA 2CJBA 5B0DA 2DITA 2XG8A 2KG1A 1HR0F 1D8ZA 1S6UA 3AY0A 1SL0A 2X1FA 1TK8A 3M8PA 2IRUA 4C3LA 3LP0A 1XNQF 4CO3A 1K0TA 3UQSA 1U8SA 4ATNA 4KT0C 2YNIA 1DAXA 2YKMA 3MM5A 2UVUA 2XS2A 1O8BA 4ID5B 3BR8A 3RRKA 4ED1A 3J81Y 2ADCA 4N5SA 2PN6A 4QR2A 4RWWA 4XDCA 4K0KF 1RT5B 1FXLA 3B4DA 1GAOA 3JSBA 2F9DA 3BN4A 3ZZZA 4GKKF 5C25A 5DDRC 4R8UB 4H4KA 4ZCLA 3V6DA 1Q78A 3DCAA 3KK2A 3MMAB 4DS4A 3RW7A 3HVTB 4X64F 2Z2LA 5C25B 4BC9A 5G0RB 3V6JA 3SCKE 1KS2A 5EN1A 3PIOQ 4BCAA 3CIMA 3TA1A 4TQSA 2YX1A 2VKZG 3TOQA 2BR0A 2G9OA 3TUIC 1VRTA 3FZ2A 2DCUB 3UWTA 3K5LA 2KXNB 2B4UA 1R8BA 1ELOA 4O3QA 4CTAA 2OSQA 3LWMA 3RB6A 1T3NA 2FC9A 5IWAF 2W9AA 3D1OA 2R8KA 1R8HA 4MH8A 3PX4A 1ZM3A 4KB7A 4J9NA 3C6TB 1RYSA 4HDHA 4MK9A 1YQHA 2EK1A 5CYMA 3UW1A 4DV1F 5GAGU 3RAXA 1N32F 4B9VA 4TLRA 3LWLA 2AGOA 1RWUA 2EI5A 3FSIA 4TYBA 4IOCQ 1DQAA 1JXLA 4ELVA 2H9ZA 4K4XA 4K4YA 1REVA 2DH8A 1D9AA 3RTVA 2CQIA 2R7RA 2VA3A 2NSCA 1HQEB 4RNOA 2EBEA 3OR2A 3QJPA 3NMAA 1Q8LA 3BB5A 4NLRA 2HFNA 3EZ5A 3MZIA 1F9FA 2P9CA 5HMWA 4NXMF 1KOOA 5B0GA 4LF9F 1CLFA 4HH0A 1NH8A 1FRIA 4FVCA 4G6VB 5KFFA 1X4BA 2O01C 3E8OA 3M30B 3MM5B 2DCLA 5D4PA 1FVQA 3T9ZA 5KFDA 1U49A 2XS5A 2VG5B 1YJNS 1QAJA 1FHTA 2JZ5A 4KTQA 3ZZTA 4WKRA 2ACYA 3CB4A 2OTLS 4O3PA 2MQMA 1FO1A 5KFAA 4JI4F 1KFDA 1FKPB 1KTQA 1R89A 1KEKA 3SZ2A 3JSMB 2BANA 2GCFA 4QYZJ 1VBZA 1JLQB 2KXHA 2QZ8A 5T41A 1S49A 4F67A 1SV5B 5EWGA 2A3JA 4QBUA 4ZPAA 5L38A 2F1FA 1F0XA 2PA8D 4CZCA 4Y0FA 1SJ3P 1HBOA 1X4AA 2YWGA 4HT5A 1VJWA 1S1UB 3K5OA 4YB5A 1CG2A 2LA6A 4ES1A 2Y1IA 2EFPA 1C4AA 4OX6A 3KLHA 3DN9A 4DN0A 3U1NA 4DFPA 1NJZA 1M5VC 4ETXA 2Q3PA 1KFSA 5GMKa 5J2QB 4DWIA 1QJHA 2GHVC 1T8EA 3MM8A 4C3MA 3V2UC 1P1TA 2GFFA 4BDPA 1C0UB 2WAQD 3M05A 2F8EX 4RBTA 2XMKA 4RZRA 4AYBD 3O1LA 1EP4A 3MCSA 3BF4A 4ZP7A 3QLHB 4IH6A 3UDLA 2VBWA 2ZDOA 4USJC 5KFGA 3I32A 3QWPA 3IR7B 2DR9A 1XERA 1FEEA 4CNZA 3DRXA 2VQEF 2Z2MA 2PE8A 1FA0A 4RBUA 3WC2A 2MKIA 3K0JA 3FEYB 4ZVFA 4K4ZA 1HBMA 2BOPA 1HBNB 4YDDB 5DDPC 1AFIA 2Z8QA 4C11A 4DQSA 3MUTP 5KG5A 1S97A 3JYTB 1DHMA 3QGHA 4IR1A 1IBKF 2HHWA 1RYRA 4PQAA 5FDLB 5F8HA 5E3PA 4TU9A 3M9MB 1R3NA 2IBOA 3GG1A 5JUMA 3Q8RB 2LCWA 4F3OA 3DHWC 1HNXF 4CIOA 2V4JB 4NLWA 5D8HB 2CPDA 2DO4A 3CDEA 1VRUB 3TYTA 2M88A 2HWTA 3S01A 4V19J 3ISND 2JL9A 1R27B 1YJRA 3K2YA 3TAMA 5HP1B 4H4MA 4H4OB 1B7FA 1FNOA 5DG9A 7FD1A 3L7PA 3H2UB 2RNEA 4G1QB 3PR5B 1TV6B 4JV0A 3MMAA 5CQGA 1NK4A 2KJWA 4OZ5A 1U1RA 4C8KA 3KG4A 3LP2A 4F02A 5H1SV 1TKZB 2JFDA 4OHZA 1OIAA 4F4XA 4GC6A 4DQIA 5AE3A 4B9LA 4F50A 1N6QB 2OPSA 2DTJA 3MPWA 3I56S 5M2UA 4DR6F 2X1BA 3M6XA 3K58A 3MECA 2I5JB 2V9WA 4KKOA 1SJ4P 2A18A 1NZAA 2RQ4A 2YKNB 4RBVA 1FK9A 5KFLA 2ZD1B 2Y0SD 5I3UB 2BM0A 2EPIA 2AD9A 2M52A 2VONA 1OS5A 2RF2B 1VQNS 2NXUA 2RQKA 2RS8A 3N9UC 2RDJA 4WXOA 4ETZA 2V94A 5FLXY 2Q43A 4YMEA 2I8EA 5HQ8A 1YJ9S 1C1BA 1H0HB 1TAQA 2RE1A 4K5RA 4DG1B 4KHPF 3M8QB 1JLAB 3CCZA 5EGYA 2MSTA 1EETB 4O4GB 3RBDA 2C3PA 2J9DA 2DISA 2K1RB 1SUQA 3EXCX 5E5NA 5LXYA 5DQGA 3CCMS 4OJ3A 4RNHA 1FJEB 1PC4A 3DRPA 5F8IA 4IOBA 1SJQA 5KG2A 1DTTA 1RAJA 4YR3A 2ASYA 1T05B 4C0OC 2QA4G 3FMBA 1WNEA 4Y2AA 2OD6A 3ZZOA 2MY8A 1FDAA 2PT0A 2AYGA 4I6WA 2KHCA 5KT5A 2XGQA 4A47A 1S6PB 3G8QA 3MM9A 3CCQS 3HPOA 1MMLA 4NLSA 2VASA 3FRYA 4NRTA 4YP3A 3G8SA 1S1TB 2VFVA 3QZ7A 1ZTWA 2DRAA 5HP1A 2ZH2A 3FVYA 4DL0C 3KK1B 2OPRA 3R1LA 1TP7A 3SV4A 4MYUA 3M9OB 4ZVHA 2OFHX 2XLKA 1FKPA 4NLTA 2XZWA 1VQKS 3DDKA 4NL5A 2R2UA 4KBIA 2W4DA 3FRZA 2GQCA 2HNYA 2ZOMA 2IM3A 3PDNA 4WFNQ 1U1MA 1N54B 1AW0A 4QIVA 2AQ4A 4X4SA 4ZCKA 1NJXA 4K5SA 5K8NA 4ZPWR 1QUPA 3VAGA 1Y00A 2W4CA 4PXEA 2DB1A 5KFWA 2CPFA 2OSRA 5IQ6A 2MZSA 2ZBCA 3DXSX 1SL1A 5A6WA 4DG1A 4LF7F 2P6SA 3DGPA 3VZHA 1UFLA 1CC7A 1UEVA 3IFEA 2XSJB 2ZE2B 4ES2A 2VKRA 1Q8BA 2YWHA 4QIEA 3OVAA 3LF0A 1SH3A 4WYLA 2B9YA 2FJXA 5K9FA 4LJMA 2VQFF 2DNZA 4BC7A 2CZ4A 2EG2A 2XULA 5L8RC 4Y28C 2B6AA 2KRBA 1FRKA 4NCGB 3G71S 3SFUA 1U47A 2MZJA 4A4JA 1VQ8S 5AXMA 2W9CA 4I69A 2RKIB 3TW0A 2ZNYA 3GR0A 3BQ0A 4LIWA 1GX5A 2XY6A 1KOHA 2KM8B 3VQTA 2KM8C 5KT2A 3W7BA 3M8RA 1GXTA 1MROA 1GH8A 3KLEB 4CO0A 2PIIA 4MFBA 4PG6A 4F8RA 3HVAA 1M5KC 2QLXA 2V0NA 1FNMA 3KJVB 4HYKA 3T1YF 3W2VB 3OTDA 2XWYA 1H7XA 3BQ1A 4DHVA 4GKJF 1VQSA 3K8WA 1HWLA 2B51A 4BS2A 3P49B 5F8JA 3MPVA 2XC9A 5F3TA 3SCJE 4N8NA 5BYRA 3I4PA 4MKBA 4EWTA 4RNMA 1X8DA 3NCRA 1O5JA 1UVMA 2E5JA 1SV5A 2EKYA 3ENQA 4NYOA 1UW4A 2VH7A 4AL6A 2R7OA 2DGVA 2RQCA 2IFXA 5KFXA 2JC1A 1XWLA 5B09A 4O3SA 2UXDF 3MTKA 3I0RB 4X84A 2AGQA 4QW9A 2AWZA 4LF8F 3KFWX 3RRHA 5KFSA 1ULRA 3B78A 3RAQA 1VQ9S 1V3ZA 3CSKA 3MPYA 5HMYA 4QIFA 4NYPA 3HZEA 1RKJA 3LANA 4X4QA 3B8HA 1SC6A 1S6OA 1RTIA 2HAIA 2CQ1A 5DDOC 1I94F 2FY1A 1NKCA 3HK2A 3THPA 2I2YA 2W9BB 1CSJA 2DNRA 1XMQF 3FFIB 2IRYA 1VK8A 1M5PC 5CCMA 1N48A 2D1CA 3HZGA 4PWDB 5AE2A 2ZJRQ 4B9TA 1Y4ZB 4C7QA 1HPZB 4ZK7M 3N6MA 3TP2A 2RKIA 2AX0A 3I0SB 5KFEA 3F73A 4OL8A 1APSA 2W7PA 1AUDA 4U67Q 1DLOB 2J6TA 5DGAA 1X4EA 3S8SA 4ZCIA 1H7WA 2GNKA 1J5OA 1FD8A 5DQHA 3GZ7A 4QR1A 3DLBA 3S6EA 2C2EA 4C8OA 5KFIA 3HJFA 2QA1A 1Z2LA 2KDOA 3TA0A 3K5NA 2SXLA 2DIUA 4RU9A 3MR2A 4B9NA 2XHWA 4NLOA 3QJJA 3OUYB 1S99A 3OHBA 3RZAA 5KAKA 2MGZB 1G6BA 1JKHA 5J2NA 1K1QA 2OPQA 4ERDA 2JJ4D 3D1QA 5ITHA 1JLCA 4HLBA 2UP1A 1VBYA 2UUBF 4ECWA 2FDNA 4FN5A 1K8AT 5E3CA 2NS1B 4BWJA 3G6ES 3I6PA 4QPTA 2MKKA 4I56A 2VPYB 1KC8T 1KQFB 2DVIA 1JLGA 1LW2B 2K7JA 1S9GB 2JHEA 1YJVA 4BWMA 3CWJA 2BUNA 4Y2IA 4WFZA 2OPRB 2HYIB 2C22A 3GG0A 2XNRA 2LQ5A 2VOOA 3IXQA