1N5QA

Crystal structure of a monooxygenase from the gene actva-orf6 of streptomyces coelicolor in complex with dehydrated sancycline
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
112
structure length
112
Chain Sequence
AEVNDPRVGFVAVVTFPVDGPATQHKLVELATGGVQEWIREVPGFLSATYHASTDGTAVVNYAQWESEQAYRVNFGADPRSAELREALSSLPGLMGPPKAVFMTPRGAILPS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ActaVA-Orf6 monooxygenase
publication title The structure of ActVA-Orf6, a novel type of monooxygenase involved in actinorhodin biosynthesis
pubmed doi rcsb
source organism Streptomyces coelicolor
molecule tags Oxidoreductase
total genus 28
structure length 112
sequence length 112
chains with identical sequence B
ec nomenclature
pdb deposition date 2002-11-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03992 ABM Antibiotic biosynthesis monooxygenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.100 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1n5qA00
1OSDA 3HHLC 2PGCA 1KVIA 2OP5A 3MCSA 2FB0A 2W4PA 1FE4A 1R6YA 5B0CA 1Q53A 5IXUA 1TZ0A 3FGVA 4HL9A 2AP6A 2XMUA 5A6WA 1YJUA 2XMWA 3KG0A 1FVSA 4OJ1A 1U7LA 1VQYA 1OPZA 2JDJA 1JK9B 2ROPA 3BGUA 3IWXA 2HQIA 1Q4RA 2BBEA 1X0PA 2W4CA 3HHLB 2OD6A 5B0FA 5B0BA 2AJ1A 3T9NA 3TNVA 5A6PA 2FTRA 1MWYA 2N4CA 2OD4A 2ZDOA 3LGNA 1FE0A 1JWWA 2N4DA 2ROEA 4HI2A 4HI1A 5K9FA 1P6TA 2HLTA 2LDIA 3HHLA 5B0DA 3KNGA 1ULRA 2ROGA 4FNHA 2XMVA 1APSA 2N7YA 5KAKA 1Y3JA 1FD8A 5T7LB 3DXSX 4NL5A 2ASYA 1FESA 3KKFA 4ZA1A 1S6UA 4DN9A 1P8GA 5F0UA 1CC7A 2HFNA 4QOTA 1VQSA 2OFGX 1FVQA 2XMJA 1GXTA 2HIQA 1YRXA 4Y2MA 1N5SA 2Q3PA 4ZOSA 5T7LA 2HLUA 5B08A 2GA7A 1TUVA 1Y3KA 1SB6A 2BJEA 2GGPB 2W4DA 1N5VA 2VH7A 4HH1A 4HH0A 3FMBA 2QLWA 3QGPA 2XMMA 1SI9A 3FRYA 4NPOA 2AJ0A 4Y2IA 2CRLA 2QLXA 5B0EA 2BUNA 3HDSA 3TRGA 2OMOA 4YDXA 2VV5A 1OQ6A 2ACYA 1SQEA 2OFHX 2GGPA 2KT3A 2LQ9A 2AW0A 3I9ZA 4A4JA 1N5QA 3BN7A 1AFJA 2QYCA 2ZDPA 5B09A 2RU9A 2GV1A 2BJDA 3BDEA 1TL5A 1Q8BA 4A48A 1XBWA 1S6OA 2GFFA 2L3MA 1AW0A 1IUJA 2K7KA 2OAUA 1Q8LA 2EW9A 2KKHA 3WDOA 2RSQA 3F44A 1WD6A 1CPZA 4DL0C 3GZ7A 5B0AA 2K2PA 1FEEA 2G9OA 2KYZA 4U9RA 3UDCA 2LXFA 1Y0HA 1GXUA 2XMKA 1KQKA 2FHMA 3HFKA 4OIXA 3QMQA 1YJRA 3HHLD 1X8DA 1RJJA 3LO3A 3TOQA 4OJ3A 1KVJA 2LQBA 3IWLA 4Q2LA 4DPOA 1V3ZA 1TL4A 3HX9A 3BR8A 3VTIA 3BF4A 4OJGA 1YG0A 1TR0A 1AFIA 1YJTA 1W2IA 2IFXA 2K1RB 2OKQA 3K7RA 1LQ9A 3CJKA 5B0GA 3E8OA 4A46A 1Y9OA 2HFOA 2XMTA 3MZIA 2K7JA 2GCFA 2QIFA 1N5TA 3DCAA 4YEAA 1URRA 2FIUA 2K1RA 2KT2A 3BM7A 1MWZA 4FNIA 2PD1A 1OQ3A 4EFAC 1QUPA 4OJHA 2RILA 4Q2MA 3BB5A 4A47A 1X7VA 4Y2KA 2RMLA 1YJVA 2BYCA 2IYGA 3LGMA 2GO8A 3HF5A 2IYIA 5F0WA 1CC8A 3CJKB 4F67A 3KG1A 1K0VA
chains in the Genus database with same CATH superfamily
1U6BA 3QPIA 4C3MA 2PFDA 1ZTWA 3OXLA 1EX8A 1HR0J 4W90B 5F8JA 2IAJB 4KFBB 1PG5B 2HG4A 3JYTB 4LF9J 2KXHA 1GTHA 2O1PA 3WC2A 4HT5A 2AV5A 5CZXA 2HHQA 3KYLA 1SIZA 2MKYA 1GEHA 1LWXA 4TLRA 5HAOA 3K17A 2BW7A 2X51A 3IS9B 4DX5A 2BQ3A 3BQ1A 2JVOA 2PDAA 4ZPBA 2QFIA 2ZH9A 3OL7A 4U7CA 3AA9A 4OI3A 3U1MA 5KFBA 4N47A 4YY3J 4F3OA 3GFHA 1RB0A 2CQBA 4M5DB 2RDIA 5IQ6A 2YNIB 4NLSA 4KGMA 2E9RX 3IN5A 1A9NB 3QWPA 2IYGA 4TQRA 1DTQA 2MKCA 4TN2A 4WBFA 2MQPA 1SKRA 3AB2B 1IBKF 4JI7F 3GTYX 3BGUA 4DV7F 2AEFA 2J9EA 4TU9A 5CYQA 4AQYJ 4C98A 3G4SS 4NLRA 1HD1A 4LR7A 3LP2A 3RB3A 2YX7A 1UFKA 1IM6A 3KLHB 2DNHA 4EU0A 3ETMA 1GQEA 2VICA 2CRLA 3NGUA 1S0OA 1LKZA 1UFLA 4A4JA 2E5LF 1QUVA 2QSWA 3EXYA 1A0OB 3JAMU 3W3SA 4S0MA 4IDKA 4FKXA 4KH1B 4N76A 1TKZB 2PEHA 2LXFA 1CS4B 4PXEA 4I6YA 4IFYA 3CJSA 2XS7A 2CIMA 2NXJA 3M2RB 1RT3B 2UUBF 2D74B 2EFOA 1W2IA 4W92B 2V4RA 1Q5VA 1FKOB 1WKJA 3V6KA 1F60B 3N6NA 3D68A 3MM7B 1OSDA 2CNOB 2GMHA 2FUG9 1UWBB 1VHIA 2IVYA 1R0AB 3JXOA 4MTPA 2RU3A 2C3UA 4LRCA 4OI2A 1U0SA 4CO1A 3G6VA 4P71A 4OZ1A 1VRTA 1TU0B 2ROEA 4TU7A 1FDBA 1RDRA 1UVMA 3W9IA 1Y5IB 3HJFA 4KIAA 3IR5B 1TL1A 4U67Q 2WBMA 2GAGC 3KLVA 4IG3B 3R9LA 2UVVA 4LQ9A 3FKBA 1T3NA 1TK5A 1RWWB 5DRKA 4ZJQA 1SKUB 1BGXT 2HYIB 1NB7A 2YWEA 4DR1F 4CO5A 3G6ES 4LIRA 3MEGB 3ZZOA 2W9BB 3QJJA 1JNRB 2BANA 5LMUJ 4A8XA 5HBMB 2W2NP 2MZRA 4Q43A 2B4PA 2HVDA 4N56A 1MMDA 2BDPA 3FBFA 4ALZA 2WVEA 3KUGA 3AD7C 2DRBA 3M32A 3BDPA 3NXZA 4RW4A 4I2PB 2PMZD 5LXYA 2VOOA 2VG7B 4UOCA 4NEZA 2B9EA 5CH7B 1TAUA 3DI6A 1TL7A 3CMAS 1LWEB 4CLUA 3QZ8A 1IBLJ 5DM7Q 3QGPA 3LWMA 4NI2B 5B0EA 1X4FA 4DCPB 1S4EA 2GVZA 5HMXA 4PEOA 4DR7J 3NS6A 1AUSL 5KFSA 1TL5A 1Q8BA 4DU7A 4JI4F 2UUCF 3BREA 3HXMA 2M88A 2F3JA 2FGOA 4RW7A 3SSSA 3FCWA 4KHPF 4X4QA 4CTAA 2BM0A 3C19A 3I0SA 2AJQA 2DNPA 2X7IA 1M1GA 4QU7A 3FBBA 2HVHA 4PWDB 2Z58B 2LXIA 1U4BA 5CA5A 4EWTA 1WSRA 2R7WA 1NSPA 4FZVA 3PDNA 3B6BA 2E66A 1MLAA 7AT1B 2JDJA 3MGJA 2BBEA 2P5VA 1X0PA 2J6UA 5KG3A 3MEKA 5A6PA 2HS4A 1JXVA 2N4CA 6FDRA 2Y1RI 2ZC3A 3UDVA 4IUFA 3I9V9 2IDLA 2ASYA 2R42A 3I4HX 4P7TA 4JV1A 2HVZA 1P8GA 4Q7AA 2PMWA 2HGLA 2OPPB 3HHEA 3QT8A 1TKTB 3GCWP 1FK9B 1N0VC 4LF7J 1RT5A 4NPOA 1NK4A 1FKPA 1C0TB 3HSGA 3T1YJ 1DY3A 2QYCA 5ETNA 4R0EA 2HHXA 4LVOP 4CIOA 1B0PA 4RUCA 1RAOA 3TZWA 2MPUA 2RD5C 3QJPA 1OPIA 4ZCLA 2FZCB 1NAQA 2CQPA 2J8SA 2E1PA 3AOBA 4A8SA 3ITHA 2KHCA 3CD0A 2EC0A 2EVZA 5IOLA 2V4QA 2DNNA 4FYXB 1T9VA 2CQ1A 3BKTA 4F3QA 4ICLA 3UD5A 4I0WA 1M5KC 4UF4A 2MYFA 4CDIA 4IRKA 3VAHA 2UP1A 1HNWF 5D0EA 5KTQA 3TEHB 4C8YA 4UUXA 4OHYA 2VODA 1QTNB 3M6XA 1QAYA 4NASA 5M2UA 2V0NA 5KFDA 3IAS9 3P6YC 3QGIA 2GVDA 4DFMA 2MKSA 2D7SA 1WDTA 5EUHA 4Q5VA 1RHJB 2MZTA 4ZK7M 4DSEA 3LP2B 3HI9A 1XQIA 3L7PA 4DSKA 4B17A 2UV8A 5H9FK 2YQ3A 1PIEA 4DR5F 3W63A 4PXDA 4X4SA 1WNEA 2BE7D 3V2UC 4LRBA 1SUQB 4ERDA 3KMQA 2N3LA 1RLDA 1IWAA 3ELHA 2KG0A 2IRUA 4C0OC 5B7WA 3EGZA 2P9GA 4NLVA 1SCJB 4PZVA 4ZVGA 1HHTP 3K7RA 3VQSA 1W2BR 2DEIA 4K4YA 1X4EA 1DRZA 1GXLA 1ZYQA 3CC2S 3VAJA 3MOZA 3VAMA 5HMZA 4Q45A 2P6TA 5DLFA 1WC4A 2Y1LB 4IRDA 3X3UA 2B6AB 4IOBA 5FDLB 2CDRB 2NXNA 3N0VA 4FBUA 4DCJB 4X4PA 1FWKA 4NLXA 3EGNA 1U2RA 4ECWA 3MCNA 1HQEB 2IDEA 3MEDA 4DUTA 1YZ6A 2KN4A 1XNRF 1RKJA 4J5OA 3VVTA 1T8EA 4LF8J 3K89A 2V2ZA 3EYZA 1E6YB 3T1AA 2ZNZA 4JV0A 5ETQA 4QBUA 1YJNS 4WP9A 3IBCB 3QLHA 2WZ1A 2EXUA 4ZPAA 1HWUA 1NXIA 2OGUA 3GIMA 1T9WA 1E6VB 4I6AA 3NWGA 2K1RB 3IFEA 4YQWA 2RUSA 3DCAA 4L75A 4URQU 1KR4A 2NPIA 4IKAA 2DY9A 2HFZA 5ETRA 1OO0B 1SQGA 4UOFA 3H2UB 3H7HB 4X66F 3EVMA 5AE2A 2CQCA 1HWJA 2KVQE 3J81j 1SC1B 3KLFA 1CSJA 3HSDA 2VZ9A 2YBVA 4LFAF 3W62A 5G0RA 2C2KB 3VGSA 2RRNA 1KC8T 1VQSA 3KLEA 1GMWD 4QWBA 1UVNA 1R0BG 4V19J 2BR0A 2AW0A 2RKIB 1N5QA 3SFGA 3J80Y 1X0FA 1MNEA 4P2SA 4FPIA 2UXDJ 1IUJA 1VQ7S 1F5BA 4DX7A 3PZPA 4BS2A 2CWKA 1NSKL 4WTYA 1MN7A 2B5JA 1NKEA 1LEOA 4NX9A 2Y8YA 3H4BA 1BQMA 2ZBQA 1W7WA 4L73A 5CD4H 3KK1A 1RGVA 1NDPA 2W25A 2GZOA 5J2NB 1LXJA 1FRMA 2CG8A 2V8PA 4HHUA 2KVIA 2RQKA 2JLFA 3KG1A 3VR1A 3BGOP 3S1TA 3F73A 2XSFA 1P27B 4QU6A 3N9UC 1RAAB 3TNVA 3HVWA 1PYOB 3NOGA 4RBVA 2RF2A 1DBDA 3PR5B 5IZHA 1YKWA 3M1VA 5HSPA 4OX7A 2LEAA 1XR5A 1OYEA 3PJWA 2GA7A 1HI8A 5GAGU 3CCRS 1GX5A 1JLCB 2MZSA 1HNZF 4LFBF 1UW4A 3M30A 4Q0BB 3CDEA 1FRLA 2EFGA 2XS2A 4L3KA 4LRAA 4WK3A 5DM6Q 1QSSA 1RBAA 3KXDA 3X1LB 4KBIA 4Y6IA 4IO9Q 4ZVTB 2IM1A 1T9UA 1N32J 4AL5A 1VQKS 2VBYA 3CDBA 1PJ6A 3HFVA 5LL6d 1FEHA 2FZGB 1RAGB 4OYMA 4LBIA 4OFZA 4KC5A 5H9EK 2VB6A 3C15A 4G1IA 4MYUA 4NCAA 3KG4A 5KFLA 4DR3F 4PKDB 2JJ4D 9RUBA 1KHWA 1RWNB 3W5YA 2HMIB 3OHBA 4JB8B 3LGNA 2RB7A 4C8NA 5K9FA 2CJXB 2YQ0A 3OFEA 3QT6A 1JLQB 1H7XA 3QO9B 1Y5NB 1SKWA 3MMCA 1IR1A 4JOUA 3MF5A 1KOOA 1GXTA 4MFBB 1BQXA 2WW8A 5KFMA 3W2VB 2OMOA 3O44A 4IOAQ 5M2RA 2J6SA 5KG0A 1RBLA 5IV3A 2QTWA 3QWUA 3G96A 2BE2B 1M1HA 1RHQB 1S1WA 2DPJA 1REVA 2OIHA 4R0JA 4RNMA 3UDLA 5HANA 2MDAA 4QWCA 4KO0A 1KQSR 4DCOB 1FWLA 2BRKA 2DH8A 2D3OR 3M9NB 4PQUB 3W9JA 2NSCA 4F8RA 2DRAA 1KNZA 2R7RA 4UOGA 2Z2MA 4L76A 3EZUA 2YWKA 1D0EA 1T95A 3HHNB 4HHHA 1L3KA 2M5YA 5HL7Q 4ZP8A 1RWVB 3ADAC 1L3SA 4DUZF 4CT9A 5KFNA 2OD6A 3NAIA 3TUJC 1M5OC 1U48A 4B9SA 5T14A 2FVSA 2ILZA 2ZHAA 3DHXA 4F4ZA 1F1BB 2XTJP 5T7LB 4DG1B 4HT7A 5IC4B 2QT7A 1WHVA 2BKOA 2QO3A 4MIWA 3R6GB 3F0NA 1Q86T 2EPIA 3ZZUA 5E3QA 4ECRA 1F2HA 4TY9A 1FDAA 1G7CB 2MLXA 1HYSB 2HGNA 2M0GB 3D3BJ 4ILMA 1FRKA 1RT1A 4TNOA 1R3NA 2YX4A 2VKZG 3MHYA 4WK1A 3I0RA 2OH2A 3BF4A 2HBQB 1IBKJ 4JI7J 4ZPDA 2FHKA 3M2UB 2YWFA 3D6TB 4LQ3A 4NLDA 1NDCA 1B7FA 1H72C 3PG9A 1CJTB 1MU2A 4Y2KA 3GG1A 3O6QA 4N41A 4WZMA 4DV0F 5E3CA 2D3UA 3CMQA 1G1XA 1T05A 1IQTA 1RTIA 3UD4P 2IY5B 2NZCA 1BY9A 5E7OB 1RTJA 5KT5A 1FA0A 5IM0B 2E5LJ 1FTCA 1Y4ZB 1MG7A 4JYAJ 2GW8A 3MUTP 2HWTA 3PW2A 4DV4J 2V8DA 4PG7A 2WSCC 3V4IA 1KRPA 2Y8WA 5I42A 3NGRA 3P3DA 4K5SA 2D3ZA 3WQPA 3GWCA 3DLEA 1HBUB 4MK8A 2JFKA 5C2GA 2W2QP 3DLKB 1I94F 3D5MA 1VS3A 4RNHA 4IR9A 5I4MA 1XMOF 4IH5A 3ENQA 3MR2A 2HHVA 2OKQA 3CJKA 5B0GA 4A46A 4H54A 1I6JA 4WXWA 1URRA 2DR8A 3C14A 3OQ2A 2FGCA 3NLCA 5A8KB 3KK1B 2NXCA 3FK4A 4MH8A 4DQSA 3A8KA 3RYLA 4RPFA 3O8WA 4ZDNA 2Z2YB 3OUYA 2M4MA 2MTLA 3SBMA 4K2JA 3V6JA 2ROGA 3L7OA 1TMJA 1XJWB 1GT8A 3OHAA 4JI5J 2DR5A 1UEVA 2VG6B 2RF2B 4ZIVA 2YNGB 3A13A 5B08A 2DIUA 5JVGQ 1UVLA 2H3EB 1CJUA 4ZVPB 3LALA 4F4YA 4QJVA 4M5NA 4ES2A 4BHQA 2BJ3A 2W2PP 3QRQA 5H1SV 3DYAB 4LIWA 1NH8A 3EDRB 4EYHB 2HS0A 2HNZA 2VG5A 1XMQJ 1IKVA 3VV2B 4USIA 4CYUB 3Q2SC 1RK8A 1RCXB 1IQZA 2ZWPA 3KHLA 4AL6A 3GONA 1S7HA 5D78A 1FJEB 4DZ6A 4QYRA 2QFJA 4D3GA 2DRDA 2R7QA 1K0VA 1FRIA 5F0WA 3RAMA 3KDNA 4C97A 2QL9B 1UJ4A 3CXCR 4Y0FA 2G13A 3E01B 4A8KA 1OSCA 1X5OA 1L3TA 4DR6F 2XY6A 5KFUA 3M8YA 3N4WA 4KPCA 3FRZA 2EG1A 2HNDB 4YN3B 2OEMA 4KTQA 3RG6A 3OL8A 2VPXB 4KHPJ 1EKRA 4NLUA 1FXLA 5KFAA 4HDHA 1UA0A 2MHEA 2OPQB 2MJNA 5KFEA 3IMQJ 1Q5YA 1N6QA 1S6OA 1CJVA 2WONB 3HZGA 3HPOA 4NRTA 3A12A 3G86A 4FYWB 5K8OA 1RJJA 4A8MP 3DOLB 3HX9A 2AYEA 4YS2A 1S1UB 3TYTA 2QJ3A 1JQGA 2YKMB 2LA6A 1S72S 2B9XA 1HFEL 3BV8A 1VRUA 4JV2A 3TVKA 2RHSB 5LMNF 3H4DA 4LJMA 2EFNA 5EDWA 4B3TF 4G1QA 3Q86A 2JL9A 3HHLB 2QG9B 2UZAA 5D3GA 4ID5A 2FTRA 1RE1B 4RW6B 8AT1B 5HMYA 1Y5LB 4OI4A 3RUBL 5KAKA 2CZ4A 1OS5A 1ZA1B 2XEXA 4MAKA 4DR2F 2MQMA 2QC3A 3H5SA 5JXSA 4IFVA 2AJ2A 3NCPA 1TL3A 4USTA 4R25A 2F9JA 5LSOA 5ETVA 1CULB 1PAUB 2UXCJ 2I8EA 2VBWA 2VASA 3K5LA 1NSQA 4GKKF 3VZHA 3CCES 4KGZB 3ZC4A 1NM2A 3UDCA 2N7CA 1VRQC 1Y7PA 1FX4A 3JQMA 3GJRB 8ATCB 1DZ5A 1U1KA 3POTB 1HNWJ 3OR1A 2B8PA 5DQIA 2R2UA 3C46A 2DD8S 3LH2S 1BE4A 5LOQA 1NEEA 1TP7A 4K50A 3QBCA 2GMLA 1Q0NA 2CUYA 3OXGA 3M6VA 4DV3F 4QWEA 1SC3B 4R5PB 3MUVP 1HBNB 1SJQA 1F0XA 4H4OA 4E2FB 5A8WB 3QT5A 1IWGA 4XPCA 4WFNQ 1REGX 2UU9F 3P49B 2R2TA 1YLXA 2DCUB 3R27A 4DV5F 2RE1A 1P6TA 4QYZK 2VDIA 2KL8A 5GAEI 4DR5J 4DQIA 5KFHA 1BLUA 2LECA 1GH8A 2DNZA 4JBCA 5HQ8A 2QLXA 4CH7A 3AJDA 1JLEB 1PILA 2ZC4A 3BO2A 2QL7B 2QX0A 2CPFA 4RUHA 3BEGB 2X1BA 1RP5A 1I1GA 3OL6A 2G9OA 3CGIA 2XMKA 4EBDA 4KE5A 5KT6A 1HQUB 1KKHA 5JUMA 3AOCA 4CLLA 3N5BA 4OZLA 1RABB 3RGIA 1DTTB 5KFCA 1PAEX 4JI6F 3NRBA 3D4JA 4NCGA 1Z1ZA 2I1RA 2Z8QA 4ETXA 2OMLA 3M6UA 2HAFA 2AQ4A 1YJVA 3FMWA 4IH6A 1YIJS 3CJKB 3SMZA 2O3DA 5EWGA 3BGRA 2DGOA 5KT4A 3E2EA 3BS9A 3PKYA 1TQLA 1C0UA 5J2QB 3OFGA 4OZJA 4DPTA 2XLIA 1PSDA 2E9TA 5AE3A 4J9UE 3JSMB 3K59A 2NUUG 4JI1F 4ZVHA 4KT0C 2J8AA 2HFNA 2DGSA 2YXLA 5I3UA 3ZTOA 2E29A 1M5PC 3AB4B 2PI4A 1EHWA 1K1SA 2PN6A 2RU9A 1KVKA 4QZVB 2FVQA 2ZOFA 2GFFA 5E0OA 3H42A 3LP1A 3F41A 3CTRA 3W5XA 2QL5B 4J90A 1QD1A 1NJXA 4C48A 3HHLD 4M5IA 3JTOA 4MMOA 1UZHA 3CJ0A 4YB6A 4C4WA 3W9HA 2K8GA 4USKA 2VG5B 3SCIE 3W66A 1N5YA 4O4GB 5D15A 1MWZA 3A3OB 4URGA 2ZH8A 1X7VA 3KK2A 1K44A 2C2EA 2DXDA 3BSOA 1JLGA 2XB2D 1UEKA 2MLYA 2XSJB 4KAIA 1RT4B 1V9OA 1F5AA 4F0KA 1TFWA 1AZSA 4O3NA 5CZVA 3O1LA 3C6UB 5B0DA 1R43A 4I64A 4FPRA 5A8RA 5L1KA 3LAKA 2GX8A 3K57A 1NHUA 2R7UA 2UUAF 4DOZA 2FLLA 3MAAA 1XERA 1XWLA 2CAJA 3M8SA 5C7PA 5GVQA 1WACA 2LLZA 3HVTB 1S6PA 1WELA 1NB2A 3R1LA 3TAMA 3JTPA 1GXUA 1PGZA 5DETA 2LU1A 2VQEF 3IRXA 2QA4G 4L74A 2Q1LA 3A3NB 3CJTA 3EPGA 1FWPA 3ISNC 2KRBA 2UUWA 3AQPA 2P8IA 3MEEB 4FXVA 3H5XA 3G8TA 1ACMB 4URSA 3TO8A 3DOMB 4G6VB 4CO2A 1YHQS 5J1NA 2FJEB 1J5EF 3KDOA 4ER8A 4FYYB 1U1OA 3EX7B 2G2YA 3DU6A 1U7LA 2AYBA 2A18A 3VAIA 1TVRA 4AQYF 3CSKA 2MEWA 4LFBJ 2XMAA 1TFYA 1ULRA 2ZJPQ 2QEXS 3NEKA 3MM6B 4EBCA 4PQAA 4GVLA 3M8QB 1U47A 4O4RA 5L1IA 2LDYA 2EC2A 1CEZA 3I82A 5M2PA 2GHVC 3CMES 2NXEA 4IR1A 2BW2A 1IKXB 2HEKA 4NWBA 1U25A 3AHPA 3PYEA 1JLBB 4YFUA 3B78A 2YNHA 3VGUA 5JMNA 1V5IB 4DL3A 2HNYB 3OTOJ 4K4WA 1HI0P 2R7OA 3KJVA 1N5TA 2E1RA 1S9FA 2ZZNA 2MGZB 1SC6A 2ATLA 2Q43A 2FC8A 4ZKAA 3KK3B 3MCSA 2VFRA 3FGVA 4QWAA 4YR3A 2ROPA 1ZAVA 3T6BA 1RHUB 2Z30B 3KNGA 3BR9A 3KHHA 4ED5A 2ZZTA 2HK3A 4OV1A 4F04B 3MAQA 1KN6A 3CCTA 1CC7A 3GCXP 1JLFB 4X4VA 5DG9A 1R7IA 1Y3KA 3CCUS 3GV5B 2B4VA 1AUDA 2OTJS 3KFWX 2RIJA 4FS1A 3OSPA 4NA1A 4ELTA 5ETLA 1WEXA 3M8PB 4ZVSB 3THPA 4BWJA 5D0GA 4CQ1A 3V6DA 1TK0A 2IA6A 2PMHA 1FEEA 1JKHB 3VGTA 3SV4A 2G0JA 3KJQB 4E8UA 3TOQA 2O67A 5EN1A 2HZAA 4ECXA 1WC6A 5LMUF 1VGYA 1AXQA 1LQ9A 5DLGA 2HBYB 4CLYA 4W4MA 2Y3YA 3DXBA 1LW0A 2KRRA 4CLFA 1NDLA 3M05A 1CQMA 3KUHA 3OVAA 1LW2A 2E7VA 1VQNS 4IG0A 2OSQA 2VC0A 2MQLA 2XGQA 3PYDA 3G71S 5HVHA 3DLGA 4QIEA 4B9LA 1IVZA 2JFDA 1MMNA 3M4XA 1YRXA 2HLUA 3GILA 2Q79A 3HK2A 5EWEA 4LF6F 1BD6A 1RHMB 1WUUA 4JUZA 3MTJA 2J7KA 2EW9A 1P9QC 2C28A 2BKNA 3RBEA 5BYSA 1VQOS 3UWTA 1U1QA 3GIKA 1RUSA 1GTEA 1QJHA 4DSJA 2A6OA 2HHPA 3Q8PB 4MKAA 4B3OB 3UVJA 1VQLS 2DH7A 4QR2A 4XO0A 2RSQA 2V4JA 1S97A 5L38A 3S7RA 3NBPA 5DG7A 5CCMA 2E5HA 5B0BA 4M5JA 3OL9A 5ETSA 3TA0A 3CCMS 4XK8C 2CQ4A 4CI0B 4FNHA 2V2KA 1MROA 4LSNB 3PCOB 4F0HA 5THWA 1S6UA 2ZBIA 1I94J 4CO4A 4B9NA 1L3VA 3CD5A 4LF7F 4OQJA 4MKBA 1XMOJ 3CCVS 3T1YF 2XGPA 4OI6A 3EGVA 1U6FA 1F6TA 5EGYA 3IP0A 2VJUA 3WIUA 4F7VA 2VJVA 2MKIA 3ENAA 4ECQA 5DGBA 1NK5A 4ZVUB 2I5JB 2QSFA 2XNRA 1V3ZA 1ROFA 3GQCA 1LWFB 3HHKA 3MM9A 3ICLA 4H4MB 2CQHA 3N5FA 2PA3A 4J9OA 5D6GA 2XYHB 3IRXB 3T19A 3I5AA 4IQXA 2AF6A 4WFXA 1V3RA 3MM8A 3FEZA 2ZH7A 1N34J 2IYIA 2DHGA 1S49A 2YY3A 5E3PA 2XCAA 4NXMJ 3QIPB 1P9YA 4LF1A 1NO8A 4I2QA 2VOPA 4LBPA 5L39A 2BV3A 5AXMA 1Z2LA 3W5ZA 1YZ7A 1OYDA 4DN0A 3TX0A 4E98A 4G1PA 4HTIA 3GJQB 2GIQA 4HH1A 1C1CA 1RAFB 3MM5A 1U1MA 4DV6F 3BQ0A 2DCLA 2A0FB 4OYIA 4RU9A 4J9LA 3BYRA 1H98A 5HI7A 3VHQA 4F4KA 3PW0A 1HBMA 5LJ5Y 4U9RA 4ZHRB 3PY8A 3M2VA 4I56A 3HHDA 3IXQA 4X62F 4O44A 2KTQA 2K3IA 4CNYA 1TR0A 4RW8B 4UY85 1GMVA 1SL1A 1TELA 5E2QA 4Y34A 4DR6J 2LQ5A 4FBTA 1EP4A 3EGWB 3DRYA 1HD0A 4WYLA 4USWA 5J1EB 2HRUA 4RBTA 4HL9A 2XM3A 1QAIA 1YJUA 1RTHB 4ZVEA 5KFPA 3AH6A 2MQQA 2ZE2B 3CDUA 2YH1A 2AKWB 2CFXA 3G82B 4C8MA 2N7YA 1U8WA 1X4HA 2YX1A 1TUVA 2R3VA 4P74A 2V50A 4CM2A 1A6LA 3NMRA 2AWZA 2HZCA 4OHVA 1HNIB 4E0DA 2DNKA 3PW7A 3FCHA 1DHMA 1ZZNA 2WVDA 2QRRA 3UNYA 1X60A 3FCVA 1Z2ZA 1QY7A 5HROB 1XN9A 2AYMA 3V6DB 5KFVA 2XWXA 5KFOA 2I38A 4B3TJ 3FFIA 5C25A 2BMBA 2KT2A 1QAXA 1HA1A 5F8GA 3NWRA 3KOAA 5J2MB 5KFWA 2B4UA 4NZ6A 4DR2J 3RU0A 2DHAA 4WU3A 3RRHA 4IRCA 3VQTA 3OSNA 3NG8A 4C11B 2BJ9A 4UW2A 1Y10A 3C16B 2ZNYA 2BJ8A 2LVWA 1TV6A 3B4MA 1YK9A 4QW8A 3KHRA 3SYZA 3EWGA 3TRGA 3DHWC 5KG1A 3PYGA 5LJ3Y 3R7SB 2CG4A 3DRPB 3Q8YA 2VQFF 2OAUA 3IM8A 3ILJA 2ZHBA 4B3RJ 3OFHA 4ZPWR 1VIXA 4EUVA 2WOMB 1XC9A 2DO4A 2HFVA 1JIHA 5F3TA 1DQ8A 4PWUA 5C42B 3UW1A 3TJ8A 4LF5J 1YJ9S 1WI8A 1I5OB 3NY0A 1HBOB 4DV5J 1YJ7A 4DF4A 5IWAJ 2JH3A 4WJBA 4OJ1A 2XO6A 3FEXB 5GMDA 1DFDA 1S1VB 1VBXA 3HKZD 2H5JB 3OJSA 1IR0A 2IC3A 3T5HA 1NK8A 3R8YA 2E44A 2DXEA 4KRWA 2QMWA 1X4CA 2DNGA 4OLOA 2DH9A 2NXUA 4DMZA 2CDQA 1VMBA 4ITSA 2QA4S 3H98A 1S1XB 3D54A 2BJ7A 2XI2A 3TJ9A 1H38A 5EWFA 1DARA 2DR6A 4X4RA 3MR5A 1RWMB 1RZMA 3AT1B 2IMOA 3C6TB 3MD3A 4OYBA 3HVRA 5KFIA 2JWNA 1EZZB 1N32F 5LM7E 3G9CA 5AE1A 2FJAB 3CJ3A 2MZ1A 5EHHA 2VC1A 3DRSB 3KMSA 4FS2A 2HQGA 1S1TA 2CZ9A 1C4CA 2V2VA 5F8MA 4OZ0A 2M3DA 1ZBTA 3EDQB 2Y1IA 1LWCA 2B0GA 2D9OA 1SBRA 2DHHA 3KHGA 2ZWOA 2B9YA 3CCLS 3NGDA 3R5AA 1TZ0A 2F8EX 3TA1A 2FZKB 3T6JA 3PIPQ 1VQYA 3MM8B 3K5OA 2PA8D 2OD4A 2XBPA 4ZVQB 4RU2A 5C24A 4ED1A 3BGFA 1BQNA 1Z4UA 4DZDA 3JTNA 4M94A 1FESA 4HHJA 4OX8A 2RRBA 1WOOA 3PX6A 3ZTSA 4LF4F 2XMMA 3HVAA 1KLMB 4EZ6A 4M8LA 2ZD1B 2FHJA 5A0YA 4HVZA 5AXLA 2LEBA 2R8GA 5MLCV 2CADA 4XTTA 2QLJB 2QMXA 2ASDA 3D0IE 1VOMA 1N54B 3CT9A 2YNFA 1HARA 3T41A 2MZJA 3E8OA 3Q23A 3F56A 2GQQA 1KDNA 5C2CA 4X2BA 5L46A 4KB7A 5MAOA 4I7FA 4OJHA 3ZO7A 1WJ9A 2BYCA 4U96A 1S76D 2OP5A 2GJIA 3CCJS 3FDSA 1WEYA 1TKXB 3T9ZA 2B9WA 3ZZTA 2EBGA 3LP0B 1NZAA 4Q8EA 2UUAJ 1EP4B 1S10A 2F65A 1HPZA 4V1Ak 1S9GA 4CT8A 1WF1A 5J2PB 2FYXA 3SDEB 4B9MA 4WYWA 1A7GE 1D8YA 3TR5A 3TARA 2QLFB 2V5HG 3IBFB 4WE1B 1CJKB 3RB4A 3MPVA 2N82B 2VQEJ 3CD6S 4NOHA 5GADI 3UCGA 4GO5X 2BM1A 3RBDA 2UVWA 4J9QA 3DC2A 3VVUA 1SV5B 3ETOA 3ET6A 2EG2A 2XNQA 1Y0HA 3P45B 1VR6A 3OR2A 4ZN1A 1Q1KA 4ZLLA 1WOPA 1YGYA 1J5EJ 1R8BA 2W9AA 2L9DA 2PO4A 3ISND 3FSXA 2DEJA 3MMAA 5DJBA 1FFSB 4KKOB 2GCFA 5D0RA 3RR8A 2QA1A 3W61A 3FEYB 5CQGA 3BH6B 2F9DA 3MI7X 2DGVA 4N5SA 2G4BA 1FXRA 1U24A 3HULA 4CLWA 3MMBB 4AT1B 1YBAA 3KG0A 3CJ8A 3DRRA 1HNVA 4K4VA 1U6ZA 4JP8A 3HFZB 3PR4A 1VJQA 5HMWA 2AIRB 2GNKA 3BGLA 3G6YA 4ANDA 4N7TA 4C3LA 1ZM4A 4JYAF 4WZQA 4C8ZA 5JJBA 4DV4F 2MSTA 2YPZA 3D0HE 1GX6A 2HQ3A 4WFZA 3MCMA 3Q22A 1EETA 3FQLA 1VC6A 1X9WA 1EB0A 3W60A 5HK4A 1HW9A 2EKNA 3BN7A 4C6AA 4ELVA 3FC9A 3F44A 1S48A 3U7JA 2OPRB 3FVYA 3PYFA 1S57A 2ZVIA 4R8UB 5CYMB 1RT7A 1WTBA 1JLAB 3DGVA 1WHYA 4PUOA 1LNQA 4M5MA 4KQZA 4WU2A 4WIIA 1RAIB 5D4OA 1OJ4A 4J91A 2EFVA 3U02A 8RUCA 3ZZYA 4ZVOB 1ZPWX 4YDDB 4ID8A 3VWSA 2V9KA 1VQMS 4ZLPA 1UA1A 4ECYA 3Q8RB 1DQAA 4MK9A 1YTYA 3S8SA 4WPAA 4HI1A 3ISZA 1UZDA 3CULA 1N48A 5HP1A 3DXSX 4U8VA 3UE2A 3M9MB 4JI5F 4MIAA 4K4TA 4L6V3 3SCLE 4FKYA 4CLSA 1VK3A 3AJ1A 3ZTRA 1N33F 1RT2A 3MECA 4KY3A 1ZETA 4YUDA 3PW5A 3NNCA 2IJFA 3W2WA 1J5OB 4OIXA 3EM1A 2OEKA 3PEHA 3LO3A 1XMQF 2O66A 2AMCB 4L72B 3Q89A 3OPKA 2H9ZA 4KJIA 3DOKA 4CRJA 1WDDA 3IR6B 3SQGA 1D8ZA 4O3SA 1B0TA 1B64A 2AX1A 3TWZA 2E1MC 2PD1A 1PJ7A 2DHSA 1GMUA 2GO8A 3HF5A 1S1TB 2U1AA 3MFIA 3GIJA 1NPKA 2WVBA 1NH7A 1UJ6A 4BLGA 4C0BA 1ZM9A 4LF6J 4KHRA 2HVIA 2OJ3A 2XG8A 1S9EB 1DQ9A 4Z7CA 5L9NA 4Y2MA 2OFGX 1T9XA 4TY8A 2H54B 1RTZA 5ETTA 4DPWA 5C24B 2W9CB 2GGPB 1BQNB 1KONA 3FRYA 1FJGF 1G6BA 1IKYB 3V4MA 4QQBA 3RB0A 1MW7A 3J7ZT 4C0HA 4CLKA 3R5CA 2Z56B 3IG1A 5HQLA 4DLGA 2VBXA 2M70A 4LR8A 2AT1B 3IR7B 4BBYA 2V8VA 3JSBA 2DR7A 1OY6A 3JS9A 2IM0A 3VCDA 1FRXA 1U8SA 3J7YU 3OV7A 1Y9OA 4DJBA 3D6FB 2X1AA 3KLGA 1RT6B 4Z7YA 3SIPB 1YVFA 1IBCB 3ONQA 2FPHX 4DSLA 1PYSB 2HK2A 4OZ2A 3DNCA 4I7FB 1H0HB 1Q4RA 3CD7A 2GIFA 3ZTQA 3H2VE 3UN5A 1XIQA 4M5LA 4M63A 1WG1A 1RBOB 3UCZP 2XMVA 5HJYA 4ZVRB 3H5YA 3KKFA 4Y2CA 1R31A 3H59A 5CHCB 3UDEA 3N6LA 1VDHA 3PRDA 2NCKL 1C1BA 2R8JA 1SB6A 1QE1A 4NE9C 4GVBA 3DN9A 3MR3A 3VZIA 3DM2A 2CQIA 1JJCB 3MURP 4RW9A 2UXCF 3AY0A 2L3MA 2JC1A 3WC0A 1K73T 4USMA 4KV8A 4DF8A 4GMKA 1HMVA 3I32A 2LQBA 2HWHA 1Q16B 3GSDA 2X3DA 3TANA 1SJ4P 1ZOTA 2LFVA 2RT3A 3OR2B 3W8GA 4PXCA 4PCQA 3BQ2A 2VONA 2CPDA 4OYPA 1DTQB 3WX4A 1W25A 1JB0C 2I0XA 1BMQB 4NXNF 5K14A 4UT4A 2GAHC 3MOJB 5HLFA 2E7XA 5CYQB 2E1CA 4P6QA 5DDQC 5BR8J 2C2OB 3CE8A 4WP8A 4JI8J 2AJ1A 4ECSA 5F41A 2C2ZB 4AD6A 2FHOB 4KYZA 4DV6J 4J7CA 3D66A 2Y0SD 2APOA 2DHXA 3CJRA 1T9TA 4DSIA 3D3CJ 2NPFA 3U1NA 1B7YB 4X62J 2CQ0A 3DGPA 4Z2XA 4IDKB 5KFTA 3V81A 2BJDA 1NJYA 3QJLA 3R97A 2J0WA 4IFYB 4FYVB 2K2PA 4K4XA 2YWGA 1VQ5S 2W7AA 2O5DA 2VFTA 4DDFA 1IJFB 5RUBA 1T03A 1HW8A 2CNNB 4Y2AA 2YKNA 3TUZC 1BHNA 4N77A 5GAHU 4KHMA 4ECVA 2R7XA 2UVUA 2X1FA 1DLOA 1D9AA 2JZ5A 4ZPTR 1NDKA 3MAHA 1XR7A 4FF1A 2WBRA 3AD9C 1VRTB 4JI3F 5B0FA 1WHWA 3I6PA 2N4DA 5E41A 1N0UA 1TL1B 1UVIA 1VHFA 3WHIA 4IO1A 3IM9A 3K2YA 2IAJA 1S77D 2ZOGA 3CVKA 4KFBA 3JYTA 4P75A 4ZJOA 4GC7A 3VAKA 3ULHA 2GMJA 4DPUA 2JEIA 3PFEA 1LXNA 1OQ6A 2P6SA 2AX0A 1N36J 2BACA 2ZDPA 3NCRA 4JI0F 2VFUA 3IWNC 1U2FA 2HQCA 1BXNA 3IS9A 3OTBA 3BPDA 2B4OA 4MJKA 2XY5A 2IMWP 2HFSA 2BANB 3BH7B 3TZXA 1CVJA 3FBCA 2AYGA 3MR6A 3JB9k 2KG1A 2CPYA 4XIUA 3GIIA 1NJZA 4NA3A 4M5DA 2DNYA 4BC7A 5KT3A 3D9BA 4OYZA 2V34A 4RJVA 2YNIA 4I67A 4FP9A 4F67A 1CC8A 5I3QA 2FB0A 2W4PA 3M32B 4YMEA 4YB1P 2V2QA 4RW4B 3Q8SB 1UWAA 3EZOA 2W4CA 1AROP 1M5SA 4K4SA 3LTOA 2PT0A 1RWUA 3CJ5A 3TZZA 4EI2A 1Y3JA 4JV5J 3DI6B 1TL7B 3IA0A 3SCJE 1QVGR 2VQFJ 3R1HA 4NLGA 4ECUA 2GVZB 2W4DA 2VKRA 3EICA 3SZ2A 4F36A 4MKYA 1CLFA 3KLHA 5AXKA 4RW7B 2HHTA 2VFVA 3GFXA 4CTAB 2CJQA 3I0SB 1LFPA 5ETKA 4BWMA 3HFKA 4Q44A 2ZEJA 1Q7LB 4DFKA 3SQOP 5FJ4A 3N6MA 1CS4A 3BR8A 1TKDA 3ILIA 4ECTA 1V5VA 3CB4A 2LEPA 3M2RA 1V6HA 1RT3A 3ZZPA 2E7WA 5KG6A 4WIQA 1NHKL 2COLA 3GE9A 2R8KA 3W65A 2HS3A 5F9NA 1U49A 1YRUA 2W01A 1TAQA 2EFPA 2HHHF 4NLYA 3MM7A 2HQIA 1UWBA 4B9UA 3D1OA 5KFKA 1R0AA 2ZFHA 2FDNA 4Y28C 3T5KA 3HMJG 5FLXU 4RNOA 1FO1A 2ZKTA 3Q8VA 4OL8A 2B7BB 1RT5B 4PYDA 1FKPB 3GIRA 3UNGC 4DEZA 4RNFA 2G0CA 2CA9A 4DL7A 1IBMJ 4YB7A 2ACYA 1IM4A 1PYTA 4IG3A 3UFCX 4U6PA 4I6WA 2DGQA 5KFZA 4J37A 1SC4B 4I1TA 5I3PA 2FVPA 1N88A 2IM2A 1S0NA 2UVRA 1RA7A 3C8YA 4J9RA 4ZPCA 3I55S 3ITHB 3HZEA 2PI5A 1M0SA 1XNQJ 3MEGA 5KFFA 3TQEA 3OTOF 4KV8B 1C2PA 1NU4A 3OW2R 4ICLB 4OI0A 1VQ6S 1K47A 5HBMA 1VQPS 1UEUA 3GV7B 2FLNA 1F3VA 4FF4A 2P9CA 3GFZA 2ZH2A 3MDFA 2KXNB 4P9SA 4LF4J 3A1YG 2DNQA 5K14B 2KH9A 1MWYA 5HQMA 2GVDB 2CJYB 1R27B 1RACB 3HT3A 4I2PA 1H73A 1X4GA 3G6XA 4TYAA 2VG7A 5CAAA 3TUPA 5K8MA 3GB0A 3UCUP 1LWEA 2WHOA 1OMSA 2HHWA 4NI2A 2KJWA 4NLWA 3RW6A 4PG4A 2CNKB 1NHVA 1ZA2B 2GQCA 2HPUA 3EXCX 4ZS6A 1B0VA 2FVRA 3S01A 3BPSP 2J76E 2WK4A 3KJNB 1LOUA 2ATCB 2CQGA 4PWDA 2RRAA 3P96A 4ECZA 5HVGA 3EUNA 2Z2LA 4HDGA 4RNNA 4JI2F 1HLWA 1JXLA 4ZCMA 3VAFA 2LU2A 2IBKA 2HBRB 4X4OA 3MEDB 4HYKA 4DBQA 2R7SA 1UPMB 2NS1B 1YJWS 3R5GA 2HIQA 6AT1B 2C42A 3FZ2A 1JJ4A 4YOEA 5GAGI 1YI2S 1KP6A 2DY1A 2X1GA 2OPPA 1TKTA 1FK9A 2H4WB 3L7UA 4MIBA 3QLHB 1EQ0A 2CQDA 2DB1A 1C0TA 3GR0A 4AUKA 4O3RA 1NK7A 3GFYA 2ACMA 4DUYJ 2YWWA 1SH0A 1SL2A 2IVMA 4QPTA 2WCXA 4DV2J 2DNOA 4EO8A 4YEAA 4BCAA 1D3WA 4A8QA 1WC1A 2FJVA 4EO6A 1GMWA 4USHA 4QR1A 4OYAA 4USUA 3VGVA 1RAJA 2FVCA 2AP6A 2QZ8A 4EZ9A 1O0PA 2AJ4A 2Z4PA 3H0PA 1MN9A 3KLFB 2VA2A 4B02A 5G0RB 2L08A 4KGKA 4DV1J 1RCOB 2DK2A 3PFOA 3CW2C 4NLQA 3KLEB 4N8OA 3T3FA 1O8BA 3VAGA 3D2WA 3CCQS 3PW4A 1IN0A 1G2EA 1Q95G 3PHTA 2BABA 7FD1A 1FNXH 4K5RA 1N5VA 2I9SA 2M7SA 2RNEA 3BSNA 2RQMA 1WEZA 1O5JA 2DGWA 5HATA 2VV5A 3PNIA 4OX9J 2UUTA 1S79A 4TVAB 3W1YC 2MQ8A 2B5JB 1WD6A 1T94A 4LRDA 4P10A 1BQMB 3TAPA 3IWLA 1TUWA 4DPOA 1UAWA 1SUQA 1RTDA 3KTQA 4ZMMA 3L9ZA 2DBBA 5CCLA 5D0HA 4CZCA 3QRPA 1KTQA 1HWIA 1FT8A 2BX6A 2UXBF 3GP9A 4M5HA 1KFDA 2D41A 4DL4A 1N34F 1G3OA 1R6YA 1FVSA 3CCSS 4NXMF 2MLZA 3SFUA 4RBUA 3M1VB 1F9FA 3QAEA 3T9NA 3BKFA 2FJDB 1N33J 1NJWA 2B6AA 5FDLA 4NMXA 3CC4S 2B43A 2XQCA 4GC6A 4WFYA 2NSBA 2AD9A 1B99A 1VQ9S 2CKWA 4NLPA 3M30B 1HQEA 3M7VA 2AJ0A 4F4AA 1RXOB 4PR6A 1FRJA 3RJMB 4QR0A 1K9MT 3QT7A 1E6YA 2H4YB 2FY1A 1RLCL 2GJFA 3A8IA 4FF2A 1HKAA 1HHSA 1KQGB 4U8YA 2DO0A 4Y00A 2ILYA 5FIIA 4KGVB 3C15B 1E6VA 2MY8A 5CXTA 4DL2A 2K1RA 4WKYA 3LANA 1PC4A 1T11A 2FJBB 1NLKL 2A10A 2R7TA 4WCEQ 1SJ1A 3WZ0A 1NUEA 4CNZA 1VC0A 2CQ3A 5SUHA 3LOUA 1YBUA 4EEYA 1FJGJ 3MMCB 4EGLA 4YP3A 3IC1A 5ADZA 4WKRA 4USJC 2VFSA 5F0UA 1NJIT 4RWXA 3QIDA 2HSEB 3NGTA 4HKQA 3U1LA 4ELUA 3UPFA 3L4BC 3A3PB 2RQ4A 5DO2A 4PXBA 3AXKA 2QN6B 3TJAA 5E3RA 2LQ9A 1S1WB 1REVB 3LPYA 5KT2A 3N01A 2M8HA 4KO0B 2RKIA 1V3SA 2OI2A 1RHRB 2CVEA 3QMQA 5AT1B 1S7IA 1KVJA 2F4VF 3OTDA 2OLWA 3JSYA 1PBUA 1F5CA 3I4PA 2HBZB 1QM9A 5LT5A 4WFAQ 5DZ7A 3CUNA 5J2NA 1S5ZA 3RBXA 1U2CA 1WG4A 5IT9U 1R8PA 2BRLA 1RU2A 4PRFA 4F26A 4M5GA 2Q66A 4FVCA 1RAEB 4PAAA 1R8CA 1SJ3P 2LQJA 4P2MA 5D4LA 4ATNA 1EQMA 3G87A 1T9YA 5T41A 1FX2A 3CO0P 1UJ5A 2D9PA 2FLPA 4X4UA 1URNA 4N8NA 3T1HJ 1S4FA 2NYIA 1TMMA 4F2SA 5HO4A 1YQHA 1KBRA 3QAUA 2WTFA 2NQPA 1SQEA 1JLCA 3EPIA 1RT1B 3TW0A 1ZAWA 4Q0BA 3EJMA 5KOXA 4FXWA 4B3RF 2HVEA 4DS4A 3I0RB 4QW9A 2ZITA 4NXNJ 3RR7A 2IA0A 3PVXA 4OJGA 2HHUA 1Q8KA 2OUGA 1WOSA 4LF5F 4P73A 1OIAA 1RWPB 1MU2B 2WW4A 3H90A 2DXFA 2XLJA 2RJZA 4O0IA 4C8OA 3THVA 2RMLA 1T05B 5IWAF 2J0SD 1RTIB 1FXDA 1HI1A 2XHWA 4PG5A 4B3MF 2ZVSA 1RTJB 2MQOA 3CF5Q 1D9FA 4HI2A 2LXUA 2HMIA 1AA1B 4PYAA 3LW5C 4OHZA 3V4IB 2VPZB 3T5LA 5I42B 4DN9A 3OLAA 1JLQA 3G2XA 3QO9A 2KFNA 4NYZA 4ETZA 3I96A 1I3OB 4U7UD 4UQGA 3FMBA 3DLEB 5CD4A 4MFBA 4ES3A 4YDXA 2AGOA 2HW3A 4RL1A 3W2VA 3ILLA 2NR0A 2NZ4A 1O6XA 1B3TA 2BKPA 3R5JB 2JEFA 1CQNA 2BE2A 2W8KA 3W8PA 1DURA 2SXLA 1UW9A 4DWIA 4X64F 4U7UK 3M8ZA 1YJTA 3C14B 4XDCA 4PQUA 4JI3J 2AU0A 3E51A 4QYZJ 1RTDB 5KFRA 2OPSA 3AA8A 3AJ2A 4WFBQ 4ED3A 3OUYB 4LBHA 4CM0A 4ZP6A 2AGQA 1RWXB 1GNKA 2P2CB 2JVRA 2FD2A 2VBZA 4RZRA 1ZPVA 4B3SF 4JI0J 3C2PA 1CJUB 5ETOA 5T7LA 1YRTA 4DG1A 2VH7A 1SI9A 4ZVFA 2B7CB 2VIHA 4D3HA 3HLUA 3UN3A 5F8HA 3T5JA 3O3LA 4HLBA 2HNZB 1EKSA 1IKVB 2HIYA 1HYSA 2HKEA 1PCAA 1TL4A 1FDNA 2YKQA 3TAQA 5K5MA 2JX2A 2CZVC 3B8HA 4ZP7A 4ED0A 2BZ2A 3PKMA 3M2UA 3VF0B 3H8YA 2DIVA 3CIMA 3GLJA 3HHLC 2GHPA 2XYGB 3BKUA 1CJTA 2E1AA 2I6WA 1X9SA 2Q6CA 3OVSA 1RQ0A 5U47A 4ED6A 4DPYA 2KZZA 3I56S 4F25A 5JVHQ 4XDDA 4F4WA 4DX6A 5IM0A 1BUXA 1WF0A 2N3OA 2A2DA 1H6KX 1N6QB 4K0KJ 4C3KA 1B4SA 1CJVB 3CDAA 1UP1A 1VI7A 3CJ2A 2WSFC 2ASJA 1FHTA 2GS8A 1XBWA 5ETPA 4F0MA 2IHR1 1VBKA 3K8WA 1HBUA 4DQPA 3DLKA 3PTWA 3A4TA 3D1HA 3HJVA 2CPEA 2H1YA 1AB8A 2HHHJ 3GV8B 2YKOA 5IQQA 3DDNA 1VLOA 1SJRA 4F2RA 1VRUB 5F3ZA 3A8EA 2MY7A 2CJ9A 3OTCA 2DISA 2W7PA 2EK6A 1UTAA 4O3PA 1WC3A 2V8HA 4J9SA 4P2FA 2W2OP 3FSYA 1HWKA 4G1QB 5A8KA 3SSQA 3CJQA 5D3GB 4ID5B 3RZAA 1MWQA 2C2MB 2RH3A 4OHXA 1LV5A 3GYNA 1FE0A 3TEGA 3EVWA 1FJ7A 3WX8A 4IFVB 4KPYA 5F8IA 1UPPA 2MJUA 1TL3B 1QLNA 1BWVA 5DS7A 3A8JA 4WP3A 1WKKA 1KS2A 1T02A 3CWJA 1CBKA 2VG6A 2YNGA 3RAXA 2BUNA 4KR0B 1WC5A 2ZH6A 3I9ZA 5FLXY 4WF9Q 1JXEA 2ZM6J 2LP4A 1SQFA 1H2VZ 2JSXA 3CNQP 2J9DA 3JQJA 4ZN3A 3DYAA 4IQMA 3OR1B 2DYAA 1UFWA 1FCAA 4CYUA 3MD1A 3NNHA 3R5BA 3ENWA 2XZDB 4C8KA 4ZJLA 4A47A 2CVIA 2EKYA 4TU8A 4H4OB 5IXUA 3B82A 4LFCJ 1Y00A 4Q8FA 3UR0A 4NMLA 1T0TV 4LF2A 3I5CA 3E01A 2XC9A 2CPZA 3DLHA 1NBEB 4ZA1A 3G8QA 3BBBA 1H74A 2I2YA 2HNDA 3WIVA 1VLYA 4DL6A 4MK7A 1XTZA 2RDDA 3W7BA 5DDPC 4RR5A 3RB6A 5E33A 3NNAA 4ZLNA 5KG2A 2OPQA 3M8WA 3HM9A 2WONA 1X8DA 5A2QY 1IXKA 4NCGB 1XMBA 1VK8A 2F4FA 2D69A 4JI2J 2CYYA 3DOLA 4UZCA 4P2XA 2KXFA 1M5VC 1S1UA 2V9WA 4YR0A 3MPUB 2YKMA 3BGRB 1FNMA 2Y9HA 3RRGA 1Q8IA 2BA9A 1U02A 4WXOA 2YQ1A 2RVJA 1C0UB 1ZM3A 4O3QA 2J7WA 3UD3P 2OPSB 3RRKA 2FY8A 3HHLA 5DDRC 4RW6A 3U27A 5I3UB 2LA4A 2JEGA 3KJFB 3TZYA 1S6QA 3PIOQ 2Q3PA 3OTEA 3FNNA 2LYVA 1JJHA 2ZH4A 4J9MA 5KFQA 3LP1B 2W1BA 2R2SA 2ZJQQ 1CULA 2FJXA 2YH0A 5ITHA 4ED8A 4RWWA 1NZ8A 2IPOB 5ETMA 1YJRA 3NKYA 3TA2A 2GIRA 4B08A 1VIOA 3MFHA 3CCWA 1HHQA 1AFIA 2IFXA 1N5YB 3P5BP 1T7PA 3KK2B 2HRYA 4WWSA 3POTA 3AD8C 4ZLJA 1JLGB 4OLPA 4AXJA 4C2MA 1B70B 4XAKA 4FF3A 3D7SB 1PO6A 1S12A 1AZSB 3PO5A 4OZ5A 4DV7J 4R5PA 3RAQA 2MSSA 4F50A 1HBNA 2H5EA 4HR2A 2DVIA 5A8WA 5A8RB 3J81U 3NGKA 5DQHA 3Q0AA 2U2FA 3QYYA 3PV8A 2YTCA 4NL5A 1VBZA 4NLOA 2O01C 2VL1A 3MAAB 3D0GE 1DAXA 4ENOA 1Q79A 1R8AA 5A76A 4LUBA 1S6PB 3QNWB 4KH0B 3TAMB 4A48A 4DX8H 1JLEA 4PG6A 3O2IA 5AXNA 2ADBA 1O51A 4Y3CA 1XK8A 3MPWA 2UXBJ 3R3TA 4QIVA 2L41A 2UUBJ 1HQUA 4HACA 2HFOA 3PACA 1DTTA 3PM9A 1NKBA 3CC7S 4RX6A 1IKWA 3OBIA 2RILA 1WSVA 3L95X 1WHXA 3JQKA 2RS8A 2BOPA 2MQNA 4ED2A 3JAMY 1TVRB 2KI2A 2AHOB 5BR8F 4CP5A 4JI8F 2C3YA 2YVSA 2WB4A 3MUMP 2VPYB 2QA2A 1HNXF 2IIHA 2MHNA 5J2QA 3JSRA 1YWXA 5BXIA 3H5UA 3L3CA 2HAIA 1U1RA 3MPDA 4ZOSA 3JSMA 4ZIWA 1U1NA 1RSCA 1KTVA 2W7OA 3BSCA 1M5HA 2OSRA 3QGHA 3ENVA 2GV1A 3GJSB 3ILOA 1AW0A 1OWXA 2KFZA 2YNHB 1FRHA 4DR1J 1QTMA 2FHMA 4V19X 3DLLQ 3BO3A 3MPYA 4KGXB 1ZTTA 4Q2LA 1RKIA 3AODA 5KFXA 3KJVB 5CABA 4ZCKA 1FFGB 1VISA 1P1LA 1IR2A 2FIUA 2V67A 4FNIA 2DKOB 2JOQA 4GRSA 4O4GA 4J9KA 3P4UB 5L1JA 3FZBA 1C4AA 2EFQA 1K8AT 1D1UA 3QATA 2BJ1A 3PRVA 2W8LA 1EIYB 2DITA 2XSJA 3HCXA 2IRXA 1RT4A 3LUYA 2BVZA 1WTFA 4PWWA 2ZKUA 2EK1A 4XPEA 5GAEU 3C6UA 1YSJA 2FLOA 3J7AN 1VQ4S 2DTJA 1T3OA 3CDWA 2V94A 2PSZA 2W2MP 2KU7A 2F4VJ 4NRUA 1N36F 3TP2A 3CO9A 4JI4J 3BZQA 2UUCJ 2HFUA 1QSLA 3TQ1A 4DSFA 1FNOA 1NPPA 4BDPA 3HT0A 3HVTA 1JNZB 1RISA 3P8BB 3ZZZA 5EX3A 5AJ3F 3HKWA 2YKPA 1NNDA 3PEJA 2ASLA 4OMFG 1LW0B 2PIIA 2PC6A 3H20A 1OQ3A 3RTVA 3J7A1 3QFHA 3MEEA 1W26A 1RYRA 1LW2B 4TYBA 1KHVA 4AXIA 4CLPA 3DOMA 3IO1A 2XS5A 4IG0B 4A8YA 1XR6A 4X65F 3DDIA 3OJUA 2E5GA 2F8MA 1KSPA 3DLGB 4WTOB 2OTLS 4ANEA 2FC9A 1ZZFA 2B51A 4K8RA 4JV5F 4I68A 5IT9Y 1NMEB 3MXHP 5KG5A 3R6LB 1RA6A 5CYJA 4C9DA 3MM6A 2YKAA 4QIGA 1YBTA 3KNAA 2BQRA 2RS2A 2POKA 2XWYA 3M8QA 1KQFB 1AFJA 1SH3A 1S6QB 2XLKA 5GMEA 2WSEC 2KB2A 2C3OA 4K59A 3ZZRA 3HSZA 3OFFA 1IKXA 2D1CA 2PE8A 1JLBA 2EI5A 2X3GA 3D6HB 1X4BA 3EE3A 5F9LA 3UVJB 5IC6B 4B3MJ 1VYAA 5HN0A 1X5PA 2HNYA 3NP5A 3Q2TC 1OY9A 1TUGB 2V4JB 4TLQA 5DQGA 2MZQA 4K7QA 4Q2MA 3KUEA 4M5KA 3R7BB 1S0MA 2M52A 2A1BA 2DNLA 3NBPB 2VA3A 1ZM2A 2PGCA 2C2NA 2MGZA 1HQ2A 3KK3A 2PEBA 1F3FA 4HTJA 2CWXA 1MROB 2ZDOA 3VALA 5DZ6A 4FN5A 2LDIA 5D8HB 1ITPA 1BC6A 4OZNA 4F3MA 2HQDA 1Q7YT 2AGPA 3FQKA 2OEJA 4A8OA 4OYWA 4UUWA 3G8SA 4FDFA 2QLWA 1R0CB 1NKCA 1IBMF 1JLFA 2IRYA 3H25A 4X64J 2KO1A 1N4LA 2DNRA 4HEA9 4DR4F 3GG0A 3TI0A 2UV8G 3GR1A 1N56A 3WDOA 4DFPA 2B8QA 4NCBA 1CPZA 3M8PA 4FVMA 5E3AA 4LSLA 3MM9B 4OYOA 3Q8QB 3KLIA 1XNQF 1JKHA 5KFYA 4YHHF 3O5TB 3L09A 1SKSA 2H65B 2KM8C 2C3PA 4GKJF 4DL5A 1H3DA 5K8NA 5IS2A 3MR7A 3WBZA 2LCWA 4LSZB 4X4TA 1U0HA 4UOHA 2E5JA 3BO4A 4B3SJ 4HACB 2A2CA 5DGAA 1FFWB 5HJXA 5DG8A 1VCTA 1Q81T 1IKWB 4OYXA 2DNMA 2Y0BB 2HZVA 4I2QB 3OVBA 3NCQA 3AFGA 4A8FA 4MT1A 4DFJA 2ZUAA 2C1EB 2KT5A 2HWIA 1QDUB 1RWKB 2F1FA 4H4KC 4J9PA 3FBEA 4TXSA 2R9LA 2FJWA 4NYOA 1TTHB 3EMTA 2ZHOA 4NYPA 1C1CB 5KOWA 3MM5B 1XNRJ 4FXDA 2KFYA 5GMKa 3S6EA 1HBMB 2ZH3A 4NLTA 5LSLA 4CO0A 3M2VB 4DL0C 1VC5A 4O44B 2ALYB 2VPWB 1FKAF 3MCOA 2LKZA 1X31C 3HP6A 2ZBRA 3C66A 1HWLA 2V69A 1WC0A 1KLNA 3Q8UA 4AFFA 3SXLA 4ILLA 1X5SA 2ZJRQ 1Q78A 4B3OA 2L9NA 4G65A 1F2GA 1YDLA 2G2OA 2OHDA 2M8DB 1ICEB 4X66J 1NPRA 4YB5A 1HL6A 4FYDA 1L3UA 1MSWD 2CXEA 1DJ0A 2WB1D 1APSA 4J9NA 4LVNP 4QIWD 4LFAJ 1U09A 3ZZ0A 3BJYA 1N5SA 4LSNA 4ZP9A 2CJAA 3I87A 3UR3C 1GK8A 5D4PA 7FDRA 4ES1A 1HR0F 3DDKA 4F02A 1JJ2R 4LF9F 2XULA 3W64A 4NZ0A 2GQ2A 3AQOA 1R6VA 4DUYF 1UL3A 3SSRA 4RUBA 3FFIB 2J6TA 3FJ2A 3VTIA 5C25B 2GO9A 4TKTA 4OI1A 2VDHA 2I5JA 4DV2F 2A3JA 5K20B 1LWFA 5LSRA 3QSIA 1NCLA 1J2VA 4H4MA 4P52A 5KG4A 1EAYC 2YPYA 4EFAC 2ZBPA 1KFSA 3QQCD 2VD3A 4LT6A 1KQKA 4YY3F 1IJEB 4QPXA 2W24A 5L1LA 2MKHA 3AXMA 1FF2A 2XZWA 1JMTA 2H51B 3ZXWA 3GYGA 1M90T 3NAHA 1RI7A 4IOCQ 3QIPA 4DV1F 2F63A 5J1PA 1TV6B 2CJKA 2L48A 1OY8A 1YX2A 2CNLB 4EK2A 3US5A 3RBZA 2BJEA 3NS7B 1R89A 3UQSA 2HURA 2MKKA 1HNZJ 2VUGA 2ZH5A 2H5IB 4BC9A 4OX9F 3QZ7A 2K7KA 1Q8LA 2IJRA 1Y11A 2J0QD 4KSEB 4DI6A 4OJ3A 3HD2A 5IT0A 3K5MA 3DMJA 4ZHRA 3DFEA 2A6MA 1NRKA 3UN2A 3R5DA 4RW8A 2ZZMA 3LGHA 1WG5A 3PJ9A 2H48B 3NMAA 4DR3J 4PG8A 2CPXA 5B0CA 4DHVA 1SVDA 1H7WA 2WVFA 2RDJA 2AEJA 2LQ8A 5J1EA 1K0TA 2DPIA 4LRFA 1RTHA 2IC3B 1AYEA 2EEYA 3SV3A 2HLTA 4B9VA 2ZE2A 4DLEA 2B56A 5KFGA 4K4UA 3G82A 3RW7A 1NK0A 2IM3A 2RQCA 1RHKB 4H4KA 2RUGA 4O0NA 3Q24A 2V63A 5B09A 2JHEA 3LWLA 4M95A 4PPZA 2DJWA 1HNIA 2M2BA 2JLGA 1VJWA 3LF0A 3M9OB 2C2RA 4OX6A 2OO4A 1RWOB 2YWHA 1NK9A 2G1DA 4NA2A 2ZOMA 9ATCB 5HROA 1LK7A 4LSLB 3AAWB 2BXJA 1LWCB 1Q82T 1K1QA 3MTKA 3QGGA 3GPAA 3KLIB 2BOAA 2V68A 5K8PA 3BN4A 5L8RC 1G4CA 2OELA 3IAM9 1KD1T 5C5JA 3PJXA 1FE4A 4G3IA 2XMWA 1OPZA 2E9ZA 3DKDA 5J2MA 2KJVA 4DUZJ 1U0HB 5BJRA 4P72A 3Q83A 3AOAA 2GJ2A 3R7NB 2G2ZA 4C11A 1KWMA 2XCPA 3C16A 1RADB 5A0YB 2LMIA 2F7VA 4A8WA 3V6HA 3GMGA 1ZAXA 2C22A 1WORA 4P7VA 2KKHA 3DRPA 1L5UA 3GZ7A 3K0JA 4ED4A 1SL0A 1H2TZ 1IBLF 2R7VA 4L3NA 2YNFB 1ELOA 3PX0A 2G1HA 2F8HA 1NK6A 2JLEA 4DR7F 1JX4A 2WOMA 5L9XA 1MMLA 3I5BA 4RUAA 3MZIA 3E3XA 5E5NA 5C42A 1UKUA 1RYSA 5IV4A 3CCZA 2MB0B 3TVYA 4AL7A 5FD1A 4DQQA 2HGMA 4DV0J 1HBOA 1KVIA 3OLBA 3GSIA 3CJ4A 1HPZB 1EJ7L 1S9GB 2CJBA 2Z0GA 1S1VA 3HSJA 4X4NA 5F8NA 1AT1B 1D9DA 4CH1A 2CQ2A 3T1HF 2ERRA 2NUHA 4B9TA 2BEFA 1SPBP 1PKUA 3HDSA 5BYRA 3J81Y 3OD2A 2C2DA 3ET6B 4I69A 2PFFB 4ANCA 2CPHA 3D28A 4UY8T 2GHWA 1GFWB 5HVFA 1S1XA 1YITS 3DU5A 2Y1JA 3MMAB 1N8RT 3C6TA 1YG0A 3J7Z5 5KFJA 3EVOA 3H40A 3DRSA 3ZNJ1 1QUPA 1HNXJ 1U26A 4NEYA 3IRWP 4AYBD 4LMZA 3DRRB 1HNVB 2JC0A 4TQSA 2QYGA 3IWXA 2NLWA 3ZFVA 2HHSA 4CLTA 3UO0A 4CWBA 2XI3A 1PBAA 1FD2A 4QCLA 5D77A 1U45A 3K58A 1FVQA 1EETB 1VFJA 4C8LA 2R8HA 1UVJA 4EMDA 4UQTA 4ZITA 1M1KT 3GU0A 3N79A 3P5TL 2FQQB 1KLMA 2R4FA 1LFWA 2ZD1A 2F5GA 1RT7B 4U95A 2DT9A 3BYPA 2ALZA 3D6MB 2R2RA 4PUOB 1NSAA 1BWEA 2IJNA 1UCNA 3J7YI 1FJCA 2ZBCA 3D1QA 3BBCA 5SZTA 1UVKA 1S99A 5H9FJ 3TVZA 3DMJB 2F40A 2FHJD 3C3LA 3QSYB 2VF3A 5IT4A 3LGMA 4NZ7A 1RAHB 4DPXA 4UTGA 2XMUA 1ZH5A 4K4ZA 3OT9A 1TKXA 3BBFA 5HP1B 3LP0A 3FSIA 2KM8B 1JWWA 1F9HA 2XYPB 2MXYA 2AZ1A 1U1LA 2WVCA 5J2PA 4MYTA 1TK8A 3SDEA 3M6WA 5F8LA 1RT2B 3MECB 1WKLA 2DR9A 4WE1A 2OFHX 2KT3A 1CJKA 3LQVA 1RU1A 2G0IA 3PHEA 3H2LA 5AJ3J 2AEMA 3W2WB 3IGVA 4LR9A 2NREA 2JNJA 2K3KA 3UI3A 2AZ3A 1HIYA 1VBYA 3FUYA 2KYZA 2B3TB 1SV5A 1UMJA 2V8GA 3DOKB 1CG2A 1ZS6A 2JEJA 3SQGB 4LF8F 2R8IA 4LREA 3DRXA 2RHQB 4ILRA 2XY7A 2CPIA 4X65J 3ZTPA 2QIFA 2ADCA 3BM7A 4YR2A 4KKOA 2HRTA 5LMNJ 3SI8A 3IBWA 2VU5A 3SCKE 1JK9B 3PXGa 4W98A 2M9KA 3MMBA 3CIZA 2JRSA 1S59A 1KOHA 3J80U 4TY8B 3CPWR 2NYHA 3K5PA 4OHWA 3M8RA 4QOTA 2XMJA 2WRMA 5DDOC 3DLJA 2J5AA 1FI4A 4HH0A 4Z37A 1TKZA 4PABA 4K0KF 5IFMA 3THTA 3MMJA 3B4DA 4GKKJ 3IG1B 1QAJA 3IGNA 3PRBA 2BQUA 2QMUB 6FD1A 1FKOA 5BYQA 2XHCA 2Q6BA 2K06A 4GO7X 4MKVA 2OPRA 2IVFB 2XZTB 4R8UA 4F4XA 2J0XA 1D09B 5CYMA 2VHGA 3D67A 3KLGB 2UXDF 5GAHI 2P9EA 1JLAA 4OV6A 2K7JA 3PX4A 1KEKA 1EARA 1P1TA 4O3OA 1SJFA 4DV3J 2E5IA 2RAQA 3TUIC 2Z57B 3GYXB 4IYQA 5A6WA 1X4AA 4UZBA 3I31A 1FDDA 2CPJA 3EZ5A 2KYXA 2J9DE 1N52B 1S0VA 4O23A 4QIFA 2UU9J 3N28A 1PC5A 4CH0S 1FD8A 4M1KA 4DR4J 1C1BB 2J7UA 4PPDA 1QE1B 4GVBB 4X84A 1QVFR 2C3MA 5B0AA 1WWHA 3DM2B 4DQRA 3K5NA 4RW9B 2QV6A 3QFWA 1UETA 4RO0A 4ED7A 4C7QA 1PJ5A 4YHHJ 2WAQD 4CCHA 5GADU 1J27A 3BDEA 2ZM6F 1X9MA 1XEZA 3OXFA 2W9BA 4DXLA 4GKJJ 1HMVB 3LPEA 2QGFB 4DU8A 3LA0A 3HO1A 3NS5A 3ZNUA 1LK5A 3BSAA 4DS5A 1J5OA 3NGSA 2QE5A 2MMYA 1FTRA 2QLBB 1VQ8S 4Y65A 4JI6J 1X5TA 3R2DJ 3QRRA 2EWHA 2ZUGA 1U1PA 2EBEA 5HLFB 3BB5A 3K8VA 2Z2ZA 2IBOA 5EX0A 4OZ3A 5KG7A 3R2CJ 2BE9B 1H2UX 3GJTB 1Q53A 3V5RA 4LFCF 1SXLA 2KDOA 3SEOA 3PO4A 5KT7A 2ZH1A 3CEDA 5A2QU 4RLEA 2DGTA 3KWMA 3NOCA 2HQFA 5G4DA 4EYIB 3LAMA 1R8HA 1X4DA 4QWDA 3B54A 4JI1J 4USVA 4CLZA 2V6AA 2AJFE 5H9EJ 2XO7A 3DGPB 4I4BA 5D4NA 1SH2A 1S9EA 2GC8A 3V81B 4RKUC 4Y2IA 2L9WA 4AE5A 2W9CA 2GGPA 1I51B 1WF2A 4J9VA 3HD1A 1IKYA 2D3O1 3NL0A 5LXRA 2DGXA 1F9EB 1T03B 2YKNB 1WI6A 2KHDA 4IH7A 4K2XA 4CO3A 1FERA 1SIWB 3DLBA 2J9CA 1GAOA 1DLOB 2XMTA 2KZMA 4ZPVR 1QSYA 3TX8A 4EBEA 2DGUA 3MWBA 4ZCIA 2MKJA 2ABYA 1RT6A
chains in the Genus database with same CATH topology
5EWGA 1PO6A 1U6BA 3BGRA 3QPIA 5HLFA 2DGOA 2E7XA 5KT4A 5CYQB 2E1CA 4P6QA 3PO5A 5DDQC 4OZ5A 4C3MA 3E2EA 3BS9A 3PKYA 1TQLA 3CE8A 1C0UA 4R5PA 3RAQA 5J2QB 1ZTWA 3OFGA 2MSSA 2AJ1A 3OXLA 4F50A 1HBNA 4ECSA 5F41A 2H5EA 2DVIA 4OZJA 2FHOB 5A8WA 4W90B 5A8RB 5F8JA 2XLIA 1PSDA 3NGKA 2E9TA 2IAJB 5AE3A 5DQHA 3Q0AA 2U2FA 3QYYA 4KFBB 3PV8A 3JSMB 2HG4A 2Y0SD 2YTCA 4NL5A 3JYTB 2KXHA 1GTHA 2NUUG 2O1PA 3K59A 3WC2A 4JI1F 2APOA 1VBZA 4HT5A 2AV5A 4NLOA 5CZXA 4ZVHA 2DHXA 4KT0C 2J8AA 2HFNA 2DGSA 2O01C 2HHQA 3KYLA 2VL1A 1SIZA 4DSIA 2NPFA 5I3UA 3D0GE 1DAXA 4TLRA 3U1NA 1Q79A 1R8AA 2E29A 2CQ0A 1M5PC 3AB4B 3DGPA 4Z2XA 2PI4A 2X51A 4IDKB 3IS9B 1K1SA 4LUBA 1S6PB 2BQ3A 5KFTA 2PN6A 2RU9A 3BQ1A 3V81A 2BJDA 3TAMB 4QZVB 2FVQA 2ZOFA 2JVOA 2PDAA 4A48A 1NJYA 2GFFA 4DX8H 1JLEA 3QJLA 4PG6A 4ZPBA 5E0OA 3LP1A 2J0WA 3F41A 3CTRA 4IFYB 3O2IA 2ZH9A 5AXNA 2ADBA 3OL7A 1O51A 4Y3CA 4U7CA 2K2PA 3AA9A 4OI3A 1XK8A 2YWGA 4K4XA 3MPWA 1VQ5S 2W7AA 3U1MA 1NJXA 2O5DA 3HHLD 2VFTA 4DDFA 3JTOA 4MMOA 5KFBA 1IJFB 1T03A 1HW8A 4N47A 4Y2AA 3R3TA 2YKNA 4QIVA 3TUZC 3CJ0A 2L41A 4F3OA 4YB6A 3GFHA 4N77A 4C4WA 1HQUA 2CQBA 4M5DB 2K8GA 5GAHU 2RDIA 2HFOA 5IQ6A 3PACA 1DTTA 2VG5B 4KHMA 3SCIE 2YNIB 4ECVA 3PM9A 2R7XA 1NKBA 3CC7S 4RX6A 1IKWA 1N5YA 4O4GB 2UVUA 4NLSA 1MWZA 4KGMA 2X1FA 1DLOA 1D9AA 4URGA 2E9RX 3OBIA 2RILA 2ZH8A 1X7VA 3IN5A 3KK2A 1A9NB 3QWPA 2JZ5A 2IYGA 3L95X 2C2EA 4TQRA 1WHXA 4ZPTR 1DTQA 2MKCA 3BSOA 1JLGA 4TN2A 2MQPA 1SKRA 2RS8A 3AB2B 2XB2D 1IBKF 4JI7F 3MAHA 2BOPA 1XR7A 4FF1A 2MQNA 4ED2A 2XSJB 2WBRA 3JAMY 1TVRB 4KAIA 2KI2A 1VRTB 5BR8F 3BGUA 1RT4B 4JI3F 1V9OA 1F5AA 4DV7F 4JI8F 5B0FA 2J9EA 4TU9A 5CYQA 1TFWA 4O3NA 2C3YA 1WHWA 4C98A 2YVSA 3I6PA 3G4SS 2WB4A 4NLRA 3MUMP 2VPYB 2QA2A 5CZVA 2N4DA 1HNXF 5E41A 1HD1A 3O1LA 3C6UB 2MHNA 5B0DA 1R43A 3LP2A 5J2QA 3JSRA 1N0UA 3RB3A 1YWXA 1TL1B 2YX7A 1UVIA 1VHFA 3H5UA 3L3CA 4I64A 4FPRA 4IO1A 5A8RA 2HAIA 1U1RA 3KLHB 5L1KA 3K2YA 2IAJA 1S77D 2ZOGA 3LAKA 3CVKA 4KFBA 4ZOSA 2GX8A 3JSMA 3K57A 3JYTA 2DNHA 1NHUA 1U1NA 4EU0A 2R7UA 4GC7A 2UUAF 3VAKA 1GQEA 3ULHA 2GMJA 4DOZA 2FLLA 2JEIA 1KTVA 2W7OA 3PFEA 2CRLA 3BSCA 1S0OA 1LKZA 1LXNA 1M5HA 1OQ6A 1UFLA 4A4JA 2OSRA 2P6SA 2AX0A 3QGHA 2E5LF 3ENVA 1XERA 1XWLA 2BACA 2ZDPA 3NCRA 3M8SA 1QUVA 2GV1A 2QSWA 4JI0F 1AW0A 2VFUA 3EXYA 3IWNC 1U2FA 1OWXA 5GVQA 3W3SA 1WACA 2LLZA 3IS9A 4IDKA 3HVTB 4N76A 1S6PA 1TKZB 1WELA 3R1LA 3OTBA 2PEHA 3TAMA 2KFZA 2LXFA 2YNHB 1FRHA 3JTPA 4PXEA 1GXUA 1QTMA 2B4OA 4MJKA 2FHMA 4I6YA 4IFYA 2XY5A 4V19X 1PGZA 3DLLQ 2IMWP 5DETA 3BO3A 2BANB 3MPYA 2LU1A 2VQEF 1ZTTA 4Q2LA 1RKIA 2XS7A 1CVJA 2CIMA 3IRXA 2QA4G 2Q1LA 3M2RB 5KFXA 1RT3B 3MR6A 3JB9k 2AYGA 2UUBF 2KG1A 2D74B 2EFOA 3KJVB 3EPGA 2CPYA 4XIUA 4ZCKA 1W2IA 3GIIA 3ISNC 2KRBA 1NJZA 4W92B 2UUWA 1P1LA 2V4RA 1FKOB 3AQPA 3MEEB 4FXVA 4NA3A 3H5XA 2FIUA 3G8TA 4M5DA 4FNIA 2DNYA 4BC7A 4URSA 5KT3A 3TO8A 4G6VB 4CO2A 1YHQS 2JOQA 5J1NA 1F60B 3V6KA 2FJEB 2YNIA 3N6NA 4I67A 4FP9A 4O4GA 1J5EF 4F67A 1CC8A 3MM7B 4J9KA 1OSDA 2GMHA 5I3QA 2FUG9 1UWBB 5L1JA 2FB0A 2W4PA 3M32B 4YMEA 4YB1P 3EX7B 1U1OA 2IVYA 3FZBA 3DU6A 1U7LA 1R0AB 4MTPA 2RU3A 4RW4B 1C4AA 2EFQA 2A18A 2C3UA 3Q8SB 1K8AT 4OI2A 1D1UA 2AYBA 2W8LA 2W4CA 1AROP 3VAIA 1M5SA 4K4SA 4CO1A 2DITA 2XSJA 1TVRA 4AQYF 3CSKA 3G6VA 2IRXA 2PT0A 4OZ1A 1VRTA 1RWUA 2ROEA 3CJ5A 1RT4A 1TFYA 4TU7A 1ULRA 3LUYA 2BVZA 1FDBA 1WTFA 1Y3JA 2EK1A 2ZKUA 2ZJPQ 3DI6B 3IA0A 1QVGR 3SCJE 2QEXS 1RDRA 4XPEA 5GAEU 3MM6B 3R1HA 4NLGA 3C6UA 1YSJA 1UVMA 2FLOA 4ECUA 4EBCA 1VQ4S 4PQAA 1Y5IB 2DTJA 1T3OA 4KIAA 3HJFA 3IR5B 1TL1A 4U67Q 3CDWA 2WBMA 2V94A 2W4DA 3KLVA 4IG3B 2VKRA 3M8QB 3SZ2A 1U47A 4MKYA 2PSZA 2UVVA 4O4RA 1CLFA 3KLHA 5L1IA 4LQ9A 2KU7A 2LDYA 5AXKA 1T3NA 4NRUA 1N36F 1CEZA 1TK5A 3I82A 3TP2A 5M2PA 4RW7B 3CO9A 2HHTA 3BZQA 2VFVA 3GFXA 2GHVC 3CMES 4CTAB 5DRKA 2CJQA 1QSLA 4IR1A 2BW2A 3I0SB 1BGXT 1LFPA 1IKXB 3TQ1A 2HYIB 4NWBA 1NB7A 1U25A 3AHPA 2YWEA 1JLBB 4YFUA 3B78A 4DR1F 4CO5A 1FNOA 3G6ES 4DSFA 4BWMA 4LIRA 3HFKA 4BDPA 3MEGB 3HVTA 4Q44A 1JNZB 1RISA 1Q7LB 4DFKA 3ZZOA 5FJ4A 2W9BB 3N6MA 2YNHA 3ZZZA 1TKDA 3BR8A 3QJJA 5EX3A 1JNRB 4ECTA 5AJ3F 4DL3A 2HNYB 2BANA 3HKWA 4A8XA 4K4WA 3CB4A 5HBMB 2LEPA 2YKPA 3M2RA 1V6HA 1HI0P 1RT3A 1NNDA 2MZRA 2R7OA 3PEJA 4OMFG 2B4PA 3ZZPA 2E7WA 5KG6A 4Q43A 1N5TA 3KJVA 1LW0B 2E1RA 2PIIA 1S9FA 2PC6A 2COLA 3H20A 1OQ3A 3RTVA 3J7A1 3GE9A 2R8KA 2HS3A 3MEEA 5F9NA 2MGZB 1SC6A 2ATLA 2Q43A 2FC8A 4ZKAA 2ZZNA 1U49A 1YRUA 1RYRA 1LW2B 4TYBA 4N56A 3KK3B 1KHVA 4AXIA 1MMDA 1TAQA 2EFPA 2HHHF 3DOMA 3IO1A 2XS5A 4IG0B 3MCSA 2BDPA 2VFRA 3FGVA 4NLYA 4ALZA 4A8YA 1XR6A 4QWAA 4YR3A 2ROPA 3MM7A 4X65F 1ZAVA 3OJUA 2HQIA 1UWBA 2E5GA 2DRBA 2F8MA 3M32A 1KSPA 3DLGB 4B9UA 3BDPA 3T6BA 2OTLS 3D1OA 5KFKA 1R0AA 4RW4A 4I2PB 2ZFHA 2PMZD 2FDNA 2FC9A 1ZZFA 2B51A 3KNGA 4Y28C 3BR9A 3KHHA 5LXYA 3HMJG 3T5KA 2VOOA 4ED5A 4JV5F 4OV1A 2VG7B 4RNOA 1FO1A 4I68A 3MAQA 5IT9Y 4UOCA 2ZKTA 1KN6A 3CCTA 1CC7A 3MXHP 4OL8A 2B7BB 5CH7B 5KG5A 1JLFB 1RT5B 1TAUA 4X4VA 3DI6A 1RA6A 5CYJA 1FKPB 5DG9A 1R7IA 3CMAS 1Y3KA 4C9DA 1LWEB 3MM6A 3CCUS 3UNGC 2YKAA 2B4VA 3QZ8A 4QIGA 3GV5B 5DM7Q 3QGPA 4DEZA 4RNFA 3LWMA 2G0CA 3KFWX 1AUDA 3KNAA 2RIJA 4FS1A 4DL7A 3OSPA 2OTJS 4YB7A 5B0EA 2BQRA 4NA1A 2RS2A 1X4FA 2POKA 2ACYA 1IM4A 5HMXA 4ELTA 2XWYA 4IG3A 1WEXA 3M8QA 3UFCX 1KQFB 1AFJA 1SH3A 3M8PB 1S6QB 4U6PA 3NS6A 4I6WA 2DGQA 5KFSA 1TL5A 1Q8BA 5KFZA 4J37A 2XLKA 4JI4F 2UUCF 3THPA 4I1TA 3BREA 4BWJA 2WSEC 5I3PA 3HXMA 4CQ1A 2KB2A 2C3OA 2M88A 1N88A 2F3JA 2IM2A 4K59A 3V6DA 1TK0A 1S0NA 2FGOA 4RW7A 3ZZRA 2PMHA 1RA7A 2UVRA 1FEEA 3C8YA 1JKHB 3SSSA 4KHPF 4J9RA 4X4QA 4ZPCA 3I55S 3SV4A 4CTAA 3OFFA 4E8UA 2BM0A 3I0SA 1IKXA 3ITHB 3TOQA 2D1CA 3HZEA 2PE8A 2O67A 1M0SA 1JLBA 2PI5A 2AJQA 2EI5A 2X3GA 5EN1A 4ECXA 2DNPA 3MEGA 1X4BA 5KFFA 3OTOF 4KV8B 4QU7A 5LMUF 5F9LA 1VGYA 1AXQA 1LQ9A 5DLGA 1C2PA 2HVHA 1NU4A 4PWDB 3OW2R 4ICLB 4OI0A 2LXIA 5HN0A 1VQ6S 1X5PA 2HNYA 3NP5A 3Q2TC 1U4BA 5CA5A 4EWTA 2V4JB 4TLQA 5DQGA 5HBMA 2R7WA 2MZQA 4Q2MA 1VQPS 3DXBA 1LW0A 4FZVA 1UEUA 3PDNA 1S0MA 2KRRA 2M52A 2E66A 3GV7B 2FLNA 2A1BA 2DNLA 3M05A 3NBPB 2VA3A 1ZM2A 2PGCA 4FF4A 2P9CA 1CQMA 3GFZA 3OVAA 2MGZA 2ZH2A 3MDFA 1LW2A 3KK3A 2JDJA 1VQNS 3MGJA 2KXNB 2BBEA 2P5VA 4IG0A 1X0PA 2OSQA 2VC0A 4HTJA 3A1YG 5KG3A 2DNQA 2J6UA 3MEKA 5K14B 5A6PA 2KH9A 2HS4A 1MWYA 2N4CA 1MROB 2MQLA 6FDRA 2XGQA 2ZDOA 2Y1RI 1R27B 3G71S 2ZC3A 3VALA 4FN5A 2LDIA 3DLGA 5D8HB 4IUFA 4QIEA 3I9V9 1BC6A 3HT3A 4B9LA 4OZNA 2ASYA 2JFDA 4F3MA 1MMNA 4I2PA 3I4HX 4P7TA 3M4XA 4JV1A 1Q7YT 2AGPA 2HVZA 1X4GA 1P8GA 4Q7AA 3FQKA 3G6XA 2HGLA 1YRXA 4TYAA 4A8OA 2VG7A 2HLUA 3GILA 2OPPB 3HHEA 4UUWA 2Q79A 1TKTB 3G8SA 1FK9B 2QLWA 3HK2A 1NKCA 1N0VC 5EWEA 5K8MA 1JLFA 1RT5A 4NPOA 1IBMF 1NK4A 2IRYA 3GB0A 1FKPA 3H25A 3UCUP 1LWEA 2KO1A 2WHOA 4LF6F 1C0TB 2HHWA 1N4LA 1BD6A 2QYCA 4R0EA 2DNRA 4HEA9 4DR4F 2HHXA 2KJWA 3GG0A 4LVOP 4NLWA 3TI0A 4JUZA 4CIOA 3RW6A 3MTJA 2J7KA 2UV8G 3GR1A 1N56A 1B0PA 4PG4A 3WDOA 4DFPA 2EW9A 4RUCA 4NCBA 1CPZA 3M8PA 4FVMA 5E3AA 4LSLA 1NHVA 1P9QC 2C28A 3MM9B 2MPUA 2RD5C 3QJPA 3RBEA 2GQCA 3Q8QB 1OPIA 3KLIA 1JKHA 4ZCLA 1XNQF 5KFYA 2HPUA 1NAQA 3EXCX 2CQPA 4ZS6A