1N5TA

Crystal structure of a monooxygenase from the gene actva-orf6 of streptomyces coelicolor in complex with the ligand oxidized acetyl dithranol
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
112
structure length
112
Chain Sequence
b'AEVNDPRVGFVAVVTFPVDGPATQHKLVELATGGVQEWIREVPGFLSATYHASTDGTAVVNYAQWESEQAYRVNFGADPRSAELREALSSLPGLMGPPKAVFMTPRGAILPS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ActVA-Orf6 monooxygenase
publication title The structure of ActVA-Orf6, a novel type of monooxygenase involved in actinorhodin biosynthesis
pubmed doi rcsb
source organism Streptomyces coelicolor
molecule tags Oxidoreductase
total genus 26
structure length 112
sequence length 112
chains with identical sequence B
ec nomenclature
pdb deposition date 2002-11-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03992 ABM Antibiotic biosynthesis monooxygenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.100 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1n5tA00
2QLWA 2ACYA 3FMBA 2OAUA 4NPOA 3TNVA 1JWWA 3DCAA 4Y2KA 2ROPA 5B0BA 1P8GA 3HX9A 5T7LA 3T9NA 3BM7A 2FHMA 2IYGA 4U9RA 5B0AA 4ZOSA 2HQIA 3FRYA 2IYIA 2G9OA 1TL4A 1IUJA 2HFNA 2OD4A 2GFFA 2Q3PA 1AFJA 2RILA 1SI9A 2VV5A 2GGPA 2OP5A 3HF5A 2XMWA 4YDXA 1YJUA 3UDCA 1AW0A 4HH0A 3DXSX 1APSA 1TUVA 3K7RA 2QYCA 1OQ6A 3E8OA 1MWYA 2W4PA 3GZ7A 4A46A 1K0VA 2ZDOA 1W2IA 3HDSA 1QUPA 1TR0A 1N5QA 1MWZA 2HLUA 3BGUA 3BR8A 3HFKA 5T7LB 1Q4RA 2K1RA 1YJRA 1P6TA 2GO8A 5A6PA 2AW0A 4FNIA 3KG1A 3QMQA 3LO3A 2RMLA 1URRA 5B0CA 1N5VA 2KT3A 4OJHA 1N5TA 2QLXA 4A48A 5KAKA 2HIQA 1GXUA 2GA7A 2ROEA 2XMJA 5IXUA 1WD6A 3KNGA 3HHLC 5F0WA 3TOQA 2LDIA 1S6OA 2ZDPA 3MZIA 4DL0C 2AJ1A 5B0GA 1CC7A 1OQ3A 1FVQA 1Y9OA 2OFGX 5F0UA 2GCFA 1XBWA 1FE4A 4NL5A 2N4CA 2PGCA 5B0FA 2OD6A 2AJ0A 3MCSA 4EFAC 4FNHA 2BBEA 2BJEA 2PD1A 2XMVA 4OIXA 1KQKA 2K7KA 1KVIA 4OJGA 1SQEA 1Y3JA 2N7YA 5B09A 2KT2A 2VH7A 5B0EA 2BUNA 2BJDA 2HLTA 2IFXA 1N5SA 4Y2MA 3CJKA 3TRGA 1FEEA 3VTIA 1CPZA 1VQSA 4A4JA 1YJVA 2ASYA 4HI2A 2LQ9A 2KKHA 1X7VA 2GGPB 2XMMA 1V3ZA 1X8DA 2W4DA 4HI1A 1JK9B 4Y2IA 3BN7A 1R6YA 1RJJA 4Q2MA 2W4CA 2JDJA 1Q8LA 3KKFA 3FGVA 2L3MA 1AFIA 5B0DA 4F67A 1FVSA 3IWLA 5A6WA 2FB0A 2AP6A 4A47A 5B08A 2K1RB 1LQ9A 3WDOA 1GXTA 2FTRA 2RSQA 2ROGA 4OJ3A 2XMUA 3LGMA 3HHLA 1VQYA 1TZ0A 4YEAA 1FE0A 1S6UA 3KG0A 3CJKB 1YRXA 2CRLA 1Y3KA 2EW9A 2KYZA 2K7JA 2OMOA 1YJTA 3IWXA 2LQBA 4OJ1A 1KVJA 2XMTA 1FESA 2QIFA 1TL5A 2K2PA 4ZA1A 2RU9A 3F44A 1FD8A 3BB5A 2GV1A 1Y0HA 3QGPA 3BDEA 1CC8A 5K9FA 2OKQA 2XMKA 3BF4A 2FIUA 4HH1A 4DPOA 1YG0A 1Q53A 4DN9A 2HFOA 1SB6A 1X0PA 2LXFA 2OFHX 3HHLB 3HHLD 2BYCA 1OSDA 3I9ZA 1OPZA 1Q8BA 2N4DA 3LGNA 4Q2LA 4QOTA 4HL9A 1ULRA 1U7LA
chains in the Genus database with same CATH superfamily
3DOLA 3MUMP 1IBKJ 4FVMA 3CCUS 3W60A 2ADCA 2CPYA 2XO7A 2ZZMA 4GKJJ 3WIUA 2G9OA 5L1IA 3OD2A 2MLXA 2ZE2A 2OP5A 2ZJPQ 1ZETA 2DHHA 1T8EA 4C8KA 1RYRA 4L72B 3H0PA 3O5TB 4AXIA 2PMZD 4I0WA 4ZK7M 4DZDA 4WKRA 2VQEJ 3R7NB 2GO8A 3R7SB 3I9V9 3BSAA 1Q81T 2H5IB 1S6QB 2MGZB 3OLBA 4ECVA 1UPMB 3JSRA 3I96A 1S9FA 2KTQA 2H5JB 2N3LA 3Q8YA 5HJXA 3I82A 3GJSB 4CCHA 3MMAA 4R8UA 1RJJA 4FN5A 2EBGA 1CJUB 2A0FB 2IC3A 2KM8C 1JQGA 1YRXA 2MSSA 4C0OC 4I64A 4RW8B 3NRBA 1XMQJ 1FD8A 1RTDB 4DN9A 4Q0BB 4ILMA 1HNVA 1DLOB 4X65F 2M7SA 1RHQB 3BJYA 4U9RA 1R43A 2J0XA 4LT6A 1X5TA 2XZWA 5HVHA 2B56A 2ZOGA 4UTGA 3KOAA 1RCXB 2VFTA 4B3MF 2V2QA 4DPTA 2WONA 4FBTA 3CGIA 3CULA 4PZVA 4NZ7A 2HWTA 4EI2A 2XO6A 5GAGU 4F4KA 3RW6A 2RF2A 5KFMA 3UCUP 4OLPA 1FKPB 3D66A 3LAKA 2OPPB 1RZMA 1KWMA 4PG7A 2XHCA 1BHNA 4I69A 2GZOA 4X4QA 2BKOA 1AB8A 1H74A 3PXGa 3W64A 1SCJB 3CEDA 1FESA 5AE2A 2LEPA 1UVIA 2ZNYA 1TKXA 2DNMA 2W2QP 3TVKA 3PDNA 2IVMA 2COLA 4KV8B 1MROB 1ELOA 2YKNB 2R8HA 3MM7B 2EFNA 3HMJG 4I68A 4C48A 4IR9A 3SFUA 5A2QU 2XSJA 3AD9C 4KSEB 4CT8A 5M2UA 4X4TA 3KHHA 4DR4F 3I55S 2HNZA 4ERDA 3K5LA 4DSIA 1EAYC 4B3OB 3Q8UA 1C0TA 2OFGX 3LOUA 1HPZB 1MN7A 3ZZTA 3VTIA 2LQ9A 5KG6A 4HI1A 5HROA 3EXYA 3ZZUA 4ZHRB 5DG7A 2QTWA 2Y0BB 1PGZA 1MN9A 1GX5A 3GJTB 1I51B 4GVBB 3TX0A 3DOMB 3IRXA 2MXYA 3CVKA 2KXNB 1MLAA 2FZGB 2ADBA 4EK2A 2MGZA 3MCMA 1FJGJ 4D3HA 2KM8B 3SV3A 1WG1A 3U1NA 1T94A 2I1RA 2VV5A 3GONA 4C98A 5D0GA 2C2NA 4KYZA 3I6PA 1TR0A 1MWZA 2HK3A 2HRTA 5KFEA 2Q1LA 1VGYA 4R5PA 3KG1A 4JV5J 1SJQA 4RW8A 1FJ7A 1QE1B 1TMMA 5DDRC 1Q7LB 2P9GA 4E0DA 3L7OA 4CI0B 4AXJA 1RTDA 1QDUB 1QD1A 2VBYA 5E3AA 3TI0A 4B08A 2LA4A 2KG1A 2BE7D 2R9LA 2MKKA 1RB0A 1DLOA 1RT4A 4B9SA 1GMVA 3T5LA 3OL9A 1UW4A 2DK2A 2CQ3A 4LSZB 1GTEA 2PSZA 3CDEA 3PRDA 2RSQA 5LM7E 1H2UX 3ILJA 4JI3F 1SPBP 3DOKA 3FDSA 5LSLA 4C11B 5GMKa 3D0GE 1DAXA 2EFGA 1IM4A 4QWDA 4ECZA 2FD2A 2CQCA 4WU2A 3WIVA 2J9DE 2J0WA 3R6GB 2NPIA 1VLOA 3G6VA 2ZBPA 1QJHA 1FKPA 1MW7A 2VQFF 3DC2A 1S48A 4J9QA 2MZJA 3D6HB 5KFZA 4ZPTR 3W7BA 4DX8H 1YJRA 4C3MA 5BYQA 3VGTA 3CJTA 2H51B 2IA0A 5KFNA 5ADZA 4ZPVR 2DGQA 4QYZK 5IXUA 1Y10A 1NUEA 3QSIA 3BGRB 2HBRB 2ZVIA 4ZLJA 1VDHA 2IJRA 1G1XA 1MROA 4PPZA 4J9OA 3MM7A 2CNKB 3GCXP 2EPIA 2XNQA 4URSA 3V81B 1F9EB 3PFEA 5CYMA 2CFXA 2UXCJ 4FVCA 3L4BC 4DFJA 5HMZA 5E2QA 1S0MA 1OSDA 3LP2B 4B3OA 1VIXA 4K4TA 2VONA 3G8TA 2HHPA 2FLNA 3CDWA 4ED8A 1BC6A 1X4CA 2DHGA 1TL4A 2OD4A 1TK0A 2QA1A 2KL8A 4ZHRA 3W63A 2FYXA 2AGPA 1NXIA 3M8RA 1N5TA 1UAWA 3EDRB 4CM0A 5T14A 1UA1A 5CAAA 5AXKA 3NXZA 1U1KA 3DYAB 3V6JA 1X4BA 4A8WA 3UCZP 2EVZA 1CEZA 4CDIA 4NYPA 3OVBA 1N48A 3KJFB 2CJXB 3R3TA 3EVMA 2C42A 2WOMB 5B08A 3B82A 3WZ0A 1FNMA 1Y3KA 1IJEB 2YWHA 4LRCA 1JLAA 3CPWR 1JKHA 4F0HA 3QWPA 4V1Ak 4DQRA 3UR3C 1IQZA 3OV7A 1QE1A 1T95A 2UU9F 4J9NA 5IQQA 3FFIA 4XDCA 3CXCR 2FGCA 2BANA 1GXLA 5MLCV 1RI7A 1X4HA 3UNGC 1QLNA 1WDDA 4Y0FA 3NMAA 2QLBB 3CJRA 3T1YJ 1VISA 2ASLA 3B6BA 2XS5A 1W26A 4C11A 3RAMA 1GMWD 3R5BA 4X64J 4OZ3A 1S6PA 2KJWA 1B3TA 5KFFA 1XNQF 2PMHA 2R7XA 2Z8QA 4KB7A 5K5MA 1RHRB 2HEKA 3B4DA 1BWEA 5KFDA 2C3YA 2BABA 1U1QA 5KFWA 1A6LA 4M5NA 4C9DA 2ZVSA 4PQUB 2CA9A 2DY9A 2F40A 1T9YA 4KHPJ 1RWVB 4DI6A 1FO1A 4P10A 2X7IA 3CNQP 3AB4B 4NA1A 4KFBB 3BGRA 1WHXA 4MIAA 4TYBA 2JLGA 1JLGA 6AT1B 3SI8A 4DQIA 1JJ2R 3C66A 1XC9A 1Q95G 9RUBA 3FUYA 1A9NB 3VHQA 2IHR1 3QT8A 4OV6A 4JI7F 1MWYA 2D69A 2ZZTA 3M6VA 4HEA9 1Q4RA 5KG0A 2VUGA 3V81A 3J7ZT 1IBLF 4TY8B 2XSFA 2UUAF 5AE1A 5KAKA 3D28A 1BQMB 4NLDA 2ROEA 5IT9U 4USTA 2YXLA 5K8NA 2VG7B 2IPOB 2HZCA 5A8KB 2IBOA 4NLUA 1IWGA 1I94J 1Z2ZA 4O3SA 1AFIA 3IWLA 2H65B 2DPJA 2IVFB 3LGMA 2D1CA 1SIWB 3IWNC 2ZFHA 4CLWA 2WVBA 4H4MA 3L7PA 1TL5A 1VK3A 2E5JA 2V5HG 5U47A 1Q78A 1K0TA 1JXVA 2J7KA 2YWWA 4MAKA 4ZP8A 1CJVA 4QOTA 4M5KA 2OPRB 1N32J 2UUBF 1FRMA 2CJKA 4P72A 1Q8KA 3TO8A 2PDAA 1APSA 4JYAJ 1ROFA 3M05A 4ANDA 4UOCA 2WOMA 2R8IA 2BRLA 2FY8A 5GAHU 3RYLA 2RMLA 2CNLB 3TUJC 3PW2A 3QJJA 2C2ZB 1XN9A 2CVEA 2MHNA 4B3TJ 2OGUA 1HFEL 3H4DA 2VD3A 4IH6A 1S1WB 1SBRA 5B0EA 3GFZA 1SL2A 3TX8A 1UJ4A 4M94A 2BJ8A 3IR7B 2OEKA 2UXDJ 1SVDA 2H3EB 3W2VA 3TJAA 1JLFA 5HATA 4F7VA 2DR9A 4LF7F 3G2XA 3TUIC 3QAUA 4MKVA 2Y8WA 1O5JA 1NH7A 5E3PA 3ICLA 2GHWA 3U7JA 4IDKA 2DGWA 1U1OA 5L1KA 1PJ6A 4WK1A 4M5MA 3TNVA 3JAMY 2AWZA 2HHHJ 2HQGA 4AQYF 2KG0A 4Q8FA 3N0VA 4KRWA 4RU2A 4CNZA 2QV6A 1LWCA 4NXNF 3UDEA 3SMZA 2VG5B 3T1HJ 4HT7A 2LDYA 4FYXB 3Q2SC 5F9LA 2R7VA 4DEZA 1GXUA 5DDQC 1HBUA 2HW3A 2XYPB 3GWCA 4ZCMA 4DV6F 1UW9A 1W7WA 2RHQB 1H38A 2AQ4A 2E5GA 3SDEB 3P45B 2HGMA 1FXDA 5J1EA 3BO2A 1WOOA 1FJEB 2F4VJ 1NSPA 4Q2MA 4MH8A 2NYIA 3OPKA 5HMXA 4CTAA 4KC5A 2RVJA 1B0PA 3QGGA 2B3TB 3M9NB 4ED5A 4ED2A 1HQUB 1HWUA 1RAEB 1RLCL 3VCDA 2AEMA 3DGPB 2ZD1A 3JSMB 2UVVA 2Z2YB 2VG7A 1XR6A 3R2DJ 4OI2A 3TJ9A 3MAAA 3N79A 2CNNB 4O4RA 4LBPA 3DLLQ 3BR9A 3NLCA 2QL9B 4NASA 1EQ0A 2QMWA 4RBUA 3ZZ0A 2VKRA 3KXDA 2W8LA 2D7SA 3VGSA 4K7QA 1GH8A 4K4YA 5EX0A 3BGLA 2AZ3A 4ER8A 2V9KA 5T7LB 3RBDA 1KBRA 2R7RA 3ZTQA 3FQKA 1VRUB 1NK7A 1HHSA 1SKWA 4IH7A 2PI4A 1HYSB 2HVEA 1JNZB 4O3QA 4U96A 2DYAA 2Y1JA 4LRBA 2HQCA 2M8DB 1UFWA 4A4JA 3ENAA 4KPCA 2ZH2A 4X4SA 1RP5A 4DPXA 2HHTA 2XGPA 1KHWA 2KO1A 1DRZA 4QU7A 5KFQA 3T6BA 2XWYA 1T9UA 3AOBA 2IM0A 1K1QA 3M6WA 4P2MA 3I56S 3G96A 2AX1A 4FPIA 2DT9A 5KFKA 2VU5A 2APOA 1S1WA 3C15A 4DR6J 2OTLS 1AFJA 3CCVS 2ZWPA 4M63A 4K5RA 3O8WA 4TQSA 5CYJA 2DTJA 3CIZA 4NRTA 4P2SA 3P49B 5IV4A 5KT3A 1HW8A 3EGZA 3J7Z5 2NS1B 2KDOA 2IRYA 4GRSA 4TN2A 4E8UA 3FSYA 2AX0A 2KFNA 2MZTA 4N7TA 1B70B 2HHVA 2J7UA 3HM9A 4JUZA 5D0RA 1FWLA 2XLKA 4LQ3A 5IM0B 4X65J 1B0VA 5D4LA 3IA0A 1WKKA 4ZJOA 1WC4A 2DNLA 3QJLA 1UFKA 4H4KA 4X66F 3KG0A 3UVJB 2GMHA 3AQPA 1RT1B 3NOCA 2LCWA 1X5SA 2OKQA 3IG1B 1F9FA 1NPRA 3HHLB 1XR5A 5L9NA 4DV3F 3RTVA 3FZ2A 3MEDB 5ETPA 1H98A 3U1LA 4IQXA 3SDEA 4FYDA 3K5PA 1C1BA 2ABYA 1OS5A 4A46A 1XTZA 3MM9B 3KK2B 3X3UA 4CLKA 1E6YB 2Y3YA 3ETOA 4BDPA 4U8VA 3W9IA 4DCJB 3OTOF 1RT2B 3BO3A 3ILOA 1C0UA 2HGNA 4M5IA 3JSMA 3RAXA 5LMNJ 3I5CA 3GV7B 4KGZB 2VA2A 4G65A 1IM6A 2HHUA 5CHCB 4USUA 1VJWA 3N6NA 1HBNB 4YR0A 1JK9B 1JB0C 1UTAA 4A8OA 4J7CA 5CYQB 1B4SA 2DBBA 3JQKA 5A6WA 1KDNA 1RT6B 4YY3J 2ZH4A 4KPYA 1WDTA 4ECWA 1VQKS 2QG9B 4WFZA 3TZWA 3GTYX 4B3SF 4I1TA 1TQLA 2FVSA 3MWBA 2KFZA 1OPIA 3I4HX 3SCJE 4B9NA 2LQJA 3CD7A 5D0EA 3H25A 2PC6A 1YX2A 1VI7A 5F8HA 3HCXA 2CQHA 3MCOA 2ZH8A 4DG1B 3QPIA 3CD0A 3JQJA 1AUSL 3H8YA 1PYSB 3KUHA 4RJVA 5D4NA 5B0CA 4ZCLA 1HMVA 2VFUA 4WFYA 1VQLS 3H2VE 2O1PA 4M5GA 1IKWB 4ED3A 1YVFA 2F7VA 2OELA 2OSQA 1JIHA 4LF1A 4YS2A 3TWZA 2IY5B 5GAGI 4CM2A 2VC1A 1FTRA 4LR9A 2DNOA 2VODA 3FZBA 3PX4A 2QLJB 3S7RA 3N28A 2DPIA 5LJ5Y 2L9WA 2W01A 1BY9A 3NG8A 2DH9A 4DPWA 3BKFA 4RNHA 5GVQA 1ZS6A 3OJUA 2ILYA 4JI2F 5J2PB 3DLBA 2DGXA 4WTYA 1H73A 4CLSA 2AYBA 2HVIA 1RHJB 2FUG9 4KQZA 4K4XA 1H7XA 4V19J 3TARA 4ETXA 3CF5Q 4B9VA 3UVJA 2FLOA 1D8YA 4AYBD 1HA1A 3CDAA 3IAS9 5I42B 2VPWB 3UR0A 3MEDA 2DIUA 1NJYA 2YWGA 4KGXB 4K8RA 2HURA 4H4OA 4IH5A 4LF5F 3D6MB 4F02A 4M5JA 2H48B 2BJ7A 2BW2A 5GMEA 4NE9C 1N6QA 4OJ3A 5KFXA 2ZM6F 2VQFJ 4EEYA 4EYHB 1R0AA 3NNAA 4Q44A 3KK2A 1JJHA 2FJXA 2UZAA 3I4PA 1RAFB 1YRUA 3K8VA 2YQ3A 2CPIA 4YHHF 4BC9A 2LMIA 1LXNA 2BE9B 5KFOA 3MMCB 4ZVQB 4ZLPA 2YNGB 5KG7A 8RUCA 3JSYA 5JXSA 3FBEA 3TA1A 3OTBA 2EXUA 4BWJA 4I2QB 3DRRB 4WFNQ 3PM9A 1AA1B 3GG0A 4YDDB 1RLDA 2PD1A 4ECTA 1NK5A 1R8CA 3AY0A 2ASYA 3GG1A 4QWAA 5C24B 4MK9A 4OL8A 3GP9A 1EP4A 3X1LB 2BJ3A 2C2RA 1NB7A 2J0QD 1GXTA 4DG1A 2GQQA 3P6YC 1RADB 3A8KA 1HQEA 2MHEA 3F0NA 2PO4A 5HSPA 1QVGR 4PG8A 2NXCA 2FLPA 3W65A 1LW0B 1HW9A 5ETOA 5J2QB 3CD5A 4HTIA 4RW4B 2HFOA 1BXNA 4DHVA 2DJWA 1IKWA 3EGNA 4ZVRB 1FX4A 4A8KA 5DG9A 2HVHA 1FT8A 3ENWA 2AYEA 4XIUA 3FBCA 2CPFA 5KTQA 3TZXA 1TUVA 2ZH1A 2B6AA 4AL7A 1HNIB 1MWQA 3R5CA 3H4BA 2DGVA 2E44A 2OH2A 3MECB 3UD4P 5IQ6A 1F3VA 4P7TA 4HDGA 3PEHA 3LP0B 1NHVA 1Q16B 4EBCA 3KLHB 2K06A 1NJZA 1ZZFA 5B09A 4IRCA 3NNHA 1Z1ZA 2EI5A 4LF4F 3ZTPA 3RAQA 1ZTWA 4IG0A 1WC3A 3FK4A 2CG4A 4MK8A 4CZCA 3OFHA 3MMBB 3M1VB 4I4BA 1NJXA 3TW0A 2IM3A 5KT5A 4CH1A 2E7VA 4ECXA 1T05A 2ZBQA 4ZN1A 2IMWP 5KT6A 1XMQF 4C8LA 1SH3A 1EHWA 1IR0A 4ED7A 2YPYA 2HQIA 3PFOA 1J2VA 3H5UA 3C19A 4CO0A 1XNQJ 3MCNA 4NLXA 4PUOB 1JLQB 5BXIA 4USMA 2MKCA 2WK4A 2MQPA 3D6TB 5JJBA 2GW8A 3M32B 3E01A 4A48A 2HS3A 3OLAA 1XMBA 3JB9k 1X4GA 1TL1B 3R2CJ 1DTTB 2RRAA 2H5EA 4BBYA 1FVQA 3M2UB 1WEYA 5B0FA 3U02A 2QLFB 1REGX 5H9EJ 2IVYA 1T9VA 4OX8A 1D9DA 5DG8A 1J27A 2GIFA 2MSTA 2GIQA 2QGFB 4DR5J 3MMCA 3RRHA 1G6BA 3V6DB 3IO1A 4MFBB 4JI7J 3ET6B 2O3DA 3MOJB 1RT7B 1TP7A 2XWXA 4DPOA 3JYTA 3RW7A 3DRRA 3SCIE 3LGNA 2F8MA 1B64A 3HSGA 3NWGA 3M2RB 4IYQA 4ZVEA 1FI4A 2RILA 5C24A 4NLVA 1AW0A 2DCLA 1AYEA 5IWAF 3CSKA 2QA2A 1VBYA 3SQGB 4KKOB 3J80Y 4RW9B 1UWBB 4ZP9A 1VS3A 1X0FA 1S79A 3PRVA 3OFGA 3CJ2A 1RISA 4M5HA 3RG6A 3ILLA 3MM5B 3FBFA 4WYLA 5J2QA 1TKTB 1IKXB 4RW4A 1X31C 3GFXA 3AXKA 3BQ0A 3H42A 2PMWA 2B7CB 4NA2A 3Q22A 4ZIWA 4EU0A 4X84A 2CZVC 1BQNB 3VVTA 4GC6A 4QIGA 1LQ9A 5HJYA 1NBEB 4OYMA 3DNCA 4U8YA 1HNIA 3IWXA 2FJBB 2KT5A 2U1AA 3EE3A 2AV5A 4LVOP 1Y0HA 1TKDA 4RW6B 3GYXB 3J7A1 3PG9A 3DRYA 2N4DA 5F8JA 2B5JB 3LP0A 2HIYA 1P8GA 4QPTA 3KLHA 5F41A 2V34A 3FC9A 4KGVB 2LEAA 4K50A 1ZA1B 3M1VA 3KK1A 2UVRA 4NYOA 2HSEB 5M2RA 4ZLLA 2DNYA 4S0MA 2DISA 2A1BA 4I56A 4RW7B 3DRSB 4OHYA 1VBZA 1RAHB 2MJUA 4OYOA 1U1PA 2H1YA 2HS4A 4W90B 2VG6B 3MEEB 3MMJA 5DS7A 5K8PA 4LIWA 2AP6A 2DCUB 4P6QA 2DNZA 2XGQA 2HMIB 2SXLA 3AA8A 2OMOA 3KTQA 2PE8A 4PYAA 4WFAQ 3G6YA 4HT5A 2L9DA 4OX9J 3D1QA 1DTTA 1JLBB 2ACYA 2UXBJ 4DDFA 2XY6A 2YY3A 2FZKB 4DL6A 4DV6J 1OSCA 4FXDA 3W3SA 5DJBA 3D4JA 1OY9A 2FHJA 5HP1A 3UDCA 4LF8J 4C0BA 1VBKA 3GSDA 4N41A 3CMES 4K2XA 3GYGA 1P27B 2L48A 3MR5A 1HLWA 2L9NA 4MFBA 3V6DA 3ET6A 3LPYA 3G6ES 2VPXB 3KLEA 4WXOA 4OHZA 3KLGA 5GAHI 3GIIA 5HQMA 2VOOA 3DLGA 3ITHA 2QA4S 2OMLA 2NXUA 3OT9A 1VHIA 4ZPBA 5KFHA 3K0JA 3WC0A 2IFXA 3MR7A 3UFCX 3W5YA 3N01A 3M2RA 4IFYB 1G7CB 4JI0J 3KKFA 2RB7A 2NREA 4NMXA 1KTVA 2KZMA 2EK1A 1UWBA 2VFVA 3VAJA 1LFPA 4UUWA 2QFJA 6FD1A 2FIUA 2UXCF 4DL4A 2JEJA 3A3OB 1TKTA 5L1JA 4C3LA 2JFDA 1ZYQA 3I5BA 1YKWA 3CCMS 5BYSA 3DM2A 4FYYB 1XNRF 3I87A 1FFGB 4MIWA 3D0HE 2HBYB 2DNPA 1RUSA 5LT5A 1BQNA 1HWLA 1PC5A 5ETQA 3ENVA 1OO0B 2CJQA 2KJVA 4Y34A 2WBMA 3TVYA 3HO1A 2PIIA 3M9OB 2Q43A 4U67Q 2EG1A 2RDJA 1F2GA 3NS6A 2KHDA 2VHGA 1T3OA 2JOQA 2KT2A 1M5PC 4MIBA 1TVRA 2RIJA 5CD4A 2J5AA 5AXLA 3D68A 3K5NA 3I0RA 1WC6A 2LU2A 1EZZB 4PXEA 4M95A 2YX1A 3CJKB 3EJMA 2PA3A 4DUZJ 1KOOA 2XEXA 3BF4A 4O3PA 4U7UD 1X0PA 4NLTA 4RW7A 3GIKA 3A1YG 2C3PA 4M5LA 3MFIA 4G6VB 2W9CB 2MZRA 3H59A 2BRKA 1QM9A 2CPDA 1VYAA 4I6AA 1T9XA 3LH2S 1RGVA 3DLEB 1R3NA 3BREA 3H2UB 3MD3A 1AXQA 3PW0A 2QEXS 3QNWB 3QGIA 5HLFB 2PA8D 3BPSP 1S6OA 4PCQA 4PR6A 3UDVA 4F3OA 1DHMA 1FKAF 1S1VB 2CPXA 2D9PA 1T3NA 2C3UA 2B9XA 4ED0A 4Z37A 2F1FA 3PHEA 5J2NB 3P5BP 3AT1B 2I8EA 3ELHA 3BN7A 1YIJS 2ZNZA 2DXFA 2W2PP 7AT1B 3JSBA 3CC7S 1S77D 2JZ5A 4WE1B 1O51A 1L5UA 3F44A 5KFPA 2F5GA 3T41A 4HH1A 1DZ5A 4PYDA 2JVRA 2DR5A 4QW8A 2BXJA 4KHPF 3OXGA 4N8NA 4DR2F 2EKYA 4A8QA 4QPXA 4NCGB 3M6XA 3NBPA 3BGFA 2BE2B 3KK3B 4LR7A 1OMSA 5C2GA 2XI2A 3Q23A 4IFYA 1MG7A 5KFSA 1J5EJ 3OW2R 4CLPA 2GIRA 2MKIA 4KH0B 2IM2A 1K1SA 2HIQA 3JTPA 2J9DA 2EK6A 2MB0B 4B3SJ 1S0VA 2V69A 4AE5A 1OY8A 4FNHA 4Q5VA 1DQAA 3KMSA 2NYHA 3O3LA 1RTJA 2HG4A 4CYUA 3FQLA 3MD1A 3MM8B 1VQ4S 1M5SA 1TU0B 1HIYA 2DEJA 3I31A 3PY8A 4X4NA 1T9WA 4NLQA 4RNNA 3QGPA 1S72S 4OI6A 2OFHX 1RYSA 2DXDA 4DV5J 1FXLA 2HZAA 3DU6A 2KN4A 3QT5A 5L46A 3SFGA 3OQ2A 1NSKL 1SKRA 4AT1B 2OHDA 2XULA 3DOLB 3HDSA 1EX8A 1VCTA 2EKNA 3R8YA 2XY5A 4JYAF 1U2FA 4W92B 3LA0A 4DX6A 3B4MA 2C2EA 3ZO7A 3HP6A 4NLSA 4CO5A 2VJVA 4MYTA 2ZITA 3R9LA 5ETTA 4IO1A 4QWBA 4B3TF 4LSNB 2XG8A 3DU5A 4WPAA 3HSDA 2FVRA 1EARA 5J1PA 3LWLA 1UJ6A 3FGVA 1JNRB 4CH7A 3HT0A 4G1IA 3PJ9A 2HFSA 2P6SA 5A2QY 2CIMA 4FKYA 1XMOJ 2UXDF 4R8UB 3BDEA 1U48A 1RTZA 4YB7A 1CVJA 5HLFA 3CJQA 3KUEA 4DQPA 1S1VA 4N5SA 3QATA 4DV1F 2I2YA 7FD1A 5J2NA 1U6ZA 1RWWB 4CWBA 4LF5J 2ALYB 1E6VB 5G0RB 2JL9A 1URRA 3T1HF 5L9XA 4PXBA 4ZDNA 5AT1B 4J9RA 5E3RA 4UF4A 3TUZC 2IM1A 3GQCA 2F4FA 2WONB 3VAFA 2O5DA 2YQ1A 2C1EB 2N4CA 2QT7A 3TANA 3VAKA 1IR2A 4WKYA 3M2VA 4ILRA 1QTMA 1LK5A 1K73T 1TV6A 4NXMJ 1M1GA 1PKUA 4NCGA 2W4CA 3THPA 2BE2A 1NCLA 3KK3A 1GK8A 2V67A 4YHHJ 1CJTA 3K5MA 3NGDA 1VQ9S 2HZVA 3RJMB 2FPHX 2LQBA 3J81j 1N0UA 1WC0A 5KFTA 4L74A 1HNWF 3WQPA 1WORA 1UA0A 3N4WA 2IMOA 4J9LA 4ECSA 5C42A 2MY7A 1UEKA 1B7FA 2RQ4A 5AE3A 3MR2A 5F8GA 1PIEA 1S0OA 3MM8A 1UVNA 4FNIA 3QMQA 1RWPB 2ZBIA 5CCLA 3W5ZA 4DPYA 2XSJB 2EC0A 3N9UC 1X4AA 4K4VA 2MQOA 3FBBA 1RQ0A 1MMDA 1U2CA 2D41A 4EFAC 2NSCA 3OHAA 1BQXA 1WSVA 3OSPA 1U4BA 4L6V3 5KFRA 4HKQA 3A13A 4DFPA 4CLFA 3AD7C 3K89A 5HROB 4BWMA 4RBTA 4ZVTB 1CBKA 4OI1A 2G0CA 4GVLA 1VJQA 6FDRA 3Q24A 1H2TZ 2PEBA 3IRXB 1JXEA 3GR0A 1GFWB 4USJC 1RA6A 2BDPA 3MTKA 2V2ZA 1X9WA 4LSNA 3NCRA 2ZOMA 1EETA 3Q8SB 4ZVOB 3GJRB 4LF4J 2HKEA 3CCJS 4DR6F 2HLUA 3EZUA 1KNZA 4KH1B 5IT4A 3UDLA 2Z58B 3QZ8A 3OR2B 2OPQA 3LO3A 1QAXA 2WW4A 2J6UA 2CXEA 2MQQA 3CJ0A 4DQSA 1L3KA 2CG8A 1WI6A 4LF9J 2GJIA 1PO6A 4R5PB 2LXIA 1KS2A 4FP9A 2K7KA 2JJ4D 1S1XA 1HNZJ 1UL3A 4LFCF 4DPUA 4IKAA 1DARA 5DDPC 2E1RA 2D3O1 1DY3A 1YSJA 1RT4B 4YEAA 3S01A 1TAQA 1E6VA 4AL5A 5DDOC 3TAPA 5G0RA 3CCLS 1KQSR 1V3RA 1SXLA 4RWWA 2Y1IA 3S1TA 4LIRA 2BW7A 4MKYA 3DOKB 2Z56B 2P9CA 2Z2LA 4K4SA 2X1FA 4LSLB 2ACMA 3T9NA 4DF8A 3HD1A 2K8GA 1SL1A 4ZP7A 4ZCIA 1XERA 3C14A 4J5OA 2DVIA 2R7SA 2B9WA 4WFBQ 4OX6A 3RBZA 4OYWA 1SC3B 4A8YA 1CJKA 3FCHA 4CQ1A 1B0TA 2R7UA 4O3OA 4TU8A 3AXMA 1UETA 2GMJA 1KLMA 5LMNF 4PQAA 1FA0A 2W4DA 4RL1A 1RAGB 1BMQB 1WI8A 3RB6A 1CQNA 3D6FB 3AB2B 2DO0A 5IWAJ 3BYRA 1B7YB 4TU7A 4YY3F 4LF2A 3QRRA 3A3NB 1QSLA 3OR1A 1RA7A 3QFHA 2NZCA 2GHVC 1XK8A 5CYMB 4B9UA 3C16A 2ZHBA 4QU6A 2DKOB 3N5BA 5CZVA 2MKHA 1J5OA 2XNRA 1NK0A 3C6TB 4OFZA 1WC1A 2V2VA 4NYZA 1UVMA 2FHOB 4YDXA 4ANEA 1I1GA 1W2BR 1VBXA 1M90T 2JNJA 2HVDA 2KYXA 4KHRA 2CQ4A 4NCAA 1WEZA 2FC8A 4BLGA 1HBOB 4FBUA 4TNOA 2HQ3A 1Q79A 2VPZB 2U2FA 5G4DA 4UT4A 5HAOA 2BJDA 1CPZA 1WWHA 1FEEA 3KLIA 1RT3A 1KR4A 2L41A 5E0OA 3GU0A 4ZITA 2UUTA 2R8KA 5HI7A 3MURP 4OZ5A 4OI4A 2W24A 2V6AA 4ID8A 3CB4A 5IC4B 4DUYJ 2VBZA 3BSOA 1IKYB 2NCKL 3OR2A 5A76A 1WUUA 4AFFA 5IT9Y 1I5OB 1OPZA 3MEKA 1JLAB 1JKHB 2YKAA 2Z2ZA 3BKUA 4KBIA 1LWFB 2FHMA 1C1CA 2QSFA 4I2PB 2FJWA 2I9SA 3FFIB 4HH0A 4HLBA 2KXHA 1OQ6A 4RUAA 3DI6B 2BANB 5DM6Q 1YRTA 1P6TA 3RBXA 3MUTP 1WF2A 4R0JA 3PCOB 4PG6A 5A8RB 4F8RA 3ETMA 4L76A 3LAMA 4PRFA 2PI5A 3GB0A 4UY8T 3TP2A 4QR0A 1FERA 1Y5LB 4USHA 4LBIA 2BQ3A 2PFDA 2BMBA 4HI2A 4LSLA 2MPUA 2M4MA 2FC9A 1TUWA 1S6PB 4OQJA 4NLRA 3HK2A 1SKUB 4IRKA 4N76A 5JMNA 1S6UA 4CT9A 1HL6A 1T0TV 1YJTA 4LREA 2A3JA 1NK8A 2RD5C 1MNEA 2MKYA 2YKOA 5K9FA 2XCPA 4ELTA 3RU0A 2ZWOA 1FDAA 4JP8A 1Y4ZB 3M30B 4ZS6A 2R7QA 2OO4A 3BZQA 1KRPA 3DCAA 3IR6B 4WTOB 1F6TA 2JVOA 3FRYA 3VZIA 4FDFA 1R7IA 1UVKA 2EEYA 1P1TA 4K4ZA 2B9EA 1GQEA 1JLGB 3BGUA 4DR1F 2AYMA 3IBWA 1Q5VA 3K8WA 1TK5A 2WB4A 3G8QA 4Z7CA 2FHJD 4WIQA 3ZZOA 5C7PA 2CPHA 3N5FA 2XC9A 3MUVP 1UZDA 1VC6A 2R8JA 1DQ8A 1RK8A 2V50A 2YNIB 4GO7X 2GGPB 3C6TA 2YKMA 5LL6d 4PWUA 3K58A 5IZHA 1NDCA 1C4CA 1IXKA 1XNRJ 2KRBA 4OI0A 2AJQA 4DV7J 4LFBJ 1NU4A 2HFUA 3ZZYA 4F50A 5DQHA 1SB6A 1HBOA 3I9ZA 1VQ6S 2D3OR 4H4MB 4HL9A 2E1MC 2CWXA 5HO4A 3LP1B 4F04B 1T11A 3LPEA 2BACA 2PEHA 4MTPA 4F2SA 4RPFA 1CJVB 2WVFA 1SI9A 3KHLA 3HF5A 1Z2LA 3CJSA 1UKUA 1BUXA 1TL3A 2IAJA 1IKYA 1SJFA 2QL5B 2AJ1A 4IOBA 2GVZB 3QYYA 2ZC3A 5K14B 2PGCA 4GMKA 4ECQA 3TYTA 2V63A 1CSJA 1LWFA 3SYZA 4KO0A 3JS9A 1X8DA 1S9GA 5J1NA 1SH0A 4I2PA 4NI2B 4QIEA 4CH0S 1A0OB 3MR6A 3R1LA 2RDDA 5ETSA 3DI6A 4ID5A 1X4DA 2D74B 3HD2A 1M5OC 2E1PA 2HQFA 5A8RA 4FF1A 1F3FA 2LXFA 3W2VB 1CS4A 1JLFB 3J80U 3RBEA 3C8YA 4CO2A 2VA3A 5EWGA 3MM6B 4F25A 2RS2A 3MPDA 4DJBA 4URGA 3D2WA 3DXBA 2IDLA 1AUDA 3GIMA 4IDKB 4LBHA 2B4PA 2ZH3A 2DNRA 2OSRA 1YJ9S 3POTA 5LSOA 3NAIA 2QYCA 3OTEA 2J6SA 1OIAA 3QGHA 4MMOA 1Y7PA 4J9SA 1QUPA 1RWMB 2FY1A 3T6JA 2ASJA 1LWCB 4JI5J 2DRDA 2DXEA 2GC8A 3B78A 2A6OA 2ZJQQ 2NSBA 3M30A 4DCOB 2E9TA 1KQKA 4YR2A 1HBUB 1NDLA 2WB1D 3FSXA 3UNYA 3G6XA 2CQBA 2BOPA 2Y8YA 1TMJA 4H4KC 2LFVA 2M70A 4DR2J 5GADI 2F9DA 4MYUA 1U6BA 5J1EB 1RWNB 4B17A 2CPEA 3SQOP 3HVRA 1Y5NB 5EUHA 1L3TA 5J2MA 1XIQA 2GV1A 2DGOA 3EWGA 3EGVA 5F8IA 4DR5F 3RRKA 4PXDA 4CTAB 3DRXA 4R25A 4B02A 1VRQC 2YNIA 2XZTB 2ZD1B 3CJ5A 4WZQA 4FKXA 2GGPA 3NKYA 5KT2A 3EPGA 3MAAB 4PXCA 3J7YI 2E1AA 1FDBA 4UOGA 2MZ1A 4NOHA 3UN2A 1FF2A 1N8RT 2FQQB 3PW7A 1LFWA 3PYGA 4EUVA 1U2RA 2K3KA 4NMLA 1TFYA 2OIHA 2DNNA 4F4ZA 2DB1A 2HAIA 2YKQA 4D3GA 2VJUA 5BR8J 1I3OB 3R97A 4CLLA 2UP1A 1NDKA 3KJVA 1RAOA 3M9MB 1HQ2A 4UY85 3KJNB 2AD9A 2IIHA 1FKOA 3LP1A 1FFSB 1ZM4A 3T5JA 2V2KA 1URNA 2Z4PA 2GHPA 2K3IA 3E51A 3KMQA 2KXFA 2AU0A 1F2HA 2EG2A 2V8PA 2B8QA 1YZ7A 3HFVA 5L1LA 2KYZA 5DQGA 2GX8A 3T9ZA 3N6LA 3PVXA 2DHXA 3BO4A 3QJPA 1R0BG 1PAUB 4CO3A 3ILIA 1U26A 2DRAA 2V0NA 4WYWA 3MR3A 3G8SA 3SSSA 2GVZA 5K14A 4DSJA 2W7PA 2B4OA 5EWFA 4O44B 3THVA 2H4YB 2C2DA 4ZP6A 2W9BA 4DL7A 3ZFVA 2W7AA 1LW2B 4NI2A 2W25A 4ECRA 3C15B 1GMUA 2YTCA 4P71A 3BSCA 2CDRB 3ZNUA 1DURA 4RNMA 4USWA 4KR0B 4AUKA 2JRSA 1VQOS 2QSWA 2VH7A 3MM6A 8AT1B 1R6VA 1IVZA 2P6TA 1MSWD 5LJ3Y 4ENOA 4OV1A 2DR8A 2F63A 3VGUA 4DV1J 3GIRA 2F8HA 4KT0C 4CLYA 4NLGA 3QAEA 5F8NA 5DZ7A 2OEJA 3P3DA 1RBLA 4K4UA 5KT7A 3FRZA 2OLWA 2XCAA 4DV2F 3BBCA 5DZ6A 4E2FB 2XLJA 1XJWB 5KFAA 3TEGA 3D1OA 4C3KA 1K9MT 2WSEC 3R7BB 5E7OB 4OX9F 5E3QA 2BQUA 2RQKA 1D3WA 1WEXA 2UXBF 3OTCA 5LXRA 4J91A 3HJFA 3QLHB 2CQ1A 1K0VA 2ZUAA 1N5QA 3BR8A 4OZ2A 1R8PA 4LF8F 2Q66A 1P1LA 1C1BB 1ZAVA 3MTJA 2DITA 2M3DA 4O0IA 4Y2CA 3HHLC 3HT3A 3IRWP 3HI9A 4PPDA 5KFBA 2CADA 4OYAA 1CC7A 3P4UB 4TQRA 1V6HA 5KG5A 3A3PB 4YP3A 3M8PB 1Y11A 3TRGA 4HDHA 1HNWJ 5THWA 2CZ9A 4A8FA 3SEOA 4OYIA 1C0UB 2UV8A 1KC8T 3OVSA 1D8ZA 5A0YA 2CQ0A 3EM1A 2EFOA 1RE1B 1FRIA 4OHWA 1RTIA 4JI0F 3DDIA 4OJ1A 2CPJA 2R2TA 4FXVA 2EWHA 4Z7YA 3D0IE 3QWUA 4RLEA 2Z0GA 3C46A 3PYDA 5SZTA 3R27A 3W8GA 1F5CA 9ATCB 3TQ1A 5B0BA 3EZOA 1RU2A 1FNOA 3Q89A 1VHFA 5KG2A 3HFZB 3MXHP 4W98A 2BOAA 2D9OA 4CO1A 2MZSA 1RAIB 5FIIA 2UV8G 1EKSA 2X3DA 3L09A 4JI4J 4X62F 1T9TA 2P8IA 2YQ0A 2E9ZA 2AW0A 4IOCQ 2N3OA 3ISZA 4IQMA 1HWJA 4ES3A 2LQ5A 3AQOA 2QA4G 5C25B 3D9BA 4V19X 5H9FK 1WTBA 3MCSA 1HMVB 1Y3JA 4F0MA 3NEKA 1DQ9A 3PX6A 1UP1A 3IS9B 2XMMA 1FEHA 3OXLA 4O44A 2CDQA 2HFZA 3UN5A 1IR1A 3CCTA 4KHMA 3RR8A 4PG4A 1N4LA 3EGWB 4UUXA 1LW2A 2XMAA 1UVLA 1IBMJ 1CG2A 2HWHA 3PRBA 4HTJA 2WTFA 1NEEA 4DS5A 3TZYA 1U09A 4NEZA 3DGVA 3AA9A 2Q6BA 4DUZF 1VRTA 4CIOA 1ULRA 1M1HA 3NNCA 1HI1A 1ZZNA 1HD0A 5DGBA 3G87A 4CRJA 3G4SS 2DNGA 4ZOSA 1N33F 3M7VA 2F9JA 4OZ0A 3EICA 4EGLA 3SCKE 1KP6A 4OHXA 4QR1A 4LFCJ 5F8LA 3PX0A 1MU2A 5T41A 3AHPA 2CJBA 3J81U 2YWKA 3O44A 5FD1A 1N5VA 2KT3A 3R5GA 1RWKB 1WOSA 4IO9Q 3GFHA 4K0KF 1UEVA 1Y9OA 2WRMA 3FCWA 5ETNA 4DMZA 4OIXA 1HBMA 2V8VA 3EVWA 1YDLA 3C6UB 1KFDA 1Z4UA 4QWCA 2IBKA 2I5JA 2RU3A 3H7HB 2V94A 1R0CB 3QLHA 1TZ0A 2DR7A 3CUNA 4H4OB 2G1DA 2FVPA 4RKUC 5RUBA 4ELVA 4KIAA 1BE4A 4Q7AA 4KGMA 4J9PA 1S1TA 4DBQA 1N6QB 2ZUGA 2Z57B 1R0AB 3TA2A 2CWKA 4WK3A 1U7LA 2OPSA 4WF9Q 4ICLB 1U1NA 1UEUA 1HNXF 2MDAA 3M8PA 2WAQD 4ZPCA 3QIDA 4JV2A 1ZPWX 3UI3A 1CULA 2KRRA 1DBDA 1VK8A 2RQCA 3DHXA 1RACB 2V8HA 3NGSA 2CQPA 2LEBA 3UCGA 1XWLA 1J5EF 4LRDA 1GNKA 4L3KA 4QR2A 2HHXA 5L38A 3O6QA 3PW4A 2C2KB 4ZVFA 3BBFA 4ES1A 5K8MA 1YWXA 2MY8A 3CO0P 4KGKA 2HAFA 3ZC4A 2M5YA 4A47A 2LECA 2HGLA 3SSRA 2A2CA 1SQGA 1IJFB 1U0SA 2UVWA 1VFJA 1EP4B 2HFVA 3N6MA 1WHWA 5H9EK 5EGYA 2IA6A 3ENQA 4UW2A 3AH6A 1YZ6A 5C25A 2E5IA 4FF4A 2AGQA 1HQEB 2W8KA 4DV5F 3HHDA 4J9VA 3IS9A 1LNQA 1S6QA 1Y00A 2XMWA 3EPIA 1H2VZ 2QN6B 3BQ2A 3PO4A 3GZ7A 2IRUA 4YOEA 4RNFA 3FMWA 3HLUA 3G9CA 2VKZG 3WC2A 1WKLA 1FRKA 1FFWB 2MLZA 1LWXA 2BA9A 2QX0A 3CC4S 2B6AB 2RHSB 1ZTTA 2MJNA 2ZH6A 2R2SA 1SQEA 1CJUA 2YNHB 4QZVB 1YJVA 2KKHA 3MAHA 1IBCB 3W8PA 2AT1B 4O3RA 4Q0BA 1N34F 1S49A 4DFKA 4ZMMA 4DLGA 1H0HB 4IG0B 4P7VA 3L3CA 4O23A 1YLXA 4EBDA 1XMOF 3Q2TC 4XO0A 4ETZA 4GKKF 1ACMB 1ICEB 2OAUA 4NPOA 1VQ8S 4O0NA 4EO6A 1T05B 1KLNA 1TL7B 3BM7A 1YI2S 3PO5A 5B0AA 1U8SA 5DLFA 4ZPWR 3C6UA 4YN3B 1X4EA 3GPAA 4DR3J 2RUGA 1T03B 1U6FA 4KE5A 4L75A 3K59A 5D77A 4QBUA 2OJ3A 1JLEB 2BKPA 3IR5B 3D1HA 1SJRA 1X4FA 3AJ1A 3MZIA 4H54A 1BLUA 1S99A 4ZN3A 1WSRA 5B0GA 4QQBA 4XK8C 2OPPA 5AJ3F 3E01B 1OWXA 4ICLA 3KYLA 1VC5A 1NLKL 3LTOA 5IC6B 4KAIA 2HHSA 3PR5B 4NXMF 2QMUB 4UQTA 4FS2A 4N8OA 4KV8A 2QE5A 4DR1J 2YKNA 1K44A 2NPFA 1VMBA 2XS2A 2YNFB 1UWAA 2BYCA 3PJXA 3GR1A 3JTNA 3S8SA 4YQWA 2E5HA 1YTYA 4J90A 2MZQA 2WVDA 2IDEA 3JYTB 3UD5A 5D78A 3PKYA 4UOHA 1ZM9A 4ED6A 2J7WA 1U0HB 3WX4A 2M2BA 1ZPVA 1WTFA 1S12A 4EO8A 1HPZA 5IOLA 4DV0J 2NXNA 1ZM2A 2VZ9A 2G0JA 4WZMA 4P73A 3OUYB 3NOGA 1ZOTA 4FXWA 4U6PA 2ZHOA 4F0KA 3QSYB 1RXOB 2LKZA 4K59A 3VAHA 4U95A 3CCSS 4DL5A 2MMYA 3KWMA 4GVBA 2BV3A 4DSLA 3DOMA 5DQIA 3FEZA 4RU9A 2ROGA 3GLJA 3DLHA 4DV4F 1CQMA 3M8ZA 3A12A 5KFJA 2Y0SD 1FRJA 2LU1A 2K2PA 3OHBA 4DU8A 2OTJS 3GIJA 4DN0A 4XDDA 4A8MP 2QLWA 3NP5A 4UQGA 1L3VA 1YBUA 5KFCA 2H4WB 1G3OA 2KH9A 2YNHA 2BVZA 2BEFA 1JMTA 3QRQA 3PNIA 4C4WA 5ETKA 1K8AT 2WVEA 1SL0A 4W4MA 2JLFA 1T7PA 3TA0A 4NLYA 5F8MA 4I7FB 2CYYA 4Z2XA 4PABA 1IQTA 4TLQA 2L08A 1EIYB 3F41A 2JH3A 4X4VA 3KK1B 4HACB 5IFMA 3VWSA 4UOFA 3K57A 2AJ0A 1OY6A 2DNKA 2XMVA 5D15A 5FLXY 1NK4A 4M5DB 2AEJA 1VQSA 3KLFB 3D54A 1TL7A 2C28A 4LF9F 2KZZA 4WCEQ 1IN0A 3O1LA 2DNQA 4YMEA 3MF5A 4G1QB 1TKZB 1HNZF 3FKBA 1VQYA 2CRLA 1T03A 4RX6A 4RUHA 1AT1B 3W5XA 4YFUA 1S9EB 4JI8J 3BB5A 3CC2S 1BGXT 5HMYA 1JLEA 4I6WA 1NRKA 4QJVA 3KJQB 3NS5A 3TJ8A 2GJ2A 4DS4A 3WHIA 4QCLA 2QO3A 4OLOA 3A8EA 4A8XA 5JVHQ 2MQ8A 1NAQA 2A6MA 1WKJA 1UCNA 4DF4A 3W9JA 1RKIA 5ITHA 4LFAF 5EHHA 2ZKTA 4EWTA 5HP1B 4EZ6A 4ITSA 4NRUA 3BQ1A 4FF2A 2YNFA 5F3ZA 4X4OA 3MPVA 2E5LJ 1VQPS 1PG5B 1KFSA 1G2EA 2B8PA 3QO9B 3HJVA 1N0VC 4FF3A 1L3UA 2XS7A 2WHOA 3KLEB 3GV8B 1VOMA 3KLGB 4GC7A 3UE2A 3DLGB 3ITHB 2JC1A 2DRBA 3TAMB 4DX5A 1WG5A 3MFHA 1FRLA 3VGVA 1U0HA 3LP2A 2HPUA 3CDBA 2V68A 2MQMA 2E9RX 4ZA1A 4NZ6A 2RE1A 3CCZA 3EMTA 4ECUA 4C8YA 4LRFA 4ANCA 3ZTOA 2W2MP 4OZ1A 1HD1A 3OUYA 4DZ6A 1Q7YT 3CO9A 2RJZA 2JX2A 2FVQA 1SQFA 1QUVA 2BM1A 1M5VC 4OZJA 3K17A 1R89A 3ZTRA 3ISND 3D67A 3ADAC 5D4PA 5F9NA 3UN3A 4JBCA 2CAJA 3DM2B 4WXWA 3CCES 3DYAA 3V2UC 3R1HA 2YVSA 2JWNA 2IJFA 2R2UA 2LQ8A 4MT1A 1EJ7L 4HHUA 1REVB 1IKVB 2M88A 1S57A 1RHKB 2YWFA 1U1MA 2G4BA 4DX7A 5M2PA 1RSCA 3JTOA 2HS0A 1VIOA 4RO0A 2FTRA 1FE0A 4I7FA 1TVRB 3OVAA 3T5HA 1S10A 1KVJA 3VQTA 1UZHA 3PEJA 2YH1A 2R2RA 3T1AA 3I0RB 1FRXA 3M4XA 3OJSA 4Y65A 4DUYF 3GMGA 1C2PA 2LLZA 2HRUA 3BN4A 3RR7A 4LUBA 1XEZA 4HACA 3IM9A 1UMJA 4Y2KA 4QYZJ 2M52A 4ZVUB 3BSNA 2RNEA 2DGUA 4Y3CA 2C2MB 2IYIA 4M5DA 1QAYA 2OEMA 4DR7J 3KLFA 2YPZA 3UD3P 2MYFA 2I0XA 1F1BB 3FSIA 4G1QA 1TKZA 3F73A 4JI1F 1LK7A 3GCWP 2VL1A 4CLTA 1S4EA 4M1KA 4USKA 1S9EA 3IBCB 3KNGA 1Q5YA 2HQDA 5KFUA 1Q82T 2I6WA 2POKA 2RH3A 2CUYA 3VR1A 2JLEA 4RWXA 4YR3A 4DFMA 3UWTA 3DDKA 2X1AA 3NGUA 4DV2J 1NKBA 3LWMA 1ZA2B 4Y6IA 3NY0A 2BR0A 5I4MA 1NNDA 4PQUA 1EKRA 1R31A 4F4YA 1LWEB 2K1RB 2LXUA 1Q86T 5DETA 4KFBA 3IMQJ 3MHYA 3PIPQ 2ERRA 4B9MA 1V5VA 4RUCA 4N47A 4USVA 1FHTA 3R5DA 2C2OB 2HVZA 3WBZA 4QWEA 3DLKB 3P96A 1RCOB 2VOPA 3QO9A 3ULHA 2O67A 1F5AA 4TY8A 4YUDA 4WBFA 1YJUA 1BQMA 4Y2AA 4ALZA 2AHOB 3TAMA 5A8KA 3NBPB 3H40A 2RT3A 1NM2A 3CJ3A 4A8SA 3MGJA 4ZCKA 2BQRA 1UVJA 3AOCA 3OXFA 2EBEA 1SKSA 3H5SA 2W9AA 1PSDA 3FCVA 3BEGB 3HSZA 1V3SA 4X2BA 3A8IA 3K5OA 3WDOA 5EX3A 5DM7Q 3VAMA 2J8AA 2JSXA 3HZEA 5HANA 1LV5A 3C3LA 2OPRA 1HWKA 3OL7A 2P2CB 4X62J 1RTJB 4CYUB 2DD8S 4G3IA 1N36F 4DV7F 1TUGB 4EMDA 2GAHC 4LFBF 3CD6S 2G0IA 2HHQA 3PTWA 3MOZA 3EXCX 2XZDB 4TU9A 1REVA 1IKVA 2RDIA 3S6EA 3QIPB 3V4IB 4NA3A 2GFFA 2XYGB 2ZBRA 5ETRA 1VC0A 5HMWA 2BX6A 1NHUA 2ZH9A 5GMDA 2R8GA 3T3FA 2AJFE 5CD4H 1JXLA 4OJHA 1S7HA 1KQFB 2ASDA 3BGOP 1WD6A 3V6KA 3NGRA 2DNHA 1ZAWA 5HL7Q 4DU7A 2D3ZA 1AROP 5KFYA 1XR7A 2M0GB 4ZKAA 3MPUB 5KFVA 1PYTA 2MKSA 3MAQA 1N33J 4IUFA 3JXOA 1RT5B 3TVZA 1U45A 1M0SA 5DLGA 2J0SD 3GILA 2KB2A 3SIPB 3IN5A 4IOAQ 2NZ4A 1GX6A 3SZ2A 3SBMA 2MQLA 4ZJQA 1WJ9A 2Q6CA 4KTQA 3HKWA 2WW8A 3MPYA 2VG5A 2H9ZA 4K0KJ 1KQGB 4BHQA 2GAGC 4B3MJ 1O0PA 2UVUA 2XTJP 5LMUF 1SV5B 2YWEA 2F8EX 1LWEA 4FS1A 2K1RA 3THTA 4DCPB 1P9QC 4B3RF 3Q0AA 1YK9A 3AD8C 2FJAB 2AKWB 1U24A 3SSQA 1H3DA 4OYBA 2YH0A 4JI5F 3HXMA 2E29A 1FWPA 3DFEA 4NLOA 4IG3B 3MDFA 3DRPB 3DLKA 2CQGA 5AXNA 3LF0A 1H6KX 4C8NA 2VIHA 4JI6F 1HQUA 2OUGA 1HNXJ 3CWJA 2RRBA 3DGPA 3M2VB 2VC0A 4C8MA 1KEKA 3HVTB 1TV6B 3DKDA 1NSAA 1X9SA 1PILA 4ECYA 2HNYB 2WSFC 1SC6A 2RS8A 1KTQA 1PJ7A 1CJTB 3IXQA 5HN0A 2FJDB 1N88A 3M8WA 2VASA 1D09B 5KOWA 1HHQA 1X5OA 4PWWA 1N56A 3BS9A 4MKBA 4N56A 4KJIA 4USIA 4GO5X 4JV1A 4PAAA 5T7LA 3W66A 3HULA 2VBWA 3J7AN 1IUJA 2FJVA 1PBAA 3UPFA 1VRUA 4DR4J 2M9KA 2FZCB 1NJWA 1W2IA 5E5NA 3O2IA 1HYSA 4C8OA 1NK6A 5C42B 2UUWA 3F56A 4WFXA 3EZ5A 2I38A 3KNAA 1DFDA 4XTTA 2ATCB 1A7GE 2QMXA 3Q8VA 4UZCA 5GAEU 1EB0A 2C3OA 2UUCF 3JAMU 1KSPA 4TKTA 1KD1T 3PYEA 3RB4A 4F4AA 5BR8F 4IFVB 1BWVA 1NSQA 4F2RA 3K2YA 3G82B 3QIPA 3V4IA 1Q8LA 2O01C 2AYGA 1NDPA 4OMFG 2JHEA 3H98A 4PWDB 5I3UB 1EQMA 5JVGQ 3QFWA 4P2FA 4B9TA 1S0NA 2HHWA 1F9HA 4PG5A 3OSNA 1VR6A 1KKHA 4NCBA 1NJIT 1RABB 1D1UA 2PFFB 2KHCA 4EBEA 3I5AA 2J9EA 5EDWA 4WU3A 1G4CA 2GQ2A 3BH6B 3PACA 2V4JB 1IWAA 5AXMA 2ZDOA 1RT5A 4F4XA 3C2PA 2NUHA 4X4UA 4NZ0A 1EETB 4ZVHA 2CQ2A 1N34J 3TR5A 1RBOB 2NQPA 5IM0A 2DR6A 4DL0C 4ATNA 4WP9A 1YHQS 3P8BB 1FE4A 3H5XA 5HBMB 2OPQB 5K8OA 4GKKJ 2X1BA 4FZVA 2ZOFA 4TLRA 4JI3J 5D8HB 1RT1A 1P9YA 5SUHA 2MTLA 2B9YA 3B54A 5K20B 2A2DA 3BV8A 3KFWX 4F67A 3VQSA 3IG1A 1SV5A 3FVYA 5IS2A 3HHLA 1S1XB 2JC0A 3EVOA 2QZ8A 1PAEX 2FLLA 5HQLA 2NXEA 3GSIA 1NPPA 1YG0A 3R5AA 3KDNA 4Q2LA 3KUGA 3FMBA 1GAOA 3MM9A 3RGIA 2QJ3A 4IG3A 1HI8A 3DRPA 1E6YA 2CZ4A 5AJ3J 2LVWA 4I6YA 1VQ5S 3EX7B 1RT2A 1AZSB 2KU7A 2XYHB 3GYNA 4F36A 2HRYA 3HSJA 1RU1A 4ZVPB 2IJNA 2BM0A 3FJ2A 5A6PA 3HVTA 4QIVA 2DO4A 1FJCA 3SXLA 2LP4A 4LF6F 5H9FJ 2HNYA 3C14B 1HBNA 1I6JA 2Z2MA 2XM3A 1OQ3A 2GCFA 5CYQA 1RT6A 1KHVA 2HWIA 3Q86A 4CP5A 1HR0F 1LKZA 1S1UB 1M5KC 4Q43A 1RDRA 1CJKB 3OFFA 4LQ9A 5D3GB 1V3ZA 4R0EA 3IGVA 5B7WA 1NHKL 2ATLA 1PC4A 2L3MA 2BKNA 1S7IA 1KLMB 2R3VA 2GO9A 5KOXA 4DUTA 2Q79A 5KT4A 2DHSA 3UW1A 1Q0NA 4DL2A 2P5VA 2R7TA 4NWBA 3W61A 2FJEB 4ILLA 3CIMA 3GE9A 3W2WB 1NO8A 5CABA 4ELUA 5ETMA 2ROPA 4WJBA 3HX9A 3PR4A 4WP8A 1Q1KA 3OR1B 5DRKA 2CNOB 2J8SA 4IFVA 3C16B 3G82A 2VICA 3DXSX 3Q8PB 4NX9A 2WBRA 2W4PA 1J5OB 3D3BJ 3VVUA 4C97A 2G2OA 4PWDA 4X4RA 5I3UA 4K5SA 2MEWA 4C2MA 1DJ0A 1QAJA 3D7SB 2JEFA 4DV4J 3M8YA 2CVIA 4OYXA 4JI4F 2GA7A 1IBKF 1NB2A 4TVAB 5FDLB 4GKJF 3V6HA 1C4AA 1XQIA 5F3TA 4J9UE 3V4MA 3LGHA 3QBCA 2N7YA 4YB6A 4Y2MA 3EUNA 4JV0A 2LA6A 3ONQA 4F3QA 1WC5A 5ETLA 2VQEF 4P52A 1QTNB 2V4JA 4ZVGA 5KFGA 2Z30B 3KLIB 1RT3B 2A10A 2UU9J 1FD2A 3UO0A 5J2PA 2AJ4A 1NKEA 5EWEA 3AOAA 3L9ZA 3NCPA 1UJ5A 1IBMF 1N5YB 3MI7X 2ZEJA 3L95X 1U47A 2EFQA 2PT0A 2HNDB 5CZXA 5HBMA 4F3MA 1X5PA 3BYPA 4Q45A 4NLPA 2Q3PA 4J9KA 2CJ9A 2WVCA 1S59A 2NLWA 3L7UA 2X1GA 5MAOA 3E2EA 5I42A 1C1CB 3QQCD 4OYPA 2AIRB 1YGYA 2RRNA 3H2LA 1KVKA 1H72C 3I32A 2LDIA 3GFYA 2QRRA 2B0GA 1M1KT 3QT6A 5A8WB 3IAM9 2VBXA 2XI3A 4OI3A 1FVSA 1AZSA 4J37A 4ES2A 4PKDB 3HKZD 2V4RA 1TK8A 2XQCA 5IV3A 4F4WA 2XMKA 1UFLA 4LFAJ 1FWKA 3Q8QB 1YJ7A 5D0HA 2E1CA 5HQ8A 2VB6A 1RWOB 4FYVB 4HHHA 3H5YA 1PYOB 2PN6A 2YNGA 3DLJA 1YJWS 3PJWA 4FYWB 3OL8A 1S1UA 2X51A 4JOUA 5JUMA 5D3GA 1IBLJ 4I2QA 2UUAJ 1R8HA 1ZAXA 1NZ8A 1RKJA 1U1LA 2M8HA 3LANA 3CMAS 3HVAA 1RHMB 5LXYA 3UQSA 1U25A 4ZPDA 2DGSA 2GMLA 1WF1A 2DH7A 4C0HA 1WELA 1TTHB 3W2WA 1N5SA 3TZZA 1FDDA 2J6TA 2V4QA 4Y2IA 1SIZA 1U1RA 1LW0A 5CQGA 2O66A 2EFPA 1H7WA 2YKMB 3ISNC 2Y9HA 2UUBJ 3IC1A 1Q53A 3V5RA 5I3QA 4DSKA 1Q8IA 5CA5A 2XB2D 3W1YC 5FDLA 2HBQB 2CQIA 3VF0B 3PIOQ 4K4WA 2Y1RI 1YJNS 1KONA 4MKAA 2HFNA 5DGAA 3MECA 2AGOA 1FNXH 2FGOA 2BZ2A 4BC7A 3HFKA 1SH2A 2B4VA 1FTCA 2R42A 1V5IB 3ZTSA 1NPKA 1FJGF 2R7OA 1SUQB 4I67A 4NEYA 1FK9B 5HVGA 3RUBL 1YQHA 1TFWA 4OX7A 1YBAA 1HI0P 1N5YA 2F65A 1SC1B 2CJAA 3MMBA 1YBTA 1TL3B 3W62A 2IAJB 2HNDA 2ZHAA 1O8BA 2DGTA 3M8SA 2W1BA 4LF7J 3Q8RB 3A8JA 1B99A 1N52B 4K2JA 2GS8A 4OHVA 1MMNA 4JV5F 2BJ1A 1WNEA 4MJKA 3VAGA 4RNOA 1CLFA 4DOZA 4KO0B 1S9GB 3ZNJ1 4TXSA 1CC8A 4JI1J 4C8ZA 1K47A 2FDNA 4AQYJ 4ID5B 1D9FA 4PUOA 3A4TA 1JLQA 5C2CA 2VPYB 4XPEA 3TUPA 2DIVA 2KVQE 4NXNJ 2DY1A 4DSEA 5HK4A 2QL7B 5A8WA 1FCAA 4NLWA 1SJ3P 3M32A 1CS4B 3M6UA 1R27B 1GT8A 4P75A 3ZZZA 1VQMS 3T19A 1OJ4A 3NMRA 3HZGA 1TL1A 4JB8B 4PEOA 5E3CA 3M2UA 3HVWA 4DR3F 1WHVA 1WHYA 5E41A 1RBAA 3POTB 1NK9A 3IP0A 3KDOA 2JFKA 3GJQB 2G2ZA 2ZDPA 1LOUA 3PYFA 1XBWA 4OZNA 3AJDA 4C7QA 1N54B 2R4FA 2MLYA 3OFEA 5CH7B 3EDQB 2JEIA 2YX7A 2JDJA 4AD6A 3DMJB 1RT7A 3U27A 1VQ7S 3RB0A 4WWSA 2G1HA 2EW9A 3IM8A 4KY3A 3FEXB 1JJ4A 2IRXA 4WIIA 2CQDA 4N77A 5HVFA 4LJMA 4QIWD 2RUSA 3NGKA 5I3PA 5ETVA 3SQGA 4ZJLA 4KKOA 2AMCB 5J2MB 4RW9A 5L39A 2IYGA 2VF3A 4FPRA 3DHWC 4UZBA 4DQQA 5EN1A 4X4PA 2F3JA 1L3SA 3PZPA 2J76E 5L8RC 3K7RA 4RR5A 4HR2A 3MM5A 2E7XA 3CT9A 5FLXU 2W7OA 4RUBA 1IKXA 8ATCB 2ZKUA 2QLXA 1RWUA 3T5KA 3DDNA 3G71S 1MMLA 1F5BA 3TOQA 2CPZA 4DV0F 4E98A 2Y1LB 2V8GA 1N36J 2XBPA 2GNKA 1NH8A 2ALZA 1D9AA 1JJCB 4TY9A 1M5HA 4DL3A 4WP3A 1ZBTA 3VALA 3NS7B 3KJVB 4RW6A 1SJ4P 3BH7B 4URQU 2VDHA 2CKWA 1FKOB 1NZAA 2HBZB 2B5JA 1TELA 2QIFA 2B51A 5GADU 4G1PA 2ZBCA 1SUQA 3OTDA 3MEGB 1FK9A 2QC3A 3E3XA 1JWWA 3RZAA 3HPOA 4CNYA 3FEYB 3PV8A 1DTQB 4HHJA 2NR0A 4P9SA 1SC4B 2XHWA 4DWIA 2ILZA 3RB3A 2B7BB 3CCQS 2VFSA 4TYAA 3E8OA 3DRSA 1JX4A 1GMWA 3HHEA 5BJRA 2B43A 3CJ8A 1WACA 1FDNA 2W9BB 2E66A 3J7YU 1S4FA 4CO4A 3D3CJ 3JQMA 3BPDA 1VLYA 2VG6A 3MEEA 2OD6A 2BJEA 2HMIA 1S5ZA 1R8AA 3HHNB 3QZ7A 4X66J 1HARA 2GQCA 1R6YA 2D3UA 2W2OP 3T1YF 3TAQA 2KI2A 3TEHB 2EC2A 3ZZRA 4CLUA 5E33A 2K7JA 5LMUJ 2ZC4A 3HHKA 5KFIA 1JLBA 2XMTA 4X64F 3AJ2A 4DV3J 2RU9A 4L3NA 1GTHA 1PJ5A 4YB1P 2FVCA 4B3RJ 4XAKA 4JI8F 2MKJA 5BYRA 3OL6A 1RTHB 1SJ1A 2DH8A 4LVNP 3AODA 3H20A 4Q8EA 2OI2A 2H54B 3DMJA 4IRDA 4JI6J 3OTOJ 3ZZPA 3US5A 2E7WA 3WX8A 1FRHA 2YKPA 1QY7A 4J9MA 2AJ2A 4Y00A 1RAJA 4AL6A 5LOQA 3D5MA 4ED4A 5F0WA 2V8DA 2G2YA 5KG3A 2NXJA 4RZRA 4YB5A 3MPWA 3I0SB 2WCXA 2RKIB 4OJGA 3CMQA 3LW5C 2BUNA 1KOHA 3EYZA 3IFEA 4L73A 1BD6A 2E5LF 2ZJRQ 3PKMA 2HYIB 1LEOA 3GV5B 5FJ4A 1Y5IB 1YITS 2R7WA 3LALA 1R8BA 5IT0A 3J81Y 1ITPA 4OYZA 1JLCB 2QYGA 4RBVA 2C22A 5A0YB 1WF0A 2LYVA 3VV2B 1HWIA 4BCAA 1KN6A 1RTIB 2DHAA 1I94F 1UPPA 5CCMA 1T02A 2ZZNA 2C3MA 2UUCJ 3PW5A 3NCQA 4ZLNA 3RRGA 4HYKA 4DSFA 1D0EA 4LR8A 2JEGA 5DO2A 2WSCC 3KHGA 1QVFR 2GVDB 1W25A 3QRPA 4XPCA 3M8QB 2XMJA 4O4GB 1N32F 4DLEA 4QIFA 2NUUG 1QAIA 1HHTP 5F0UA 2AF6A 2EFVA 3MEGA 4NL5A 3NWRA 4LRAA 4O3NA 5D6GA 4C6AA 3IBFB 4LMZA 3CJKA 1DTQA 2ZE2B 1X7VA 1ZH5A 4ZIVA 1QSYA 2B4UA 1NKCA 2FB0A 3NL0A 2XMUA 3PHTA 1PCAA 3R5JB 5D4OA 2RAQA 4U7UK 4JI2J 2W9CA 3W9HA 2HK2A 2AEFA 3KG4A 1O6XA 5C5JA 3KLVA 2WZ1A 2XLIA 3DLEA 1WG4A 3OBIA 3MMAB 3VZHA 2CJYB 5KFLA 1U49A 3ZXWA 4ED1A 1VRTB 1RWXB 1V9OA 2IC3B 3AAWB 3AFGA 5KG4A 3CE8A 1GEHA 4DR7F 4P2XA 4DXLA 3CDUA 3SV4A 3LUYA 1RHUB 2RQMA 1MU2B 2HHHF 1HNVB 2A18A 2YX4A 1HKAA 2AZ1A 1ZM3A 3QT7A 5GAEI 1KVIA 4HVZA 3VAIA 2HLTA 2VDIA 4U7CA 4WE1A 1NMEB 2ZM6J 1RTHA 2J9CA 3CCRS 2ZH7A 3LQVA 4MK7A 5B0DA 1HBMB 3DN9A 2VFRA 1X60A 4OZLA 3BKTA 3KHRA 1X9MA 3P5TL 4F26A 2I5JB 3NAHA 2KVIA 5H1SV 1F60B 1PBUA 1VQNS 3CJ4A 3HHLD 4BS2A 1Q8BA 2RF2B 2XY7A 1F0XA 5LSRA 4LF6J 4M8LA 3R6LB 3I0SA 2G13A 2F4VF 3G86A 4QYRA 2RKIA 4CLZA 3U1MA 3FNNA 1S1TB 2X3GA 3BBBA 1U02A 1HR0J 2OPSB 2MQNA 4EZ9A 4Y28C 4P74A 4ZPAA 3CW2C 1TKXB 1LXJA 1CULB 1OYEA 1OYDA 1JLCA 2N82B 2ZH5A 2V9WA 1RAAB 3Q83A 4B9LA 1FXRA 2KFYA 2YBVA 3IGNA 2BBEA 1S76D 2BJ9A 1S97A 1U8WA 2W2NP 4QW9A 1FX2A 2N7CA 2FHKA 4EYIB 7FDRA 1TAUA 2GJFA 1QSSA 2HNZB 5CXTA 3BDPA 4ZVSB 3B8HA 2P9EA 2GVDA 3M8QA 5KG1A 1C0TB 2DEIA 2QFIA 3SCLE 4O4GA 3CCWA 3NGTA 3TQEA 3H90A 3CTRA 1WOPA 4IR1A
chains in the Genus database with same CATH topology
2E1MC 3DOLA 4A8KA 5DG9A 3MUMP 4FVMA 3CCUS 2HVHA 1FT8A 3EXCX 3ENWA 4TU9A 5HO4A 1REVA 1IKVA 2AYEA 2ADCA 3LP1B 4XIUA 2CPYA 2XO7A 2ZZMA 2RDIA 3S6EA 2BACA 3QIPB 2PEHA 2CPFA 4MTPA 2G9OA 5KTQA 3V4IB 4NA3A 5L1IA 4F2SA 2GFFA 3KHLA 1SI9A 2ZE2A 2OP5A 3HF5A 2ZJPQ 1Z2LA 1ZETA 1T8EA 4C8KA 1VC0A 1RYRA 4L72B 3O5TB 1TUVA 4AXIA 5HMWA 2ZH1A 1UKUA 2PMZD 1NHUA 2B6AA 2ZH9A 4I0WA 4ZK7M 4AL7A 2R8GA 1HNIB 3T3FA 4WKRA 3R5CA 3H4BA 2GO8A 2DGVA 3I9V9 2E44A 2OH2A 2AJFE 5CD4H 1JXLA 3BSAA 1Q81T 3MECB 4OJHA 3UD4P 1S6QB 1TL3A 1S7HA 1KQFB 2MGZB 2ASDA 2IAJA 1IKYA 1WD6A 3OLBA 4ECVA 3JSRA 3I96A 5IQ6A 3V6KA 1SJFA 4P7TA 2DNHA 4HDGA 2AJ1A 1ZAWA 3PEHA 5HL7Q 1S9FA 2KTQA 4IOBA 3LP0B 3QYYA 2ZC3A 5K14B 2N3LA 1NHVA 1Q16B 4EBCA 2PGCA 2D3ZA 3I82A 4GMKA 1AROP 3KLHB 5KFYA 1XR7A 1NJZA 1ZZFA 5B09A 4IRCA 4ECQA 2M0GB 3TYTA 1CSJA 3NNHA 1LWFA 1Z1ZA 4KO0A 4ZKAA 3SYZA 2EI5A 1X8DA 4CCHA 3MMAA 4LF4F 1ZTWA 3RAQA 1S9GA 4IG0A 4R8UA 1RJJA 5KFVA 5J1NA 1SH0A 2CG4A 4FN5A 4I2PA 4MK8A 4CZCA 2MKSA 3MAQA 3OFHA 4IUFA 3MMBB 3M1VB 4I4BA 4QIEA 4CH0S 2EBGA 1RT5B 1NJXA 3TVZA 3MR6A 1U45A 3R1LA 2IC3A 1M0SA 2KM8C 5DLGA 2J0SD 1YRXA 3DI6A 3TW0A 2IM3A 3GILA 2MSSA 4ID5A 4C0OC 2KB2A 4I64A 3IN5A 4RW8B 5KT5A 4IOAQ 3NRBA 1X4DA 2D74B 2NZ4A 1GX6A 4CH1A 3SZ2A 4ECXA 1T05A 2MQLA 1M5OC 1FD8A 2Q6CA 5A8RA 4KTQA 1RTDB 2IMWP 4FF1A 4DN9A 4Q0BB 2LXFA 3HKWA 2WW8A 3W2VB 5KT6A 1JLFB 4ILMA 3RBEA 1HNVA 1XMQF 4C8LA 3C8YA 3MPYA 4CO2A 2VA3A 1SH3A 5EWGA 1DLOB 2VG5A 2H9ZA 3MM6B 4X65F 2M7SA 4F25A 2RS2A 1KQGB 1IR0A 4DJBA 4ED7A 3BJYA 4URGA 4U9RA 1R43A 4BHQA 3D2WA 2J0XA 3DXBA 1X5TA 2HQIA 4LT6A 1AUDA 3GIMA 3PFOA 1J2VA 3H5UA 2XZWA 2B4PA 4IDKB 4CO0A 1O0PA 2UVUA 2ZH3A 2DNRA 2OSRA 1YJ9S 4NLXA 4PUOB 3POTA 5LMUF 2B56A 1SV5B 2ZOGA 2YWEA 1JLQB 2F8EX 5LSOA 2MKCA 2QYCA 3NAIA 3OTEA 2J6SA 1OIAA 3KOAA 3QGHA 4B3MF 2VFTA 4MMOA 1LWEA 4FS1A 1Y7PA 4J9SA 1QUPA 2WK4A 2WONA 2K1RA 3THTA 2MQPA 4FBTA 5JJBA 1P9QC 2FY1A 2GW8A 3CGIA 3M32B 4B3RF 3E01A 3T6JA 3Q0AA 4A48A 3CULA 2HS3A 2ASJA 1LWCB 3OLAA 1XMBA 4NZ7A 2FJAB 3JB9k 1U24A 1X4GA 2GC8A 2HWTA 3B78A 1TL1B 5GAGU 1DTTB 2RRAA 2H5EA 3SSQA 4BBYA 1FVQA 2ZJQQ 1H3DA 2NSBA 3M2UB 4F4KA 3RW6A 1WEYA 2YH0A 5B0FA 4JI5F 3HXMA 2RF2A 2E29A 3M30A 3U02A 2E9TA 1KQKA 3DFEA 4NLOA 4IG3B 3MDFA 3DRPB 5KFMA 5H9EJ 3DLKA 4YR2A 1HBUB 2CQGA 3UCUP 5AXNA 2IVYA 2WB1D 1H6KX 1FKPB 3FSXA 3LF0A 4OLPA 3G6XA 4C8NA 4OX8A 2CQBA 5DG8A 1D9DA 2BOPA 4JI6F 3LAKA 1HQUA 4H4KC 2OPPB 2M70A 3CWJA 5GADI 2F9DA 2RRBA 3DGPA 4MYUA 2MSTA 4I69A 4PG7A 3M2VB 2VC0A 1U6BA 4C8MA 2GIQA 1KEKA 4X4QA 3HVTB 3MMCA 3RRHA 5J1EB 1G6BA 4B17A 3PXGa 1TV6B 2CPEA 3IO1A 4MFBB 3V6DB 3HVRA 3CEDA 1X9SA 1PILA 1FESA 1Y5NB 5EUHA 5AE2A 4ECYA 1L3TA 5J2MA 2LEPA 1UVIA 2HNYB 2GV1A 2DGOA 2O3DA 1TKXA 2ZNYA 2WSFC 3MOJB 1SC6A 5F8IA 1RT7B 2RS8A 4DR5F 1KTQA 1TP7A 2XWXA 3RRKA 2DNMA 4DPOA 3IXQA 3JYTA 4PXDA 2FJDB 3RW7A 5HN0A 4CTAB 3TVKA 1N88A 2VASA 5KOWA 3PDNA 3DRRA 3SCIE 3LGNA 4IR1A 2F8MA 1X5OA 1B64A 1N56A 2IVMA 3BS9A 4MKBA 3DRXA 4R25A 2COLA 4KV8B 4B02A 4N56A 4KJIA 4USIA 4GO5X 4JV1A 1MROB 1ELOA 5T7LA 2YKNB 2YNIA 2R8HA 3MM7B 2EFNA 2VBWA 3NWGA 2ZD1B 3CJ5A 4WZQA 3M2RB 1IUJA 4IYQA 3HMJG 4ZVEA 2FJVA 2RILA 5C24A 3UPFA 2GGPA 3NKYA 5KT2A 4NLVA 1VRUA 2DCLA 1AW0A 3EPGA 2M9KA 5IWAF 4PXCA 3CSKA 4I68A 2QA2A 4IR9A 1VBYA 3SQGB 3SFUA 2XSJA 4KKOB 3J7YI 1NJWA 1W2IA 3J80Y 4RW9B 1UWBB 4ZP9A 4KSEB 5E5NA 4CT8A 5M2UA 3O2IA 4X4TA 1VS3A 4C8OA 1HYSA 2E1AA 3KHHA 1FDBA 1NK6A 5C42B 2UUWA 3F56A 4WFXA 2MZ1A 3EZ5A 2I38A 4NOHA 1X0FA 3KNAA 1FF2A 3I55S 4DR4F 1N8RT 1S79A 2HNZA 1DFDA 4ERDA 3K5LA 3OFGA 3PW7A 1LFWA 4EUVA 1A7GE 1U2RA 2K3KA 2QMXA 4DSIA 3CJ2A 1RISA 4NMLA 1TFYA 2OIHA 2DNNA 4F4ZA 2DB1A 5GAEU 2HAIA 3MM5B 4B3OB 2YKQA 4D3GA 4WYLA 5J2QA 2C3OA 1TKTB 2UUCF 2UP1A 1C0TA 2OFGX 3KJVA 1IKXB 1KSPA 4RW4A 3LOUA 4TKTA 1HPZB 1KD1T 3M9MB 4UY85 3GFXA 3ZZTA 3BQ0A 2B7CB 3RB4A 4NA2A 2AD9A 3Q22A 3VTIA 5BR8F 1FKOA 3LP1A 4IFVB 2LQ9A 1ZM4A 4HI1A 5KG6A 4EU0A 3K2YA 4X84A 3T5JA 5HROA 3EXYA 4F2RA 3ZZUA 3QIPA 2CZVC 1BQNB 3V4IA 1Q8LA 2V2KA 4ZHRB 1URNA 2O01C 2Z4PA 2GHPA 4GC6A 2AYGA 2K3IA 3E51A 4OMFG 2JHEA 2KXFA 3H98A 5DG7A 4QIGA 2AU0A 3KMQA 1PGZA 1LQ9A 4PWDB 2EG2A 5I3UB 1GX5A 5JVGQ 3DNCA 5L1LA 2KYZA 5DQGA 2GX8A 1HNIA 3IWXA 2FJBB 2KT5A 4B9TA 2HHWA 1S0NA 2U1AA 3T9ZA 3IRXA 3N6LA 3PVXA 2MXYA 2AV5A 4LVOP 2DHXA 3BO4A 1Y0HA 3CVKA 2KXNB 3QJPA 4PG5A 3OSNA 4RW6B 1TKDA 2ADBA 2MGZA 3GYXB 3J7A1 4CO3A 4NCBA 3DRYA 1U26A 1NJIT 2DRAA 2N4DA 2V0NA 1D1UA 2PFFB 2KHCA 4D3HA 4WYWA 5F8JA 3MR3A 3G8SA 3SSSA 4EBEA 2B5JB 3I5AA 2J9EA 3LP0A 5K14A 2KM8B 4DSJA 1P8GA 3SV3A 4QPTA 3KLHA 2W7PA 2B4OA 5F41A 5EDWA 4WU3A 1WG1A 5EWFA 4O44B 3U1NA 3THVA 1T94A 2I1RA 2GQ2A 2VV5A 2C2DA 4ZP6A 2W9BA 4C98A 3PACA 2V4JB 2LEAA 4K50A 4DL7A 3I6PA 3ZFVA 5AXMA 2W7AA 1LW2B 2ZDOA 1TR0A 1MWZA 3M1VA 3KK1A 2W25A 5KFEA 1RT5A 4F4XA 3C2PA 2Q1LA 2NUHA 2UVRA 4X4UA 1VGYA 4NZ0A 4ECRA 4NYOA 3KG1A 4R5PA 1SJQA 2YTCA 5M2RA 1EETB 4ZVHA 4RW8A 2DNYA 2CQ2A 1FJ7A 3TR5A 1QE1B 3BSCA 2NQPA 5DDRC 1Q7LB 2DISA 2P9GA 2A1BA 4I56A 4RW7B 5IM0A 3DRSB 4E0DA 4OHYA 1DURA 4ATNA 3L7OA 4DL0C 1VBZA 4CI0B 4RNMA 4AXJA 1RTDA 1YHQS 2VBYA 1FE4A 5E3AA 3TI0A 4B08A 3H5XA 2LA4A 4KR0B 5HBMB 2OPQB 2JRSA 4AUKA 2KG1A 5K8OA 2R9LA 1VQOS 2MJUA 2QSWA 2MKKA 1DLOA 1RT4A 2VH7A 3MM6A 4B9SA 1U1PA 3T5LA 3OL9A 2X1BA 2HS4A 1UW4A 2DK2A 4FZVA 2CQ3A 2ZOFA 2P6TA 4TLRA 1MSWD 1GTEA 5LJ3Y 2PSZA 5D8HB 3CDEA 1RT1A 4OV1A 5SUHA 4W90B 2VG6B 3MEEB 3MMJA 2B9YA 5DS7A 5K8PA 2DR8A 3PRDA 2A2DA 3KFWX 4F67A 4LIWA 3VQSA 2F8HA 2AP6A 2DCUB 3IG1A 4KT0C 4P6QA 2DNZA 2XGQA 1SV5A 2RSQA 3FVYA 5IS2A 2HMIB 1H2UX 3HHLA 4JI3F 2SXLA 1S1XB 4NLGA 3AA8A 3QAEA 2OMOA 2JC0A 3DOKA 5F8NA 3FDSA 3P3DA 3KTQA 2PE8A 2QZ8A 5LSLA 4C11B 4WFAQ 3G6YA 2FLLA 4K4UA 5KT7A 5GMKa 4HT5A 3D0GE 1YG0A 3FRZA 2L9DA 1DAXA 2OLWA 2EFGA 3R5AA 2XCAA 4DV2F 4Q2LA 3D1QA 1DTTA 1IM4A 4QWDA 1JLBB 2ACYA 2FD2A 3FMBA 4ECZA 2XLJA 2CQCA 1GAOA 4WU2A 2J9DE 5KFAA 4DDFA 2J0WA 3MM9A 2XY6A 2YY3A 4DL6A 3D1OA 4C3KA 1K9MT 2WSEC 4IG3A 5E7OB 1HI8A 3DRPA 1E6YA 2NPIA 4OX9F 5E3QA 1OSCA 3G6VA 2CZ4A 2BQUA 4FXDA 1QJHA 2LVWA 2RQKA 4I6YA 1FKPA 5DJBA 1D3WA 1VQ5S 3W3SA 1WEXA 1MW7A 2VQFF 2UXBF 3DC2A 1S48A 3OTCA 2FHJA 2MZJA 5LXRA 3EX7B 3UDCA 4J9QA 5HP1A 3HJFA 4C0BA 1RT2A 4ZPTR 5KFZA 3QLHB 2KU7A 3GYNA 2HRYA 3W7BA 2CQ1A 3GSDA 1K0VA 4DX8H 4N41A 1N5QA 3BR8A 3CMES 2IJNA 1YJRA 2BM0A 4C3MA 3FJ2A 4K2XA 5A6PA 1R8PA 5BYQA 3HVTA 4QIVA 4LF8F 1P27B 1P1LA 2L48A 3MR5A 2Q66A 1C1BB 1ZAVA 2IA0A 2DO4A 1FJCA 3SXLA 5KFNA 5ADZA 3MTJA 2L9NA 4MFBA 4ZPVR 3V6DA 2DGQA 2DITA 3LPYA 2M3DA 5IXUA 4O0IA 4Y2CA 3G6ES 4LF6F 3HHLC 5H9FJ 3HT3A 2VPXB 3HI9A 4WXOA 4OHZA 2HNYA 3KLEA 4PPDA 3IRWP 3KLGA 1HBNA 5GAHI 1I6JA 5KFBA 3GIIA 2Z2MA 1CC7A 1OQ3A 3BGRB 2VOOA 2GCFA 3DLGA 3ITHA 5CYQA 2QA4S 2OMLA 4TQRA 1RT6A 1KHVA 2HWIA 1V6HA 2NXUA 5KG5A 1HR0F 4ZPBA 1LKZA 5KFHA 3K0JA 1S1UB 1M5KC 4Q43A 4YP3A 3M8PB 3WC0A 2IFXA 1RDRA 1G1XA 3TRGA 4HDHA 5THWA 1MROA 3OFFA 4LQ9A 4A8FA 4PPZA 3SEOA 4J9OA 5D3GB 1C0UB 1V3ZA 4R0EA 2UV8A 3MM7A 1KC8T 3IGVA 5B7WA 3UFCX 3OVSA 2ATLA 3N01A 3M2RA 1PC4A 4IFYB 1D8ZA 1G7CB 2EPIA 2XNQA 3KKFA 2L3MA 2CQ0A 5A0YA 4URSA 2RB7A 2NREA 2EFOA