1N5YA

Hiv-1 reverse transcriptase crosslinked to post-translocation aztmp-terminated dna (complex p)
Total Genus 122
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
122
sequence length
558
structure length
558
Chain Sequence
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFKKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDICKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNKGRQKVVPLTNTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDKSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLVSAGIRK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of HIV-1 Reverse Transcriptase with Pre-Translocation and Post-Translocation AZTMP-Terminated DNA
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Transferase/immune system/dna
molecule keywords 5'-D(*AP*TP*GP*C*TP*AP*GP*GP*CP*GP*CP*CP*CP*GP*AP*AP*CP*AP*G
total genus 122
structure length 558
sequence length 558
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2002-11-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 1n5yA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1n5yA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1n5yA03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1n5yA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1n5yA05
2HHTA 3CJ4A 3NAEA 2IGIA 3AO1A 4JLHA 2RKIB 3EPIA 4CEEA 3HVWA 1OS5A 4IH7A 3OYEA 1NK4A 4YFUA 4DQIA 4NLGA 4G1QA 2W7OA 4MH8A 3V6DB 1Z26A 2C2RA 3PW7A 1HQEA 2WONB 4KREA 5I3UA 5EUHA 4KI6A 1S48A 4FXDA 3LP3A 4OGCA 2ATQA 5KT6A 4QW8A 2R8HA 3AO4A 3KMSA 2HWIA 1RT1B 3UR0A 4J9KA 3C6UB 1F21A 3BSAA 3GIKA 4M41A 3OYLA 1WSGA 1NJXA 4DL6A 3BSCA 1HPZB 4FLWA 3AVJA 1WNSA 2OPPA 3OYDA 4J9RA 5F8IA 1IKXB 1JLQA 3SV3A 3PY8A 1YTAA 3IG1A 2ASJA 1HNVA 3M9MB 4PA1A 4DF4A 1TL1B 4DQPA 3NH0A 3KK2A 4E0DA 2PZSA 3LPUA 2BQRA 5HROB 2HHVA 1NJYA 5KRTA 4CCHA 5KG5A 4CHZA 1S97A 3KLEB 4I9LA 4ZHRB 4AHTA 4K4SA 4CF9A 3OS1A 4DLGA 1IKVB 4RW7A 3ZSYA 4O3QA 4ZPDA 3S3NA 5KG2A 5KFLA 1C2PA 1JXLA 4W5RA 5HRNA 4AHRA 4ED6A 1ZTWA 3RMAA 1NK5A 3OYIA 3KK1A 1N5YA 3BDPA 1KLMA 4JRPA 4WE1B 1DLOB 2AGOA 3U6FA 4JV0A 3QZ7A 3HK2A 3H4DA 3L8BA 3HO1A 3M9OB 1UWBB 3K59A 3NKYA 1W0HA 4QCLA 4DQSA 2IBKA 5KFVA 3M8RA 1LWFA 4RNMA 1TV6A 3LAMA 3DOLA 2I5JA 4N47A 1NKBA 5DQIA 3KLGA 2NUBA 4JV1A 1U45A 1O1WA 4M95A 1QSYA 4EZ9A 2B5JB 3V9SA 2XY7A 1HMVB 2IAJA 3AVGA 4NYNA 1J5OA 4NLPA 3PUFA 3DLKA 1RDRA 3ZT0A 1UOCA 3D45A 3QNNA 3QIPB 3DI6B 4URSA 3V4IB 2YNGB 2HWHA 4O55A 3B6OA 4TN2A 2AGPA 1CZ9A 3OHAA 3HVAA 3T5KA 3NGZA 4BDPA 3DMJA 3TI0A 4FJKA 3FFIA 5F8GA 4E7LA 4KO0A 1EXQA 3OSPA 4W5TA 2BRLA 1U04A 4FK4A 2V4QA 4MIAA 3ICLA 5FROA 3RRHA 3UQSA 2OZMA 4KHNA 2IJFA 4G3IA 4JRQA 4Z4IA 1QE1B 1ZYQA 3M8PB 4EBDA 5T7BA 3V6KA 1JLGA 4CF1A 1RDDA 4YR3A 1RBRA 3MEDA 4X2BA 4FYDA 3S9HA 1RT7A 5KT5A 4KAIA 2ZD1A 4Z4EA 1RT5B 3DLEA 5D3GB 3SJJA 4TQSA 1C0MA 4CF2A 4PWDA 1SL1A 3NAIA 2PY5A 5DQGA 3TARA 4CJLA 4K4TA 1TKXB 3CIZA 1KSPA 4ELTA 4Q0BB 4CFBA 4J9OA 3SZ2A 3SPZA 3HM9A 3ZSQA 1CSJA 1X9MA 2IC3B 2KTQA 5HP1A 4IFVB 4XO0A 3JSMA 2O5DA 4K8ZA 4RW4B 4HUGA 5I42B 4R5PB 4R8UB 1C1BB 2E9TA 1ZBIA 1S6QB 4DTXA 4ICLA 4I2QB 4IDKB 4NLOA 4ELVA 2D5RA 1VSLA 3Q8PB 1IO2A 3ZT3A 3TAFA 3MEGB 4KFBA 3PVXA 1ASVA 3EPGA 4GC7A 4PY5A 1JLFA 4BE1A 1WSIA 2UUWA 1TL3B 4B08A 4JS4A 3HSTB 2FBYA 4YNQA 3QEVA 3OJSA 5KFWA 1T7PA 3LP1A 2XWYA 3H4BA 4FLXA 4K4XA 2WTFA 2B4JA 3H08A 3PO5A 4DFPA 4CEOA 4FCYA 4N76A 2HNZA 4FJ5A 4JS5A 1FKOB 4WXOA 3VA3A 2FJXA 2JEIA 4PUOA 1BQMB 1LWEA 4DQQA 1RTIB 2C2EA 3K57A 1Q9XA 4KB7A 1S5JA 4EBCA 3DRSA 2QKBA 1T3NA 2B6AA 1L3VA 1B9DA 3T5LA 5HRSA 4IRDA 2F96A 1RTDB 4B9TA 2XY6A 2E6LA 3CM5A 2IS3A 2XC9A 4CFCA 4CJ3A 4O3OA 1NK0A 5KG4A 1K1SA 1DTQB 3ALYA 2ZQBA 4FJMA 3K5LA 3EZUA 4HVJA 4ZPAA 4FZYA 1IKYB 4XPCA 4WFXA 1SV5A 4EYIB 4FBUA 2LSNA 1IG9A 1TKZB 2XGQA 2W9BB 3KK2B 3RBDA 3V9ZA 2YKMB 5KGWA 4Z4HA 4CGHA 4KTZA 2VA2A 3CJ2A 4CEAA 3V81B 1TAUA 5J2QB 2YNIB 1G15A 4IH5A 3CVKA 1RILA 2BGGA 1UA1A 1JIHA 4HHTA 3H40A 2EC0A 4CEDA 1FK9B 3L2UA 3MECB 2VWJA 4MQ3A 5J2NB 3AVLA 4KAZA 1JXEA 1S4FA 3BGRB 4IG3A 1QQCA 3ISNC 1TVRA 2HNDB 4XPEA 4O44B 1CXQA 4KHSA 3TAMA 5I3UB 1RT2A 2F8TA 5DGAA 1QAIA 3GYNA 2QE5A 2Z1IA 4K50A 4I7FA 2RF2A 3OYJA 5SWMA 1JLCA 2VA3A 1RT1A 4TSXA 3C6UA 2KFZA 2P1JA 5KRSA 4NCGA 3ZSZA 3RAQA 1S9GA 5HBMA 1EP4B 2IMWP 4FLTA 4B3OB 2B5JA 4NLVA 2IAJB 4J9LA 1N56A 4FW1A 1MMLA 3AVFA 4K4WA 3SQ0A 4NLWA 3DLKB 4RW9A 4FLUA 1L3UA 1HNVB 1IM4A 1TL1A 1Q9YA 3KLVA 3DI6A 1VSIA 1BIZA 1REVB 5KFKA 3GV5B 5DMRA 2IA6A 5EWFA 3MEEA 1YTUA 2XI3A 3LP2A 1RT3A 4F4XA 4O3PA 1XWLA 3B6PA 2XCPA 1YT3A 3M9NB 1J9AA 2D0CA 3SI8A 5KFJA 2E9ZA 1U4BA 2G8WA 3CFOA 5DQHA 4NLUA 3HHKA 4FJGA 5DLGA 1NHUA 4TYAA 4ZVEA 1SUQB 4IR9A 4M3ZA 3H5SA 5SZTA 2R8KA 1KLMB 4NLQA 2YNHA 3MFHA 1VSJA 4KSEB 1BQNB 1S6PA 3VQQA 2IM2A 3I5AA 1UWBA 3DDKA 2V0NA 1TV6B 4LY7A 1RCHA 2I5JB 4DG1A 3KLGB 2FLPA 2X74A 1VRUB 4F3TA 5KFQA 4ZVHA 5DLFA 5F9LA 2I1RA 3CDEA 3HVTB 4K4VA 3QGIA 1WSJA 4KTQA 1S1WB 4RUCA 1BCMA 1QUVA 3SUNA 3OYKA 2BE2B 4NCAA 4FJXA 5HRRA 2OPQB 2J6SA 3C6TA 4ECQA 3KKRA 2JEJA 4RW4A 1C0UA 4KV8B 5J2PA 1T03B 4NLRA 1C1BA 3M8QB 2E6MA 2HVHA 1ZBHA 3OS0A 4KTWA 4MKBA 2ASLA 4C8LA 1JL2A 1NK8A 3I5CA 2BDPA 1Z25A 5KFOA 4ZP7A 2QXFA 4CGJA 3AO3A 2FVSA 3OYCA 2FLNA 4DTSA 3K58A 1HRHA 3KHHA 3THVA 1SH2A 3VQ9A 4ZPBA 4NRTA 4Q45A 3UDLA 4B9LA 4ECTA 3KMQA 3DLHA 2ZE2B 3NBPB 4FS1A 1WN7A 3RMCA 3KLFB 4FJNA 3NF6A 5JS1A 5EWEA 4IRCA 1S9FA 2Y1IA 1FKPA 4OGEA 5KFCA 4DSLA 1LWEB 3LP0B 4NLDA 3OS2A 2KW4A 1TKXA 3KTQA 3G6YA 4FJLA 3DRSB 4EEYA 2ATLA 4R0EA 4YQWA 4M45A 3DLBA 3MR2A 1QHTA 3KK1B 4TXSA 2IC3A 4WE1A 5HP1B 1DLOA 1SL0A 1RBSA 1RYSA 1VRTB 3MR5A 4DTUA 4CFDA 4Z0UA 4CHQA 5KT4A 3LDSA 4W5NA 1C1CA 4CF8A 3SI6A 3MR3A 3DOLB 1LWCB 5J1EB 1XR6A 5KFFA 3MEGA 3RB6A 4J9MA 1HPZA 5KI6A 2RPIA 1JLFB 3IRXB 2G8UA 4HUEA 4H4MA 4DTMA 4CE9A 4IKAA 2AGQA 5KFEA 3LALA 3MXMA 4Y2AA 5J2QA 5L1IA 5HROA 3JYTA 1BHLA 4FM0A 1HNIA 4EO8A 4CJWA 2ILYA 4F50A 3ZSOA 4DSFA 1QSSA 1IH7A 4ZHRA 3D0PA 3DMJB 1C0TA 3BGRA 4QWDA 1TGOA 4Q5VA 4PUOB 1RT6A 4FVMA 4K8XA 1RNHA 2P5OA 3TQ1A 3TAMB 4F3OA 4MIBA 3GIJA 3QLHB 2OH2A 3V1RA 2RF2B 2EX3A 5FRMA 4Q8EA 2R2TA 2WCXA 1LAVA 3QO9A 2V4RA 1HQUA 5KFXA 3ZCMA 3M8PA 1S9GB 3KLHA 5CYMB 3FDSA 5F8NA 1LWFB 4RZRA 3VQ7A 4CGGA 3O3GA 2RDJA 4B3OA 3HPHA 4CEBA 3KLIB 4ZPCA 1WSFA 1SV5B 1U49A 3MEDB 2P5GA 1FXXA 4Q43A 5J2MB 4PQUB 4E3SA 1TKZA 4LD0A 3TVKA 1RT7B 1S1TA 4CJEA 4HUFA 1ITGA 4DWIA 3L3UA 2WHOA 3AO2A 1NJZA 5HLFB 4AHVA 1VSHA 3OL8A 4DL5A 4PWDB 5E41A 2HB5A 3TANA 4FJJA 3V81A 1TQLA 2PYJA 3NGDA 2YNIA 1NKEA 4MK8A 4CJVA 4MFBB 4Z4GA 1RT3B 1KLNA 2KZZA 5F8HA 3SV4A 3EZ5A 2FLLA 1KFSA 3QEIA 3AVMA 4RNOA 4MKAA 4HCBA 3QINA 1S1XB 2W42A 3FFIB 1SUQA 2Z1JA 3TAQA 3P83D 4FZXC 1DTTA 2AX0A 2BANB 2JC0A 4OKEA 4DU1A 2HNDA 3G10A 4CEFA 4OL8A 3LWLA 4ZTFA 1T05A 4WFYA 2YNFA 3VQ6A 2DFEA 1S1UB 3HT3A 3CJ3A 4CEZA 3MFIA 4NCGB 3SYZA 1TL3A 1VRUA 4IFYA 3PJWA 4B8CA 5DG7A 4TY9A 1CZBA 1QSLA 3VQCA 3H98A 1D5AA 1XI1A 1UA0A 1Y97A 2P51A 4J2EA 5KG1A 5DK5A 4RW9B 3FSIA 2AWZA 3DYAA 1S49A 3CYMA 4CJKA 2O4IA 2D3ZA 3H5UA 3WNHA 5K14A 1HYSA 2HNZB 4FLVA 2CJQA 3BSNA 1S0NA 2B43A 1VSEA 2C2DA 3QGGA 3V1OA 1RTIA 4DFJA 5L1JA 4EP5A 1KHVA 4E89A 3VQ8A 5KG0A 3SUOA 3SUQA 4KKOA 4DSIA 2HHUA 3OHBA 1VK0A 4O4GB 3WNEA 4DL4A 4IH6A 4DF8A 4ZVFA 4FJ7A 2FC0A 3AVNA 3HXMA 1RTJA 3DLRA 4CF0A 2YNHB 4ED3A 4RNHA 1TK5A 4Y34A 4DU4A 4CECA 1VSMA 4DTOA 2GIRA 4KFBB 3T1AA 2XO7A 4J2DA 5FDLA 4GC6A 4O0IA 4RW8A 4C8NA 4NLXA 4CJPA 1C1AA 3A2FA 4DL7A 4O4RA 4M3UA 4Z4CA 2G8KA 3FQLA 4EP4A 4ED0A 3PX0A 4ECWA 1XC9A 4ED7A 3H59A 4NLYA 3LP1B 3HJFA 4EBEA 1LW2A 3NL0A 3E01A 2C22A 1W9HA 4B9VA 4M3TA 1FK9A 4FK0A 3MECA 1S1WA 1KVCA 2VG6A 2W8LA 4LH5A 3V6JA 3HVRA 1FKOA 3V6HA 3DRRA 1JXBA 2E4LA 4M3YA 3OL9A 3F73A 2IDOA 2YKNA 2BR0A 1TVRB 2IM1A 4JV2A 3C6TB 3RB3A 1C1CB 4DS4A 4J2BA 3VN5A 4M3WA 5EWGA 3VQEA 3RB4A 3C95A 4M3RA 3DLGA 4ECXA 2UUTA 3BQ2A 3I5BA 1BIUA 3WNFA 2R2SA 5HBMB 1I3AA 3QETA 2Y1JA 4B9MA 2VG7B 3OL6A 2HMIB 3IRXA 4JUZA 2YHAA 1NJWA 4FW2A 4YMEA 3G6XA 3AO5A 4CJ4A 4C8KA 2R2RA 1WLJA 3M8SA 4KI4A 1EETA 1Z4UA 5CZ1A 2BQUA 5KFYA 3SFUA 1TK0A 1HNIB 2HW3A 1S10A 2D0BA 2ZE2A 3NBPA 3VQSA 1L5UA 1D1UA 3KLFA 2ZKUA 3MXIA 3OL7A 1S1VA 1C0TB 1ZBFA 1A5VA 3ITHB 1NK9A 4H4OB 5DG9A 2VWKA 4CGIA 3BJYA 4M42A 1TP7A 4QPXA 2WRMA 4CHOA 3GIIA 3NF7A 1SH3A 4NYFA 1RBVA 4IG3B 3CO9A 3T3FA 1BQNA 1S6PB 1VRTA 2AQ4A 3LPTA 4WZMA 4E7JA 4I7FB 3PW4A 4FJHA 2XY8A 1JLCB 4ECRA 5CYMA 2UVVA 3G86A 4FJIA 4E19A 1MU2B 1S9EB 5J1EA 4B9SA 3PW5A 3NE6A 2W9CA 1XHZA 2FVQA 1RT4B 1SL2A 1T8EA 4H4MB 4OPJA 1XR5A 3CJ5A 3U3YA 3SNNA 4CK3A 1REVA 4MFBA 3KHRA 3K5MA 2FBVA 3QZ8A 4BACA 4ID5B 2XCAA 5C5JA 1XHXA 1BL3A 2OPQA 1B9FA 1HYVA 4CJTA 5J2PB 1T03A 5KG3A 4NRUA 3AVHA 1YVUA 1I39A 3L2WA 1DTTB 1RT6B 4ECZA 4RW6A 3RR8A 2DFFA 2YV0X 4IR1A 5KG7A 1IKWA 2GC8A 4L8RB 4KBIA 1TKTB 3GV7B 3IGVA 1S1UA 4KB1A 2R8IA 3QIOA 3TABA 1LW0A 3IS9A 4HYKA 4U6PA 3LWMA 2DPJA 1KTQA 5KFDA 3KIOA 4LSLA 3PX6A 2HHQA 4KB0A 1X9WA 5F8JA 2R7YA 2OPRA 4DG1B 4BE2A 5CZ2A 4NYZA 5J2MA 4PQUA 2UVRA 3SQ4A 2QK9A 3S3OA 4Q8FA 2WB4A 2G8VA 3RBEA 1HYSB 2FBTA 3NMAA 3Q8SB 4ZTJA 3MTKA 4TYBA 2PYLA 2R2UA 3ZT1A 4IOBA 1TKDA 3HVTA 3CM6A 1JLBB 3N6MA 3KD1E 2G8FA 3SQ2A 4CHYA 3OYAA 4DTNA 3OYFA 2D0AA 2GUIA 2GIQA 3K5NA 3QEPA 2BE2A 4QOZB 3SPYA 4F2SA 3PR4A 4BE0A 1B92A 5C25A 1JLEA 3OJUA 3PZPA 4NLTA 3NAHA 4KHQA 3OYGA 1RTHA 1RDCA 3N6NA 4KRFA 3BREA 2O4GA 2RDIA 3NF8A 3QGHA 3O3HA 4MK7A 5KTQA 2IOCA 2XY5A 1LWCA 3L2VA 2YNFB 1U48A 3TAPA 4F4WA 1KHWA 1UAXA 4ZP9A 2HAIA 5FDLB 4WFZA 3NDKA 3QEWA 2FJVA 1I6JA 4Z4FA 4E7IA 4CGDA 4NZ0A 5C24A 3GILA 4IFYB 2G8HA 1EKEA 5C42B 3BR9A 2YHBA 4CJFA 1JKHB 4QWEA 3H2LA 4CK2A 4U7CA 5KFIA 4FJ9A 4E1MA 3TAEA 4F4YA 3DYAB 5KFPA 4DFKA 2XHBA 4W5OA 1N48A 2J6TA 3OVNA 4Y2CA 1FKPB 2AJQA 3ISND 3LP0A 1QTMA 1ZETA 5L9XA 4OVLA 4KHMA 2IM0A 4FZZA 3F9KA 4CJRA 2JLEA 3EYZA 5KGXA 3OY9A 3PV8A 4TY8A 1BI4A 3DM2A 4LSNB 1SKRA 3QO9B 4EO6A 4OJRA 3V9XA 4YR2A 4K4ZA 4DS5A 1HQUB 2HHSA 3DRPA 3P5JA 3VQ4A 2OPPB 3KLIA 4CHNA 2VG7A 3TR8A 5KG6A 2QKKA 2FBXA 2W8KA 3NF9A 3D28A 3QERA 1N6QA 3RTVA 4CEQA 2HNYA 3CFRA 5KT2A 2GBZA 4NLSA 3I0RB 3ASMA 4IG0B 1JL1A 3I8DA 4O3NA 3QIDA 3MF5A 1S1VB 4WZQA 3JYTB 4I2PA 3N6LA 5CYQB 5L1KA 3KJVB 3ITHA 3BQ0A 1GOAA 3Q8QB 4KHUA 2VG6B 4DSKA 2VG5A 4DEZA 4RUAA 3CWJA 3V9UA 5KFHA 4AH9A 3QNOA 3K2PA 4ED8A 1KVBA 4RU9A 2CKWA 4DLEA 1N5YB 3VQ5A 2X6SA 4DTJA 1HQEB 3HPOA 3QYYA 2WONA 1T05B 4Y3CA 3QLHA 3OLBA 5F9NA 3AVIA 2AX1A 3MR6A 1CLQA 1JLAA 2FVRA 3LZIA 2JEFA 4KE5A 4O3SA 3CDUA 3OLAA 3C94A 3CQ8A 3KLHB 4ECUA 3RAXA 4FLZA 2C28A 1QS4A 4IBNA 1RAJA 4WYLA 1JLQB 3H5YA 3T5JA 1NOYA 2OA8A 4OKKA 1S1TB 4LH4A 1JX4A 5K14B 3KHLA 3Q8RB 5HLFA 2WOMA 5FRNA 4LQ3A 5KFAA 5KFBA 4AHSA 4O5BA 2X6NA 1NK6A 1BISA 3NH1A 4Y1DA 5JS2A 4ZMMA 4TQRA 4KHWA 4H4OA 4KO0B 4F4ZA 4GMJB 4ED1A 4I9QA 5KFMA 2FVPA 4RG8A 1S1XA 4DMNA 2Z1GA 3RR7A 1HYZA 3AV9A 4GVMA 2BANA 4DTRA 4FM1A 2OZSA 4FM2A 4LSLB 4CK1A 4DU3A 1TAQA 4QAGA 3PJXA 1MU2A 3OYNA 4J2AA 5T14A 3DOKB 5KFTA 2HHWA 2HVIA 4QWCA 5DGBA 2W9AA 3AVAA 2OPSB 1WAFA 3GIMA 3OYBA 5D3GA 1LW2B 1J5OB 1X9SA 4TLRA 4ZVGA 4QWAA 3I0SA 3NGYA 3K5OA 3E01B 4CIGA 1ZTTA 1WNEA 4E7HA 3QIPA 2RKIA 1ZBLA 1U09A 5KFRA 3ZSVA 4F4KA 3E51A 3AVBA 5JXSA 2YNGA 4M94A 1RYRA 2XRIA 4O0JA 3DRRB 4CERA 3WNGA 2YKNB 3AVCA 2IJNA 3T19A 4GW6A 4CESA 4DSEA 4J9SA 3LAKA 3TWHA 4LQ9A 4KKOB 4R5PA 3PHEA 4R8UA 4CJSA 1S6QA 1RTHB 4O4GA 2FVCA 3IGNA 4RW6B 1RA7A 1D8YA 4I2QA 1RDAA 3DLGB 5KFSA 1IKWB 2ILZA 4RNNA 1RTJB 4IQXA 2F8EX 5EU7A 2Z1HA 4DTPA 2GV9A 2HMIA 3ZSXA 1NK7A 1IKXA 1S0OA 1D9FA 4F8RA 2WK4A 3IG1B 2D7SA 2KZMA 2R8GA 4FBTA 4B8AB 3VQDA 2DFHA 1R0AA 1YVFA 4EYHB 3FQKA 4B9NA 1K1QA 4RW8B 1D9DA 3KNAA 3GQCA 1X1PA 2JC1A 4IRKA 2ZD1B 5KFUA 4CJ5A 4XIUA 2QV6A 4YR0A 3AVKA 3UIQA 3KK3A 4BWMA 3LZJA 2DY4A 3L3VA 4CJQA 4N41A 3V1QA 1IKVA 2BQ3A 4URGA 1W25A 1GOCA 3RMBA 4QWBA 3KHGA 2JGUA 5JUMA 3NHGA 4OLAA 5KFGA 4ECVA 5EDWA 1VSDA 4G1QB 2B6AB 1L3SA 3V6DA 4URQU 5KFZA 3HP6A 3H5XA 2ALZA 3U3GA 3JSMB 4RNFA 1JLEB 1ASWA 2KQ2A 3MAQA 3AA3A 1DTQA 4KPYA 3DRPB 5HRPA 2W7PA 4B9UA 4W5QA 1NKCA 3KOAA 1IKYA 3TAGA 3CJ0A 1NNDA 1S9EA 2DPIA 2A1SA 4DQRA 3O4NA 1BCOA 2W9CB 2F8SA 4HCCA 4DFMA 1N6QB 4QW9A 2E9RX 4ZP6A 3VQPA 5CY4A 3L2RA 1WSHA 4IG0A 4CGFA 4OLBA 1EETB 5KT3A 3HYFA 5CYQA 3FRZA 5KT7A 4ID5A 1J54A 2ETJA 1NHVA 1VSFA 2OYQA 3KLEA 2Q3SA 1TK8A 4MK9A 1GOBA 4RW7B 4Y1CA 3VQAA 4CFAA 3V9WA 1XR7A 1JLAB 4YP3A 3CDWA 3SCXA 1LW0B 3IS9B 3IN5A 4M3XA 4WXWA 5DG8A 3PW0A 1LAWA 4LSNA 1RDBA 1NOZA 4K4YA 3G6VA 1QE1A 5F8MA 2J6UA 1WAJA 1EP4A 2AU0A 4K4UA 4CIEA 4KHYA 3ULDA 4BWJA 1JLGB 4CIFA 3RWUA 2OPRB 1WSEA 1KVAA 3PX4A 1N4LA 1RA6A 3SUPA 4FS2A 2W9BA 2D41A 3GV8B 1J53A 1BGXT 3KD5E 1RT4A 2RN2A 1HMVA 4N56A 3PO4A 4IKFA 1KCFA 4BDYA 2HNYB 4DL3A 3SFGA 2WOMB 1JLBA 5F8LA 4O3RA 4ELUA 2X78A 3ZSRA 1RBTA 2UVUA 4UQGA 4NCBA 1SKSA 1CXUA 3AA4A 3HP9A 3V4IA 2BRKA 3VQBA 3RRGA 1ASUA 3S3MA 1SKWA 1Q8IA 1A5WA 3PW2A 3OYHA 3D5MA 3RB0A 5J2NA 4IFVA 3QEXA 5C25B 3RMDA 3HL8A 5I42A 2VG5B 3ZSWA 4HTUA 2HHXA 3OSNA 4FLYA 3NFAA 4AHCA 2G8IA 3KKSA 1T94A 4O44A 4IDKA 1RT2B 4J9QA 4E1NA 3UPFA 3HPGA 1TKTA 1ZBUA 1EX4A 4WYWA 4Q44A 3CG7A 2UVWA 1KRPA 4C8MA 3EY1A 3L2QA 3IAYA 5C24B 4H8KA 4DL2A 3HKWA 2A1RA 2XI2A 4AILC 2R8JA 3LANA 2OPSA 3O4QA 1VSKA 3CFPA 4F2RA 1RBUA 2ITGA 3AA5X 1LV5A 1RT5A 1L3TA 3DLEB 3BSOA 4ID1A 4J9PA 4KHRA 3OYMA 1BQMA 4E7KA 3MEEB 5L1LA 4BDZA 2DTUA 3LP2B 4KV8A 1C0UB 1GX6A 4Q0BA 4HKQA 2FJWA 4OKJA 3BQ1A 4OPKA 3M8QA 1KFDA 1RTDA 3ZT4A 4TY8B 3P1GA 3ZT2A 3SQ1A 1D0EA 1BI4B 4FK2A 3DM2B 4C8OA 2XGPA 3G0ZA 4J9NA 2ASDA 4ICLB 3NCIA 3NGIA 3QESA 1S0MA 4AHUA 2D3UA 2IM3A 4CHPA 4N5SA 3MXJA 1A5XA 4ECSA 4FJ8A 3AA2A 4ECYA 1R0AB 1HARA 1K6YA 1SH0A 4H54A 2YKMA 1QAJA 4EZ6A 3VA0A 1U47A 2JEGA 3DOKA 2KFNA 2EHGA 4CJUA 3I0RA 4DSJA 2V9WA 5C42A 1GX5A 3PR5B 1JKHA 4ZP8A 3NH2A 1HJRA 1C6VA 3O3FA 3KK3B 3T5HA 5KFNA 4ED2A 4I2PB 3KJVA 3I0SB
chains in the Genus database with same CATH superfamily
2CJYB 2IGIA 1CBKA 4BRLA 5A76A 4JLHA 3F9MA 2RKIB 4CH7A 1RI7A 3OFEA 1ZBTA 1CG2A 2W2PP 4QR2A 4I1TA 2CGKA 4A2BA 4MH8A 1HNWJ 4BQLA 4LRCA 3WIUA 3PW7A 2CQGA 1F3FA 1VQON 2WONB 3BGOP 1WOSA 5EUHA 5T41A 1OKJA 2DK2A 2FSNA 5F3ZA 4LF6J 2ATQA 4UOHA 4B9QA 3NS5A 3IWXA 2OANA 2MLXA 5F1XA 1RKIA 2DR6A 3BSAA 3S6EA 5CH7B 3HLUA 2RU9A 4BGBA 1HPZB 4OFZA 3AVJA 3OYDA 5AQPA 2DGVA 2GQCA 3IG1A 2VQFK 1HNVA 4DF4A 4NI2B 2P9LA 4FPAA 3KK2A 4ZOSA 2YX1A 4XAKA 4M5NA 2ZBRA 3O2IA 3DDIA 2E1YA 3LPUA 4QPTA 2HHVA 5HL7L 4OX9K 4JI8J 2GA7A 1UKUA 4GO5X 4JB8B 4CCHA 3HDSA 2NPFA 2GJIA 4I9LA 1FWPA 3UD5A 3VEOA 3K0SA 4K4SA 1EB0A 3IC1A 2HS3A 3SMPA 1KXPA 2HF3A 3PHTA 1C2PA 4DHYA 1W26A 4ED6A 5ETOA 5HI7A 3R9PA 3GIRA 2KI2A 3B8HA 2DH9A 2KO1A 2AGOA 3QZ7A 4JP8A 4X4QA 1UWBB 3K59A 3NKYA 2AIRB 2EXUA 5CAAA 5KFVA 1O8BA 2DXFA 2JZ5A 4RNMA 3AY0A 3DOLA 4ZLJA 1NDPA 1U45A 4MYTA 1O1WA 2IRUA 2BH1A 1NO8A 4JYAK 1HMVB 1SC3B 2IAJA 3CXCR 1E3MA 2GW8A 1J5OA 2FIUA 2QJ3A 1BY9A 3BO2A 3D45A 3QIPB 2A42A 3TUIC 1Q78A 2PIIA 2QEXS 2J0QD 1TYQA 2HWHA 4O55A 2AGPA 1NSKL 3OHAA 3EEQA 1SZ2A 3T5KA 4LF8K 2PE8A 2ABYA 2MZSA 1VQLN 2ZH9A 4F3MA 3EICA 4H5TA 2NRRA 5DS7A 3CC7N 1EXQA 3OSPA 2VKRA 2BRLA 4CW7B 2WBMA 7FDRA 2IVPA 3QMQA 3MCNA 1KD1T 2N7YA 3RRHA 4C3LA 3CCVS 2OZMA 1KOOA 1N5QA 4NLCA 4USUA 4JI3J 2DNRA 4G3IA 4QBUA 1QE1B 4GY2B 3D7EO 1ZYQA 3M8PB 4GNIA 3V6KA 2CADA 1M5HA 2ZBPA 1QAXA 1RDDA 4YR3A 3M8YA 1RBRA 4JI5F 3VGTA 3RW6A 3U27A 1TUWA 2MZRA 4CF2A 3NAIA 2PY5A 3TARA 2GVZB 1YJWN 1TKXB 2DH7A 5CABA 3CIZA 4O5FA 3FZFA 4CFBA 1GXLA 2A5XA 1CSJA 4P9SA 2IC3B 1SQKA 4BRFA 3G9CA 4J5OA 2V8PA 2YJFA 2VQEK 5ETVA 4DTXA 2KN4A 2RVJA 4I2QB 3ID6A 3PRDA 4IDKB 2D5RA 1S79A 1IO2A 5AZIA 3ZT3A 4ZN1A 2GZOA 4CH1A 4KFBA 2WC9A 2VQEF 1ASVA 3EPGA 1MROB 4MT1A 4A8WA 1RFQA 2DCLA 1XNRK 4B08A 1T9XA 2ZFHA 3RBZA 3HSTB 3GR1A 1VQ7N 2FBYA 1FRLA 2P9UA 4YNQA 1B3TA 3SCIE 1M5KC 4CO3A 2GFFA 3CCEN 3H4BA 2QL5B 4NASA 3LGNA 3CT9A 4V19X 4ZJLA 2HNZA 3BKUA 4HT5A 3VA3A 2FJXA 2ZGZA 1BQMB 4MMOA 3VEVA 3K9KA 1XNQJ 2BTFA 3ZTRA 4P73A 4EBCA 2LU2A 2B6AA 1B9DA 3O1LA 3T5LA 2QA4S 4IRDA 2ZBQA 1RTDB 1YITN 2QFJA 4NA1A 2XC9A 5C12A 4ILGB 4CFCA 4CJ3A 1N5SA 1VQ9N 1NK0A 1K1SA 3IAM9 4DB3A 1FERA 4FJMA 1SKUB 4ZPAA 4WP9A 1IKYB 4JI4K 4L72B 4EWTA 4YOWA 4B1XB 4YB7A 4AFFA 2LSNA 4A48A 2MMYA 4BC2A 2W9BB 1CS4A 4DV4F 5KGWA 3H0PA 2M8HA 2NUUG 3HJVA 4CEAA 3E1YA 2VPWB 4QS7A 1U6ZA 2UUCF 1G15A 5ETLA 4G65A 4IH5A 2BGGA 3CJTA 1FA0A 4DX8H 4CEDA 4B3RJ 2QA2A 3AVLA 3I31A 4LFBF 3ISNC 1X4EA 3EE9A 5CZVA 1YHQN 4XPEA 2GO9A 2QWQA 1P1LA 3K17A 3GPAA 3GYNA 3OYJA 4K50A 2RF2A 5SWMA 2UUAJ 1JLCA 2P9IA 5GIPA 4TSXA 2O8CB 3QT5A 5B0FA 3D0IE 4LF8J 3I6PA 1S59A 1S9GA 1N5VA 2HMPA 2FHMA 4NLVA 3BO3A 2VFTA 4FLUA 3AAQA 3KLVA 3R2DJ 2WVFA 2CH5A 5DO2A 2IA6A 3JS6A 2XI3A 1RABB 2D69A 3J81j 2C42A 1VQPN 2CDQA 1QVFR 2FF3B 2HQDA 1RLDA 5KFJA 1Q81O 2MLZA 2UXCK 2XLIA 4Y0FA 2G8WA 1PYSB 3G4SS 3I56N 4FJGA 1NHUA 4ZVEA 3OW2M 1CEZA 2AJ0A 1IJFB 2DIVA 1M5OC 5LL6d 2R7WA 2G1HA 5C2DA 2YNHA 3MFHA 1FVQA 1S6PA 2V2QA 3VQQA 1FE4A 4ISGA 3ENQA 2UXCF 3LTOA 3NEKA 1HKGA 4LF4J 3ETOA 3CJ9A 2X74A 3AJ2A 3F56A 1NDLA 1VRUB 2OEKA 2IVOA 5AXNA 2I1RA 4X4RA 4PKHA 2E5JA 2VYPA 5D0EA 3A8YA 5AZJA 2F9DA 3CMAN 3UKUB 3VGKA 3IMQJ 1P8ZA 4Y65A 4B1UB 1QUVA 3SUNA 3Q86A 3OYKA 3THWB 5A0YA 4FJXA 2QLBB 3C6TA 1OH6A 4ECQA 3ZZUA 1C0UA 5J2PA 2H4WB 2BUNA 3R3LA 2XMWA 2XYGB 5H1SV 2ZBIA 5EOYA 1O6XA 2E6MA 1ZBHA 2ASLA 1A7GE 1O0PA 2J9EA 4NEZA 2BZ2A 2XMVA 2VPYB 4K5SA 2QXFA 5LJVA 2MYFA 3AO3A 2FVSA 2FLNA 5HN0A 2DGSA 3J7ZO 2Z2ZA 2Z0GA 3BH7B 3KMQA 4C9DA 3NBPB 1WN7A 4FS1A 3BZQA 3NF6A 3NGRA 5EWEA 2ZH3A 2XWXA 1N36J 4OGEA 3ATUA 4BR4A 4DSLA 2E5HA 1U1LA 2YX7A 2A3ZA 1T9YA 1TKXA 3O44A 3G6YA 4FJLA 4R0EA 3LQVA 1XMOK 4M45A 4JV5F 3DLBA 1WOQA 3H45C 1N0UA 1QHTA 1RBSA 4QIEA 3QFHA 4CHQA 1C1CA 2V51B 3Q89A 4K2XA 2P9EA 4FYYB 4USVA 3A5MC 5J1EB 3B54A 2GV1A 4CZJA 5T7LA 3W66A 2LEBA 2HVDA 1MROA 1NGBA 3E9PA 4K0KJ 4IKAA 4ILMA 4JI0J 5KFEA 2P9UB 3LALA 1NUEA 3MXMA 4Y2MA 4BRAA 2ZHAA 1WJ9A 2JOQA 3P5TL 3C6AA 3ZSOA 1SQEA 3M2VB 3U1LA 1TGOA 1FRHA 4KR0B 3CCRN 1FRXA 1RT6A 3P3DA 1S5ZA 4KRWA 1YXQA 1U2VA 2CNOB 2E8AA 5AQQA 2RQMA 1RNHA 2P5OA 3DOMB 2O8DB 4DV0K 4F3OA 3MM5B 4MIBA 3W1YC 4LFCF 1VHIA 4B3SJ 4OMFG 5LL6Z 2WCXA 4ANDA 3TNVA 2QMXA 4KGXB 1HQUA 2AJFE 3MTJA 1R7IA 3VQ7A 4RZRA 2HKEA 4CGGA 1Q0NA 2RDJA 4B3OA 4FF4A 3HPHA 1DY3A 2B3TB 1Q8LA 2XTJP 1FXXA 4L3KA 4E3SA 3TVKA 1RT7B 3EO3A 4GKJJ 4C2MA 2MHNA 3FSXA 3DWLA 1ICEB 3DJCA 1TMJA 3OL8A 3CJAA 3IFRA 5E41A 2HB5A 3TANA 4FJJA 2PYJA 3H8YA 4AL6A 1RT3B 1Y5LB 4UOCA 1KLNA 2UUBJ 1UWAA 3GFHA 4U8YA 2I2YA 5FPMA 3IBFB 2LMIA 3ETMA 3D6TB 1FVSA 3MMAA 4CJ7A 4TU7A 4MKAA 3QINA 1T9UA 1T44A 3AY9A 1LOUA 3FMBA 1OPZA 5ETTA 2JNJA 4CEFA 3ZZOA 4F36A 3D2FA 1BUXA 2HRUA 2DFEA 1U0SA 2C3MA 4CEZA 1RHKB 1HJOA 4NCGB 4KHPK 1TL3A 3MOZA 1M5VC 4DPYA 4H4KC 4DUZF 3PJWA 3J7AN 1VBKA 4JI7F 4J9VA 1QSLA 3MMVA 3VQCA 1UCNA 4X64K 1XI1A 1UA0A 1FNXH 1SJFA 3FSIA 3DYAA 1S49A 4CWBA 1B99A 3H5UA 5E7OB 4CDIA 5FD1A 3JB9k 3OR2A 2CJQA 3US5A 1N33F 3CJCA 3THWA 1FXRA 3RU0A 5M1QA 4E89A 1PSDA 4USKA 3DLLL 3VQ8A 2QWOA 1LK7A 3R7BB 5G0RA 4O4GB 3WNEA 1AXQA 5I3PA 3Q0AA 1LEOA 4KC5A 4DF8A 2DISA 1GQEA 4FJ7A 4CBUA 4KGVB 2MQOA 3O8MA 5ETPA 1KC8T 4CF0A 2JJ4D 3BV8A 3X3UA 2XG8A 3O9UA 3VESA 3W3SA 1NH8A 4Y34A 4JKDA 4QZVB 2XO7A 1VQSA 1M90O 3O1WA 3M05A 1VI7A 4WQ4A 5LXRA 1UVNA 3KKFA 1VGYA 4O4RA 2OD6A 2I7NA 3TWZA 3FQLA 2ITMA 4ED7A 1YITS 4I67A 3MXHP 4KYZA 1R8HA 5M1OA 5JVHL 1N0VC 3NL0A 1S99A 4A59A 3M2UB 4FK0A 4OLOA 1S1WA 1KVCA 5BN9A 2KB2A 3V6JA 1J2VA 5DM6Q 1H7WA 1BU6O 4GV9A 2J4RA 5ELZA 3CTRA 2E4LA 4PPZA 2YKNA 2WBNA 3CIPA 3HHLD 1TVRB 5B0BA 1RLCL 4ZS6A 3CJQA 5AXLA 4DS4A 2B51A 4ILHA 2NSBA 4M3WA 3HOSA 2RB7A 2UUTA 3BQ2A 1RAHB 1BIUA 1HX1A 2XZTB 3OUYA 4XDDA 5HBMB 3QJPA 2DR5A 3AA8A 1G4CA 4L75A 2Y1JA 4FW2A 3GYGA 4YMEA 3MD1A 4LIWA 3KXDA 4KGKA 4ALZA 4C8KA 2XMTA 2R2RA 4IO1A 2F4VJ 3L6QA 2XMMA 4YOYA 4DR1K 1YAGA 1RBAA 4B3SK 2D0BA 3NBPA 3CC2S 3B4MA 3VQSA 3KLFA 2B7BB 2HOEA 4NYOA 1WF1A 1S1VA 3M2VA 3A5OC 4LRBA 5FLXU 2VWKA 5DG9A 4CGIA 3DRYA 4H5RA 4OI0A 5IM0B 4CHOA 3IDHA 1GMWA 4DV3J 3UNYA 3SAHA 4IG3B 2RS8A 4LF6F 2PBDA 3T3FA 1BQNA 4WZMA 2AYBA 2IDEA 4ZVRB 3PW4A 4DI6A 2BJ3A 4AUKA 3FLCO 1MU2B 5J1EA 4RBTA 3LDLA 1GTHA 5FLXY 2ZNYA 3W2VB 3PNIA 3I9V9 3EL2A 3KFWX 2L3MA 1WTFA 3MWTA 3UCUP 3U1MA 4LBPA 3V5RA 2R7XA 4JV5K 3CJ5A 4NA3A 1XMOF 1WKJA 1G1XA 4L76A 4CK3A 1REVA 3WX8A 3GSDA 3THYB 3FCHA 1NB2A 3UDCA 5C5JA 1TUYA 4AL7A 1FT8A 2J7KA 2DRAA 1I39A 3L2WA 1DTTB 3NGKA 1VHXA 3MM9A 1MDUB 4M63A 3IGVA 3J7AP 3HSZA 1VIOA 3MPYA 3ONQA 1H6KX 4HYKA 3LWMA 1KTQA 2DPJA 5KFDA 3KIOA 1CZAN 2X3DA 4DMZA 5A8WB 2CQBA 2FDNA 1P6TA 2OPRA 1IWAA 1ROFA 5K9FA 1IXKA 3IWNC 3DHWC 2B56A 2GUPA 1R6VA 2ZH5A 1V6HA 5GAEI 5M1KA 1DT9A 3DAWA 3RBEA 4Z37A 3NMAA 4ZTJA 3MTKA 1QUPA 5AFUA 4U7UD 3NWGA 1F3VA 4H0XB 2G8FA 1N34F 1H73A 3RSEA 4U95A 4QOZB 2M0GB 2CPIA 5U47A 2QMUB 3MMAB 4HTLA 3TPQA 3PZPA 3LW5C 4NLTA 2FHOB 5GAEP 4KHQA 2E5LF 1RDCA 1QM9A 2IVMA 4KRFA 1Y5IB 3NF8A 3QGHA 3O3HA 2CQ2A 2GHPA 2J7UA 3SAFA 2VOOA 3CC4N 4PQAA 2GS8A 3ZYYX 1XNQK 4F4WA 4ZP9A 3QEWA 3G8SA 1I6JA 3J81Y 3BUZB 3HHEA 8ATCB 3GILA 1RAEB 4JI0F 1CQNA 1A6LA 2CPFA 1EKEA 3GOIA 4CJFA 1PAEX 4EI2A 5LXYA 1C4AA 1YKWA 2X1BA 1LOTB 3DYAB 3U9DA 1LXJA 1RSCA 2G0IA 4DR3K 4FXWA 2J6TA 3OVNA 4DR2K 2WW8A 3G6EN 1Y5NB 4UQTA 2AJQA 2O8EA 3ISND 1HUXA 1VQNS 3PJ9A 1QD1A 1YRUA 1ZETA 1QTMA 2PD1A 2HSEB 2F5GA 4PXBA 5L9XA 3W9JA 4X4VA 3IXQA 3F9KA 2KLAA 3EYZA 2QLFB 3KJNB 3VGVA 4F67A 4ZCIA 3CUNA 4LSNB 3QO9B 3VGLA 4DS5A 4K4ZA 3M3ZA 3LDPA 1WEZA 3UB5A 4I6MB 3UDVA 1HR0K 2H3GX 3QNWB 3TR8A 2FBXA 3C3LA 3J80Y 3NF9A 2EBEA 3FBFA 2I0XA 2W4CA 5LMUK 5GAGU 2WUSA 4CEQA 2MB0B 4KY3A 4DR7F 3VAKA 4NLSA 3NCQA 3I0RB 5DM7L 4WZQA 3JYTB 5L1KA 3BEXA 3DRXA 3ITHA 4WTYA 3BQ0A 1YJRA 4BLGA 1GOAA 5AQTA 3Q8QB 2VBYA 3EGVA 1AYEA 1GEHA 5IZHA 3EVOA 5KFHA 1K0VA 4USIA 5BR8J 3VQ5A 2HRTA 2DGQA 1NGDA 2ROEA 3O9QA 3W2WB 3QLHA 3AVIA 2COLA 4RWWA 2NRXA 2QYCA 4KE5A 2XMUA 3KLHB 4JKGA 3MCSA 4JI7J 2XS7A 4UW2A 2EEYA 2XSJA 3KUGA 5KAKA 4WYLA 1NOYA 4JI4J 2NXEA 3OBIA 1KQGB 4H5NA 2X7IA 3GWCA 3WXJA 4CP5A 3KHLA 2HS0A 3S8SA 1Y3JA 3Q8RB 5HLFA 4FN5A 4PG6A 2PMZD 3JS9A 3JSYA 1T02A 4O5BA 2EC2A 2X51A 2X6NA 1NK6A 3NH1A 3M6WA 2B8QA 5JS2A 4KHWA 4C98A 4F4ZA 5HANA 3J7YP 4I9QA 5ETQA 3TZWA 1U1NA 4DMNA 3PSFA 4G6VB 4B02A 1FXLA 2DYAA 2O8BB 1HYZA 4LFCK 2BANA 2JH3A 2ASOA 2RUGA 1Y10A 2QX0A 1RWUA 1TAQA 3BF1A 2B9EA 1HQ2A 1BMQB 4TU9A 2ZJQQ 1IBLJ 2HVIA 3I55N 3AVAA 1M1KT 1X8DA 4UY8T 4TLRA 3I0SA 3GU0A 3E01B 1WNEA 2RKIA 3D7SB 1RAOA 4O0JA 2AEMA 1T9TA 3T19A 4DSEA 3TWHA 4LQ9A 3FNNA 1ZM2A 2KL8A 3PHEA 1MSWD 3ZXWA 1S6QA 3W8GA 4CNYA 2R9LA 3A0IX 3W64A 4UF4A 1J6ZA 1RDAA 3DLGB 2QGFB 3W62A 1IKWB 3O4WA 4BRDA 1RTJB 1S7IA 2GNKA 4FNHA 4JI3F 1NK7A 4JI4F 4CLZA 3VQDA 1R0AA 1DKGD 3AOCA 4GVBA 3FQKA 3ILLA 3O6WA 3SCLE 3D2EB 1OY9A 4UZBA 3WEEA 3GQCA 2PEBA 2LQJA 4JI3K 1RGIA 2VGNA 4CJ5A 2PAVA 2P9CA 2RE2A 4LBHA 4YR0A 4CI6A 3AVKA 2FJAB 3KK3A 4I6WA 2O8EB 4CJQA 1IBKF 2I8EA 2BQ3A 4C1NK 2ACYA 4S0MA 1GTEA 4QWBA 3KHGA 4OLAA 4U8VA 5KFGA 1VSDA 4R0JA 1T9VA 1K8KB 2K7JA 3WQTA 4URQU 1W97L 1WB9A 1RWKB 2XZWA 4JHDB 4X64F 1ASWA 3BZKA 1U6FA 2CGJA 1B4SA 1RHUB 2XM3A 4X65J 4WIIA 5ETMA 2W7PA 4FPBA 2V63A 2ADCA 3KOAA 1ZM9A 1NNDA 2E7WA 3O4NA 1FWKA 3EUNA 1NEEA 1BCOA 4XH4A 2W9CB 3FC9A 1FFWB 4C0OC 2BUPA 4I6YA 3DXKB 2E9RX 5CY4A 3L2RA 5D0HA 3TJ8A 2CQCA 2V52B 1WSHA 3P5BP 4WCEL 4WCEQ 3CQYA 4CGFA 4YDUA 4A8QA 3HYFA 5AJ3K 1TUUA 3FRZA 2DY1A 1N32K 5KT7A 4ID5A 1J54A 4FKYA 1VSFA 3NXZA 1XQSC 3KLEA 2Q3SA 3PACA 3BGFA 1T95A 4CFAA 1JLAB 2RHQB 2P5VA 2CAJA 2ZH8A 1XJWB 3CDWA 3IS9B 4CLKA 2YH1A 4LSNA 3G6VA 3JAMO 4CIEA 4KHYA 3VALA 3UN2A 4NA2A 3RWUA 2XSJB 4PPDA 3PX4A 1NSPA 1B7YB 2ZGYA 3SUPA 4W90B 4A8XA 3CC7S 3AJDA 3GV8B 1Q95G 3KD5E 2RN2A 2CQHA 2P6SA 4N56A 4WK3A 4PKIA 4IKFA 3WX4A 5D77A 2XNQA 2C3PA 5AQIA 1CJKB 4UQGA 2UVUA 3CMQA 2C2NA 5DDPC 1HPMA 4BRHA 3VHQA 5HQLA 3VQBA 3R5CA 1A5WA 3PW2A 3D5MA 3ZEUB 4CLLA 1KEKA 3SBMA 3H2UB 1WTBA 3D0HE 2OJ3A 2PFFB 4H5WA 4XK8C 2Q79A 2R4FA 1JJ2R 4WFBL 4IDKA 1RT2B 3J7A1 3HRGA 2X1FA 5THWA 3D6RA 1QQMA 1EQ0A 4C8MA 2RAQA 4DHVA 1JXVA 3QSYB 3IAYA 5C24B 4DL2A 4X65F 3CCTA 3LANA 3ZTPA 5A8KA 1RBUA 2HQ3A 3AA5X 1LV5A 5GAGP 2NYHA 5KPZA 4PL7A 2J0XA 3K0JA 1L3TA 3DLEB 3M5RA 1RWWB 2OEJA 2V8HA 4ID1A 1B0TA 2M7SA 3K8VA 4ES2A 1W2BR 4E7KA 4OX8A 4M5MA 4JI1K 3SBGA 4A47A 3SSRA 3LP2B 1FJGJ 4HKQA 2FJWA 4OKJA 3QJJA 4OPKA 3M8QA 3GCXP 4WP8A 1CJTB 3ZT4A 3P1GA 1D0EA 4FK2A 2HBYB 4ERDA 4AL5A 3ULHA 1F2HA 4JV5J 4ICLB 1S0MA 4AHUA 2D3UA 1QVGM 3MXJA 2C3UA 8AT1B 4ECSA 4FJ8A 3CCLN 1R0AB 1HARA 4K5RA 1SH0A 3THTA 4H54A 3TRGA 1ZBSA 2YKMA 2IVNA 4EZ6A 1LFPA 2D74B 1U47A 2Y0BB 2L48A 5D15A 1VQ4S 4C0BA 2EHGA 2DGOA 2P9NA 3CD6N 3NH2A 1O51A 1HJRA 3KK3B 3KJVA 2HHTA 3NAEA 3NCPA 4X84A 3HVWA 3UCGA 2DT9A 2DNZA 5GADU 1S12A 1TMMA 2W7OA 5HVGA 3S41A 3ENOA 3MM6A 4LFCJ 3CETA 3O80A 4KI6A 1S48A 2DNHA 4MDBA 1EJ7L 1P27B 5KT6A 4CRJA 1WC4A 2D3OR 3KMSA 2HWIA 1RT1B 3HX9A 3UR0A 3JTPA 3TA1A 1MN7A 2NNWA 2G2YA 2OD4A 1IN0A 3OYLA 1FWLA 4MLHA 1TL4A 1NJXA 3H20A 3VAJA 2OI2A 4FLWA 1WDTA 2OPPA 4J9RA 5F8IA 3OXFA 1YTAA 2ASJA 4PA1A 3QMLA 1O5JA 1TL1B 4DQPA 4JI0K 3WUHA 2MZQA 7AT1B 2PZSA 3MAHA 5GAEU 2HG4A 2VFVA 2DH8A 2MY8A 1ZC6A 5KRTA 1YJ7A 5LJ3Y 4JAXA 3NWRA 3KLEB 3JAMY 4ZHRB 5AQUA 2AEFA 1V4TA 2V67A 3VOVA 4DLGA 3OS1A 1KWMA 4O3QA 3MUVP 3SQOP 1EKSA 5KG2A 3B8AX 3T1HK 4ZCLA 1SI9A 4YEAA 1NB7A 3P49B 4W5RA 3NCRA 4FWRA 5HRNA 2E88A 3ILIA 1GLEG 1DGKN 3HSDA 1ESVA 4H0VB 1R8AA 3KK1A 1VQKS 2QG9B 4JRPA 4WE1B 1S6OA 1DLOB 1PGZA 1MWQA 2APOA 1S6UA 3H4DA 2O66A 4AM6A 1V9OA 4GV3A 4JYAJ 5FPNA 2NCKL 4QCLA 4A8SA 4DQSA 1NU4A 2IBKA 1W0HA 3O9SA 2OELA 1LWFA 1DURA 4N47A 1NKBA 5IWAJ 4EZ9A 3LM2A 2B5JB 4ER8A 2XY7A 4NYNA 3PUFA 3DLKA 1K0TA 3O8WA 4HI2A 2NR0A 3UKUA 4WF9Q 2VQFF 1VQ6N 3IO1A 3DI6B 4DV1J 5E26A 1EX8A 4IUFA 4RTFD 1WG4A 4WTOB 1QVFM 3GB0A 4FPIA 2ADBA 3N01A 1JMTA 3HVAA 3GDQA 3AGKA 3CEDA 2NYIA 1UVLA 3TI0A 4FJKA 2MJUA 4ZIWA 4RUHA 4E7LA 3QAEA 1YTYA 3OTEA 4W5TA 2EKYA 3G82B 4OHYA 2R7TA 2AJ1A 4MIAA 3MMCB 3ICLA 3T1YK 1B70B 3MMJA 3UQSA 4CZMA 5IC4B 3WXIA 2EW9A 4DPWA 5IXUA 1ZH5A 5HOOA 4Z4IA 2LXIA 4LRFA 1C4CA 1SJ4P 1X4FA 4P74A 2KKZA 1JLGA 2UUCJ 3FCWA 2HAFA 5A8KB 4A46A 4X2BA 5KT5A 4Z4EA 5E3CA 1RT5B 3DLEA 5D3GB 4QIWD 3CC2N 4PWDA 2YWKA 1Y11A 3FE1A 1FDNA 3NY0A 1KSPA 1NGGA 4ELTA 2PMHA 1RWMB 3SPZA 3ZSQA 3K7RA 1X3MA 3JSMA 3SCJE 3TZXA 4K8ZA 4WFAL 4FP9A 2CPJA 2HIYA 4R8UB 1C1BB 4DV7K 4ICLA 2RNEA 4ELVA 3UN5A 4HVZA 4D3HA 3JAMU 5E5NA 3PVXA 4PY5A 2E7XA 1RE1B 5J1NA 3WBZA 1MN9A 2FY1A 1TZ0A 3CQXA 4JS4A 2KG1A 1UZDA 1UPPA 3N5BA 4Y0WA 4NE9C 3OA9A 3IA0A 1HWKA 3OJSA 5KFWA 3LP1A 2XWYA 4NLBA 4K4XA 2B4JA 2XLJA 4N76A 2XYPB 3GP9A 4FJ5A 3MHYA 2J76E 1B0PA 1R89A 1YI2S 4BC5A 1LWEA 1RB0A 4DQQA 5KOWA 1RTIB 1RBOB 2K3KA 3K57A 4DV4J 1Q53A 3MM5A 4A57A 2UU9F 3EZOA 2XY6A 3F0NA 5K8OA 2DNPA 2V7YA 1SPBP 2CIMA 3TUJC 1Q1KA 4MDAA 1DTQB 3IP0A 2V69A 2C3OA 1HBUB 3NMUA 2ZQBA 1T6DA 3K5LA 4HVJA 3LH2S 2YKAA 4FZYA 4XPCA 1MLAA 1FX4A 2CPEA 3SAGA 3CDAA 4IXCA 3AH6A 3KK2B 2VB6A 3V9ZA 2YKMB 4P7TA 4Z4HA 1F5BA 1R6YA 3O9TA 4BVOA 1DEJA 2FUG9 4CGHA 3CJ2A 3V81B 4NPOA 2LXUA 3TJAA 2P9NB 2EK1A 3POTA 3ZTQA 3VZIA 1JIHA 4HLBA 4HHTA 4CNZA 3MECB 4MQ3A 5J2NB 1NMNA 1XMOJ 1F2GA 4KAZA 1JXEA 1SB6A 1CVJA 1D4XA 2BXJA 2FYXA 1HHSA 1QQCA 2ZDOA 2OMOA 1ZAXA 4KHSA 2HFUA 3TAMA 5I3UB 3GSIA 2Z1IA 4I7FA 1AT1B 1Y3KA 1FD8A 1Q5VA 3KWIA 1RT1A 2MHEA 2GTDA 2AMCB 3O5BA 5KRSA 4NCGA 1UJ5A 2MQLA 3M32A 9ATCB 2Z8QA 3PRBA 1F1BB 2IMWP 2CQDA 2B5JA 4FWLA 2IAJB 4HDGA 4FW1A 3OTOJ 1TL1A 4OYXA 1LK5A 2X1AA 1VSIA 2IJRA 4DV5J 2YJEA 1F5CA 2DHSA 1KQFB 4FZVA 4FVUA 1EWRA 2HEKA 1R0BG 4O23A 3MCPA 1KVKA 3LOUA 2UUCK 3I9ZA 4F4XA 3RZAA 5HJXA 3SI8A 2JWNA 1JJCB 1OH7A 1KVJA 3CFOA 3TSPA 3HHKA 5DLGA 1SUQB 4AT1B 4M3ZA 3ULEB 2HYIB 1CJUB 1VCTA 2R42A 2IM2A 3I5AA 1SCJB 1SIWB 2KM8B 3C2PA 1HNXK 5MLCQ 3F41A 3PYGA 2YQ1A 3AD7C 1X5PA 3RW7A 2I5JB 4DG1A 3E3XA 2FLPA 3E66A 4FWNA 4F3TA 3BKTA 4MO5A 4DX7A 3J7Z5 4EMDA 4K4VA 3QGIA 1WSJA 2ZNZA 2QEXN 3S1TA 1S1WB 4RUCA 3MPVA 3N5FA 2UXBF 1CJVA 3QPIA 2OPQB 2CWXA 1HKCA 2UYTA 3CMEN 1VYAA 1C1BA 4K41A 2IRXA 3PDNA 3MEKA 1WBBA 2E44A 3KNGA 1Q7YT 4KTWA 1S3XA 4ILLA 3VAIA 1RDWX 1WG5A 3I5CA 4Y2KA 4IO9Q 3P8BB 1U2FA 4ZP7A 4X66F 3D9BA 5B0AA 3HSJA 1HRHA 5B7WA 4TVAB 3VQ9A 4ZDNA 1GLAG 3KWMA 4JKHA 4CD3A 2BE7D 1F9FA 2O1PA 4QJVA 4ECTA 2BE9B 4X4SA 2ZE2B 4WK1A 3KLFB 4FJNA 2NZCA 4BRKA 2HHHK 5KFCA 1HBMB 2ZKTA 1LWEB 3BEGB 2YHYA 4UUXA 1WC6A 1LFWA 2QSFA 4YQWA 2QLXA 2G0JA 2N3LA 5KQDA 4KIAA 4I6AA 4TXSA 5HP1B 1TR0A 2K2PA 1SL0A 5AE2A 1V3SA 2PDAA 2NRVA 4CFDA 3HHDA 2A2DA 1XUPO 2L9NA 1VAZA 5LSLA 3SI6A 3GG4A 2PFDA 1X5OA 5HAOA 3DOLB 4BRNA 3TR5A 1NNEA 4C7QA 2QIFA 5CE3A 1HBOA 1HPZA 1FRJA 5KI6A 1X4AA 4HUEA 3M8WA 1YLXA 5BPMA 4X4TA 2DY9A 3PEHA 3FR0A 3MN6A 5CYJA 4Y2AA 3FEYB 2GAGC 4JI2K 1HNIA 1KS2A 4EO8A 4CJWA 5IC6B 1Y4ZB 2CPZA 1N54B 2BJDA 1QSSA 1IH7A 3DMJB 1C0TA 2HRYA 4OJ1A 3GE1A 3CCQS 4PWUA 4GO7X 1JWWA 5CZXA 1WC3A 3VGSA 1TFWA 3TQ1A 1RBLA 2RE1A 3CI5A 3UCZP 1E4GT 2OH2A 2RF2B 3BZCA 1AUSL 1WC0A 4LF5F 2P9IB 2W2OP 2BKOA 2VBWA 4KHPF 1LAVA 3OXLA 2Y1LB 1PC5A 5KFXA 3M8PA 5B0GA 1S9GB 3FDSA 5B09A 2L08A 3O3GA 1NHKL 3KLIB 4LSZB 1U49A 2P5GA 5J2MB 4PQUB 2FHJA 4LD0A 4W92B 3VR1A 1S1TA 3C8YA 3K89A 3BBBA 1NJZA 3R97A 3OQ2A 4AHVA 1VSHA 3GTYX 1IBKJ 3V81A 2I6WA 4JN4A 3DFEA 1NH7A 2YNIA 4P2XA 1NKEA 5FPEA 4CJVA 2Q2RA 5F8HA 2E5IA 1U6BA 4USMA 2WVDA 1GK8A 1GXTA 2FLLA 3HZGA 4P71A 1TFYA 4HCBA 4C1NI 1FXDA 3TAQA 2MTLA 1GXUA 3GYXB 3CMAS 2PO4A 2ZOMA 3ULEA 2JC0A 2SXLA 2OTLN 5AQSA 1T05A 4WFYA 2XULA 4DV0J 2LYVA 4DPOA 2K8GA 3W65A 5LMNK 1S1UB 3NGTA 4EIAA 1EQYA 5KOXA 2NRWA 1VDHA 1RTZA 2B9WA 1VRUA 4KH6A 4H0OA 4A5BA 1QLNA 4B8CA 2HFNA 4DX6A 2A6AA 2P51A 1FRKA 5DK5A 4RW9B 3CYMA 4CJKA 2Q97A 2QI2A 5AXKA 4K0KK 5K14A 1PKUA 2HNZB 4IYQA 3PKMA 4BHQA 1WHYA 1VSEA 4LF8F 3V1OA 3VTHA 4EP5A 2XQCA 4FO0A 3I87A 1YJNN 3OT9A 2HHUA 4WFNL 1VK0A 3RUBL 4JI8K 4DL4A 2C2ZB 4L3QA 2WZ1A 4IH6A 4DR5J 1R27B 5BR8K 4B3RF 1CJUA 1OJ4A 3CD5A 4PG4A 2KKHA 2KXNB 4X64J 4DU4A 4DTOA 4EFHA 3T1AA 3GG0A 4J2DA 5FDLA 2WTUA 2HLTA 2V7ZA 2LU1A 4CJPA 2CQ1A 2JFKA 4Q7AA 4RBUA 4Z4CA 2G8KA 4ZA1A 4L74A 4ED0A 3GL1A 1XC9A 4PG8A 2GMJA 3ZX3A 3H59A 4MIWA 3DGPB 2KVQE 3HJFA 1LW2A 5K8MA 5LMUJ 2F65A 1W9HA 4BR5A 1FK9A 5CCMA 2OIHA 1NSAA 2HFZA 1YUWA 3A12A 2Y1RI 3BY5A 3V6HA 1BG3A 4QYRA 1JXBA 2V2ZA 3F73A 1X4BA 4JV2A 1PBUA 1VQKN 3AHPA 4FYXB 1C1CB 2Q6BA 2YX6A 1K47A 4B3MF 5EWGA 3RB4A 3C95A 4M3RA 3KZBA 4JI8F 4IOXA 3I5BA 5HMWA 1RCXB 1E6YB 1NLVA 1U0HA 4BRQA 3HKZD 2R2SA 1ATRA 4YHHF 3BYPA 1PJ7A 5E3AA 1GLFO 4B9MA 2VG7B 1J5EJ 2DCUB 1M0SA 4JUZA 2YHAA 4EHTA 1NJWA 3AO5A 4BG9A 3H6EA 4QIFA 1EETA 2W4DA 1VLYA 2O8FA 1HWJA 2HW3A 2VJVA 1HLUA 2ZE2A 3VAFA 3MXIA 3U9ZA 3N28A 1U1QA 1C0TB 2ZVIA 1ZBFA 3WXKA 4NMLA 3L0QA 3BJYA 4M42A 4DUYJ 4M7XA 4OQJA 1F0XA 3M30B 4I0WA 1TL7A 3CO9A 3CCSN 1FDBA 1UW9A 3BP8A 2AW0A 3B6BA 1VRTA 2VJUA 3SDEA 1X5TA 3FZ2A 1JLCB 5M2PA 3P4IA 2UVVA 2VBXA 4E19A 2WFBA 1S9EB 2E66A 3KHYA 3NE6A 1MW7A 3FK4A 2CG8A 2QLWA 1BA0A 2Y9HA 2A2CA 1N8RO 2FVQA 4OJHA 4YDXA 1SL2A 1T0TV 1PIEA 5JLFA 5AZJB 4F4AA 2E1RA 2YWWA 1XR5A 5ADZA 3HSCA 3CCJN 3U3YA 2OLWA 8RUCA 2ZITA 5H1SQ 5A0YB 5GIOA 4DV0F 4NXMJ 1HYVA 1T03A 5LM7E 3FBEA 3WXMB 1YVUA 1XN9A 2YV0X 2YKPA 1ZOTA 5GAHI 3GFXA 2F4VK 3HD2A 3JQKA 1IKWA 4P2SA 3W9HA 5KG7A 1TKTB 4Y6IA 5IT9O 4DBQA 5J1PA 3CC4S 2R8IA 3QIOA 3C16A 1LW0A 3GMGA 4U67L 3NS7B 4J90A 3SQGA 3PX6A 1VQNN 1VQMN 4IEIA 3NRBA 1X9WA 5F8JA 3MURP 2FJEB 5CZ2A 1WG1A 5J2MA 4PQUA 2MKSA 3CCVN 3P38A 2QK9A 2E1PA 2CVIA 3T6JA 2G8VA 4DV6F 2FBTA 3OR2B 2EBGA 3MAAA 4OZ2A 1TKDA 2FJBB 3HVTA 1JLBB 4BRCA 3KG1A 4LF2A 3S01A 4CHYA 3OYAA 4DTNA 4X4NA 3FGUA 5B0EA 2GIQA 3K5NA 1BUPA 5G0RB 3HFZB 4JI7K 1S72N 1X0PA 2BW2A 3H25A 1JCGA 1H74A 2DHGA 1RTHA 3N6NA 4AXJA 2O4GA 2RDIA 4MLEA 3KYLA 2AP6A 5KTQA 2IOCA 1LWCA 2YNFB 1U48A 4OX7A 2IHR1 3CCMN 5EY4A 3NDKA 2EPIA 2HK2A 3DXMB 3TTDA 3TA2A 4DR3F 4IFYB 1PG5B 4FWSA 2P9PB 1B7FA 5AQNA 3BR9A 2YHBA 4NB4A 2JVRA 4F7VA 3P4UB 3H2LA 4U7CA 3CGIA 2FB0A 4FJ9A 3TAEA 4DN0A 4DX5A 5EVZA 5KFPA 5D0RA 5AT1B 1VOMA 3P96A 5CQGA 4Y2CA 4ETXA 2HK3A 1FKPB 3S7RA 2FLOA 4DV5F 4BRMA 4A2AA 1U2VB 3EMTA 4KHMA 3N0VA 4FZZA 2W4PA 4K43A 4FWQA 2Q0UA 2VFSA 2RRNA 1VQ5S 1BI4A 3HI9A 1FJ7A 2RHSB 2RHKA 1SKRA 1XTZA 4EO6A 4OJRA 4I56A 2CPYA 1HQUB 3R8EA 2HHSA 1Q4RA 3SCKE 5IV4A 3DRPA 2G0CA 3A1YG 3R5JB 3P5JA 4P72A 4ATNA 4CHNA 3T6BA 4PWWA 5KG6A 2CPHA 2HQFA 3KG0A 4Z7CA 5AJ3F 3QERA 2HLUA 1UL3A 4MKYA 3BPSP 2HZVA 1N6QA 3RTVA 4DCOB 3CFRA 1BDGA 2ZH4A 5KT2A 2G1DA 1CJKA 2CDRB 1URRA 2N7CA 3OTOK 4O3NA 3GCWP 1S1VB 3NGUA 2YWHA 5RUBA 2MKKA 3P6YC 1XK8A 4K25A 1DQAA 4DSKA 4QU7A 2VG5A 4DEZA 4C11A 3D4JA 4YOXA 1N5YB 1HQEB 3HPOA 3QYYA 4DU8A 2WONA 4UTGA 3IBWA 4M8LA 1KBRA 3OLBA 1WI6A 2AX1A 2V8GA 4FXVA 3LZIA 3AGRA 4FF1A 3QT8A 6FDRA 1UAWA 5E33A 3BBCA 3CDUA 3OLAA 4CYUA 1IUJA 3RAXA 4FLZA 2C28A 5M2UA 4BG8A 1JLQB 3T5JA 1FDDA 5HQMA 4FL9A 2BMBA 4OKKA 5D6GA 1BE4A 2EVZA 2O8FB 2WOMA 4LQ3A 1WHVA 5KFAA 3UVJA 3EN9A 4AHSA 3VF4A 4UT4A 3DU6A 1BISA 5DDRC 4TQRA 4KO0B 3A3PB 2GO8A 4PYDA 2UP1A 5KFMA 1ZPVA 1S7HA 3N79A 3N4WA 2GIFA 2DR9A 1S1XA 3BN7A 3IWLA 5JICA 4DCPB 4FWKA 4DTRA 1HBNA 2QA4G 1XMQK 1GH8A 3DLLQ 4YORA 4DR1F 3MCOA 4PKDB 4CK1A 4DU3A 2HPUA 3A8KA 3C7NA 3M7VA 1EIYB 1ITPA 3DOKB 3MCMA 2ZEJA 4HTJA 5KFTA 2KU7A 4RLEA 5M2RA 5DGBA 4QOTA 2ZWHA 3AAWB 5LSRA 3FZBA 3OYBA 3DU5A 1I3OB 1WUAA 1J5OB 1IR2A 3NGYA 4CIGA 5AQLA 1ZTTA 2MY7A 1U09A 2LXFA 3VV2B 3VENA 3E51A 1Q79A 1TYQB 4A8KA 3DRRB 3I33A 4UY8O 1YJTA 2YKNB 3CCES 3NGSA 1Q86O 4EFAC 4R5PA 4HACB 4CJSA 2NZ4A 1RTHB 4O4GA 1D8YA 1UW4A 4I2QA 3A5NC 1FJEB 5KFSA 3MX5A 4YY3F 2ILZA 3OV7A 1BXNA 4IQXA 3T9ZA 1R3NA 2F8EX 3C16B 2PMWA 5EU7A 2Z1HA 3L7PA 2Q1LA 2HMIA 4F8RA 1D9FA 3WDOA 2WK4A 3W61A 3SQGB 2R8GA 3HZEA 4FBTA 4B8AB 4FSVA 2P9PA 2H48B 4B9NA 2D9PA 1D9DA 5BYRA 2V4JA 1X1PA 4YY3J 4RU2A 3K2YA 2ZD1B 5KFUA 2DNQA 2DIUA 4P75A 3BB5A 3HFKA 3DLJA 3HULA 4XIUA 2IDLA 4IWVA 3UIQA 4BWMA 3I4PA 3L3VA 4N41A 3V1QA 3DNCA 5D4PA 2QC3A 2GVZA 5IM0A 2JGUA 5JUMA 3NHGA 1RQ0A 2AA4A 3V6DA 2N4DA 1NPKA 1H7XA 1YVNA 1OIAA 1WORA 2XMAA 1JLEB 2V2VA 5C2FA 3MAQA 3FCVA 4ZVTB 3HFVA 4I6MA 5CD4A 5BXIA 1BHNA 1HLWA 2ZHBA 4B9UA 4W5QA 5IQ6A 1IKYA 2DPIA 4JD2B 3OUYB 5MLCV 1UPMB 2ZJQL 1CS4B 4DFMA 4QW9A 5IQQA 3CF5L 2XLKA 4ZP6A 2K7KA 3QRPA 4DKWA 5DDQC 2KM8C 4P52A 3EE3A 4X62F 2Q0RA 4HHUA 2HBRB 1NHVA 4H5VA 2QWNA 1TK8A 1NDCA 4MK9A 2P2CB 2ROPA 1GOBA 1KC8O 3BS9A 1G3OA 4MYUA 4PXEA 3MUMP 4Y1CA 2W7AA 3TZYA 1XR7A 2GQQA 3PG9A 2YWEA 3TU5A 1ULRA 3SCXA 3PW0A 1ZAWA 3KVGA 1NSQA 3GJQB 4CYUB 5LMUF 2J6UA 1EP4A 2AU0A 3ULDA 3PEJA 4BWJA 1JLGB 2CVEA 1VQ4N 2OPRB 1WSEA 1KVAA 1VS3A 5ADXA 2W6LA 4C97A 2UUAK 4I68A 3VQTA 2MEWA 1UP1A 1BGXT 4FWMA 1RT4A 3U4LA 3RVCA 2MKIA 3VGMA 3HHNB 3SFGA 1Y9OA 2WOMB 2V94A 1CULA 1ZPWX 4ELUA 2F9TA 3ZSRA 4ENOA 4B3SF 3ZNJ1 1RBTA 1LXNA 1SKSA 4YDUC 4EHUA 1CXUA 3AA4A 3V4IA 1VHFA 3CJ1A 3THYA 1SC6A 5ITHA 1SKWA 3OYHA 1NAQA 5JMVA 5I42A 2VG5B 2HHXA 4KH1B 3THXB 4RWXA 2CNNB 4FLYA 2VU5A 4USJC 3NFAA 1HBNB 4PL8A 4AHCA 2E5GA 3KKSA 1T94A 3R8YA 4E1NA 3VF6A 3LGMA 4IZ9A 2WW4A 3D68A 4YHHK 4LF7J 1EX4A 1GMVA 4KH0B 5F3TA 3TOQA 3EY1A 1OWXA 4B3MK 2FZGB 2XI2A 5A8WA 1HNWF 4F2RA 3IMXA 3J81O 2NRZA 2PI5A 2I9SA 2ROGA 2HS4A 3BSOA 1YRTA 3TJ9A 4KHRA 3PXGa 3T1HJ 3UVJB 3U8XA 4LUBA 3MEEB 2DTUA 2JFDA 1E6VA 2KDOA 4KV8A 4Q0BA 3BQ1A 4AXIA 4RO0A 1KFDA 5B0DA 4TY8B 4KH5A 3ZT2A 3FZHA 5D4OA 4DUTA 3DM2B 3CPWM 4C8OA 2XGPA 2D4WA 4ZIVA 2ASDA 2BABA 4P7VA 3NCIA 1MMDA 2OMLA 2IM3A 4N5SA 2DNGA 1DARA 4ECYA 2MQPA 4CH0S 3DOKA 4IO8A 3IR5B 4ZLLA 2JLFA 5AQKA 4DSJA 5C42A 1GX5A 3PR5B 1EQMA 4DR6J 1HA1A 3O3FA 2JX2A 2Z58B 1JJHA 5KFNA 2H5EA 4I2PB 5A6WA 3C14B 2HFOA 2VDHA 4EAHD 2CQ4A 3CJ4A 1OH5A 1HFEL 4CEEA 1NK4A 4YFUA 1VQ8S 4NLGA 4YUDA 1KR4A 3LPYA 1WELA 2LCWA 1Z26A 4NWBA 3EGNA 3FZMA 4KREA 5I3UA 1BD6A 4U7BA 4FXDA 3RRKA 3AO4A 3SSQA 4B3MJ 3Q2TC 1RK8A 4K0KF 1VMBA 2DNOA 3GIKA 2J9DA 3CJKB 1RWVB 3JXUA 5LJWA 4DL6A 5EHHA 2UXBJ 3TTFA 5KPRA 1WNSA 3MN7A 3B4DA 5GADI 4OPAA 4HR2A 3MGJA 2OUGA 3SV3A 4OLPA 1MWZA 2PA3A 4E0DA 4A8FA 2AD9A 1ZM4A 2E29A 4FKXA 1SQGA 2BQRA 4ZPVR 5HROB 3W5ZA 3UD3P 2J0WA 4DUYK 2CFXA 4A8OA 4IOAL 4UOFA 3VERA 3A3NB 4UOGA 4CHZA 2EKNA 2QWRA 1RJJA 3W0LA 4JI1J 2BW7A 3ZSYA 5D0GA 5GADP 3S3NA 2R7QA 3QAUA 4AHRA 1JNRB 4ID8A 1A9NB 2A10A 3DKDA 1YHQS 3OYIA 2ZF5O 1RWPB 2DBBA 3KUEA 4O8KA 1TELA 3BDPA 5E3QA 3HK2A 4JKEA 1J5EK 3L8BA 3R5AA 3HO1A 3NS6A 4PEOA 2VODA 4ZLPA 4KQZA 3M8RA 4DV2F 1UFLA 2B0GA 2I5JA 5BRHA 2NUBA 4JV1A 4JD2A 1MG7A 3CULA 3AVGA 3I56S 3G4SN 4BROA 1RDRA 4KGMA 1JNZB 4XDCA 1UOCA 2LP4A 5AQHA 1H2VZ 2HFVA 3HSGA 4URSA 2PI4A 2YNGB 1WSRA 1CJVB 4TN2A 1CZ9A 2B7CB 4C48A 3G87A 4BDPA 3ZZZA 1REGX 4DDFA 3N9UC 1HNZK 1XIQA 3FFIA 3W9IA 2OO4A 3FBBA 3THXA 4LFAK 4X65K 2FSKA 4FK4A 2V4QA 2ZM6F 6AT1B 1RKJA 1Q18A 5FROA 2IYGA 1KDNA 4A8YA 3QB0A 1NBWA 4DR2J 2R7VA 2CQPA 4LVNP 2DPNA 1ZM3A 2ASMA 1SQFA 3B78A 2L9WA 2VBZA 1P1TA 3D3BJ 4LR9A 2G2OA 3HBTA 4OYAA 1RDUA 3T1YF 1ZS6A 3MEDA 2YX4A 1G2EA 4LF6K 3SJJA 4TQSA 1C0MA 2VGMA 3VVUA 5DQGA 5K20B 1YX2A 4PG5A 4Q0BB 1PYTA 4BBYA 4DR4K 4ZVPB 2J7WA 3SZ2A 3HM9A 4LR8A 2KTQA 5HP1A 3ENHA 4XO0A 2O5DA 3GFZA 4Y2IA 4HUGA 5I42B 3R5BA 3G96A 2XBPA 2E9TA 1ZBIA 2YTCA 1QY7A 3TAFA 3MEGB 3IFEA 2KT5A 1NXIA 2FC9A 3IR7B 2RMLA 2Z4PA 4GC7A 1JLFA 2HGMA 4BS2A 4FDFA 1TL3B 3LDOA 3L95X 2W2QP 3GG1A 1IBMK 2NXJA 4ZPTR 1JK9B 3C6HA 3QEVA 3GJSB 4FLXA 4WFBQ 1X4HA 2IRYA 3H08A 4DFPA 2IPOB 3FGVA 3E9OA 2CUYA 2XMJA 3EM1A 3VZHA 4JS5A 1FKOB 3BR8A 4PUOA 1MWMA 2C2EA 1JJ2M 1S5JA 1BLUA 1U1OA 3C46A 3DRSA 5C15A 2G2ZA 2HBZB 1L3VA 4OZNA 1LKZA 4ZPWR 2F96A 1IQTA 3PYEA 4B9TA 3CM5A 3L9ZA 4YY3K 3ZX2A 3W3DA 2CPDA 5KG4A 3ALYA 3TYTA 1VQ6S 1M1KO 1OH8A 1KP6A 1DQ8A 4WFAQ 1SV5A 1ZA1B 3UFCX 4FBUA 2LECA 1IG9A 1TKZB 2RQ4A 2XGQA 2MXYA 4FYVB 2ALYB 3RBDA 2K06A 5HQ8A 2BOPA 2XZDB 5D78A 4KJIA 4A8MP 5F0XA 2BJ9A 1SBRA 1GNKA 2HQGA 1R8BA 4BC3A 1T6CA 2YNIB 3U02A 3ZZRA 3CVKA 1U2RA 2UXDK 1UA1A 1N52B 4DV4K 4LF7F 3OBWA 4M7YA 3H40A 2VV5A 3M2UA 3CJ7A 3QBXA 2N82B 2VWJA 1VQYA 4BY9C 4L6V3 1YIJN 1S4FA 3BGRB 2H51B 3BGLA 1VRQC 1BQXA 4IG3A 5M1FA 2X1GA 2UU9J 1TVRA 2HNDB 3KWGA 4O44B 4BR2A 3H2VE 4GMKA 1RT2A 1QAIA 2QE5A 2DRBA 5MAOA 3R5DA 2VA3A 1EO1A 1FCAA 2KFZA 3C6UA 2P1JA 1TL5A 6FD1A 1OMSA 4FVCA 4OV6A 2QWLA 3BM7A 3ZSZA 5HBMA 4DR1J 4J9LA 4JK9A 1MMLA 3AVFA 2BVZA 4K4WA 3SQ0A 3QGPA 4JKFA 3DLKB 4RW9A 1L3UA 3MN5A 3PYDA 1Q9YA 3VPZA 2H1YA 3DI6A 3HHLC 4AQYK 5KFKA 3GV5B 5DMRA 1A0OB 4OPHA 1YTUA 1WD6A 3A8IA 4DR4J 3Q7BA 5GMDA 5LT5A 4O3PA 1XWLA 3B6PA 1NU0A 2XCPA 3M9NB 1J9AA 2D0CA 1RWXB 1U4BA 2AT1B 1T11A 3QFWA 4NLUA 1IR1A 4TYAA 3ZETA 1H3DA 4CZEA 4IR9A 1D09B 3H5SA 5SZTA 4E8UA 3W5XA 1VSJA 4KSEB 1BQNB 3M2RB 4LRDA 3A4TA 2G4BA 2D9OA 2F9WA 1VIXA 3MPUB 3VCDA 1RCHA 4ANCA 3M6XA 2VASA 1HD0A 2DGTA 2LLZA 1AROP 4ZVHA 2I38A 1HHQA 2ZHOA 1U25A 2JWKA 5F9LA 3EKSA 5LMNF 4CTAA 2N4CA 1HNXF 3GZ7A 1TU0B 5K8PA 4JI5K 3U1NA 2KYZA 2BE2B 2BYCA 2QO3A 4BR9A 4KHPJ 3KKRA 4HDHA 2E5LK 3M8QB 2HGLA 4BREA 1N5TA 2NLXA 4I64A 4WYBA 4ZVQB 3BN4A 4ETZA 2WVBA 1I5OB 1NZAA 3WIVA 2HQCA 3W63A 5JLHA 1RWNB 1Z25A 4DV1F 4CGJA 3K58A 1VQPS 1U1KA 2FHKA 2CJAA 3KHHA 3TQEA 1SH2A 3AOAA 1CC8A 1S0VA 3HF5A 1U2CA 5TKWA 1BWEA 3NOGA 4NRTA 2F7TA 2GWKA 3UDLA 4B9LA 1FRIA 1Q8BA 3RMCA 1VK3A 5JS1A 1GAOA 4IRCA 1VBZA 2ZC4A 3UR3C 2Y1IA 1AFJA 1GLBG 4RUBA 4HI1A 2O3DA 3LP0B 4NLDA 1G6BA 4GKJK 2KW4A 3QWUA 3SIPB 3MK6A 3KTQA 3DRSB 4JK7A 4XEIA 2HZAA 4LMZA 3TVYA 1S57A 3M6VA 5BPLA 2CZ4A 4WE1A 1DLOA 3ATVA 1KAXA 1VRTB 3MR5A 4DTUA 2VD3A 3WZ0A 4Z0UA 3LDSA 4W5NA 2DKOB 4OHXA 4CF8A 1H2TZ 1XNRJ 4A61A 5FIIA 5KFFA 3MEGA 3FMWA 3RB6A 4J9MA 2IY5B 2E1MC 2IA0A 1FJCA 1H98A 4ZITA 3N4QA 1WKLA 1JLFB 4NZ6A 3SK3A 4H4MA 3R1LA 4DTMA 4CE9A 2UV8A 5JVGL 2AGQA 5AQRA 3ET6B 5DJBA 1KD1O 1AZSB 2HBJA 1BHLA 4FM0A 3G71N 1FNMA 4CBWA 4F50A 4DSFA 4ZHRA 4QWDA 4DV7F 4DQ8A 4PUOB 3U7JA 4FVMA 4K8XA 2CZ9A 2DO4A 1OVQA 3HTVA 4OYIA 3TAMB 5AFUH 3G71S 3KDNA 3KG4A 3GIJA 4DR6K 2DXDA 2EX3A 5FRMA 3T9NA 4MTPA 2R7SA 4Q8EA 1Z2ZA 1NGJA 2R2TA 1RISA 1PO6A 3QO9A 2V4RA 1QVGR 3ZCMA 5F2RA 1YZ6A 2Y3YA 3KLHA 5CYMB 3ZO7A 1LWFB 5F8NA 4CZLA 1CC7A 5H9FJ 1NCLA 2BKPA 4ZPCA 1WSFA 1SV5B 4JOUA 4Q43A 1TKZA 2BBEA 5FPDA 1YRXA 5A2QO 1ITGA 3AO2A 4DL5A 2GVDA 4PWDB 4CO0A 3CJRA 1TQLA 2MPUA 3MCAB 2VPXB 5ADXH 4TLQA 1FEEA 4MK8A 4MFBB 4Z4GA 2KZZA 3SV4A 2AZ1A 2YCHA 2DRDA 2QWMA 1KFSA 3QEIA 1ZA2B 3Q22A 4HH0A 1X60A 3T1HF 4CLYA 2W42A 1IJEB 1S72S 1SUQA 2Z1JA 2O8BA 2AX0A 5D4NA 4YOTA 1B64A 5AQWA 3TTCA 3ZTSA 2HNDA 4OL8A 1KQSM 3IKMA 2YNFA 2FPHX 2GGPA 2C2OB 2NSCA 3HT3A 3CJ3A 3AAPA 2QWPA 3M6UA 5HATA 3MFIA 3DXMA 1SC4B 5HJYA 2E2QA 4IFYA 5M1NA 5DG7A 1ZZFA 4TY9A 4LF7K 1CZBA 3MM7A 3UDEA 2OSQA 1M90T 3NVMA 3K5PA 4BGAA 2BJEA 3PLAA 2YKQA 4B1WB 4CO4A 2VONA 2D3ZA 2WSFC 5BJRA 1K73T 1VISA 1HYSA 1YBTA 4KT0C 5KQ8A 3BSNA 1S0NA 2B43A 1LCUA 4CM0A 3AD9C 2C2DA 1VQ8N 2LVWA 1WC1A 4BC7A 3LM9A 2DNLA 4LF4K 3SUQA 4KKOA 4YOEA 2R3VA 4QS8A 1UEVA 2I7PA 3AQOA 2FC0A 4PR6A 3HXMA 4B1ZA 1RTJA 2NRTA 3DLRA 2VQFJ 1HWLA 2UUAF 3M2RA 4ED3A 4RNHA 4P2MA 1TK5A 4CECA 4OYMA 4LC9B 4KFBB 1X4GA 3L09A 4GC6A 4J8FA 4RW8A 4C8NA 3D2EA 2GHWA 1C1AA 4M3UA 1FE0A 1D9AA 1VK8A 3TZZA 2QXLA 4EP4A 2YPYA 4ECWA 1W2BM 2H3EB 4PRFA 4NLYA 4CO2A 1KONA 3LP1B 1RACB 4I4BA 2MSSA 3TVZA 1Q7LB 3EE8A 1N32F 1QZ6A 3G25A 2IIRA 1MA9B 2VG6A 2W8LA 3V4MA 3R9LA 2JSXA 5CR4A 2UZAA 3OL9A 2IDOA 2K1RB 4OI1A 2BR0A 4YB5A 1LQ9A 1I94K 2IM1A 1NGHA 2FD2A 4CD1A 4NEYA 4J2BA 1WF0A 2V50A 4AF1A 2RJZA 3VQEA 1HI0P 1FRMA 4K59A 3WNFA 3VVTA 2M88A 1HBOB 1YJVA 1I3AA 2DITA 2RS2A 3QETA 2AYGA 3OL6A 2O67A 2E2PA 3G6XA 1H38A 4RBVA 4CJ4A 2UXBK 1WLJA 4KI4A 1Z4UA 4LF9J 5CZ1A 1AZSA 2BQUA 2XNRA 2ZM6K 1OSDA 5KFYA 4DPXA 2E2NA 1TK0A 1HNIB 4J37A 1L5UA 1D1UA 3CW2C 4ISFA 1MWKA 1NK9A 4H4OB 4U7UK 1HWUA 1TP7A 2L9DA 2WRMA 5TKYA 3CCUS 3QWPA 3GIIA 4G1IA 1SH3A 4O0NA 5BYQA 3C19A 5F41A 3IAS9 4NYFA 2DGWA 3FJ2A 1RBVA 2BM1A 1S6PB 2W41A 4CLFA 4E7JA 2GJ2A 4RJVA 5H9FK 2PC6A 1WBDA 2ZVSA 1N33J 4FJHA 1WEYA 4ECRA 4YOUA 4FOEA 3A13A 3EXCX 2IIHA 4LFBJ 2O8CA 4ILRA 4B9SA 1H0HB 3PW5A 1XHZA 1SIZA 2KHOA 3QRRA 2HURA 4H4MB 2AJ4A 4N8NA 1GLDG 3SNNA 2D1KA 3K5MA 4MF