1N5TA

Crystal structure of a monooxygenase from the gene actva-orf6 of streptomyces coelicolor in complex with the ligand oxidized acetyl dithranol
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
112
structure length
112
Chain Sequence
AEVNDPRVGFVAVVTFPVDGPATQHKLVELATGGVQEWIREVPGFLSATYHASTDGTAVVNYAQWESEQAYRVNFGADPRSAELREALSSLPGLMGPPKAVFMTPRGAILPS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ActVA-Orf6 monooxygenase
publication title The structure of ActVA-Orf6, a novel type of monooxygenase involved in actinorhodin biosynthesis
pubmed doi rcsb
source organism Streptomyces coelicolor
molecule tags Oxidoreductase
total genus 26
structure length 112
sequence length 112
chains with identical sequence B
ec nomenclature
pdb deposition date 2002-11-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03992 ABM Antibiotic biosynthesis monooxygenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.100 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1n5tA00
1FVQA 1JK9B 5B0GA 1YG0A 2IYIA 3QMQA 3TNVA 3WDOA 1AFJA 2FTRA 2K7KA 2PGCA 3BB5A 2EW9A 1YJTA 2XMKA 3I9ZA 4DPOA 1VQSA 1YRXA 2LXFA 2FB0A 3T9NA 1KVJA 1N5VA 2BJEA 1FE4A 1Q53A 1VQYA 1AFIA 3LGMA 1W2IA 2AP6A 5B0EA 2LDIA 5A6PA 1SQEA 2RSQA 3K7RA 2VV5A 4HI1A 2GCFA 3BN7A 2N4CA 4HL9A 2K1RA 3FGVA 3KG1A 1P6TA 1MWYA 2GFFA 1KVIA 1OPZA 4Y2IA 3MZIA 5B08A 3UDCA 2KKHA 2XMTA 2GA7A 4F67A 1N5TA 3BDEA 4Q2MA 1FEEA 1Y3KA 2XMJA 2OFHX 1Q8BA 3HF5A 2OKQA 4Y2MA 2HLUA 1GXTA 2RU9A 3CJKA 1WD6A 5K9FA 2Q3PA 3KNGA 2XMUA 1Y3JA 1OQ3A 1TL4A 1P8GA 2QLWA 2XMVA 1FESA 4YDXA 4A47A 3FMBA 1N5SA 5IXUA 2ACYA 4A46A 3HHLA 5B0BA 3MCSA 4FNIA 1S6OA 1X8DA 5F0WA 3TRGA 3HHLD 5F0UA 2RMLA 4A4JA 3HFKA 2HIQA 2PD1A 1K0VA 2HFNA 2W4DA 4FNHA 4Y2KA 1APSA 2BJDA 4HH1A 2LQ9A 1R6YA 2ROPA 2G9OA 4DN9A 4ZOSA 1CC7A 2OD6A 3F44A 5B0AA 2K1RB 2GO8A 4A48A 1CC8A 3TOQA 5B0CA 2ROEA 3HHLC 4NPOA 2RILA 1SI9A 1URRA 2GGPA 2N7YA 3IWLA 5T7LA 3LGNA 3HDSA 3E8OA 2GV1A 3KG0A 2QIFA 1IUJA 2GGPB 2FIUA 1ULRA 3CJKB 2ASYA 1Y0HA 2ZDPA 1Q4RA 2AW0A 3LO3A 2BUNA 5A6WA 1CPZA 3BGUA 1Y9OA 1X7VA 2HLTA 3BM7A 1JWWA 1Q8LA 2IYGA 2ZDOA 3HHLB 5B0DA 3HX9A 1FVSA 2VH7A 2LQBA 1LQ9A 3IWXA 2KT2A 5KAKA 4HH0A 2OAUA 2KT3A 1MWZA 2AJ0A 3VTIA 1X0PA 2HQIA 2HFOA 1TR0A 2N4DA 2W4CA 4NL5A 4ZA1A 1FD8A 2OFGX 4Q2LA 1OQ6A 5B09A 1TL5A 2K2PA 1V3ZA 1YJVA 2IFXA 4OJ3A 1S6UA 1AW0A 2CRLA 3DCAA 4OJGA 3BF4A 2JDJA 2BBEA 1TUVA 2W4PA 4EFAC 1GXUA 2QLXA 2XMMA 3BR8A 1YJUA 3DXSX 2K7JA 4U9RA 5T7LB 1KQKA 3QGPA 1YJRA 1QUPA 1TZ0A 1FE0A 1OSDA 3FRYA 2L3MA 2OP5A 4OJ1A 4YEAA 1U7LA 1RJJA 2OD4A 3KKFA 2FHMA 1N5QA 2XMWA 4DL0C 2ROGA 2AJ1A 1SB6A 3GZ7A 4HI2A 1XBWA 2QYCA 4OIXA 2BYCA 4QOTA 4OJHA 5B0FA 2OMOA 2KYZA
chains in the Genus database with same CATH superfamily
1Y4ZB 1HNZJ 3H4BA 2YH1A 1WNEA 1FK9B 3NGDA 1WG4A 2DRDA 3KHHA 1RT2A 1W25A 1DQ9A 3M4XA 1KTQA 1GQEA 2ALYB 2KKHA 2FLPA 2J5AA 2YKNB 2KDOA 1RBOB 4QR0A 1QAIA 2W8LA 4HT5A 3HHLA 3W2VB 2HAIA 3MCNA 4O3NA 2KM8C 4UY85 4Y2KA 2QL9B 4EK2A 4B3SJ 1VRQC 2GO8A 3PJXA 1ULRA 1NNDA 3P45B 1P1TA 1FWKA 1Y9OA 2ZNZA 4KHRA 3TAPA 2ZH7A 2BJ9A 3ILJA 3IR7B 1OY8A 2XZDB 4DEZA 2UUCF 2YQ0A 2HHHJ 1O6XA 2AYMA 3DGPB 1FXRA 2MTLA 4OX7A 3UI3A 3IAM9 4N77A 4MKAA 4A8MP 1SC6A 2HHWA 3BO3A 4ZKAA 4OX9F 2PT0A 4RUHA 2DXDA 2J7KA 2GCFA 3PV8A 3QBCA 4DSLA 1HNVA 3K89A 4Y2IA 3QIPA 1NK7A 2DGVA 2W4DA 4TY8B 2KRRA 3UE2A 1IN0A 1JLFA 1WF2A 1RADB 1Q7YT 2PFFB 1UL3A 2YWEA 1RTHA 1S1VA 4ZPTR 2R7RA 4Q44A 3OSPA 4XDCA 5IC6B 2M88A 4DV1J 1NHUA 2YKMA 1SQGA 3MMJA 4LSLA 4OJ3A 2MQMA 3ENAA 4RBVA 4DQIA 4ED7A 5KFKA 3CJQA 4NRUA 4P6QA 3A8KA 5ETTA 1H7WA 4W90B 4DFPA 2RKIA 4FN5A 2ADCA 2VG6B 3M7VA 2BE2B 3JQJA 3RAMA 3CT9A 4YR3A 3AOBA 1SH0A 2B5JA 2HS3A 4NRTA 4DX6A 2FZKB 5SZTA 1RWPB 4K2XA 3DLKA 3DYAA 2VFVA 2BW2A 4DCOB 1FTRA 4DCPB 1MU2A 2QLWA 4N76A 3D4JA 3VVUA 1L3SA 1J5OB 3EZUA 4DV0J 1F9FA 3MECA 4HKQA 2KZMA 3NCPA 3TO8A 3OL7A 2DBBA 2AZ1A 2UXCF 4CO5A 1G2EA 1HWUA 1Q16B 2GGPB 2DISA 2HMIB 4KGZB 5EHHA 3LAMA 3HT3A 3BGUA 1IKYA 2Y8YA 2CUYA 2K3KA 1TR0A 3TEHB 2B9EA 1IXKA 3QFWA 3MEGA 3MMBB 3N5BA 1ZETA 4F02A 2BMBA 4K2JA 3MM8A 3MAHA 2EFGA 1LKZA 3JAMY 3DOLB 2GMHA 3EGWB 3SSRA 5KFAA 3QRQA 1S0NA 3AA8A 2HEKA 4C2MA 3R27A 2YNFA 3E3XA 2MGZB 4JI6J 5T14A 4GKKJ 3PW2A 3I82A 1X4FA 1GMUA 1G1XA 2VKRA 3UD4P 3OV7A 3MPUB 4K5SA 5B08A 3KG4A 3CD6S 1PJ7A 1UCNA 1M1KT 3W9JA 4ZVRB 2V4JA 3TRGA 2E1CA 5C24B 5LSRA 4ZLLA 2AJ4A 2Y3YA 4WKRA 3H0PA 1GX5A 2RE1A 3JAMU 4CLUA 4WK1A 3BH6B 3DN9A 4C11B 2XYHB 5F8HA 4WP8A 4C8KA 5D77A 1KNZA 3DOKB 2D41A 1HD1A 2JDJA 2FJXA 2DNMA 1TMJA 4ZPBA 2F9DA 3H5XA 4KPYA 2L3MA 1F5AA 4K4WA 3BQ0A 4JYAJ 1RT3A 2W1BA 5IFMA 1YZ6A 1UVKA 5B0FA 4NLQA 3JTNA 2OIHA 5DRKA 4KSEB 1VQSA 2QX0A 2ZVSA 4DX8H 4ZP7A 2A6MA 2K1RA 2VF3A 2I1RA 2DO4A 2M0GB 1NH8A 4M5HA 3D0HE 3VGVA 4J9LA 1Q86T 1YX2A 1L3UA 1BLUA 1CQNA 3OTOF 1WC4A 3NLCA 4U8VA 1HIYA 4NE9C 1ACMB 3H98A 4LSNB 3CDWA 4ZP9A 1QY7A 2IIHA 3NOCA 3QATA 3U7JA 2PMZD 2HW3A 3U1NA 2EVZA 4EWTA 1HLWA 2RILA 3R1HA 4N56A 1YHQS 5J2QA 2CQBA 3GIMA 2P9CA 1C0TA 4DV0F 5B0DA 1GAOA 3HXMA 1UWBB 2C2EA 2ADBA 4V1Ak 2CJYB 1PJ6A 3G4SS 1Q8KA 4OZ0A 4XDDA 2GJFA 3LF0A 1EQ0A 2I5JA 4LFAJ 3CMES 4JI4F 4M5GA 4OJ1A 1T94A 2XMWA 4BWJA 1FJCA 1XIQA 2O01C 1XN9A 4F4AA 3C6TA 2VQEF 2HQFA 1WOOA 1Q95G 2DGXA 4LF9F 3MGJA 2W9BA 3ZZOA 1RHMB 1OPIA 2Y1RI 4JI3J 5J2MA 1SCJB 3BJYA 2VG7A 5F9NA 3M8PB 4JI6F 2X1FA 1HQ2A 1WKLA 3DNCA 2J9DA 2VC0A 3FK4A 3GG0A 1Q5VA 4ZITA 1B99A 3MF5A 1UVMA 2ZZNA 4LSZB 4BBYA 3VTIA 2ZITA 2HQIA 4OFZA 2W4CA 3KJVB 2WSCC 1YKWA 2WVEA 3M32A 4QIVA 1FRMA 2CQ2A 4I2PB 3M8QA 2GW8A 3ZFVA 2VIHA 2MLXA 5IT9U 3KMSA 1WC6A 3Q8QB 1CS4A 2XS7A 1F1BB 1JMTA 2H3EB 2PGCA 2Y0BB 3WC0A 2RT3A 3EWGA 2KRBA 3OPKA 4KJIA 4QYZK 5L1LA 2AKWB 4UOHA 3OXFA 2BABA 2EFNA 4NCGA 4KPCA 4YB6A 4X4NA 3BR9A 3SBMA 4Z37A 4ZVQB 2LDYA 2HIQA 3R3TA 1WI6A 1WC1A 3W62A 2EK6A 3OR2B 2MZJA 1B7YB 2HG4A 3Q8VA 3AOCA 1F2GA 3I0RB 2HVIA 3KLFB 1BQNA 3BDPA 4DV3F 3R97A 2KFNA 3QGIA 2Q1LA 2N4DA 4ELVA 5A8KB 1E6VB 2OJ3A 4DSEA 3R6LB 1CJVA 2HQGA 2RRNA 5KFEA 4DV5F 2AT1B 3LWMA 2VONA 3M2RB 3HHDA 1IBLF 3L9ZA 3GFHA 5DS7A 2PMHA 3GSIA 1R31A 3GWCA 4IG3B 3R2CJ 1JK9B 2C3MA 2XWYA 4P72A 1M5KC 5AJ3F 4ECWA 2APOA 4PWWA 3K57A 3CDBA 3C14B 1RQ0A 4QW9A 2HS4A 5KG5A 3HZGA 3ZXWA 4P2MA 4IKAA 3IGNA 3W8GA 2ZZMA 3OUYB 1S6OA 4N41A 4G6VB 2H65B 2EBGA 3D5MA 5HBMA 1UTAA 3TVZA 1JXEA 1FDNA 2PDAA 2HGNA 5CCLA 5DG8A 4RX6A 2XNQA 2VICA 1VQ9S 2AJQA 1QAJA 4YQWA 4NEZA 5E3RA 1WHYA 1UVJA 1WTBA 3JYTB 4UZCA 3MAAB 1UEKA 1VQKS 1UMJA 1V6HA 4DUZF 2VFSA 4FVCA 3C46A 4DR6F 2E44A 1R27B 2C2OB 4W98A 2C3UA 3DI6B 3EM1A 2UUTA 3Q0AA 3HZEA 3JXOA 2FTRA 1P9QC 1A9NB 5HP1A 4ZVGA 1FXLA 3T1YF 1TKZB 3RAQA 3A3PB 4OX6A 2RHSB 3RRKA 2QMWA 5CHCB 3KUGA 2R8GA 3MPVA 2ALZA 1OQ3A 1NDKA 2E7VA 4KFBA 2W01A 4LF4J 1BQXA 3WZ0A 1U1PA 1T7PA 2DHXA 4NLSA 3MUMP 3V81A 5D0GA 2X1AA 4ENOA 3SSSA 1N0UA 1H0HB 1VRTA 2MJNA 4A48A 4E0DA 2DK2A 2F65A 4DG1A 2J7WA 3PCOB 1NZAA 2ILZA 2W2NP 3JQKA 2IRXA 2RDIA 5D15A 2MQ8A 3BKFA 3GIJA 2DNNA 5J1EA 1VMBA 1VBKA 4KH0B 5GAEI 1N54B 3DRRA 1H38A 4P2XA 4DOZA 5CYMA 3I5CA 1HHQA 2DCUB 5A8WB 5KFWA 2IDLA 3BSOA 1OSDA 1NJYA 1TL3B 4LF1A 2LP4A 2ZC3A 1XMOJ 2JEGA 3IMQJ 4KGVB 4LRFA 2EK1A 5CA5A 5I4MA 2QT7A 1JKHB 1S9EB 3GIKA 1IKWB 2MZSA 3QIDA 3WQPA 1P6TA 5CH7B 4A8SA 1YLXA 1EKSA 2I9SA 3TAMA 2EFQA 4YY3F 3SEOA 1DARA 3QGHA 3CCZA 2DNRA 5B0BA 4X4TA 4WZQA 2MY8A 2F9JA 1KS2A 3Q23A 4MIAA 4JOUA 4IFYB 4EBDA 2VBYA 3DLEB 4FDFA 4TQSA 2C2ZB 5LJ5Y 3GYXB 4JI5J 1DURA 3FUYA 1F2HA 1YQHA 2HWHA 4HH0A 2IVMA 3AQPA 4IQXA 1RTIA 4WKYA 2Z2YB 4AL5A 2XYGB 2LEPA 3OFHA 4ER8A 4GKJF 2RIJA 4YHHJ 2VQFJ 2G2YA 3P96A 1RBLA 2CPYA 1F5BA 5ITHA 1Q79A 3D6TB 1HNWF 5B0GA 3KJQB 4LF6F 3UFCX 2V5HG 3RU0A 2P6SA 1G7CB 3WX8A 4OI6A 2BV3A 3LGMA 4OQJA 3J7YI 4C8MA 2CZ4A 1T05B 2W2MP 1XR6A 2GFFA 2GHWA 2IM1A 5J2PB 3UDCA 1NM2A 2DB1A 1IBMJ 5EWFA 3C15A 2OKQA 3FVYA 4OZ1A 1QSSA 4KKOB 1N5SA 4IH5A 2XB2D 2F5GA 2POKA 4NLRA 2DNKA 3PW4A 3CULA 2JLGA 1U09A 4B9NA 1WDTA 2BACA 2G4BA 2X51A 4OZNA 2CG8A 5J1NA 3ZTPA 5K5MA 1BQMA 2OTJS 2A6OA 1HR0J 2NS1B 1UA1A 5KFRA 3W60A 5A2QY 1HWLA 1QE1A 2CWKA 4CLTA 2VFUA 2YKPA 1QJHA 5EDWA 4C8LA 2UVVA 5ETNA 3KLIB 3KOAA 3L4BC 4DLGA 2AD9A 4WWSA 3EVWA 1YJNS 1KWMA 2Z30B 2OO4A 4UZBA 4O4GA 3M8SA 3G8QA 4MK7A 4Y6IA 1PYOB 5ETMA 3VAJA 2A2DA 2VB6A 2OPRB 2QA4S 1HBOB 5D8HB 2KO1A 4RBTA 2HIYA 3ZTRA 2IA6A 3I0SA 4RW9A 3M2UB 5A2QU 5KFCA 4R0EA 2VBWA 2WSEC 4CO4A 1S7IA 2ACYA 2VJUA 2XULA 3SFUA 4FNHA 5AE3A 1FWPA 2A10A 1RWNB 1U24A 2MQLA 2AGOA 3DDNA 1J5EF 3K5PA 2NQPA 4K0KF 1TMMA 2D3ZA 3FCVA 4R5PB 2FIUA 4EBCA 4C6AA 3HX9A 4DV2J 5IQQA 2VD3A 4L3NA 1FFGB 1FFWB 4CO1A 4V19X 4ILLA 4ZLJA 1XC9A 3ILIA 1H6KX 2DNGA 3O3LA 4RZRA 4EYIB 1L5UA 2JL9A 2Y1LB 2V8GA 4DR5F 4QCLA 2W7OA 1CJTA 3E01A 3PY8A 3HFZB 4GO7X 1U02A 2C2DA 5F8IA 3QRRA 3QPIA 1T3NA 1N8RT 2MZQA 2UP1A 2DR6A 3X1LB 2C42A 2R7XA 4KE5A 1H2VZ 4R25A 4Q2MA 2LXIA 4ZVFA 3PNIA 5KFYA 4YDXA 4HTIA 1TAUA 4FNIA 3W3SA 1JJ4A 4D3HA 2JEFA 2EBEA 4M8LA 2B56A 2IY5B 1C2PA 3G86A 3M2VB 4ZLPA 5JVHQ 5DG9A 5D78A 1VISA 3AOAA 2HYIB 4KHPF 1G3OA 1M90T 2FLNA 4R0JA 2OSRA 4ILMA 2W7PA 1QTMA 1C4AA 4YR0A 3CJ8A 2XCAA 2GNKA 3K8WA 1RACB 4IDKB 1HR0F 1FHTA 4DV7F 1UFWA 4RW6B 3SCKE 3TX8A 3L3CA 4O3RA 1TZ0A 2RQMA 4X62F 4CDIA 2JLFA 2ZM6J 1IKVA 1UWAA 1N5QA 2AJ1A 3A13A 5DQGA 4WXWA 2CQDA 3GILA 4DV6J 5M2PA 3HHEA 4NZ7A 4X66J 3CWJA 3CVKA 3HD2A 3V6DA 2JHEA 4EZ6A 4AQYF 3BB5A 3N5FA 3PDNA 1FKOB 4Y00A 5ETLA 3TVKA 1DLOA 5I3PA 4CLWA 4I0WA 4ILRA 4Y2AA 3AT1B 2DJWA 4OYIA 1IJFB 2E5JA 2MQQA 3MR7A 1CG2A 2YPYA 5F0WA 3GR1A 5HLFA 3KDOA 4UUWA 1S9GA 1RT2B 2NXJA 2OD6A 1TU0B 3QWUA 4KBIA 4CLZA 2QIFA 4ES2A 2CDRB 3FQKA 4NXMF 4ICLB 4NASA 1NDPA 2IYGA 3HHLB 3FCHA 5AXLA 2LA4A 2R2TA 5EUHA 1R0CB 2QLBB 5DDPC 2JEJA 3RRGA 5DG7A 4WU2A 2EI5A 1S6UA 5MLCV 3PR5B 4C4WA 3BQ2A 3V4MA 2BZ2A 1R8CA 4NA1A 2G0JA 2R4FA 3RUBL 1FXDA 4DV2F 2RDDA 1S6PA 4K4ZA 3J7AN 3V2UC 1CEZA 1PC4A 4QPXA 3MR5A 2CG4A 3E51A 2P6TA 3I6PA 3DRXA 4FXWA 2XSJB 4USWA 4A8OA 3IBCB 3QAUA 2EW9A 3JSMA 4ZJQA 1YRXA 4RU9A 2ZD1A 4PR6A 2BXJA 5JUMA 2LU2A 3Q24A 1SL2A 2YNHB 3HVTA 1JLAA 1TV6A 2DNPA 1EKRA 2Y0SD 5LM7E 5DM6Q 4B9UA 2NXEA 2EKNA 4PCQA 1XNQF 4LF8F 2HNYA 1R0BG 1WG5A 4ZCLA 4UW2A 1HI8A 1LWFB 2J9EA 2UVWA 1X9MA 1N36J 1CJUA 1HNVB 2CKWA 2EG1A 2ZH3A 3HDSA 3ET6B 2SXLA 2ASJA 4ZVEA 1N88A 4LR8A 3QIPB 1DAXA 2F40A 2DD8S 4OMFG 4FF4A 5DO2A 1OQ6A 1R43A 4DJBA 3UCZP 4I64A 1HBUA 2HRUA 4F4KA 1XJWB 4RWWA 1UEUA 1S1VB 4C7QA 1S10A 2YKMB 1VQLS 4ECRA 4LSLB 5A8RB 4NZ6A 4DPOA 5HVGA 3HLUA 1LXNA 2AP6A 1WF0A 4JI1J 3K58A 4DR7F 2RKIB 4DV6F 1Y3KA 3R9LA 1M5OC 4RNNA 4RL1A 1U1KA 1NRKA 2BJ7A 2AMCB 4J9KA 2B5JB 5KTQA 1ZA2B 1RYSA 4ED0A 2W24A 1B0VA 4H4OA 4LBHA 3F44A 3DLKB 3DYAB 3TUPA 1IM6A 2RF2A 2DXFA 4F3QA 2LQ5A 3KXDA 1MU2B 1RAJA 3HMJG 3DDKA 3MECB 2R8JA 4X4RA 4IQMA 4NEYA 2BX6A 3JS9A 4GVBA 1U1MA 1NJXA 3BZQA 2F3JA 2ZBIA 4U9RA 3TJ8A 5BJRA 3M8WA 3NCQA 1C4CA 3NGKA 4OZJA 1WEXA 4M95A 2EFOA 1FDDA 3G9CA 4G1IA 1CVJA 4DDFA 5KFTA 3MEGB 2V9KA 1ITPA 4ANDA 3AB2B 2KTQA 1SQEA 2X1GA 3E2EA 2DIUA 4FKXA 1SBRA 5KG6A 2P5VA 1VDHA 3K2YA 2YNFB 4Q5VA 2RS8A 2CIMA 2J76E 3AJ2A 1KQGB 2K3IA 5BYQA 3LGNA 3J7YU 3IAS9 2J0SD 2N7CA 2F63A 2LA6A 2V4JB 4RBUA 3M8ZA 2HRYA 1SQFA 2B3TB 2H51B 1WSRA 4X65J 4FYXB 2HQDA 2QLXA 4J9VA 4C8ZA 2WRMA 5KFNA 1CBKA 1T03A 2G13A 1RA7A 4DR1F 3VGTA 4ED6A 2PI5A 4JI0J 5E3QA 4CLSA 2ZOMA 4HHJA 2K7KA 4IOCQ 1RT4A 2V8HA 2FDNA 1LWXA 1WKKA 2QSFA 1RT3B 4NLPA 2OPQA 1FRJA 4USHA 4J7CA 2HNZA 1NPKA 4JI1F 2F8EX 4DSFA 5HMWA 1NSKL 2VG5A 2K1RB 2MQOA 3F73A 3AXKA 3KG0A 4LR9A 4ZP6A 5HN0A 5L9XA 6AT1B 3ICLA 3R2DJ 4U7UD 2R8IA 2VH7A 1NO8A 1XTZA 1MN7A 4FZVA 2CWXA 4B9LA 4ECXA 3MMAA 1HQEB 4ZCMA 5HQLA 1NSQA 4PQAA 4DX7A 1ZAXA 4RW7B 4CM2A 3MUTP 1VYAA 1BUXA 2JC1A 3I56S 2RD5C 4PQUA 2R8KA 4B9TA 3LP0A 1I51B 3PRVA 5FLXY 2B4VA 1FO1A 3O8WA 3GV8B 2K06A 4HHUA 1KFDA 2M5YA 4OHZA 2D9OA 5CYQA 2L08A 2IVFB 1TK0A 3L7OA 2GX8A 1NJIT 2PA8D 4N8NA 4OZ5A 1LWCA 3HJVA 1JJHA 5GAGI 2RMLA 5D4NA 2H1YA 3PTWA 2HHQA 2XYPB 1TFYA 4M5LA 4LMZA 3QJLA 1DZ5A 3W1YC 2W9BB 4CCHA 1BGXT 3UWTA 5E0OA 1GT8A 5J2MB 3TI0A 4C0BA 4O0IA 1K47A 2VG7B 4NOHA 4RKUC 3O6QA 1N52B 5FLXU 1N34J 3I96A 3MD1A 3F0NA 1AW0A 4JV5J 3AQOA 1RISA 1UAWA 5CZVA 1TL1A 3IRXA 2ROGA 2GAHC 1T9VA 4ZS6A 2ZE2B 1XK8A 5FJ4A 5HO4A 1E6YB 5K8MA 2PN6A 5LMNF 3TZWA 1G6BA 2RVJA 2WOMA 3M32B 3MD3A 3GQCA 1Q8IA 2BQRA 3BREA 5KFGA 3J81Y 3FZ2A 4AL6A 2WSFC 4CYUA 2WW8A 1AXQA 1KVIA 4DR3J 4JI0F 1Z4UA 2HK2A 1U6FA 1BE4A 3TA0A 1N33F 1U2RA 3RYLA 1U6BA 4NLTA 1VFJA 1X4DA 2NR0A 1FRXA 3D68A 3LOUA 4QWAA 4F4XA 3CNQP 2XWXA 4NCGB 4YFUA 3S1TA 2CNNB 3QGGA 4LVOP 1X7VA 5L8RC 5E7OB 1F3VA 2PI4A 4HACB 1C1CB 3MM5A 1VBYA 3QAEA 1S1WA 1YJWS 3J81U 4ES3A 5CCMA 4M63A 4N8OA 2KZZA 2K7JA 2KN4A 4MKYA 5E5NA 1TAQA 3CJRA 3RG6A 1GMWA 2CZVC 1KLMB 4Z2XA 3I31A 9ATCB 2YWWA 1RWXB 4CQ1A 2CQHA 3NS7B 1CJVB 3PX4A 3VAMA 3D6MB 5L39A 3PACA 3GFZA 3MFHA 1FRIA 2QA1A 5BR8F 1IBKJ 2J0XA 2YXLA 2KYXA 1BWVA 4B3RJ 3JTPA 2B6AA 3VZHA 2FHJD 3CJSA 1FJ7A 3RGIA 2IJRA 1X4AA 3QWPA 2OPPA 2V2ZA 4LJMA 4C48A 3CW2C 4EO6A 1RWVB 3V4IB 1U48A 2WBRA 1YRTA 2OUGA 3W65A 3Q86A 5C42A 2ZFHA 2WTFA 2GHVC 3VAKA 2CVIA 2Y8WA 4DPUA 3PXGa 3NG8A 2IFXA 1R89A 3QT8A 3QGPA 1W26A 3K5OA 1S1TA 3B4MA 5ETVA 3KKFA 4IH7A 3W64A 5EN1A 4X4QA 3M1VA 3VAGA 1NJWA 4ED2A 4DWIA 4DV4J 1RAHB 4Y28C 1O0PA 4HI1A 4K4UA 4O44A 3J81j 5A0YB 3ILOA 2Q66A 2V50A 4WFYA 2MMYA 4CLYA 5LMUJ 2AGQA 5HMXA 2NLWA 3MCSA 3NCRA 5HP1B 3BKTA 1JLCA 5LJ3Y 1VBXA 1FA0A 1NXIA 3SCLE 1FDAA 3SDEA 1N0VC 5D0EA 2PO4A 1CPZA 3QNWB 5K20B 4KFBB 1JQGA 5G0RA 3DMJA 4F0HA 3V81B 2RH3A 4P75A 1VRTB 5IOLA 1LNQA 2W9CA 3BYPA 2Z2MA 4U7UK 5KT5A 2C3YA 4USMA 2FC8A 1TKTA 1VQ7S 1VIOA 2Y1JA 2V8PA 1S0MA 4USUA 5J1EB 4DL3A 2QFIA 4X2BA 2YKQA 3KJNB 4FYWB 2G0CA 4DUTA 3DRRB 4ED3A 3HSDA 1EJ7L 1N5VA 5CYMB 3L7PA 3D1OA 3MM9A 3H5UA 3VQTA 3R5CA 5AT1B 3DM2A 5HMZA 1DY3A 4OZ3A 4OL8A 1MMNA 5EX3A 5BXIA 1URNA 3MM6A 1UEVA 1NUEA 2F4VJ 2BANA 1IBKF 4DL5A 4JI8F 1SXLA 2UVRA 1DJ0A 4WK3A 1RT1B 2AYBA 1R8PA 2QLFB 1Y5LB 4DFKA 3I9V9 1HI0P 3ELHA 2JVRA 3GJQB 1RHUB 3C19A 3OLBA 3DOMB 1QUPA 1U8SA 1EB0A 2HRTA 4Q0BA 1NMEB 3M8RA 4YR2A 4H4KC 1Z2ZA 1U47A 4MJKA 2E5LJ 3I5AA 1RT7A 1U1RA 2XMKA 3I87A 3CEDA 1SUQB 1KEKA 3NY0A 3D9BA 4H4MA 4K7QA 1L3VA 3EE3A 3CF5Q 4PXEA 2DHSA 2NSCA 2R7UA 1M0SA 4KGXB 4USTA 3EGNA 2Y1IA 4MKVA 1WWHA 5IT0A 2AZ3A 3QT6A 2HBYB 3EDQB 3K0JA 4L75A 4LBPA 1KDNA 1LXJA 3FEZA 5KT2A 3BYRA 3C15B 2RUSA 2ASYA 1RAIB 2O5DA 1U0HB 1DTTB 3DLJA 1F9EB 3GJRB 4FKYA 4NLXA 1VR6A 5IWAF 3W61A 1OY9A 4NLGA 3FEYB 2YNIA 2U2FA 3PW7A 2QSWA 3HT0A 3NL0A 3R8YA 4CM0A 4ECTA 2XQCA 4M5KA 4JB8B 5L1JA 3IGVA 1PILA 2QYCA 2CNKB 1QE1B 2UUAJ 3BBCA 3H2UB 3CPWR 4L6V3 3QMQA 1YJTA 2ZKTA 3D6HB 4DL6A 4P10A 2B8QA 3GJTB 4LREA 1RCXB 3LALA 4TY9A 4K4XA 3K8VA 4LT6A 3ZZPA 5DZ6A 2GVZB 4B3OA 2XY6A 3EVOA 3OL9A 4F67A 1N5TA 1S49A 4O4GB 2H5EA 1X5SA 2M8HA 1X4GA 2PE8A 2XG8A 2DT9A 2DR8A 2FC9A 5HQMA 4OV1A 2XHWA 2XC9A 3PYFA 5F3TA 1PKUA 4OI0A 3FSXA 1HHSA 2L9WA 4WPAA 3I0SB 4RW9B 4YN3B 2E29A 2NSBA 5JJBA 4I68A 1QM9A 2Z0GA 4Z7YA 1F3FA 2PIIA 1N32J 2FVPA 3R7NB 1LQ9A 4MIBA 3OLAA 1H98A 2H5IB 3C2PA 1TL7A 2E9RX 4IR1A 4DL4A 1LWEB 5GAGU 4RNFA 2QEXS 4DN0A 5J2NB 4QU6A 3HKWA 3DGPA 4ANEA 2XMMA 2BRKA 3ZNJ1 1VRUA 3MEDB 5KOXA 5HJYA 2IRUA 2DNOA 3ULHA 2M70A 5DGBA 1NHVA 4OIXA 1X9WA 2D3UA 1JLQA 2PC6A 1VC5A 3IXQA 1CQMA 2ZWPA 1JXLA 1LK7A 4O23A 3PRDA 5HANA 3K5NA 2FPHX 1RWWB 1T02A 1HW8A 1X4CA 1JB0C 4IH6A 2BRLA 2HLUA 2MKJA 3PIPQ 1CJTB 2XMUA 4K59A 4E2FB 2BVZA 4UQGA 1PBAA 2BKOA 1K0VA 1HPZB 1OYDA 3I32A 3P5TL 4GVLA 2HVDA 1XNRJ 2IMOA 5I3UB 5SUHA 1S5ZA 2AV5A 4URGA 2IBKA 4BCAA 4TU8A 3DC2A 1REVA 5C5JA 4RUCA 2QGFB 2H54B 4RNOA 5F8MA 1AT1B 2OLWA 2ZH5A 2DY1A 3BR8A 2QL7B 1YJUA 2E1RA 5IV4A 3T1HF 3FRYA 1VCTA 4NLOA 5C25A 1X4BA 3LQVA 1U1LA 2MKSA 2BE2A 1K1QA 1SKWA 3D67A 1PC5A 3ZO7A 2HSEB 3P6YC 4K4SA 2FB0A 2JWNA 4AYBD 3O5TB 3SSQA 1W2IA 2CVEA 1VC0A 2HGMA 4RJVA 1RHQB 3UVJA 2XGPA 4WFBQ 3G82A 1Q0NA 2OEJA 3EXYA 4MFBB 3NGUA 3ISNC 4I4BA 4RR5A 3DU6A 1J5OA 2NYIA 5KFUA 3V6DB 3M6UA 3M30A 3GYGA 3LTOA 3BEGB 2HFNA 2LXUA 2JFDA 5KT7A 2UU9J 2VPYB 4FYYB 1IKXA 2UVUA 1S6QA 1DLOB 4KB7A 3IG1A 3GCWP 1B3TA 2GGPA 2DNZA 2BM0A 4X4PA 3IS9B 5A6WA 5DDQC 2WB1D 3DRYA 3OFGA 3AJDA 3HSZA 2OH2A 5HLFB 3GIIA 3C6UA 4Z7CA 1S9GB 4ZVOB 5LSOA 2KXNB 4J5OA 1VHFA 5CQGA 4EO8A 4DLEA 4NI2A 2R7QA 2DR5A 3M6XA 1I6JA 2XNRA 2VBZA 3ITHA 4DPXA 4OYWA 3OTBA 4QJVA 4F50A 4DZ6A 2I0XA 3NAHA 3OTCA 5ETKA 3CCWA 4U6PA 4HT7A 2DH9A 3UPFA 2UXDJ 1EIYB 1WACA 1YJ7A 2VPXB 1YWXA 2ZH2A 4J37A 5C24A 2DCLA 1RBAA 4IFVB 3I5BA 2UXBJ 3JSMB 2ABYA 1RLDA 3H2LA 2ZD1B 1FCAA 4RW8A 1OMSA 3HVTB 2CAJA 4A8FA 1JLAB 1TV6B 4ZCIA 4C11A 3MOJB 4XPCA 4A8KA 2JVOA 4DBQA 2J6UA 2XBPA 3QSYB 4LR7A 3GYNA 4ZJOA 1MWZA 4G1QA 2R9LA 4DR4J 4QWBA 3MCOA 2OEKA 3MPDA 4NA3A 1FTCA 1CJUB 1Y5IB 1YDLA 2O3DA 2RQKA 5LXRA 2PEBA 2V4RA 2FVQA 2HFSA 3AB4B 3OR1A 3SV3A 3HVRA 1U7LA 4FVMA 2B43A 3CIMA 2MHEA 1SB6A 4DL2A 1PCAA 4HI2A 2BJ8A 2DNYA 1XMBA 4YB7A 3KLHA 2DGSA 1UP1A 4F4ZA 1AUDA 4JP8A 2C3OA 4L73A 3ONQA 5I42A 4F2RA 3PO5A 2FJEB 1OS5A 1FJGF 2MB0B 2EG2A 3W2WA 4M5MA 3QQCD 1XR5A 1OY6A 5KFHA 3NOGA 5KFMA 3C8YA 1FD2A 4PZVA 1I94F 2LYVA 2MZRA 4X64F 1T11A 3F56A 4C9DA 1H2TZ 1T9WA 2NYHA 2B4OA 1EAYC 1N5YA 3JSYA 1YBAA 1K9MT 1MROB 3HHLC 4UT4A 2ZJRQ 1IUJA 2V69A 4QBUA 3HSJA 3W8PA 3IN5A 4LFCJ 1JNZB 5BYSA 4YS2A 3MM7A 2YH0A 2JNJA 3VWSA 4NMXA 3CCQS 1HNXF 1TVRA 2MHNA 3VHQA 4H4OB 2RF2B 1YJRA 3MWBA 1FX4A 1M5PC 1V5IB 2MSTA 4JI2J 1IVZA 1RABB 5KG1A 2Q79A 6FD1A 3C66A 4YUDA 1HNZF 2E5HA 1RA6A 2QC3A 1UZHA 4GVBB 4JUZA 3G6YA 2Z58B 1TELA 2J6SA 3LH2S 3SQGA 2W2PP 3MOZA 3CJTA 3M8PA 4PPZA 2CQCA 2VHGA 1KQFB 3CCJS 3AD7C 2KG1A 2DR9A 2IMWP 2CQ3A 4PXCA 1R0AA 1WTFA 3QT7A 1MWQA 2LQ9A 2RUGA 2BR0A 4WF9Q 4B3SF 2J9DE 3AJ1A 3SYZA 2M7SA 2I8EA 4V19J 1S0VA 1FRLA 2G1DA 4BWMA 4DUYJ 3IBFB 2KI2A 2QZ8A 2KT2A 3ZZ0A 3LP2B 3KJVA 1J27A 2NCKL 3UD5A 4BC7A 8AT1B 2OFGX 2L48A 1DFDA 1EP4A 2CRLA 4I2PA 2HHHF 2G2ZA 4FBUA 2CQPA 1AUSL 4DPYA 3FJ2A 4HTJA 4ELUA 1RLCL 2BA9A 4ZP8A 2CNLB 1JJCB 1JLBA 2IM2A 1CLFA 4CT9A 2UUBJ 2LQJA 3G2XA 2HNDA 3V6JA 5B0EA 4KRWA 4DU7A 5IM0A 1T03B 3JQMA 3J7A1 2OEMA 1NU4A 4ALZA 4QQBA 3CJKA 2RU9A 3FRZA 3SQOP 1KOOA 4ZVHA 3IWNC 2Z56B 3MDFA 2QA4G 4ED5A 4J9MA 4CO0A 2BJDA 3HHKA 5AXMA 2EFVA 2LCWA 2N7YA 1QTNB 4KC5A 4F3MA 4RU2A 2OPQB 1Q5YA 3D0GE 3DRSA 2HNZB 5A8KA 4DV1F 2QRRA 2E7XA 2ZBRA 3ENQA 4ZDNA 4CH1A 2VG5B 2F1FA 2Q43A 3MEKA 1HQUA 3NBPB 4M5NA 4LFCF 1T8EA 2WB4A 2EFPA 4IUFA 3O1LA 4ZIVA 1ZM9A 3ZZYA 1GNKA 5LXYA 3GSDA 3IO1A 1FF2A 1GH8A 2XHCA 2MKIA 1OPZA 1R8AA 3NKYA 1KP6A 4CLPA 1RT6A 3OUYA 5HVFA 1Z1ZA 4AFFA 1TKXB 4PQUB 4ZVUB 4XTTA 1A7GE 5F0UA 3LP0B 2PD1A 1U1OA 4HH1A 2KXHA 2V8DA 3G87A 3S7RA 2BW7A 1HKAA 2N82B 1XMQJ 1FX2A 1K8AT 1RTJA 4LRDA 1UFKA 1PG5B 1S4FA 1LWCB 4CZCA 5KFSA 2IM3A 4OYOA 3R5DA 4WBFA 2PMWA 5L9NA 5B09A 4I7FA 2NUHA 3QLHB 1V3ZA 3G6VA 4MYTA 2ZHOA 3AXMA 1NJZA 2IDEA 2FJDB 1RJJA 3ETMA 2FHKA 2KL8A 4AUKA 2RNEA 5KFDA 3BV8A 2KB2A 3DI6A 2D1CA 1G4CA 4C8OA 3UNYA 1K44A 3T9ZA 2MKCA 3WDOA 2NPIA 3BSAA 4GKKF 4KV8A 4L3KA 1NK5A 1RKIA 3AAWB 5A6PA 2DTJA 1TL1B 3RAXA 3IRXB 3QSIA 1XR7A 1JJ2R 2HZAA 1Q8BA 1NPPA 3J7ZT 3U1MA 2Q3PA 5I3QA 3FMBA 4QIWD 5FD1A 4OHWA 3T5LA 3VZIA 1HBNB 2AX1A 4EGLA 5GMDA 2OI2A 2G9OA 5ETPA 5KFBA 3TWZA 3AD8C 2G0IA 4EU0A 3OTDA 1ZPVA 4WJBA 2XMAA 1KSPA 4P52A 5IS2A 4C8NA 3GU0A 5CYJA 2LKZA 3FSIA 3LP1A 2MPUA 1TUVA 3DLGA 1NK9A 4P7VA 4JYAF 3EYZA 4DL0C 4ID5A 3MM5B 2ZHBA 3KHLA 1S1WB 1WORA 3IBWA 3PHTA 1JKHA 1S9EA 2YWHA 4B02A 1S1UA 3JSBA 2CADA 2VL1A 1SJ3P 1T3OA 3MHYA 2DGWA 1H74A 5IZHA 1GMWD 1I5OB 2B7CB 2MDAA 3PHEA 2YX7A 1FESA 4G3IA 4JV0A 1LFPA 2GC8A 3ADAC 3BH7B 2ZEJA 2WVCA 2B9XA 4PPDA 2W8KA 1RCOB 3CDAA 3DLEA 3RBEA 4C3LA 1U49A 1FRKA 4DSJA 7FD1A 2Z8QA 4NCAA 5F41A 4LF5J 2RDJA 3R5BA 4J9OA 3MTKA 2YNGB 3CMQA 4FXVA 1U2CA 1UVNA 2W4PA 2OPPB 4LFAF 1WHXA 4WFAQ 2EC0A 2I38A 5C42B 2DVIA 4I6WA 3MMCB 3TQEA 2ASDA 2FUG9 5MAOA 4OYMA 1OYEA 3SXLA 2F4FA 1NDLA 3FZBA 1S1TB 3KNAA 1BXNA 3KJFB 2N3OA 4PWDB 2FJVA 4FS1A 2RB7A 3CSKA 4JI3F 2M52A 1KHVA 3KHGA 4E8UA 2HPUA 1NEEA 3M6VA 1IM4A 4XK8C 2MJUA 4TNOA 1R6YA 2MKHA 4O44B 4UOFA 2DNHA 2HAFA 4K4TA 2A3JA 1RXOB 3BGRA 4TU7A 4AL7A 1VQ6S 3JB9k 5HI7A 3V5RA 3T6JA 4UOCA 4ZN1A 4DQPA 4DR2J 2KVQE 5KOWA 3UR0A 1LK5A 2MZ1A 1BMQB 4O3SA 3PYGA 1UPMB 4PYAA 3QFHA 2R42A 2DYAA 2WVDA 3KLIA 3SI8A 1VQNS 3W7BA 2WBMA 2J0WA 2V8VA 2DH7A 3CJ0A 5F8JA 7AT1B 2H4YB 2P8IA 3LW5C 3NGSA 5G0RB 3DMJB 1S9FA 1U1QA 5KG2A 3MPYA 2QFJA 4I2QB 1YG0A 1TP7A 1S72S 2OPRA 1HBOA 4Y65A 1Q53A 4HL9A 3K17A 3W9HA 4PKDB 1FEEA 2VC1A 3RR8A 4ES1A 5B7WA 5ETQA 4TXSA 5GAHI 2NPFA 1KRPA 3QRPA 1YK9A 3R6GB 1ZS6A 2RQ4A 3OW2R 1M1HA 3PJ9A 1TUGB 3ZNUA 3MM9B 2YWGA 5T7LA 2BKNA 3L09A 3HSGA 3DM2B 1B4SA 3D28A 3RJMB 1HD0A 4BC9A 4C97A 1EETA 2JOQA 3MM6B 3VR1A 1FD8A 2YX1A 2DH8A 5E2QA 3IRWP 8RUCA 1XERA 4DCJB 2UUCJ 3CC7S 3D6FB 2C2KB 4LVNP 4U96A 3X3UA 4J9RA 1X5TA 2IC3A 3SCIE 4RNMA 4MK8A 5K8NA 2GO9A 4BHQA 4HR2A 3FQLA 4P2FA 3R5GA 4ITSA 4OX9J 3H20A 3NRBA 4J9SA 1EX8A 4OHVA 3PR4A 4FXDA 4Q0BB 2IJNA 1HWKA 3WIVA 4ZK7M 1TL4A 1V5VA 3BO4A 2R7TA 2LQ8A 3O2IA 1KBRA 1X8DA 1WJ9A 1RT7B 1HBMA 2EWHA 1UJ5A 4H4MB 5GADI 2CPDA 2KJVA 1T95A 3A8JA 1JLEA 3AFGA 2VZ9A 4MH8A 2HK3A 5KG3A 3NS5A 4IDKA 5H9FK 1T9UA 4IYQA 4RW4B 2J0QD 1ZA1B 5HVHA 1GFWB 2GVDA 1W7WA 1C1BA 3CDEA 4WP9A 2ZVIA 3N4WA 4ECQA 4EYHB 2HHXA 3IP0A 1QD1A 3TW0A 1RHRB 5EWEA 5H9EJ 1FKOA 4ZPWR 3I4HX 3DXBA 2LLZA 2B4UA 2B9YA 4H54A 2AYGA 1LOUA 3IA0A 4LF4F 1M5SA 1RWKB 1VS3A 3R1LA 4QIGA 3TUJC 3CCUS 2HZCA 2BE9B 1YRUA 5DZ7A 2Z57B 2UXCJ 5FDLB 4ZHRA 3OVAA 1URRA 4B3OB 4X84A 4ICLA 4ED1A 1NK8A 5CXTA 2EEYA 1JWWA 4P74A 4WFXA 1BC6A 2HFOA 3Q8RB 4DQSA 2D9PA 2XM3A 3GV7B 2B7BB 2QJ3A 3CE8A 4MKBA 4TLQA 4QYRA 1FE0A 1WUUA 3HM9A 3D2WA 2CXEA 4F3OA 1FKAF 3KK3A 4DQRA 3OL6A 3NNCA 1FERA 1XMOF 1TL7B 3PRBA 2OMOA 1DTQA 2XSJA 4KTQA 2IBOA 1R8BA 1WEYA 4IRDA 4CNYA 2QE5A 4CTAA 2D74B 1VOMA 4CLFA 4OLOA 1X4EA 5CD4A 2J8AA 1VK3A 2DITA 5BYRA 1F6TA 1VRUB 2YNHA 3ISND 1NSPA 4P7TA 1MLAA 1U0SA 1D0EA 1GXTA 3M9MB 1JLQB 2CJQA 3BGOP 3HP6A 5KFZA 3VAFA 1LWFA 1IWAA 3U1LA 5KFIA 4AE5A 4X4SA 4TN2A 3S8SA 4GO5X 3ET6A 2EC2A 4UF4A 4LIRA 1YGYA 4JI5F 4LBIA 2V2VA 3C3LA 2Z4PA 5HSPA 4DS4A 2C1EB 2OHDA 4OYBA 2LECA 3CCMS 3TZZA 3MAQA 3N0VA 1UJ4A 2AEMA 4BDPA 4YHHF 1VHIA 2VQFF 3NNAA 1TKDA 1S59A 1UW4A 1REVB 2YWFA 4NXNJ 4HLBA 3C16B 4ERDA 5A8RA 1SKSA 3UQSA 1CULA 3NNHA 1MN9A 5GMEA 1GEHA 3HPOA 3OTEA 2QN6B 4WIQA 5C25B 4MT1A 3WBZA 1A0OB 1IBMF 2XEXA 2IJFA 4Y34A 1SC3B 3UDLA 2FY1A 4A46A 3OTOJ 4WTOB 3FFIA 2DHAA 3DLHA 4UY8T 4ZOSA 1Q1KA 3UVJB 3IR6B 3G82B 5F3ZA 2JFKA 1NDCA 2HLTA 4W92B 2X3DA 1FVSA 4UUXA 2OTLS 1Z2LA 3CC2S 3M30B 3QZ7A 5KAKA 1V3RA 2MZTA 1MW7A 5LL6d 2ATLA 1IKXB 1S77D 1S6QB 1JLGA 1ZOTA 3IG1B 3ZC4A 2UV8A 4JI4J 4KH1B 2MLZA 3OJSA 2RU3A 2E66A 4QWCA 1SC1B 4O0NA 3C6UB 1KFSA 2HURA 2R7WA 1D09B 2VQEJ 4RUBA 5IC4B 3H4DA 4R8UA 1PAEX 4HHHA 4LF9J 1AZSA 4NI2B 4LQ3A 2NXUA 2WW4A 2EKYA 1WI8A 2KHCA 3GLJA 3PKYA 5HROA 3HHLD 3ITHB 4C0HA 2VPZB 4KGMA 3UD3P 3BSCA 4PRFA 3GB0A 1J2VA 2D69A 2KT5A 2V34A 1RUSA 3I55S 3E8OA 3TANA 2FYXA 5RUBA 1Y5NB 5KFVA 3LGHA 4CLKA 1VJWA 2DGQA 1EZZB 4HVZA 5JXSA 1ZM3A 3O44A 4ZCKA 2E5IA 3RBDA 1S1XA 4ZA1A 4RW8B 2MEWA 2HHVA 1IBCB 4EFAC 2WZ1A 2PEHA 2GZOA 1T0TV 4G1QB 4WYLA 5DDRC 1PSDA 2AHOB 4GC6A 5CABA 4OX8A 2P2CB 4X4VA 2VBXA 1SKUB 1VQ4S 1VQMS 1IR2A 3GPAA 3OR1B 1TUWA 4NXNF 1AROP 4ZPCA 3RB6A 3P5BP 3KLHB 2A2CA 3SCJE 3PZPA 4DHVA 3HFKA 4J9PA 5I42B 4ECUA 3VGSA 1U25A 4OYXA 1APSA 2NZ4A 4DN9A 5B0AA 4IOBA 3W2WB 3TUIC 1JLFB 1AYEA 5B0CA 2RHQB 2O1PA 5M2UA 4M5JA 1HNIA 1LFWA 5ETOA 2IVYA 3DHWC 1RTHB 2BKPA 3HFVA 4DV3J 4OYZA 1KN6A 1X0PA 2XO7A 5GAHU 1JX4A 1N5YB 3WC2A 2XLIA 1HQEA 2JX2A 1RHJB 5J1PA 1RSCA 2C3PA 4OJGA 2WONA 1PBUA 4RW7A 5GAEU 4DV5J 2ZM6F 4NLDA 3T5HA 3P3DA 1IBLJ 1XBWA 3MM7B 4X66F 2VDHA 2XMJA 4ED4A 4W4MA 1OJ4A 1I1GA 3KK2A 1TVRB 4E98A 3LANA 1UA0A 1KVJA 5AJ3J 3DU5A 4O3OA 4PG8A 1KD1T 1OO0B 1YIJS 4NZ0A 3CD7A 2C22A 3TUZC 2YKAA 1MMDA 4JI7J 4MTPA 4FPIA 4EUVA 5IXUA 4NYPA 1FT8A 4RUAA 1QUVA 4UOGA 3KLEA 4TVAB 1AA1B 1HI1A 2NXNA 4OI2A 1U2FA 1NK4A 1LW0A 3SQGB 2E9TA 1O51A 2FLOA 2FVCA 3PW5A 5IT4A 2FJWA 3DFEA 3FMWA 5IT9Y 4NX9A 2RRAA 2JC0A 1IKYB 5HATA 4DMZA 1R0AB 2VFTA 1RZMA 4IG0A 2CPEA 3D3BJ 1GTEA 3GFXA 3ZTOA 3MM8B 5GADU 2FJBB 3EDRB 1M5HA 1ZH5A 3L95X 4DUZJ 2OD4A 4DR6J 3D66A 2ZE2A 3TX0A 1E6YA 4DL7A 2R7OA 9RUBA 1HL6A 1SIZA 3IR5B 4KHMA 1KLNA 2CJAA 4ZVSB 1EP4B 1DHMA 2HHUA 3T1YJ 4YDDB 1BWEA 1QSLA 2FZCB 1SV5A 3VCDA 2A1BA 3QJPA 1JLBB 2YY3A 4ZPAA 1WC5A 5AXKA 2HNDB 1N36F 3UN5A 2CPHA 2PSZA 5K8OA 2R2RA 5IM0B 1DQAA 3CXCR 5ETRA 3CJKB 3HCXA 2DNQA 1SH3A 1VJQA 2X7IA 4HACA 5KFQA 1C1CA 3QT5A 1FI4A 3MEEA 1T9YA 4ECVA 1NB2A 5FIIA 3Q8PB 1IQTA 5U47A 4TKTA 4GRSA 3D54A 4WE1A 1VQ5S 3UCGA 5K14A 4DSKA 2VOOA 2OP5A 2ZWOA 3B8HA 5KT4A 2NZCA 1KLMA 2L9DA 2XS5A 4GC7A 3DRSB 2DGUA 3T5JA 2ZUAA 4OJHA 4B08A 2ZOGA 3BPDA 2E1MC 3I9ZA 3KK1A 2LXFA 1HQUB 1ICEB 3CC4S 1JNRB 1QDUB 4PYDA 3FGVA 2COLA 4FP9A 2XLKA 2DO0A 4N47A 3CCVS 2YBVA 5IV3A 4YY3J 3HI9A 2LU1A 2W9AA 3ILLA 1AB8A 3N28A 1RYRA 2FHJA 2F8MA 4I6YA 1ZYQA 1F0XA 2GAGC 3BSNA 2GIQA 2VASA 4HYKA 4DF8A 1YSJA 3TOQA 2E7WA 4JI7F 3A3OB 3V4IA 1ZAVA 1RT6B 4KAIA 1Y00A 5J2QB 3PFEA 3W63A 3SMZA 2KG0A 2LQBA 2N3LA 1C0TB 1WEZA 3F41A 1ZZFA 4OZ2A 3MR6A 2GMJA 2CPXA 1LW2A 3UW1A 3B6BA 2I5JB 1RTJB 4GKJJ 2FY8A 1SH2A 4LQ9A 3H42A 3GZ7A 1VQ8S 2AIRB 3RBXA 1HNWJ 5E33A 8ATCB 4I7FB 3UR3C 4J9NA 4LF6J 3C6TB 4IRKA 1Q81T 5KG0A 2IA0A 1BD6A 4QIEA 3H8YA 2VA2A 5A0YA 2BJ1A 2GA7A 1NZ8A 2KXFA 4ECZA 3TZXA 2V9WA 5KFOA 3TJ9A 2DGOA 4NWBA 1Q7LB 4KGKA 4PUOA 2OMLA 4KV8B 2HFUA 2PA3A 5DQHA 1H2UX 4NPOA 2WHOA 5KFPA 1NKEA 4Q43A 1D9FA 4LRBA 3OT9A 2CPJA 2Q6BA 2B4PA 3BGLA 3OVSA 4CP5A 2CFXA 3UDEA 4X65F 2HKEA 3M9NB 1HARA 2D3O1 4DS5A 2DPIA 3M8QB 3K5LA 2ZJPQ 3A8EA 2FHMA 4ZLNA 3CCRS 3P49B 2Z2LA 4NYZA 4OZLA 2KYZA 1D3WA 1CS4B 2V2KA 4B3TJ 1AFJA 3LP1B 1RAEB 5AE2A 4LF7J 2YKOA 2DR7A 4QR1A 4B9MA 3SFGA 3DLGB 2HHTA 1DBDA 1ZM4A 2VV5A 2FQQB 3EJMA 2BQ3A 1SKRA 3MZIA 4ID5B 2BOAA 2ZNYA 4DZDA 3LWLA 4ZJLA 2KFZA 3MXHP 3NEKA 2XI3A 3ZZZA 1S1UB 4ZVPB 4Q8EA 3PKMA 3WIUA 4FPRA 2R3VA 1J5EJ 4K0KJ 1KC8T 1RT1A 3KDNA 2BUNA 2M8DB 4ED8A 4I1TA 2ZH4A 3BM7A 1T9XA 3CJ4A 3K59A 1BQNB 4M5DA 2BJ3A 2AJ0A 2MKYA 4UTGA 4U7CA 1FNXH 2CYYA 1HMVA 1QSYA 2DEIA 2BBEA 3DOMA 2V67A 2AQ4A 1GXUA 4P71A 3W66A 1UKUA 1PIEA 4ECYA 3FC9A 3VVTA 4DR5J 4F8RA 1HFEL 2ZZTA 4QOTA 1IJEB 2CQIA 4CNZA 2M9KA 4B17A 1SUQA 3KWMA 3MR2A 4YOEA 3HULA 1BY9A 5CD4H 2XMTA 4DSIA 3BDEA 5K8PA 3HF5A 1FNMA 4O3PA 1WC3A 3B78A 5L46A 1S97A 1B70B 5KT3A 1EARA 1R6VA 1Q78A 4FF2A 1ELOA 4WFZA 2CQ0A 5HBMB 1A6LA 2CA9A 4DF4A 1SJRA 3LA0A 1RT5A 3DRPA 1RP5A 4KHPJ 3V6HA 3SV4A 4B9SA 1IR1A 4Y3CA 2AW0A 1U0HA 1DTTA 4CH0S 3PFOA 2XO6A 2GHPA 3US5A 1N34F 2H5JB 3G6ES 1NK6A 3IM8A 2LMIA 1YJVA 4A8XA 2RQCA 1QLNA 4JV5F 4C3KA 2XZTB 4DV7J 3BGRB 2HFZA 4X62J 1IQZA 4J9UE 4I67A 3NGTA 1KR4A 3J80Y 3TAQA 1HYSA 1VQOS 1SL1A 3D1HA 1R8HA 4AQYJ 2DIVA 4USVA 4LIWA 4I69A 1FE4A 3R7SB 1M1GA 2GVZA 3G8SA 3KYLA 4DR3F 4DPTA 3N6MA 4TQRA 5H9EK 4RPFA 3SZ2A 2I2YA 5K9FA 2R2SA 4B3TF 1VLOA 4IO9Q 2MQNA 4LF7F 4LF2A 1FDBA 3RR7A 1U6ZA 3ZZTA 1RHKB 4NLWA 2ROPA 3EPGA 3FBEA 1QVGR 1GMVA 3DLBA 2FZGB 2V2QA 1HW9A 4DG1B 1FNOA 4CLLA 3J80U 4NXMJ 1X5PA 3OQ2A 2J7UA 4WFNQ 3H5YA 2KT3A 3THPA 1LWEA 3PEHA 3B54A 3Q8SB 5J2NA 2Q6CA 3MEDA 5T7LB 5THWA 1WHVA 2VPWB 3G71S 4WIIA 1L3KA 1WHWA 1EETB 1FKPA 2QA2A 1UVLA 4O4RA 5LSLA 1QAXA 4KQZA 1R7IA 4Y2CA 2E9ZA 1S12A 2WVFA 4G65A 1XQIA 3CIZA 1N6QA 1F9HA 1CJKA 3CD5A 4N7TA 2AU0A 1DRZA 2MYFA 2IC3B 2J9CA 3QO9A 4HDHA 1NAQA 4KO0A 4WTYA 3TAMB 4QIFA 3U27A 2O66A 2IRYA 1I3OB 4CRJA 4B3RF 3VV2B 2IAJA 1XNQJ 5F8NA 4LF8J 1HPZA 4A4JA 4CO2A 5I3UA 1JXVA 4F7VA 4YP3A 4EI2A 5LT5A 3EMTA 2KM8B 4P2SA 2OPSA 3UN3A 1NLKL 1S48A 5M2RA 2CPZA 2CQGA 2MQPA 2BQUA 3CMAS 1HBMB 4ZN3A 4PAAA 5JVGQ 1VIXA 5IQ6A 4USJC 1RTIB 1PGZA 4F25A 1RWUA 2DGTA 3OHAA 2BEFA 5LOQA 3QYYA 5KFXA 3TVYA 1X5OA 3OXGA 1JLEB 1REGX 4FF3A 4LFBJ 2IYIA 1RB0A 2FD2A 4DV4F 4IOAQ 4P9SA 4LRCA 1NH7A 5KFFA 1X31C 5L38A 2GVDB 1P27B 5ADZA 1C1BB 1C0UA 1VI7A 4DR7J 3RB0A 4PG6A 3BKUA 2YTCA 4MFBA 3HVAA 5LMUF 3ENWA 3VAHA 1RTDA 4EEYA 3CJ5A 2VDIA 3G6XA 1Y11A 3KLGA 2ZKUA 3A4TA 3EVMA 3D3CJ 3A12A 3TYTA 3POTA 3IS9A 4PEOA 2JEIA 3UCUP 1V9OA 5D3GA 2YQ3A 1KQSR 3KHRA 1BQMB 3GCXP 2HWTA 3N6NA 3N01A 4DU8A 4EMDA 4NL5A 2Z2ZA 1OIAA 5D4LA 4Q2LA 5EWGA 3PX0A 4WCEQ 1FK9A 4USIA 4ZHRB 1S79A 3FBFA 1XEZA 4O3QA 3LPYA 2AGPA 3RW7A 1B64A 4OLPA 2YKNA 3W2VA 3H5SA 4F4WA 3SIPB 2J8SA 2GQCA 3CUNA 3T6BA 1RWMB 2HQ3A 3KK3B 1L3TA 2V6AA 3T1AA 1DTQB 3B82A 4IFVA 3K5MA 3IC1A 1OSCA 3KFWX 2DNLA 3KTQA 4CTAB 5C2GA 1SJFA 1PO6A 2F4VF 4ZMMA 5D6GA 4K50A 4J9QA 4J90A 4CH7A 1KHWA 4KR0B 2GV1A 3D1QA 3BBBA 2HVEA 3KUHA 3A1YG 3BN4A 3PW0A 5AXNA 4TLRA 2E5GA 1ROFA 2AJ2A 1MMLA 3H59A 5JMNA 4CT8A 2MY7A 3TP2A 4DR1J 3MUVP 4C3MA 1CSJA 1WOPA 2BM1A 1WC0A 2E5LF 3E01B 3ZTQA 2MKKA 3GR0A 7FDRA 4TY8A 4DFMA 4CWBA 4YB5A 2P9GA 4XPEA 3NS6A 4LFBF 5H9FJ 1RGVA 2R2UA 1HHTP 2AJFE 1CULB 3A3NB 5G4DA 5F8LA 2QL5B 3CDUA 4C0OC 3LPEA 4IRCA 1X4HA 6FDRA 2G1HA 1MROA 3TARA 4OHYA 2R7VA 4XO0A 4L76A 4FBTA 3D0IE 2GIRA 5AE1A 1GK8A 4KIAA 3IWXA 2VG6A 4M1KA 3UN2A 5E3PA 3T5KA 2ZH9A 2X1BA 3FFIB 2HBRB 4HEA9 4PG4A 1U8WA 3DCAA 3BO2A 4F4YA 3VALA 1VQPS 3ZZUA 3CJ2A 1IKVB 2VOPA 1RAOA 3RB4A 4XAKA 2HFVA 4L72B 3KMQA 2UUAF 1NK0A 4TYBA 3TNVA 1JLGB 4K4VA 3AODA 2O67A 3TZYA 1VQYA 1AFIA 4NA2A 1MWYA 4B3MJ 1ZPWX 3PJWA 4FF1A 3OVBA 1WOSA 4KY3A 4I56A 2HMIA 2G2OA 1XWLA 2H4WB 1UPPA 2W7AA 3FEXB 5F9LA 2CJ9A 2MSSA 4OI4A 3UDVA 4CI0B 4R8UB 1AZSB 2XGQA 1FRHA 3RTVA 3CCSS 3MMBA 1H73A 2RJZA 5E3CA 1Q4RA 2VODA 2DKOB 1N32F 3DOLA 3LP2A 5HROB 2HHSA 3HKZD 1RTZA 4K4YA 1UVIA 4WXOA 1NKBA 1S0OA 2XI2A 2MGZA 2GQ2A 2F8HA 2HGLA 1GXLA 2ASLA 3U02A 2HWIA 3CCES 1S6PB 1NHKL 2BYCA 5HAOA 1FFSB 3BPSP 1S1XB 5LMNJ 2AYEA 3T9NA 1SJ1A 3PIOQ 1B7FA 1X9SA 4MIWA 1SVDA 2QMXA 2RAQA 2U1AA 1M5VC 1NKCA 4Y2MA 3JSRA 4ZVTB 2NREA 1N33J 4F04B 3DOKA 2LEBA 5EX0A 2M2BA 2KU7A 4NLVA 2HNYB 2ATCB 1EHWA 4C98A 1XNRF 4GMKA 4OV6A 2V4QA 3Q22A 2ACMA 3FKBA 1YZ7A 1W2BR 3AY0A 1S76D 5A76A 3M05A 3BQ1A 1BHNA 2BDPA 3HHNB 4YB1P 4AXJA 3MPWA 4WZMA 5H1SV 3NBPA 2VJVA 1UETA 2ZOFA 1HBUB 4N5SA 3WHIA 1B0PA 1HNIB 2RRBA 5L1KA 2C2NA 5KT6A 2AEFA 3Q89A 2JJ4D 4XIUA 2WONB 4QWEA 3KLVA 4MAKA 4LSNA 2LFVA 2RSQA 3OFEA 2AF6A 4NLUA 2XTJP 4M5IA 3DKDA 5BR8J 1TKXA 4A47A 5DDOC 3RZAA 2VFRA 2I6WA 3KK2B 1SJQA 1UWBA 5D4PA 1EQMA 3PEJA 3CO0P 3I4PA 1K73T 2UU9F 1RE1B 3ZTSA 3M9OB 4B3MF 2DXEA 2ILYA 3GTYX 3BBFA 1S7HA 1K1SA 4ATNA 1SIWB 2HVZA 2XY5A 3KLEB 1TK8A 4PXDA 2J6TA 4BS2A 2OAUA 3QLHA 1FJEB 2QG9B 2HQCA 2M4MA 1LW0B 3DXSX 2OSQA 2EPIA 2VUGA 4D3GA 2V94A 3CJ3A 4J91A 2P9EA 3BS9A 4AD6A 2ZUGA 2OGUA 1IR0A 3MI7X 3MR3A 1F60B 1ZAWA 1FVQA 3H90A 1D8ZA 2BE7D 4IG0B 1OWXA 3T3FA 1B0TA 4NYOA 4OHXA 1WELA 3RRHA 4PABA 1U4BA 2IM0A 1D8YA 2UXDF 3B4DA 5EGYA 2V63A 2XCPA 2UXBF 1HBNA 4NLYA 3G8TA 2QMUB 4FS2A 1WKJA 2H48B 3JTOA 1CC7A 2QV6A 3A8IA 5D0RA 1VGYA 1SV5B 1RAAB 1YI2S 2D3OR 2RS2A 4RO0A 4DR4F 2DRAA 2A18A 1WSVA 1TL5A 3OBIA 4QR2A 3GV5B 3GE9A 4G1PA 4DFJA 4A8QA 2CJBA 4OYPA 4RNHA 2LEAA 2D7SA 2Y9HA 5KG7A 3W5ZA 4WYWA 3MEEB 2JSXA 3S6EA 3TEGA 2VU5A 1ZBTA 4WU3A 4WE1B 3HK2A 3QZ8A 5K14B 1RT4B 3K7RA 1HWIA 2N4CA 4LRAA 3OR2A 3OL8A 3J7Z5 2VKZG 4F2SA 1ZTTA 3KNGA 3I0RA 3EUNA 3KLFA 1RAGB 4DXLA 5HL7Q 1VBZA 3KK1B 4KYZA 1E6VA 4A8WA 2ZJQQ 2L41A 3M6WA 3BGFA 5DM7Q 1PYSB 3EXCX 1SI9A 3IWLA 4JI8J 1SJ4P 3EICA 2R7SA 4X4UA 1IWGA 4QU7A 1RAFB 2JH3A 3P8BB 3GONA 3M2RA 3MURP 1RWOB 2YNGA 2ZBCA 3NMAA 4IG3A 3G96A 4URQU 1QAYA 4DQQA 2W2QP 3MMAB 5T41A 3CGIA 1KQKA 1NBEB 3C14A 1YITS 3NWRA 2WAQD 2UV8G 2ZH6A 4JI2F 2GJIA 1KOHA 3AD9C 2ERRA 2WVBA 1RU1A 3ETOA 1H3DA 3GMGA 1YTYA 3VQSA 1JIHA 1P1LA 3MMCA 1ZM2A 3GJSB 2CJXB 2HHPA 2EXUA 1LW2B 2BJEA 4ZPVR 2PFDA 4PWDA 2FJAB 3W5YA 3N9UC 1H7XA 4PG7A 5CYQB 1U1NA 4U95A 3PM9A 4CO3A 1UJ6A 2HZVA 3Q8YA 1T9TA 4F0KA 1NPRA 1YBUA 2FGCA 3OFFA 3IFEA 4Y0FA 3OSNA 3JYTA 5E41A 3MAAA 2DPJA 2YX4A 1TTHB 2ZDPA 4DUYF 5HQ8A 2MLYA 2QTWA 1Q8LA 1KKHA 3CCTA 2CNOB 4PUOB 1Y10A 5IWAJ 4ZIWA 1YJ9S 4H4KA 5F8GA 3HO1A 4OYAA 1FWLA 1GTHA 1TKZA 1S57A 2BOPA 3N79A 2WCXA 3AH6A 4QYZJ 3EZ5A 3NGRA 4I2QA 4PXBA 2ZBPA 1KTVA 5DGAA 2CZ9A 1Q82T 2UUBF 2WOMB 2YQ1A 1U45A 3HVWA 4WP3A 2GMLA 4RWXA 1LV5A 2KHDA 4JV1A 3FCWA 4S0MA 4CYUB 3PVXA 4MYUA 3ISZA 3ZZRA 2XS2A 2FLLA 2KFYA 4PWUA 3OD2A 1HWJA 2CDQA 3UO0A 4URSA 3H25A 2W2OP 2KH9A 2KJWA 5DLGA 2V0NA 2H9ZA 2IHR1 5A8WA 4ETZA 4AT1B 1TL3A 3R5JB 5GVQA 1RK8A 4Q7AA 4ZPDA 1VLYA 2HBZB 3DHXA 1IKWA 2K8GA 1O5JA 4MK9A 3Q8UA 3PX6A 4M5DB 2B0GA 1RI7A 4F26A 3HD1A 3IM9A 4IR9A 3DLLQ 1HMVB 4I6AA 2AWZA 4B9VA 4PG5A 3WX4A 4IFYA 3QJJA 4ECSA 2W25A 2C2RA 2LVWA 1N4LA 1TK5A 5HK4A 3ENVA 2JZ5A 1NSAA 4Q45A 3FDSA 2B6AB 1N48A 2HBQB 1S4EA 5CAAA 2KVIA 1YVFA 2XZWA 2DHGA 3CB4A 3MTJA 2IPOB 4TU9A 1H72C 1XMQF 2CPIA 3R5AA 4DI6A 2AX0A 3GG1A 2F7VA 2MXYA 3EPIA 3GP9A 1SC4B 3VAIA 5KFLA 3V6KA 4LUBA 1D1UA 1NB7A 3Q2SC 1N56A 2B9WA 4RW4A 3Q2TC 1WG1A 2ZHAA 1RT5B 3DRPB 3OJUA 2XLJA 4ID8A 2E1PA 3T1HJ 1T05A 2OELA 4NCBA 3PYEA 3NAIA 5J2PA 1PYTA 1V3SA 3NXZA 3GFYA 3TA1A 5L1IA 3GIRA 4KKOA 1F5CA 3M1VB 1DQ8A 1KVKA 4M94A 4P73A 4A8YA 3CD0A 1TQLA 2YWKA 2NUUG 4USKA 3OHBA 3BN7A 4MMOA 3FSYA 3RBZA 2M3DA 5E3AA 3T41A 3HJFA 1WDDA 2FGOA 1U26A 1HYSB 1X0FA 1MNEA 3TA2A 1VK8A 2C2MB 4JBCA 1YBTA 1K0TA 4QW8A 1MG7A 2WK4A 1JLCB 3H2VE 4UQTA 2XSFA 2ZBQA 5FDLA 2HVHA 2X3GA 3MFIA 2E1AA 1D9AA 4C8YA 3SDEB 4K8RA 3AHPA 3AA9A 2GQQA 4F0MA 4RLEA 3TQ1A 2HS0A 2QYGA 4HDGA 2DHHA 3MCMA 4FYDA 1UW9A 2AEJA 1P9YA 2ZC4A 4QZVB 4ETXA 2W9CB 1R3NA 2GIFA 2ZH1A 1TKTB 5DJBA 4ANCA 3L7UA 5KG4A 3M2UA 4BLGA 5C7PA 5CZXA 2FVSA 3R7BB 1TFWA 1SL0A 3P4UB 5DETA 3W9IA 4Q8FA 4DX5A 3M8YA 3PO4A 4KT0C 3W5XA 4K5RA 3FBCA 4R5PA 4L74A 2UZAA 1WD6A 1FKPB 5DLFA 3KUEA 1P8GA 2VA3A 4CIOA 2YPZA 3DDIA 2GJ2A 3H7HB 3THVA 1KONA 5ETSA 1NCLA 3PYDA 3RW6A 1N6QB 2JLEA 1CJKB 1ZTWA 4OI1A 3CTRA 2CQ1A 3OXLA 1CC8A 2ROEA 2DRBA 3QO9B 2BANB 4U8YA 4AXIA 4KO0B 5C2CA 4ELTA 4IO1A 3LO3A 1UZDA 1O8BA 4LF5F 2IAJB 1Y7PA 2CJKA 2UUWA 3N6LA 5HMYA 2CQ4A 3FBBA 3CO9A 2A0FB 2FVRA 1MSWD 2CPFA 5GMKa 5KFJA 2OPSB 2DEJA 4NMLA 1LEOA 4TYAA 1WF1A 1RU2A 3NP5A 3NMRA 4F36A 4X4OA 2ZH8A 3C16A 4EBEA 3EX7B 4JV2A 4EZ9A 1GX6A 3D7SB 1X60A 3H40A 1RDRA 3DGVA 4DPWA 5DQIA 2LDIA 4YMEA 2C28A 1FJGJ 3M2VA 2B8PA 1QVFR 2L9NA 3KG1A 3EGVA 3LUYA 2OFHX 1I94J 4QPTA 1Y3JA 2XMVA 4X64J 1UFLA 3VGUA 2FHOB 4FYVB 3T19A 1S99A 2DY9A 1C0UB 1PAUB 1D9DA 1VC6A 5D4OA 2GS8A 3NWGA 2NXCA 1FEHA 4RW6A 5HJXA 1Y0HA 5D0HA 3PG9A 1RTDB 4DR2F 2ZDOA 4U67Q 2QLJB 3LAKA 3Q83A 3TR5A 2R8HA 1ZZNA 3TJAA 3KLGB 3S01A 1HA1A 2YVSA 1HNXJ 2K2PA 2V68A 2B51A 3POTB 3RB3A 3VF0B 3BF4A 2QO3A 3FNNA 2XY7A 2YNIB 1SPBP 5D3GB 4YEAA 3CCLS 3EZOA 2JRSA 3THTA 1PJ5A 1RKJA 4OI3A 4QWDA 3EGZA 3UNGC
chains in the Genus database with same CATH topology
1HYSA 1Y4ZB 1VQOS 4G1IA 1SL1A 3D1HA 1CVJA 4DDFA 1R8HA 3T9ZA 2MKCA 5KFTA 3MEGB 3WDOA 2NPIA 3BSAA 3H4BA 2YH1A 1WNEA 1FK9B 2V9KA 2DIVA 4GKKF 4KV8A 4LIWA 3AB2B 4I69A 3NGDA 1FE4A 1WG4A 1RKIA 3AAWB 1NK5A 2KTQA 3KHHA 5A6PA 1SQEA 2X1GA 3G8SA 1RT2A 2DTJA 1W25A 1DQ9A 1TL1B 3RAXA 3M4XA 3KYLA 3IRXB 1KTQA 1GQEA 4DR3F 1XR7A 3E2EA 2KKHA 2FLPA 2J5AA 2DIUA 3N6MA 1JJ2R 4TQRA 1Q8BA 3SZ2A 2YKNB 2KDOA 3J7ZT 2I2YA 3U1MA 5K9FA 2Q3PA 4QR0A 1SBRA 2R2SA 5I3QA 4B3TF 1QAIA 3FMBA 2W8LA 4IO9Q 5KG6A 2MQNA 2P5VA 4QIWD 4LF7F 4HT5A 3HHLA 1FDBA 5FD1A 3W2VB 3K2YA 2YNFB 2HAIA 4OHWA 4Q5VA 2RS8A 3T5LA 3VZIA 4O3NA 2CIMA 1HBNB 2AX1A 4EGLA 2XLKA 2J76E 3RR7A 2KM8C 4UY85 4Y2KA 3AJ2A 1U6ZA 1KQGB 3ZZTA 4NLWA 2ROPA 2K3IA 2G9OA 3EPGA 1QVGR 2GO8A 3DLBA 5KFBA 3PJXA 5BYQA 3LGNA 3J7YU 1HW9A 1ULRA 3IAS9 4DG1B 1NNDA 1FNOA 1P1TA 1Y9OA 2J0SD 2N7CA 1X5PA 2ZNZA 3OQ2A 4EU0A 3OTDA 2J7UA 2LA6A 4KHRA 1ZPVA 4WJBA 3TAPA 2V4JB 4RBUA 4WFNQ 2ZH7A 3H5YA 1KSPA 2KT3A 5IS2A 3THPA 1LWEA 3PEHA 4C8NA 2HRYA 3IR7B 5CYJA 2LKZA 3Q8SB 5J2NA 2B3TB 3FSIA 2Q6CA 3LP1A 2MPUA 4DEZA 1TUVA 2UUCF 3MEDA 2AYMA 2QLXA 3DLGA 5T7LB 2HMIB 1FXRA 4C8ZA 2WRMA 5THWA 5KFNA 1NK9A 4OX7A 1WHVA 2VPWB 4P7VA 3G71S 4WIIA 1T03A 1L3KA 4JYAF 2G13A 3EYZA 1RA7A 3UI3A 4DR1F 1WHWA 4DL0C 4ED6A 4ID5A 3IAM9 2PI5A 1EETB 4N77A 4MKAA 1FKPA 3MM5B 4A8MP 2QA2A 2ZHBA 1SC6A 5E3QA 1UVLA 2HHWA 3KHLA 1S1WB 3BO3A 2ZOMA 4O4RA 4ZKAA 5LSLA 4OX9F 1QAXA 4HHJA 1R7IA 4KQZA 4Y2CA 2E9ZA 3IBWA 2K7KA 4IOCQ 2PT0A 4RUHA 3CIZA 1N6QA 1RT4A 1JKHA 1S9EA 2YWHA 2V8HA 4B02A 1S1UA 2FDNA 3JSBA 2VL1A 3CD5A 2AU0A 1SJ3P 2J7KA 1T3OA 1DRZA 2GCFA 3MHYA 3PV8A 4DSLA 2MYFA 1HNVA 2IC3B 2QSFA 2J9CA 4Y2IA 2DGWA 3QO9A 4HDHA 1RT3B 5IZHA 1NAQA 4KO0A 4WTYA 2B7CB 2MDAA 4NLPA 3PHEA 3TAMB 2YX7A 4QIFA 3U27A 2O66A 2IRYA 2OPQA 1FESA 1FRJA 4B3RF 4USHA 4JV0A 4G3IA 1LFPA 2IAJA 3QIPA 5F8NA 2GC8A 1NK7A 2DGVA 2HNZA 1HPZA 4A4JA 4JI1F 2W4DA 2B9XA 4PPDA 4CO2A 2F8EX 4DSFA 2W8KA 4TY8B 2KRRA 5HMWA 3UE2A 1IN0A 1JLFA 1WF2A 5I3UA 2VG5A 4YP3A 2K1RB 3CDAA 3DLEA 5LT5A 2MQOA 3TAQA 3RBEA 4C3LA 3F73A 1U49A 1Q7YT 2PFFB 1UL3A 4P2SA 2YWEA 3KG0A 2OPSA 2KM8B 1FRKA 4DSJA 1RTHA 1S48A 1S1VA 4ZP6A 4ZPTR 7FD1A 2Z8QA 5HN0A 4Q44A 5F41A 5M2RA 2CPZA 3ICLA 5L9XA 2CQGA 4NCAA 4XDCA 2R8IA 2VH7A 2MQPA 2RDJA 2BQUA 1NO8A 1XTZA 2M88A 3R5BA 3CMAS 1HBMB 4FZVA 4J9OA 1NHUA 4B9LA 2YKMA 3MTKA 2YNGB 3MMJA 4ECXA 4LSLA 5JVGQ 1VIXA 5IQ6A 4USJC 3MMAA 4OJ3A 1HQEB 2MQMA 4FXVA 4ZCMA 4RBVA 4DQIA 1UVNA 4ED7A 2W4PA 2OPPB 1RTIB 5KFKA 4NRUA 4PQAA 1PGZA 4LFAF 4F25A 4P6QA 1ZAXA 1H7WA 4RW7B 4W90B 1WHXA 1RWUA 3MUTP 2DGTA 4WFAQ 4DFPA 3OHAA 2RKIA 2EC0A 2JC1A 2I38A 4FN5A 2ADCA 3QYYA 2VG6B 3I56S 5KFXA 5C42B 3TVYA 1X5OA 2BE2B 3OXGA 1JLEB 4QWDA 2RD5C 2DVIA 3RAMA 4FF3A 3CT9A 2R8KA 4PQUA 4I6WA 2IYIA 4YR3A 3MMCB 2FD2A 4DV4F 3LP0A 4B9TA 4IOAQ 1SH0A 2B5JA 2ASDA 2HS3A 4NRTA 5FLXY 1NH7A 2FUG9 5KFFA 2B4VA 5MAOA 1FO1A 3O8WA 5SZTA 3GV8B 3SXLA 5L38A 1P27B 4K2XA 3FZBA 5ADZA 1S1TB 3KNAA 1C1BB 1C0UA 3DLKA 3DYAA 1VI7A 2N3OA 3RB0A 1KFDA 2M5YA 4PWDB 4OHZA 2FJVA 2D9OA 4FS1A 5CYQA 2RB7A 2L08A 4PG6A 2IVFB 3CSKA 1TK0A 4JI3F 2YTCA 2VFVA 3L7OA 2BW2A 4MFBA 1FTRA 2GX8A 1NJIT 3HVAA 5LMUF 1MU2A 2PA8D 2QLWA 3ENWA 4N8NA 3VAHA 4N76A 4OZ5A 1LWCA 2M52A 1RTDA 1KHVA 4EEYA 1L3SA 3KHGA 1JJHA 1J5OB 3CJ5A 3EZUA 1F9FA 3MECA 5GAGI 2RMLA 4HKQA 5D4NA 3G6XA 2KZMA 4E8UA 3NCPA 2HHQA 3KLGA 2HPUA 3TO8A 1TFYA 1NEEA 3OL7A 3M6VA 4LMZA 2ZKUA 1IM4A 2DBBA 3QJLA 4XK8C 1DZ5A 2W9BB 2MJUA 4TNOA 4CCHA 1R6YA 3TYTA 2MKHA 4O44B 2UXCF 4CO5A 3POTA 1BGXT 2DNHA 3UWTA 1G2EA 1HWUA 1Q16B 3IS9A 4K4TA 2A3JA 5E0OA 2JEIA 3UCUP 1GT8A 3BGRA 4TU7A 4AL7A 1V9OA 2GGPB 1VQ6S 2DISA 2YQ3A 5J2MB 3JB9k 3KHRA 3TI0A 1KQSR 4C0BA 5HI7A 3LAMA 1BQMB 5EHHA 4O0IA 3BGUA 3HT3A 2HWTA 3V5RA 3N6NA 2VG7B 3T6JA 3N01A 1IKYA 4UOCA 4NOHA 4RKUC 4DQPA 3O6QA 5KOWA 3UR0A 1N52B 1LK5A 2MZ1A 2K3KA 1TR0A 4O3SA 4NL5A 1OIAA 5D4LA 4Q2LA 5EWGA 1IXKA 3I96A 3MD1A 3PX0A 3MEGA 3MMBB 1AW0A 3N5BA 4WCEQ 1ZETA 4F02A 3KLIA 3AQOA 1FK9A 4USIA 1RISA 1S79A 4ZHRB 3SI8A 1VQNS 3MM8A 3W7BA 1UAWA 5CZVA 1XEZA 3MAHA 4O3QA 2WBMA 1TL1A 2J0WA 2V8VA 3IRXA 2DH7A 3LPYA 2AGPA 2EFGA 3CJ0A 1LKZA 3JAMY 3RW7A 5F8JA 3DOLB 2ROGA 1B64A 3LW5C 2GMHA 4OLPA 5G0RB 3DMJB 1S9FA 2YKNA 4ZS6A 2ZE2B 1XK8A 5FJ4A 3EGWB 3SSRA 5HO4A 5KFAA 1E6YB 1U1QA 5KG2A 3MPYA 3AA8A 1S0NA 2QFJA 4I2QB 5K8MA 4C2MA 1YG0A 1TP7A 2PN6A 3R27A 3W2VA 5LMNF 2YNFA 3E3XA 3H5SA 4F4WA 1G6BA 1S72S 2RVJA 2OPRA 2WOMA 3M32B 2GQCA 2MGZB 3MD3A 1HBOA 5T14A 4Y65A 3GQCA 3CUNA 1Q8IA 1Q53A 3PW2A 3T6BA 3I82A 2BQRA 3BREA 5KFGA 1X4FA 3J81Y 3FZ2A 4AL6A 2HQ3A 1G1XA 2WSFC 4HL9A 2VKRA 2WW8A 1AXQA 1KVIA 3UD4P 3OV7A 4K5SA 5B08A 4JI0F 3KG4A 1Z4UA 3CD6S 3KK3B 4PKDB 1FEEA 1L3TA 2VC1A 1U6FA 3RR8A 3T1AA 4ES1A 5B7WA 1M1KT 3TA0A 1DTQB 4TXSA 1N33F 1U2RA 3B82A 5GAHI 4IFVA 2NPFA 3K5MA 3IC1A 1KRPA 1OSCA 3RYLA 3TRGA 2V4JA 3KFWX 2DNLA 3KTQA 1U6BA 2E1CA 5C24B 4NLTA 4CTAB 1VFJA 5LSRA 1X4DA 1SJFA 2NR0A 1PO6A 1FRXA 2F4VF 2AJ4A 2RQ4A 3OW2R 4WKRA 4ZMMA 3LOUA 5D6GA 4K50A 4J9QA 4QWAA 1GX5A 2RE1A 3MM9B 4CH7A 1KHWA 4WK1A 4F4XA 2YWGA 5T7LA 2XWXA 4NCGB 4KR0B 3L09A 2GV1A 3DM2B 3DN9A 4C11B 3D1QA 4YFUA 3S1TA 5F8HA 3QGGA 3D28A 4LVOP 4C8KA 1X7VA 5L8RC 1HD0A 5E7OB 2PI4A 5D77A 1KNZA 4BC9A 3A1YG 3DOKB 2D41A 3BN4A 4C97A 1EETA 5AXNA 3PW0A 1C1CB 2JOQA 3MM6B 3MM5A 1HD1A 1VBYA 3QAEA 1S1WA 3VR1A 1YJWS 1FD8A 2YX1A 4TLRA 4ES3A 5CCMA 2DH8A 2E5GA 5E2QA 3IRWP 1ROFA 2JDJA 4M63A 4N8OA 2KZZA 1XERA 1MMLA 2FJXA 2DNMA 2K7JA 3H59A 3CC7S 2KN4A 4ZPBA 4CT8A 4MKYA 5E5NA 2F9DA 1TAQA 3H5XA 4LVNP 3X3UA 2MY7A 4KPYA 4J9RA 2L3MA 1X5TA 2IC3A 1F5AA 4K4WA 3SCIE 3BQ0A 1RT3A 3TP2A 5IFMA 4RNMA 4MK8A 2CZVC 5K8NA 2GO9A 1KLMB 4C3MA 3MUVP 1CSJA 4Z2XA 3I31A 1UVKA 5B0FA 2BM1A 4NLQA 2E5LF 4CQ1A 4BHQA 2CQHA 3E01B 3FQLA 3JTNA 2OIHA 4ITSA 1RTDB 2MKKA 3GR0A 5DRKA 3H20A 4KSEB 1VQSA 2ZVSA 4DX8H 3PX4A 4ZP7A 3NRBA 3VAMA 7FDRA 4J9SA 4TY8A 4DFMA 5L39A 2K1RA 4OHVA 3PACA 3PR4A 2I1RA 4FXDA 4Q0BB 3GFZA 2DO4A 2M0GB 3MFHA 1FRIA 1NH8A 2QA1A 5BR8F 4YB5A 2IJNA 2J0XA 1HWKA 4ZK7M 3D0HE 2P9GA 2KYXA 4XPEA 3NS6A 1TL4A 4LFBF 3BO4A 5H9FJ 2R7TA 4J9LA 1RGVA 3O2IA 1Q86T 2R2UA 3JTPA 1L3UA 1BLUA 1X8DA 2B6AA 2AJFE 3VZHA 1RT7B 1HHTP 1CQNA 3OTOF 3NLCA 1HBMA 5G4DA 2FHJD 5F8LA 3CDUA 2EWHA 1FJ7A 4C0OC 3H98A 4LSNB 4IRCA 3CDWA 4ZP9A 1QY7A 1X4HA 1UJ5A 6FDRA 1X4AA 4H4MB 1MROA 3U7JA 2PMZD 5GADI 2HW3A 3TARA 3U1NA 2CPDA 2EVZA 4EWTA 3QWPA 2RILA 2KJVA 2OPPA 4OHYA 3R1HA 2R7VA 4XO0A 4N56A 4LJMA 4EO6A 1YHQS 5J2QA 3V4IB 1T95A 2CQBA 4FBTA 3GIMA 3D0IE 2GIRA 1U48A 2WBRA 2P9CA 1C0TA 4DV0F 5AE1A 1YRTA 5B0DA 4KIAA 1GAOA 3HXMA 3IWXA 1UWBB 2VG6A 4M1KA 2C2EA 5C42A 2ADBA 1JLEA 5E3PA 3T5KA 2ZH9A 2VZ9A 2X1BA 2ZFHA 3FFIB 2WTFA 2GHVC 3VAKA 4MH8A 2CVIA 4HEA9 3PXGa 5KG3A 3NG8A 2IFXA 4PG4A 3G4SS 3NS5A 4IDKA 1R89A 3DCAA 4OZ0A 4XDDA 3BO2A 4IYQA 3LF0A 4RW4B 2J0QD 2I5JA 3CMES 3QGPA 4F4YA 3K5OA 1S1TA 3B4MA 1C1BA 3VALA 4JI4F 3CDEA 1VQPS 4OJ1A 3ZZUA 3CJ2A 1T94A 3KKFA 4IH7A 2XMWA 1IKVB 4BWJA 2VOPA 3N4WA 3RB4A 4ECQA 1FJCA 4XAKA 4EYHB 2HHXA 5EN1A 2O01C 4X4QA 4L72B 1XN9A 3KMQA 2UUAF 3M1VA 3TW0A 1NK0A 3C6TA 5EWEA 3VAGA 5H9EJ 2VQEF 4TYBA