1N5YA

Hiv-1 reverse transcriptase crosslinked to post-translocation aztmp-terminated dna (complex p)
Total Genus 122
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
122
sequence length
558
structure length
558
Chain Sequence
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFKKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDICKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNKGRQKVVPLTNTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDKSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLVSAGIRK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 5'-D(*AP*TP*GP*C*TP*AP*GP*GP*CP*GP*CP*CP*CP*GP*AP*AP*CP*AP*G
publication title Structure of HIV-1 Reverse Transcriptase with Pre-Translocation and Post-Translocation AZTMP-Terminated DNA
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Transferase/immune system/dna
total genus 122
structure length 558
sequence length 558
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2002-11-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 1n5yA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1n5yA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1n5yA03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1n5yA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1n5yA05
1S9EA 2YNGA 5FDLA 3NAIA 1X9SA 2YKNA 2R8HA 5F8LA 1S0MA 4KAZA 4CEDA 5DQIA 2ZE2A 3CJ3A 4C8LA 3V1QA 2OPRA 5L1KA 1IG9A 1RTHA 4K50A 3KLEA 4Y3CA 4ZPAA 2QK9A 2D41A 1RBRA 2Z1IA 1U49A 1RTDB 4OKJA 3Q8QB 4HUEA 4O5BA 3PJXA 4CGIA 5KFCA 3LPTA 1RTJA 4CHZA 1BQMA 4DU3A 4OKEA 1VRUB 2HNZA 1TL3B 4NLWA 1RT4B 3VQ8A 4L8RB 4FYDA 2RKIB 5EWEA 3M8SA 3CDWA 1KLNA 1XI1A 4KPYA 3BSOA 2IC3B 3K57A 5KFNA 2W9AA 3OY9A 3K5NA 3PW5A 1T3NA 3VQSA 3MEDA 5J2QA 3TARA 2D3UA 4F4WA 4DTRA 4LSNB 2C22A 3GIMA 1KFSA 4ZMMA 4O44B 3V6KA 3OVNA 1NOZA 3TAMB 4FK2A 3SUNA 5KT2A 2FBTA 3SZ2A 3H4BA 4G1QB 3G6XA 1VSMA 1T03B 1IKXA 2FJWA 2HB5A 1EETB 2BANB 1YVFA 4BE2A 4Q45A 2G8IA 4CEEA 2RN2A 4ICLA 1HYVA 2G8WA 1S4FA 5D3GA 2E9ZA 4XPEA 1FK9A 3H59A 4B9MA 4KKOB 4R8UA 2IS3A 1S1TB 1QAIA 1ZTWA 3AO2A 1RT6A 4ED1A 4ZP7A 2YNGB 5FDLB 4RNHA 2YKNB 4RW4A 4O0IA 1K6YA 4M3WA 1NK6A 4IFYA 4M94A 2ZE2B 1C6VA 4W5NA 4BACA 4QPXA 2OPRB 3RB0A 3AVGA 4M3RA 1RTHB 5KTQA 4RW9A 3NFAA 3KLEB 2EC0A 4YR3A 1KFDA 4IDKA 3AV9A 4CEZA 1QS4A 2Q3SA 4ZVFA 5F8HA 3VQ9A 4AHRA 4EBDA 3G86A 2I5JA 4NRTA 1RTJB 3K5MA 5HP1B 5KI6A 1BQMB 4KAIA 4MK8A 3KOAA 4CJRA 2HNZB 5KFUA 4CJWA 1RYSA 1RDRA 4CJUA 4BE0A 4IG0A 4CFCA 1RDCA 4EZ9A 2DFHA 5JXSA 3Q8PB 3OHBA 3AVMA 1QUVA 1DLOA 5KFQA 4JRQA 3NBPA 2KZZA 5KFZA 3KKSA 4KBIA 3I5AA 1RAJA 3OYEA 3MEDB 3B6OA 5J2QB 4FLYA 5HLFA 1TL1A 3K58A 1EX4A 3MR6A 1HPZA 4FJ9A 2YKMA 1N48A 4B9VA 4RUCA 2BQ3A 4WZMA 4B9TA 5FRNA 4U7CA 3RWUA 3HKWA 1YVUA 4K4SA 4I2QA 4FBUA 3GILA 2UUWA 4E7JA 4B08A 1NJZA 2GC8A 3KHHA 1IKXB 1BIUA 3MF5A 3OYCA 2D7SA 3GQCA 1VSLA 4J2EA 4CJQA 4J9LA 4URQU 4F50A 4ICLB 3ICLA 1JLQA 4RW8A 5D3GB 4BWMA 5DG8A 3OYHA 1FK9B 2VG7B 4IH7A 4F4YA 4R8UB 3I0SA 3K5LA 4M95A 2WK4A 1RT6B 1Z25A 4ID1A 4CF9A 4CF8A 2P5OA 4FJGA 4ZTJA 4CGJA 4EBCA 3LP3A 4RW4B 4OL8A 4M3TA 4IFYB 4QWAA 4DF4A 1WSGA 2X78A 5F8JA 2CJQA 2ATLA 3AVAA 4CEOA 2FBXA 1S97A 2VA2A 3H08A 5KFAA 4RW9B 1LW2A 3SFGA 2HNYA 2JEJA 1HARA 4N5SA 4IDKB 5JUMA 5DG9A 5KT5A 4FJXA 2UVWA 1NJWA 4URSA 3HJFA 3ITHA 4Y2CA 4ECSA 3HL8A 3SNNA 2I5JB 1JXBA 1WAJA 4ELUA 4W5RA 3MR3A 4TSXA 4GW6A 4DQRA 3TAEA 4IG0B 4PUOA 5KFBA 4M3XA 4DSFA 3E01A 4K4TA 1DLOB 1ZBHA 1L5UA 4CHNA 3NBPB 2JLEA 3HP9A 2PY5A 3P1GA 5KFMA 5T14A 5DG7A 3T5HA 5I3UB 4OPKA 1EP4A 5KT3A 3NAEA 3K5OA 1D5AA 4JV1A 4YQWA 1S9FA 4IH6A 4KRFA 3G0ZA 1TL1B 1ZBIA 3FSIA 3HM9A 3OYAA 1HPZB 2ILYA 2YKMB 4JUZA 3PY8A 5EUHA 1MU2A 1TVRA 4CHQA 1RYRA 1IH7A 2OA8A 4I2QB 4IRKA 1WNSA 3N6MA 1UAXA 2FLPA 5KFGA 3T3FA 3VQ7A 3ZSZA 2J6UA 3RB4A 3RB6A 2G8FA 4CJSA 3H40A 4QW9A 4IKAA 2O4GA 4UQGA 4NLPA 1JLQB 4RW8B 2FBVA 2R2RA 4CGGA 2WTFA 2YNIA 3I0SB 4YMEA 3N6NA 4HVJA 2BDPA 3T5LA 1U45A 5KG3A 3QIOA 2G8UA 2GIQA 1JIHA 3SPYA 3ZSVA 4O3QA 4IRCA 3DOKA 4E7HA 3OYBA 1YTUA 2F8TA 4B3OA 4NLTA 2DTUA 4J9KA 3VQ6A 4PWDA 2HHTA 1LW2B 3IAYA 2HNYB 3RRGA 2O4IA 3VQ4A 4URGA 5KFKA 3FRZA 3OJUA 2RDIA 1U47A 1JLCA 4HCCA 3ITHB 2FLNA 3NGDA 4N76A 4MIAA 3L2VA 4JLHA 1JKHA 1C0TA 1LWFA 3VQCA 3VQDA 5DMRA 4KHRA 2G8VA 3BSNA 2XHBA 4PUOB 3QZ8A 1J54A 1RDDA 4KHNA 3E01B 4YFUA 3CIZA 3H2LA 1KVBA 4CEAA 1EP4B 1SL1A 1TAUA 4ELVA 4O4GA 4Q5VA 4F3OA 4W5QA 1RT7A 1CLQA 4CJEA 3PO5A 3RTVA 1RA6A 3OYNA 3KTQA 4HTUA 3CWJA 1SKRA 4TYAA 4ZVEA 4DTUA 1MU2B 1TVRB 4R5PA 1TK0A 3DLHA 4ECQA 5DGAA 3DLGA 1S1XA 4DFPA 4TY8A 4AHTA 5F8NA 3FQLA 3I0RA 3VQ5A 4IRDA 4J9QA 4HYKA 3GV7B 4FW1A 3V9XA 3U6FA 3DYAA 4MK9A 2KTQA 2C28A 1R0AA 1XHZA 1WN7A 4FLZA 1SV5A 3ZT2A 3SUOA 2YNIB 4B9LA 4CIEA 4DL6A 3AVBA 3QGIA 3UQSA 3F9KA 4F2RA 4H4OA 4AHUA 4OVLA 1VSJA 4WFYA 5KG2A 2R2SA 4B3OB 4KHWA 4LSLA 3SCXA 4Q43A 5HROA 5EWGA 4BWJA 3L8BA 4ZPCA 4PWDB 4C8KA 3CQ8A 3S3NA 5KFDA 4F2SA 3QGHA 1ZETA 4F4XA 1IKYA 3BJYA 3TABA 4ED8A 2G8KA 1JLCB 5KG5A 2EX3A 4OPJA 2ZD1A 4IQXA 1JKHB 1C0TB 5L9XA 2W7OA 2BR0A 4DSEA 3LAMA 2HHSA 3MEGA 1J53A 4J9NA 1LWFB 1K1SA 4OLAA 3HYFA 3M9OB 3O3FA 2Y1IA 1VSKA 4RU9A 2IGIA 2W7PA 1WSEA 4DU4A 3RMBA 1I6JA 2R8IA 4FLVA 4B8AB 1YTAA 4K8XA 4JS4A 4K4UA 2E9TA 3T5KA 2WRMA 4ZVGA 4K4XA 2B43A 4O4GB 3OSNA 1RT7B 3DRRA 2HHWA 2V0NA 1JLBB 3NE6A 4O55A 4R5PB 4I2PA 2RF2A 3BQ0A 1ZBUA 3DLGB 1S1XB 4WXWA 3IG1A 3K2PA 4TY8B 3QEVA 1BQNA 4CGFA 2YNFA 3I0RB 4GC6A 3M8PA 1L3SA 1SUQA 1IKVA 5KT7A 3V4IA 4ECRA 3DYAB 3PW4A 1CZ9A 3U3YA 2KFNA 1R0AB 3LWMA 2FVQA 1T8EA 4J2BA 3CDEA 5DLGA 1NJXA 1GOAA 3ALYA 1SV5B 1IKWA 2HNDA 2VG5A 3T19A 3QLHA 4RNNA 4GMJB 4DL3A 4QWBA 1S6PA 1XHXA 2JEIA 4FLWA 3MXIA 2D5RA 3NH2A 1JL1A 2R7YA 4CF0A 4H4OB 4K4VA 1W0HA 2XY5A 1KVCA 3V1OA 4FJLA 2BQUA 4LSLB 4KFBB 5HROB 2Y1JA 3KLIA 1RBVA 1TGOA 2E6LA 1C1BA 2FBYA 4NCBA 1HQUA 1VRTA 1WLJA 3WNHA 3RRHA 3VQEA 1S1UA 4LQ9A 1IKYB 2IBKA 4EEYA 4JV2A 1NHUA 3IRXA 3MEEA 2OPQA 3AVFA 2ZD1B 4NLGA 4Y1DA 4W5OA 5L1JA 3MEGB 4DWIA 1HQEA 4QWCA 3LP0A 2YHBA 3U3GA 1Q9YA 2Z1GA 2QKBA 4F4KA 2DPIA 5KFWA 3TAPA 4BDZA 3AVLA 4JRPA 1RBUA 2IM0A 1KLMA 3QYYA 5F8GA 4ED2A 4CESA 3PJWA 5KFYA 4F4ZA 4WYLA 1WSFA 1BCMA 1KCFA 1WSHA 4AILC 1D1UA 2XI2A 4YP3A 4DSLA 3DRRB 5FRMA 3BQ2A 1LAVA 4WZQA 4LQ3A 2ZKUA 4I2PB 3OL8A 2RF2B 1VK0A 4IR9A 3ASMA 5I42A 3AO1A 5L1IA 3IG1B 1S49A 2ZQBA 3OYDA 1BQNB 2YNFB 3M8PB 1SUQB 3MXJA 3PX0A 1IKVB 2R8JA 3RR7A 4OKKA 3V4IB 1EKEA 5KFOA 3V9SA 3NF8A 2WHOA 1S9GA 2ITGA 1S9EB 4LH5A 3ZT4A 1RBTA 1CZBA 3VA0A 1NK0A 1IKWB 2HNDB 2VG5B 3BSCA 3QLHB 4Z4FA 1TKZA 1U04A 3OHAA 1S6PB 2D0BA 2JGUA 3AVCA 2IAJA 1N6QA 2DFFA 4NLXA 3MAQA 1TKDA 3OLAA 3AA5X 2JC1A 2JEGA 4KHMA 3C6TA 4TY9A 3QZ7A 3EZUA 3KLIB 1ASWA 4K4WA 3ZSYA 1C1BB 2WCXA 4ECTA 1HQUB 1VRTB 2HWIA 4EZ6A 1S1UB 2DFEA 5K14A 2IMWP 3I5BA 2IM2A 1TKXA 3IRXB 4CHPA 3VA3A 3V81A 4ZP9A 3MEEB 1WNEA 2OPQB 3UR0A 3SYZA 4DTOA 3M9MB 4J2DA 5HRNA 1S48A 3FDSA 4EBEA 4QW8A 3DRPA 3MTKA 1FKPA 3QNNA 3LP0B 4DL4A 3QO9A 3IS9A 2YNHA 3Q8SB 3OL9A 4ECWA 5CYMA 3AA3A 4NYFA 1HMVA 4O3SA 1XR7A 2OPSA 1FKOA 3V6HA 3ZT1A 1RDBA 4QCLA 4E1MA 1KLMB 4HUFA 3DLRA 2HHXA 3PUFA 5DQGA 3CJ2A 4CEFA 2QXFA 1C0UA 4RNOA 1TV6A 4J9RA 3S3MA 3GYNA 2AX1A 2G8HA 1TAQA 3O4NA 1DTQA 3VQAA 2IA6A 1A5WA 2OYQA 4K4YA 4MH8A 5I42B 3HHKA 5L1LA 3RB3A 3TAGA 4Q8EA 3NCIA 5J2PA 3M8QA 3H5UA 1L3UA 2W9CA 4CJ4A 2AGOA 1HRHA 4IBNA 3VQQA 5C24A 3NKYA 2FVPA 1S9GB 2VWKA 4W5TA 4E1NA 4CERA 4OLBA 2V4RA 4K4ZA 1D9FA 2A1SA 1TKZB 4RUAA 3ISNC 5KFEA 3LANA 2IAJB 1BI4A 1N6QB 4DMNA 3I8DA 4ZTFA 4KO0A 3BDPA 3EPIA 4HKQA 3PR4A 1BL3A 3KD5E 2PYJA 4DG1A 3EPGA 2BE2A 3C6TB 3HSTB 1KHWA 3BGRA 1UWBA 1L3VA 2GIRA 2BRKA 4Z0UA 4CFDA 5KFHA 3O3HA 1HNVA 5K14B 5HRSA 1TKXB 5KFTA 3V81B 2IM1A 4CIFA 2XY8A 1J9AA 3C94A 3DRPB 1ZBLA 1X9WA 3LDSA 1N5YA 1FKPB 2HVHA 3ZT3A 4FK4A 4M45A 4KSEB 4CJVA 3QO9B 3IS9B 2YNHB 4EO8A 4MQ3A 3L2UA 5HLFB 1CXQA 3PZPA 5CYMB 1HMVB 2OPSB 1Q8IA 4EYHB 3PR5B 1O1WA 1FKOB 1Q9XA 4HUGA 4JS5A 3GV8B 3NDKA 2IJFA 3NGZA 4NLQA 1C0UB 4F8RA 1TV6B 3VN5A 4ED7A 4CIGA 3M8RA 5KGXA 3TR8A 1GOCA 3WNFA 1DTQB 2OPPA 1QSYA 3VQPA 4CK2A 4Z4GA 5J2PB 3M8QB 4X2BA 3N6LA 4FS2A 3WNGA 4IKFA 5CZ1A 5C24B 4CHOA 5DQHA 4NCAA 4GC7A 2DPJA 4B9NA 4DFMA 3MECA 3AVIA 1LWCA 4RNFA 2GBZA 2GUIA 2Z1JA 4CJKA 1VSIA 1VSHA 1BI4B 1QTMA 2OZSA 4KO0B 3RAXA 4KREA 4C8OA 4ECVA 4M42A 4Z4EA 4E0DA 2I1RA 4IH5A 2KW4A 3B6PA 3IGNA 4DG1B 4E3SA 2BE2B 3MR2A 4O0JA 4DTJA 4DL7A 4CGHA 3KHRA 3NL0A 3BGRB 1UWBB 4Y2AA 3OS0A 2LSNA 3SQ2A 1X1PA 1HNVB 3RAQA 4KHUA 2E4LA 4ECUA 3QEXA 3KLFA 4CF1A 5KT4A 3KIOA 4RG8A 3QIPA 1KRPA 4BDPA 4TQSA 3TWHA 4QWEA 1S6QA 3HVTA 4DQPA 1UOCA 2BGGA 4I7FA 1N5YB 3TQ1A 4QAGA 5KRSA 4DTSA 3L2QA 4TXSA 3PW7A 4RNMA 1RNHA 4CJ5A 1UA0A 2J6TA 3LPUA 3V9ZA 3Q8RB 2B6AA 3SQ0A 2FLLA 3NF7A 4DQQA 4EP4A 3AA4A 3RBEA 2PZSA 3PHEA 3RBDA 3G6VA 2YHAA 2P5GA 3LALA 5SWMA 3ZSQA 3DM2A 3AO4A 2XO7A 1CXUA 1JLAA 3AVNA 3KJVA 3RMAA 2OPPB 3OYKA 1EXQA 3E51A 4ID5A 4ZVHA 3C95A 4DFKA 3OYFA 2XCPA 4FLTA 1HJRA 1FXXA 3SQ1A 3MECB 3ZSWA 2HHQA 3DMJA 3H5XA 2XC9A 4C8MA 1B9FA 5C25A 3DOKB 1LWCB 3S9HA 4DSJA 2W8LA 3PX6A 3RMCA 4M3ZA 1JLEA 1N56A 2V4QA 3CO9A 4CJLA 5KG6A 4E7IA 5EWFA 4CECA 4YNQA 4AH9A 5JS2A 2XY7A 4KB0A 1F21A 1SH2A 4ZHRA 3OJSA 3FFIA 3IN5A 5C42A 5CY4A 3QEWA 3KLGA 4N56A 4EP5A 3HT3A 3TAQA 3KMSA 4CE9A 5KFPA 3KLFB 3HXMA 4FZYA 3QIPB 1U48A 1A5XA 2E9RX 4FJNA 3H5SA 4CHYA 3SJJA 3AVJA 3NGYA 1S6QB 3HVTB 3DLBA 1I39A 3V1RA 4I7FB 4CCHA 3JYTA 3BSAA 3PVXA 3SI8A 1GX6A 1Z4UA 4Q44A 1C2PA 3QEIA 2X6NA 1A5VA 1NKCA 3OSPA 4Y34A 4RZRA 3OYJA 4Q0BA 2B6AB 5J2MA 2HW3A 1BGXT 2ILZA 4ZPDA 3HPHA 1WSIA 2FJVA 3OL7A 3TAMA 2RPIA 1C1CA 1U4BA 1XR5A 1SL0A 3DM2B 3G10A 4KTQA 1JLAB 3KJVB 5JS1A 2F8SA 4IFVA 1HYSA 1RA7A 3H4DA 2VG6A 4CJPA 4HHTA 5F8IA 1XR6A 3V6JA 4ID5B 3NAHA 4QWDA 4Z4CA 3UDLA 3KK2A 3ISND 3SPZA 4XPCA 3PX4A 4KKOA 3RMDA 4NCGA 3CFRA 4ZP6A 3CYMA 4O3RA 1C0MA 3DMJB 4WE1A 5C25B 4E19A 1KVAA 4H54A 3CJ4A 1D8YA 3SFUA 2DY4A 1JLEB 2R8KA 1T94A 3LWLA 3PW2A 4ECYA 3ZSXA 4K8ZA 3H5YA 4WXOA 3OL6A 4ZHRB 1LAWA 3FFIB 5C42B 3QETA 4FS1A 3KLGB 4TLRA 5HP1A 4LY7A 1XC9A 4OJRA 5KG1A 3CFPA 4FM1A 4YR0A 1J5OA 4DSKA 3JYTB 3T1AA 3ZSRA 3TAFA 3OYGA 3ZCMA 4CFAA 1ZBFA 4IOBA 4MK7A 2KZMA 1LWEA 4FJ8A 4O3NA 1XWLA 4Q0BB 3PW0A 5J2MB 2WOMA 4R0EA 3CDUA 4ZP8A 1S0OA 1JXEA 4H4MA 5FROA 1TK8A 2WB4A 5SZTA 4NLUA 5KGWA 3AA2A 1C1CB 3P5JA 1JLGA 3EZ5A 1HYZA 5EDWA 3SV3A 2ATQA 4DTXA 3D28A 1N4LA 4B9SA 4IFVB 1ZTTA 1HYSB 3I5CA 3OS1A 2VG6B 4NZ0A 1QAJA 3CVKA 1WAFA 3IGVA 2W9BA 4ED0A 1BCOA 5KFFA 1S5JA 4CK3A 4KHYA 4TN2A 2D0AA 4MFBA 4EYIB 2XI3A 3KK2B 3HVWA 2VG7A 2FVRA 1C1AA 1NK9A 4CJFA 4M41A 4YR2A 4E7LA 4NCGB 2XWYA 1ITGA 4WE1B 2P51A 1JX4A 4ED6A 1K1QA 1RDAA 3AVKA 2HVIA 1VSFA 5E41A 3QIDA 2FVSA 3OLBA 3L3UA 4NYNA 1Z26A 3BQ1A 2VWJA 2KQ2A 3HO1A 4FLUA 4CEBA 4FJKA 4DS5A 3BR9A 4M3UA 1RT5A 4NLSA 2UVUA 3AO5A 2AJQA 1I3AA 4DTMA 1HQEB 1B92A 3LZIA 3V9UA 4DLGA 5KFSA 2JEFA 3AO3A 2IM3A 4KTZA 3ULDA 1RT1A 2QV6A 4B8CA 1J5OB 3DI6A 4DQSA 5I3UA 5EU7A 3MXMA 3L2WA 3HP6A 3DOLA 3QGGA 1LWEB 5KT6A 4J9OA 3WNEA 1RT3A 2WOMB 3D0PA 2HHUA 3KK3A 3DDKA 2X74A 4H4MB 2QE5A 1IM4A 1U09A 3QINA 3ZT0A 4FJIA 4KHSA 4O3OA 1HNIA 1T7PA 4Z4HA 4Z4IA 1JLGB 1RTIA 3MFHA 4ECZA 3TI0A 2AGQA 4FM2A 1QHTA 2FJXA 1ZYQA 2AWZA 4LD0A 3DLEA 1OS5A 3QEPA 3GIIA 2XRIA 5F9LA 4Q8FA 2P1JA 1T05A 3ZSOA 2W8KA 2FVCA 1ASUA 1LV5A 2W9BB 2HAIA 1DTTA 3KK1A 3QESA 4NLDA 2R2TA 4E89A 2E6MA 4MFBB 5CYQA 3PV8A 2KFZA 4PQUA 4RW7A 4DLEA 3HPOA 5KFVA 1VSDA 1RT2A 4FJ7A 4BDYA 4FVMA 1GX5A 2AGPA 5J1EA 2R2UA 1NOYA 3LAKA 4J2AA 5HRPA 1NKBA 1JL2A 1MMLA 4GVMA 5F8MA 2AX0A 4FBTA 2IDOA 1SL2A 2F96A 4I9LA 2D3ZA 3RR8A 2Z1HA 2GV9A 5KFRA 4NRUA 5F9NA 2WONA 3G6YA 2O5DA 4G3IA 1RT5B 4MKBA 4AHVA 4J9SA 3JSMA 3KHLA 4DEZA 3KMQA 4FLXA 4CF2A 2B5JA 4DL5A 4IR1A 3TANA 3NGIA 1RT1B 3V6DA 2C2EA 1KTQA 3SI6A 3DI6B 4KHQA 4RW6A 1X9MA 4M3YA 3BREA 4HCBA 1TKTA 4DS4A 4DTNA 1G15A 2QKKA 5KG7A 1JLFA 3DOLB 3HPGA 4PA1A 4I9QA 2HMIA 3AVHA 3C6UA 4ELTA 1REVA 1W9HA 2R8GA 4KB7A 4IG3A 1RT3B 4FZZA 3KK3B 4WFXA 4H8KA 3D5MA 5J2NA 4KV8A 3SV4A 1GOBA 2XY6A 3O4QA 3CG7A 2AU0A 1HNIB 2IJNA 1RTIB 2BRLA 2W9CB 3EYZA 3FQKA 4CEQA 1SKSA 3DLEB 2IOCA 4O3PA 4U6PA 4N41A 4QOZB 4NLVA 3L3VA 5KG4A 1T05B 1TP7A 3GIJA 2X6SA 5HBMA 2UVRA 4AHSA 4EO6A 1DTTB 3KK1B 4CGDA 2ALZA 1RILA 1NK5A 3NHGA 4DL2A 4NLRA 4FW2A 3S3OA 5CYQB 4KB1A 2CKWA 4MKAA 4PQUB 2XCAA 1IO2A 4RW7B 1Y97A 3OYMA 3LP2A 2FC0A 4KE5A 1NNDA 1RT2B 4NYZA 4XIUA 5J1EB 1ASVA 3VQBA 1VSEA 2RDJA 4FJMA 3L2RA 3NMAA 4KTWA 4XO0A 1L3TA 3DRSA 1S0NA 5KFXA 3KD1E 1LW0A 2W42A 1TK5A 2OH2A 1UA1A 1CSJA 5KFJA 3KLVA 3KLHA 2WONB 4JV0A 3HK2A 3LZJA 3NH1A 3TVKA 4AHCA 3JSMB 1S1VA 4ZPBA 3UIQA 3EY1A 3GIKA 4ECXA 2VA3A 2B5JB 5KFLA 3OYIA 4WYWA 3THVA 1QE1A 3LP1A 1NK7A 2C2RA 1BIZA 4DTPA 3V6DB 4DSIA 3QERA 1RBSA 3MR5A 4CFBA 3UPFA 4RW6B 2B4JA 1QQCA 4FJJA 1TKTB 1D9DA 2J6SA 1JLFB 2HMIB 3C6UB 2XGPA 3NH0A 1JXLA 1REVB 4B9UA 1D0EA 4IG3B 1JLBA 1WSJA 3HVRA 5J2NB 4KV8B 4C8NA 1NHVA 4DF8A 1SH3A 2YV0X 5DK5A 1B9DA 2NUBA 4F3TA 4J9PA 3DLKA 5HRRA 4DQIA 1S1WA 2AQ4A 5CZ2A 4WFZA 2OZMA 1BHLA 4N47A 4FZXC 1NK4A 2UUTA 5DLFA 3KNAA 4CJTA 5HBMB 3CJ0A 2ASJA 4OGCA 4DU1A 1KHVA 5KRTA 3SUQA 4Y1CA 3KHGA 3V9WA 3SQ4A 1BISA 1RCHA 3O3GA 3LP2B 4O4RA 4TQRA 4FXDA 2A1RA 4MIBA 3K59A 2PYLA 1NK8A 3HVAA 2HWHA 2BQRA 4OGEA 4NLYA 1RTDA 3A2FA 3DRSB 4KFBA 3F73A 4FJHA 1LW0B 4FM0A 2C2DA 3OYLA 4DFJA 3T5JA 1VRUA 3KLHB 1NKEA 2UVVA 4FJ5A 1TL3A 1RT4A 2RKIA 4FK0A 2V9WA 3NF6A 5KG0A 1S1VB 2IC3A 5DGBA 3GV5B 4NLOA 4PY5A 4CJ3A 3CFOA 1QSLA 1S10A 5C5JA 4KI6A 1QE1B 3P83D 3LP1B 3SUPA 2D0CA 3M9NB 1TQLA 4LSNA 1NJYA 2ASLA 2XGQA 1SKWA 4O44A 4FCYA 4ED3A 5KFIA 1SH0A 4G1QA 4J9MA 2HHVA 1T03A 4E7KA 2EHGA 1W25A 2F8EX 1QSSA 3CM6A 5T7BA 3D45A 1EETA 2BANA 4KI4A 1KSPA 3QNOA 4BE1A 3CJ5A 3MFIA 3CM5A 3PO4A 3OS2A 1YT3A 2JC0A 3DLKB 2ASDA 1S1WB 4TYBA 3H98A 2ETJA 1S1TA 4CK1A 3NF9A 3KKRA 4LH4A
chains in the Genus database with same CATH superfamily
3M6GA 1WC0A 5FDLA 1SC4B 1HBUA 4LF4F 3CCLS 2OIHA 4CZFA 3R8EA 3VTIA 1IQTA 3WUHA 1IG9A 4K50A 2NYIA 4CBXA 2DGXA 4UTGA 3QT8A 1WKJA 1RTDB 4ISFA 2BBEA 3PJXA 4CGIA 8RUCA 2QTWA 5FIIA 4CHZA 4DU3A 1NDCA 2MZQA 3LPYA 5AE3A 4MTPA 1AA1B 2VCPA 3CDWA 3BGOP 4JI3F 3R3LA 3BSOA 4DI6A 3B6BA 2ERRA 3I4HX 2IIRA 3MEDA 3J7AP 5J2QA 3OA9A 2W2NP 1BXNA 3HFZB 3AAWB 5GADI 2E5LK 1FFSB 4C98A 3V6KA 3SAFA 2CPEA 4ERDA 1YX2A 2KXHA 3K9JA 5IV3A 2ASYA 2FJWA 5CD4H 3Q89A 2BTFA 4MT1A 3B4MA 1EETB 1SJ1A 2W2MP 4CLTA 3ILLA 3D4JA 3CJKB 4M5IA 4JYAF 5LSOA 5B0GA 3KWMA 4R8UA 4ZVPB 1QAIA 1RT6A 2MPUA 4ED1A 5GAEI 2YCHA 5FDLB 2MJUA 1K6YA 3G8TA 1HBUB 3EGZA 1B7FA 5BYRA 4W5NA 1R89A 2YVSA 2CG4A 5GIPA 3OV7A 2PBDA 2XMTA 3PYDA 4G1IA 2IRYA 2Q3SA 4NOHA 5F8HA 3VQ9A 4AHRA 4B9QA 4XDDA 5I4MA 3K5MA 5A8KA 4MK8A 3KOAA 1VQSA 3KZBA 1NH8A 4CFCA 1RDCA 3W9JA 3QRQA 3NBPA 4C8YA 5KFZA 1B4SA 2YX7A 4OYZA 4B1VA 4UQTA 4KGVB 3OYEA 3MEDB 4DR5J 5B08A 5J2QB 3K58A 2OTLS 1XMOJ 2YKMA 1N48A 3CCVS 4B9VA 3PHTA 4WZMA 3EEQA 4WWSA 2H3GX 1VQ7S 3E1YA 4U7CA 2CQDA 2C3OA 2LXFA 2UUWA 4CH1A 1BY9A 2IBOA 2GC8A 3KHHA 4H5RA 4J2EA 4J9LA 4URQU 2UU9K 1YZ7A 3FZLA 2FYXA 3WIVA 2E1PA 1JLQA 4DPOA 4LRCA 4BWMA 3MD1A 1UL3A 3B4DA 3KJNB 4R8UB 1U02A 1RT6B 4CF8A 4JI5K 4J8FA 4HLBA 1Q81O 3Q7BA 4U8VA 3VCDA 4CZJA 4OL8A 1R3NA 2QLWA 4M1KA 1YBAA 5D4NA 4PXCA 1ZA2B 3QFHA 3DXKA 1NSAA 3K5PA 4CEOA 2VQFJ 3RZAA 1S97A 4KH5A 1U0HA 1LW2A 3SFGA 1HKBA 4N5SA 4ES2A 1WG1A 5JUMA 1QUPA 5KT5A 3NGUA 4CJ7A 3HJFA 3ITHA 3AD7C 4Y2CA 3TJ8A 3W8PA 1Y3JA 3SNNA 1FA0A 3EM1A 5A8KB 3CMES 3NEKA 4ELUA 5E3PA 3MR3A 4GW6A 4DU7A 5D6GA 3BP8A 5KFBA 4M3XA 1RHUB 1RP5A 1F9FA 2E8AA 3NBPB 2JLEA 5CQGA 2PY5A 2LEBA 5GADU 3T5HA 4OPKA 4CLZA 5KT3A 3BY5A 1D5AA 1S9FA 2WVBA 2GUPA 2F40A 3Q22A 2QA4S 3MZIA 2ILYA 4MKVA 2YKMB 2G13A 3J81U 5DDPC 1SQGA 4X4OA 4UOHA 1HR0J 4X4SA 1JNZB 3W8GA 1K8KB 1OH5A 4ILMA 1WNSA 2ZH2A 2DGSA 3VQ7A 1JMTA 3J81j 3UN3A 5E33A 1NEEA 4JV5J 1OSCA 3H40A 2O4GA 5GAEU 4NLPA 1JLQB 4CGGA 3H1VX 4YMEA 4MLHA 4YY3K 1U45A 4BC4A 5KG3A 3QIOA 2GIQA 1JIHA 2DHAA 3HHDA 4O3QA 3DOKA 2EWSA 1XBWA 4B3OA 3DU6A 1BE4A 1VQ8N 2DTUA 2E1YA 3TUZC 3DXKB 2BX6A 1U0HB 4Z94A 1LW2B 4KR0B 1W2BR 3RRGA 4DUYJ 2V8PA 3VQ4A 5BPMA 2ZZTA 4YEAA 2YWGA 3ZTSA 3ITHB 3WBZA 3A13A 1JKHA 1C0TA 1NLVA 4FPBA 4CYUB 5AQOA 1LWFA 1TELA 4KHRA 4GKKK 2XHBA 2AJFE 2D74B 4ER8A 3HD1A 1RDDA 4QU6A 4A57A 1NGDA 4KHNA 4ZCIA 3L4BC 3H2LA 4CEAA 4PQAA 4ELVA 1QVFR 3J7YI 1YKWA 3RU0A 3IMXA 1E4GT 3D0GE 4HTUA 2ZDPA 4ZVEA 3R5CA 2P9KA 1I3OB 1RQ0A 3I31A 1S4EA 1LK5A 1VQPN 3FQLA 2HMPA 1NSKL 2V51B 1FRIA 4FPAA 4X64J 4CLWA 4XK8C 3ILIA 3U6FA 4BRAA 3DYAA 4MK9A 4XAKA 4PKDB 5BRDA 1WN7A 1FESA 1Q5VA 2HFVA 1IBKK 1RWXB 3SUOA 2L41A 2HK3A 1T3VA 2Q0RA 2R7UA 4KYZA 5AQXA 3MOZA 4OYPA 2Q43A 3HKZD 3LH2S 2D1KA 3M1VA 4AHUA 1DFDA 3CC7S 1VSJA 4FYYB 4BRMA 5KG2A 3F9MA 4B3OB 4LSLA 3SCXA 2F7VA 4C8KA 3D1HA 3S3NA 1ZETA 4F4XA 1U6BA 4AFFA 4GO5X 1EJ7L 5C10A 2E2PA 2WVDA 1FWKA 1BQXA 4KH0B 1JKHB 1C0TB 4DSEA 2BR0A 3MEGA 1LWFB 2OJ3A 4ZIWA 1RAEB 2MY7A 3IM9A 4OLAA 3RAMA 4EHUA 2QI2A 2KN4A 3K8WA 1T9TA 1QTNB 2ZHBA 2IGIA 5AQLA 1N0VC 3GSIA 4PKHA 1WSEA 3KWGA 1I6JA 3SSSA 4BBYA 2HBYB 4K4UA 2IY5B 4CBUA 2YWKA 2HRUA 1CZAN 1RI7A 4IDHA 2KVQE 2BABA 1G4CA 4B3TK 2AJ0A 3QICA 3K0SA 3Q8VA 1M0SA 1FJCA 2KU7A 4JEPA 2BJ8A 4BCAA 1M5KC 2RF2A 2P9KB 1ICEB 1ZBUA 3U4LA 1BQNA 4CGFA 1UW4A 4GC6A 4IQMA 3V4IA 1J5EK 3DYAB 4FVCA 3PW4A 4HHUA 3TUJC 2KFNA 2FB0A 2OCEA 4J2BA 1YI2S 5H1SV 1NJXA 1GOAA 2VG5A 2HNDA 5A76A 1FFWB 4GMJB 4DB3A 2YBVA 4QWBA 3IO1A 1S6PA 2JEIA 2D5RA 2IIHA 1JL1A 3OXFA 2BKPA 4FPIA 2G2OA 3M1VB 4K4VA 5AQVA 1KVCA 3V1OA 1PYSB 2BQUA 4LSLB 3I56S 1RFQA 3SSQA 4CNYA 1IM6A 2Y1JA 1TGOA 2R42A 2AT1B 2HGMA 4DR5F 3TJ9A 2R7TA 5HOOA 2X3DA 4LQ9A 3KKFA 1XMOF 3MEEA 4NA3A 1VQ6S 3O08A 4X65K 4FN5A 4Y1DA 3CQXA 2YX1A 1M90T 3MEGB 1HQEA 4QWCA 3BN4A 3LP0A 1X5PA 4JKEA 4U7UK 2JSXA 1RBUA 2J5AA 2IM0A 4M5KA 4H0OA 1VBKA 2DRAA 1UMJA 4BRPA 3CJCA 3PJWA 1YDLA 2QX0A 3HBTA 1WSFA 2CJ9A 1BCMA 1T44A 1WSHA 2C3YA 3IFEA 4OIXA 1KQFB 3BQ2A 4A5AA 3A4TA 5F41A 3SBTA 3F0NA 1WBBA 4RJVA 2RF2B 4IR9A 3ASMA 1PJ6A 4KGMA 2M8HA 3AO1A 5L1IA 2Z56B 4JI4J 2ZQBA 1BQNB 2VQFF 3ZYYX 1N88A 4IJAA 4FP9A 2B4VA 3A12A 3AOAA 2Z8QA 3VEXA 3RR7A 4OKKA 3V4IB 3BN7A 4DL0C 3NF8A 4NXMK 1FE0A 1S9GA 2JNJA 4DR7J 4C48A 3ZT4A 1I1GA 1RBTA 5BXIA 5D0HA 2VG5B 2HNDB 3BSCA 1IJJA 2W40A 3OHAA 1RTZA 1S6PB 2D0BA 3AVCA 1D9AA 2HEKA 2XBPA 1F2GA 1SC6A 2MHNA 5A2QO 3C6TA 4TY9A 1RHRB 4LF9J 2VC1A 2VYPA 4JN4A 4X84A 1K0VA 1MDUB 1DKGD 3VVTA 1JCFA 3HZGA 2QL7B 1KQKA 2IM2A 3UNYA 3VA3A 2PE8A 3MEEB 3BO3A 3M9MB 4J2DA 1HR0F 3FDSA 1BD6A 3DRPA 3MTKA 1FKPA 2WVFA 3LP0B 2LDIA 2KT3A 3QO9A 4QQBA 2VFSA 4ECWA 4CW7B 3P3DA 4O3SA 1MSWD 2CPXA 2OPSA 2NS1B 1NSPA 1S0VA 2DNYA 4HUFA 1RB0A 4JV5F 3FGUA 2NPFA 3VPZA 2HHXA 4CIOA 1N34K 4CEFA 3MN7A 5AQYA 3W7BA 2QLBB 1TV6A 3OTDA 4J9RA 2R7XA 3GYNA 2J7WA 3KNGA 2M0GB 1TAQA 2C2MB 5AQFA 1DTQA 3FBFA 3R7BB 5L1LA 1ZBSA 3TAGA 4JK7A 2FD2A 4RU2A 1L3UA 3SMZA 2AGOA 3TSQA 5KPZA 2VFRA 4IBNA 1Y64A 1FHTA 1S9GB 2VWKA 3TUPA 2EFQA 4AE5A 5LY3A 2FY1A 4BRKA 3WDOA 3VAJA 1WOOA 4OLBA 4DR4J 5AQPA 5KFEA 4CDIA 3IDHA 3WHIA 1WEXA 2HFNA 4EAHD 3EGVA 4KO0A 3BDPA 3S41A 4YOUA 1N36J 3SMPA 3C6TB 1VQKS 4JKGA 3EGWB 2YKQA 3QATA 4OZ3A 3ATUA 4FO0A 1HNVA 4CNZA 2B4PA 5C7PA 5E3QA 3VAMA 3DRPB 1N5YA 4FNIA 4H0YB 1FKPB 4FK4A 4LFBF 3QO9B 4O5FA 2YY3A 2PEBA 4MQ3A 3Q23A 3L2UA 1CXQA 2KO1A 2VZ9A 2OPSB 4EYHB 5ADZA 3PR5B 1VBYA 1OJ4A 3FVYA 2J9DE 4JS5A 3GV8B 2DR9A 2IJFA 2U1AA 4JI2J 1RAFB 3BZCA 2FY8A 4OX9K 4NLQA 4PG5A 5M1FA 1VC6A 1TV6B 4CD1A 2FC9A 2GO8A 2ZJRL 4BG9A 4QIGA 4AYBD 5F0WA 4B3SK 3NG8A 4C6AA 3DJCA 1DTQB 2OPPA 5AE1A 1QSYA 3VQPA 4CK2A 3U9ZA 2DR6A 3N6LA 3P4IA 3P8BB 5CZ1A 5B7WA 5DQHA 4NCAA 2W24A 1D4XA 4I6WA 3CJAA 3QGPA 3I55S 4U95A 2WB1D 3UCUP 3P4UB 2DBBA 1F2HA 2L9WA 4RNFA 2R4FA 2UP1A 3TA0A 1VSIA 1VSHA 1VQMN 4LC9B 2MZJA 3B8HA 2NRXA 1CBKA 3BF1A 4L74A 3O4WA 1QTMA 4KO0B 3QFUA 4ECVA 3JQMA 4FF4A 4IH5A 2PN6A 2E1MC 4O0JA 4DL7A 4JKGB 4USHA 2RQMA 1X4BA 3H2VE 1HNVB 4OZ5A 4P2SA 3QIPA 3UI3A 3MHYA 2DEJA 1UOCA 4I7FA 1N5YB 3TQ1A 2D9PA 2HKEA 2JFKA 2IJRA 3TTFA 3FBCA 1S79A 1IBLJ 1FF2A 4HHHA 4BG8A 2O8FA 5B0EA 4Z37A 1RGVA 2R9LA 4YS2A 4EP4A 1G2EA 3O8WA 1URRA 3M4XA 4DV7J 3G6VA 3RBDA 2A41A 2YHAA 2P5GA 3ZSQA 3AO4A 3ZXWA 2XO7A 1CXUA 2J0XA 2DGOA 2Q97A 2HQCA 2OPPB 3QBWA 3D3CJ 3MEKA 3UCZP 3M6VA 4PG6A 2JFDA 4ID5A 2KRBA 3EVWA 2XCPA 2HLTA 5JLHA 2BM1A 2POKA 3ZSWA 3MK6A 5I3QA 1GXUA 3DMJA 3AA8A 2XC9A 5C25A 2GMJA 3S9HA 4IUFA 4M5NA 2HGNA 3J7Z5 3HM8A 4HEA9 3BYPA 4B3RJ 4DV6K 1WTFA 1YK9A 2GGPA 4MDBA 4E7IA 1JWWA 5HMYA 1DHMA 5IQQA 4YNQA 4CLSA 1HI0P 3WQTA 1PG5B 1SH2A 3KG0A 4ZHRA 5CY4A 4N56A 4EP5A 3MMBA 4CE9A 5HMZA 1Y7PA 1WOPA 2HZVA 4XH1A 2NQPA 4FZYA 3QIPB 1U48A 4NA2A 2E9RX 1YRUA 1H0HB 3M32A 3V1RA 4I7FB 3JYTA 3QJPA 5IC4B 5EX3A 4JI4F 2H1YA 3PVXA 2LDYA 5ADXA 2AJ2A 3CSKA 3SI8A 4I67A 5KOXA 1NKCA 3CD6N 3OYJA 4Q0BA 2O8FB 3OFGA 2HW3A 5AXKA 3R1LA 4NB4A 4RPFA 2GO9A 3MM6A 4OYAA 5AXNA 2NXNA 1XNRJ 2VJUA 3AT1B 2HVZA 3ISZA 1NMDA 4ZJQA 1HYSA 1RA7A 1UJ4A 1MWZA 5F8IA 4PEOA 1UKUA 4ID5B 2RILA 3FZKA 1GLAG 4WQ4C 1JJHA 5KOWA 2IVYA 2D0OA 4JP8A 4NCGA 3OUYA 4JI1K 1C0MA 3ZNJ1 3DMJB 2Q2RA 2Y8WA 5C25B 1BLUA 5CAAA 4E19A 2P5VA 1D8YA 1NUEA 2Q31A 3FZHA 2R8KA 1K73O 2GGPB 3ZSXA 4OI4A 5K20B 1MWYA 1TU0B 1UVLA 1NGFA 3PEHA 5ETSA 3H5YA 3BS9A 5JVGL 4ZHRB 1KQSM 2QWNA 4A48A 2HFSA 2HFUA 2EXUA 3MMBB 2AJ4A 5HP1A 4DV2K 5AQRA 4LY7A 4X64K 2F63A 4GKKF 1XC9A 1KOHA 1BOTO 1KN6A 5KG1A 4IOXA 1NB7A 4FM1A 4RBVA 3M32B 4BC3A 4HH0A 3JYTB 2YPZA 4GMKA 2KI2A 2GV1A 3CI5A 4MK7A 3OR2A 3OFFA 1XWLA 5CHCB 4Q0BB 3T1YF 3PW0A 4R0EA 2F8HA 1M1GA 1RBAA 1Q18A 4BR7A 1FJ7A 2QYCA 1S0OA 1KBRA 5KGWA 3MM6B 1X3NA 2KH9A 4DR4F 4EFAC 2CPZA 5B0FA 3SV3A 3I8BA 1YTYA 1VQ9S 1ZTTA 1HYSB 2GAGC 1QAJA 1SKUB 4ED0A 4I56A 1X4FA 4EYIB 1IBKF 3WQPA 3HVWA 4IOCL 1BHNA 3CC4S 1FRMA 4YR2A 4JI8K 4NCGB 2HS0A 3OUYB 5T41A 1JK9B 1FKAF 2VU5A 4WCEQ 4PL7A 5HSPA 2QTDA 3QIDA 2FVSA 3VERA 2M88A 4P71A 1Q82O 1HBOA 3TQEA 2QWOA 5K5MA 1X4GA 4A2AA 1YF5L 1FJGK 2LU1A 3HO1A 3EJMA 1HKGA 4FLUA 1XNQJ 4FJKA 4DS5A 4M3UA 5H9EK 4NLSA 5FJ4A 3AO5A 4JI2F 1I3AA 4PKIA 1GMWD 3PSFA 1S72S 2V9KA 1S7IA 3WXJA 3AO3A 3ZETA 4KTZA 1X31C 2QV6A 1FRHA 1HNZF 4DQSA 5I3UA 1CS4A 4OV1A 3TX0A 4ZPVR 3L2WA 1I51B 3DN9A 3OT9A 2XZTB 4UUWA 4LR7A 2Y1LB 4B3TF 2V5HG 3MM9A 2YKAA 3NVMA 1OY6A 4J9OA 3VF6A 1RT3A 4LIWA 2HHUA 3VF2A 1VQ5N 2VB6A 2DEIA 3A3OB 1HNIA 2YQ0A 4Z4IA 1UEKA 3UVJA 1LKZA 3TI0A 4FM2A 1QHTA 4JKHA 1ZYQA 5KQDA 4E2FB 4LD0A 2DR7A 1S7HA 2XRIA 4LBPA 5F9LA 1T05A 3BBFA 1LV5A 3Q7CA 2HAIA 1HBNA 1UAWA 3PV8A 4J9UE 2Y0BB 4F0MA 1KTVA 3T41A 3HJVA 4FJ7A 3MWPA 2R2UA 3D0IE 4K2JA 2ZH1A 1E6VA 5HRPA 1IJEB 4ANCA 2JVRA 3DFEA 5HL7Q 4H0XB 1SL2A 2V69A 1V4TA 1HBOB 2ZVIA 3KDNA 1VHXA 1IBLF 2GV9A 4NRUA 2WONA 3RJMB 3IWNC 3QMQA 4NASA 4G3IA 4OV6A 3CCJN 1PJ7A 3LDNA 4PL8A 4AHVA 2BKOA 4J9SA 2BW7A 2WTUA 5ETQA 4DV7F 4Y6IA 4UT4A 3VGKA 4OX7A 4DL5A 3ZETB 3NGIA 3V6DA 2EPIA 1KONA 1KTQA 3M8ZA 5FLXU 4ZPTR 4MKYA 3BREA 4Q2LA 4DS4A 4DTNA 2QKKA 2DHGA 2MQOA 2R7SA 5KG7A 1JLFA 1FNXH 3MM9B 2EVZA 1KC8O 3M2UA 1YJNS 1EKRA 4IG3A 4A8FA 3IFRA 1RT3B 2FHJA 4H8KA 1U1MA 3PLAA 2XY6A 2ZVSA 3GONA 4LF9K 1HNIB 3CE8A 2ZEJA 3UVJB 2W9CB 5EVZA 3FQKA 4CEQA 1IUJA 1XMQJ 4ES1A 4F7VA 1HNXJ 2IOCA 3GCXP 2KVIA 4QOZB 1T05B 3GIJA 2FXUA 4NXMF 4RWTA 5HBMA 4CGDA 4EO6A 2YX4A 1HBNB 1RILA 3PFOA 2XMUA 3S3OA 2FUG9 2CKWA 2XCAA 3OYMA 3FJ2A 4UW2A 1YWXA 4KE5A 1ASVA 3FZFA 5BRHA 1K8AT 5F1XA 5M2UA 1E6VB 3KFWX 2OANA 4C9DA 4H03B 2F9WA 3DRSA 1S0NA 2J0QD 1FXRA 3NOGA 1FRJA 2N7CA 2MDAA 1VDHA 3O2IA 2RB7A 1CSJA 4X4VA 2WONB 2BJ1A 2NRTA 3IBCB 3LZJA 1WEZA 1HNWK 2ZOMA 4AHCA 3G71N 3CULA 2CNLB 2DRDA 2CPDA 5KFLA 4KQZA 2SXLA 1WKKA 2C2RA 1NK7A 4U7UD 3POTA 3MD3A 3ETOA 3V6DB 1UFWA 3MR5A 4FJJA 4S0MA 3O8MA 2J6SA 1JLFB 3DCAA 3W9IA 4ILLA 1G99A 3M2UB 4IG3B 3O1BA 1JLBA 1N36K 1VLOA 2OI2A 1SPBP 1GQEA 1RCXB 4OLOA 3G8SA 2UV8A 5I9EB 4PKGA 3CC2S 1UZHA 3CDAA 1B9DA 4X62K 2NUBA 3T1HJ 4F3TA 2LVWA 2MQNA 1TUUA 5HQLA 3NP5A 4OYMA 2OZMA 3A8IA 2KHDA 5HO4A 1GMUA 4DR1K 1KXPA 5HBMB 1HD0A 3CJ0A 2ASJA 2ZJQL 1FX4A 3UO0A 2MY8A 4ZITA 3MPUB 1R31A 3R9PA 2PYLA 2VQEJ 2QO3A 2G1HA 2CQ1A 1QY7A 3A3PB 2HWHA 3ZNUA 2UZAA 4BC7A 5LJVA 3DRSB 4KFBA 5D0RA 4EK2A 2YHXA 4FJHA 4N7TA 4BR4A 4OZ2A 4DFJA 1EAYC 1WC6A 4C8ZA 2VPZB 1QAXA 1VRUA 1P6TA 4FJ5A 5EN1A 1RT4A 2RKIA 2FSNA 5AFUH 4FK0A 3SDEA 4KBOA 3NCRA 2IC3A 3LO3A 5DGBA 1B0VA 2RDDA 2AHOB 1FVSA 3SUPA 2P9NA 2D0CA 3POTB 6FD1A 4DUZJ 3M9NB 2VPXB 1VQOS 1NJYA 3SCJE 4PR6A 5H1SQ 1SKWA 4O44A 4FCYA 1GLCG 4GKJJ 2PSZA 4G1QA 1J6ZA 5U47A 4E7KA 1H74A 2EHGA 4B3SF 1W25A 2F8EX 2DH8A 4HH1A 4KI4A 3TOQA 2XLKA 3MCMA 3CPWR 3CNQP 3CM5A 3KYLA 2O01C 1NAQA 2ASDA 2OSRA 3JTNA 4F25A 1MLAA 4WIQA 4CK1A 9RUBA 1P27B 4RBUA 4ZJLA 1FD8A 2KJWA 2PEHA 1S9EA 1KQSR 1XNQF 2R8HA 3FRYA 4FOIA 4KAZA 5DQIA 2ZE2A 3CJ3A 3WC2A 1TMMA 2OAUA 4KHPJ 3OTOF 3KLEA 3C15A 4Y3CA 4NXNK 4DPTA 3UD5A 1U49A 4HUEA 3CJQA 3LL3A 4O5BA 2HVDA 2L48A 2DCUB 2I9SA 2XNRA 2MXYA 3H46O 4G1PA 1X3MA 1VRUB 1H38A 3HHLC 4WFAQ 3SCKE 2NZTA 1RT4B 4FYDA 3VQ8A 2RKIB 1Y00A 3ID6A 5LMUJ 3IA0A 3SDEB 4C0BA 1KLNA 1YJ9S 4KPYA 1XI1A 2XMVA 2IC3B 3K57A 2HSTA 3K5NA 5K8NA 3TARA 2P9NB 4F4WA 4DN0A 3CCQS 2XLIA 1GLJO 4ZLLA 3GIMA 2QA4G 4O44B 3TAMB 4FK2A 4CO4A 3SUNA 4B3RK 4G1QB 1VSMA 4F26A 1BUXA 4WPAA 1HW9A 2R7VA 2RQ4A 2HB5A 4A59A 2DTJA 5EX0A 1FDDA 2GJFA 3QPIA 2V67A 2ALYB 3FCHA 1XMBA 1YJRA 5GAGP 1S4FA 3A1YG 2ZBPA 3A8JA 1FK9A 5L38A 2MGZA 3H59A 2JLFA 4RL1A 1ZTWA 2O66A 4ZP7A 1R27B 1TL4A 4M5JA 2XSJA 5IM0A 1E3MA 4LF1A 3NNAA 4O0IA 1H7WA 2CPFA 4M94A 2ZE2B 3AFGA 4BACA 4RR5A 1EARA 2IFXA 3ZZOA 3KLEB 3C15B 2EC0A 3FEYB 3JXUA 3O9UA 4CEZA 4ZVFA 3GSDA 3FKBA 1OPZA 3CCSS 3N9UC 4G6VB 2DO4A 1BC6A 3G86A 1RAAB 1QDUB 1SVDA 4CJRA 1RWOB 5KFUA 1KP6A 1RDRA 4ISGA 3KWIA 4EZ9A 2DFHA 5D4PA 4CT9A 3OHBA 4LBHA 3GG4A 3GPAA 1DQ9A 1WJ9A 2JH3A 3NGRA 5RUBA 4AQYJ 4NMXA 1A0OB 1VQNN 3I5AA 1HI8A 3B6OA 4FLYA 5HLFA 1HNXF 1EX4A 1BU6O 1VAZA 1HPZA 1RU2A 4RUCA 4WU3A 4B9TA 5AQJA 5FRNA 2RS8A 2VFTA 3OBIA 2DRBA 1YVUA 4I2QA 4B08A 5GAHI 5IT9O 3RBZA 4M63C 2WSFC 3SAHA 3OYCA 1Y9OA 3NNHA 2PFUA 3KXDA 4F50A 1FEEA 2ZC4A 2PFDA 1P8GA 4IOAQ 1S5ZA 1KD1O 3GR0A 4GV6A 3UDVA 4Z2XA 3OYHA 1FK9B 2MGZB 2PD1A 3I0SA 4M95A 4YDXA 2XSJB 5IM0B 4CGJA 1GLBG 3RW6A 2WSCC 4M3TA 4EFHA 1WSGA 1I5OB 2F4FA 4A46A 4ILGB 3W64A 5KFAA 3NCPA 1OVQA 4CM2A 2CNOB 2UVWA 1RWNB 4ECSA 3HL8A 4K25A 2BKNA 3LDPA 1WAJA 4W5RA 4DQRA 3TAEA 3M5RA 1VLYA 3E01A 4K4TA 3DRXA 1U1LA 3H42A 3P1GA 4FWRA 3HHEA 3T6BA 5DG7A 5DM6L 4A8OA 3TJAA 3DLLL 3K5OA 3T1HF 2HHHK 2VODA 1H3DA 1Y5NB 5THWA 5HANA 4YQWA 4IH6A 4KRFA 3FSIA 3MGJA 1PILA 3OYAA 1HPZB 4JUZA 5EUHA 1B0TA 1MU2A 1TVRA 1WACA 4IJNA 4M7XA 3EVOA 5IWAF 4CHQA 4USVA 1CJVA 2OA8A 4I2QB 4NL5A 4IRKA 1MA9B 1U8WA 4NWBA 4Y0WA 3N6MA 3PTWA 3UKUA 1E6YA 4B3MK 4XEIA 4JI7J 4K41A 5CE3A 2XNQA 1UVIA 2G8FA 4QW9A 4DCJB 2DYAA 1RWKB 1Z2ZA 2UUCJ 2P9SA 3I0SB 3JTOA 3R97A 3SBGA 3T5LA 1HLUA 3BYRA 4CQ1A 1QAYA 4IRCA 3VMFB 4E7HA 3RRKA 3R2CJ 4TU7A 3BGLA 4F4AA 4U96A 3VQ6A 2WZ1A 1ZPWX 2HHTA 3IAYA 4DPWA 1IWGA 3JS9A 3PEJA 2GELA 2HSEB 1KVJA 2RT3A 9ATCB 5KFKA 2RDIA 1U47A 2OHDA 1FJGF 2FLOA 2KDOA 4LF5K 2FLNA 3NGDA 1N8RO 4I6MB 4JLHA 3OQ2A 4GKJF 1FDNA 3VQCA 2VPWB 1CC7A 3CW2C 5DMRA 3BSNA 4CT8A 1IV0A 1Q81T 3E01B 1IBMJ 4YDUC 4K0KK 3CIZA 1C0FA 2ACYA 1SL1A 3EVMA 4BVOA 4CJEA 2GVZA 3RTVA 1RA6A 3OYNA 3KTQA 5GAHU 1SKRA 2JL9A 4TYAA 4DTUA 1MU2B 1TVRB 3DLHA 3K8VA 1CJVB 3P49B 1GMVA 2HIQA 3FSYA 4TY8A 4LR8A 4P2MA 4AHTA 5F8NA 3TA2A 5KQ8A 2RRNA 3VQ5A 2Q66A 3GP9A 1R0CB 3FBBA 5AXMA 4J9QA 4KHPF 3U27A 1RWMB 3UKUB 2Q79A 5D0GA 1E6YB 2AZ1A 2XMJA 1QD1A 1NM1A 1O6XA 2X51A 1SV5A 1V9OA 4LF8J 2CQ2A 5JICA 1RLCL 4A2BA 4CIEA 3FR0A 5C0YA 2UXCK 3W5YA 3QGIA 1SIWB 4CI0B 5LL6Z 5ETKA 5LMUF 2QWQA 2R2SA 4KHWA 5EWGA 4ZPCA 3ENAA 2YJEA 4Y0FA 4LRFA 2ZUAA 2RRAA 4H0PA 4ZOSA 3C7NA 1IKYA 3BJYA 4Y2MA 3RW7A 5E3AA 2BW2A 2Z2MA 2G8KA 1Q8KA 3PNIA 2I2YA 3BR8A 4OPJA 4BR9A 4O0NA 2HHSA 4JKCA 3PIOQ 3LAMA 3WEEA 1J53A 4J9NA 1K1SA 4LFCF 3HYFA 1NPPA 1IBCB 2CQIA 1VMBA 2Y1IA 1VSKA 1HWUA 4RU9A 2HRTA 4OI0A 2ZDOA 2R8IA 3ID8A 3OW2R 4B8AB 4K8XA 4JS4A 4DUTA 2K3IA 2MQMA 2WRMA 4CZGA 3AH6A 2LCWA 2GVZB 3DRRA 2HHWA 4GV9A 2O67A 2MTLA 4UUXA 3WZ0A 2ZJPQ 4WQ4A 2CPYA 3C46A 3HULA 5AQTA 4C0OC 2GJ2A 2I7NA 4U7BA 4BC9A 3K2PA 4TY8B 5AQIA 3M8PA 2JX2A 1RDWX 4LR9A 2FTRA 4ECRA 1CZ9A 1GXTA 3R6GB 3U3YA 2CFXA 3N4QA 1P8ZA 3ALYA 2DNLA 3U8XA 1SV5B 2MKCA 1XHXA 4JKAA 2UXDJ 5A8WA 2E5GA 4V19J 1YSJA 4CLKA 2QEXS 2XEXA 1RISA 1MWKA 2XY5A 1W0HA 3HZEA 2HS3A 4WFBL 3EKUA 1MROA 4FYWB 4DV1F 3GU0A 1RZMA 4AQYF 1RBVA 4NMLA 2UUAJ 2GEMA 3CXCR 4PPDA 3CCRS 5DZ6A 3VQEA 2UUBK 3C7NB 1IKYB 2IBKA 4EEYA 4BHQA 1H7XA 1LFWA 1GXLA 3N01A 5BR8J 3J7AN 1JJ2R 2OPQA 2LKZA 2ZBQA 3AVFA 2O3DA 4W5OA 5DJBA 2K8GA 3WEEB 4DWIA 4OYXA 5K8OA 4DPYA 2E2OA 4MDAA 3U3GA 4I0WA 2E1CA 3T7ZA 5HJYA 5KFWA 3AVLA 3VAFA 3EE3A 6AT1B 4OZJA 2CGJA 3ENBA 1M1KO 3ZTPA 5ADXH 1ZAVA 1VK8A 1KCFA 2IDLA 4AILC 2CJKA 3DRRB 3J7A1 3TYTA 4JAXA 2ZUGA 3B54A 4LQ3A 1FE4A 5JMNA 3ZX2A 3ZEUA 2CQ4A 1DURA 4X62F 3M8PB 1GLEG 1JJ4A 4OZNA 3MXJA 3TSPA 1M1HA 5KFOA 1H98A 2WHOA 2ITGA 1CZBA 3VA0A 2LXIA 1NK0A 1UPMB 2CG8A 5ETTA 1U04A 4OHWA 5A8WB 3TZYA 3MAQA 5CHIA 1UPPA 1ZM9A 3ZX3A 4DV0J 4B1ZA 1CQNA 2DGTA 2JEGA 2NSCA 1MROB 4F3MA 3MCNA 3EZUA 3QJJA 1ASWA 4CM0A 1YGYA 3G4SN 3CMAS 3AGKA 3CCES 5K14A 3HCXA 3I5BA 4YN3B 4FWLA 2VC0A 4DR3K 3M6UA 3V81A 5M1OA 4FWSA 4LVNP 2OPQB 2F4VK 1M5PC 1S48A 3BH6B 3FK4A 3S01A 2XULA 4A8SA 5AJ3J 3TO8A 5A6WA 4Y2IA 3MPVA 3OL9A 2H5JB 5EHHA 4PXEA 1A9NB 1HMVA 3PYFA 1H2VZ 1XR7A 4JI7F 3CIPA 1N5TA 3HFVA 2PO4A 2P6SA 1RDBA 4HACA 4E1MA 2IMOA 4LFAJ 1XQSC 3PUFA 5DQGA 2UUCF 2QXFA 4C3KA 2GA7A 1C0UA 3KJFB 2Y0SD 2C3PA 3WQUA 1YJ7A 2IA6A 1FX2A 4CZKA 2FSKA 4MH8A 4JI3J 1RXOB 2BEFA 5I3PA 3ZEUB 3RB3A 2OELA 3H5UA 3R6MA 2DB1A 4CJ4A 4PYAA 1X8DA 1M5SA 3VQQA 2KHCA 1LCUA 3NKYA 2KT2A 2FVPA 2ITMA 3HSDA 2QWLA 2ZH8A 4A61A 1OIAA 2RQKA 1N54B 1IR0A 5EX5A 7AT1B 3EPIA 2QW9A 1BL3A 4ANEA 4HDHA 4NXNF 1IBMF 4DG1A 2BE2A 1HPMA 2A18A 4FWNA 3BGRA 2GIRA 2XG8A 3EKSA 4Z0UA 1ZZFA 2ZHAA 3O3HA 3WXIA 4ZLJA 5K14B 1QZ6A 3RBXA 4M5LA 3PIPL 3V81B 2XY8A 4BRQA 4AL5A 1J9AA 3C94A 2GS8A 3LDSA 3VEWA 4AL7A 4UZBA 4M45A 1FRLA 3RUBL 3VZHA 4DR2J 3PZPA 1HMVB 1NMEB 1TL5A 1O1WA 3EZOA 4DR6J 4HACB 5HQ8A 2XTJP 3R3TA 3C3LA 3HSGA 1C0UB 1V3SA 4LF8F 4ED7A 2RD5C 2DNKA 3M8RA 4CIGA 5C12A 1QJHA 5KGXA 4JI6J 1X4HA 4OHZA 1VI7A 3UB5A 1Y4ZB 4DV4K 3E8OA 2DCLA 2MB0B 2O8DA 4LSZB 1RCOB 2AYMA 4X2BA 4FS2A 3QDKA 4CHOA 4GC7A 4B9NA 4DX6A 5E7OB 2J7UA 3MECA 2QJ3A 3AVIA 3ZX0A 1LWCA 5MLCQ 3PKYA 2F9TA 1X4AA 2HQ3A 2Z1JA 2GBZA 2GUIA 2XO6A 4B1WB 3D1QA 4AT1B 4A8MP 1TFYA 3ZZ0A 4USJC 4Z4EA 2KW4A 4DG1B 4AXIA 4E3SA 1R8BA 2BE2B 1OO0B 4DTJA 2CAJA 4CGHA 4I68A 3KHRA 3NL0A 1JQGA 3BGRB 3OS0A 1PCAA 3D2FA 1GFWB 2IVNA 2E4LA 1WORA 3GMGA 4FSVA 4RG8A 1KRPA 4BDPA 4TQSA 3TWHA 3CJSA 4C11A 3MCSA 4QWEA 4ZVRB 2RRBA 5LXRA 1YRTA 4QAGA 4DTSA 3QFPA 4TXSA 3CEDA 4DJBA 3N4PA 2NCKL 1RNHA 2V94A 2V2VA 4I1TA 1Y5IB 2WAQD 1Q7LB 2AD9A 1UA0A 1W26A 3Q8RB 1G6BA 2FLLA 2OUGA 4DZ6A 3AA4A 3PHEA 5HMWA 3R27A 4OJGA 4KH6A 2A0FB 5SWMA 3DM2A 2R3VA 2UXDF 2AIRB 1PIEA 3LOUA 1YQHA 3CJ9A 4KRWA 3L95X 3GWCA 4A62A 4BS2A 3PFEA 3G2XA 4CZEA 2CZ4A 2O8DB 3OYFA 3ILJA 4J90A 2UUAF 1VQ4N 3DHXA 4IO9L 4BRHA 4YHHK 3MECB 3GFZA 4JKFA 3H5XA 5BR8F 3OVAA 2ZWPA 1LWCB 4L3KA 4DSJA 2W8LA 3EE9A 3A8YA 5BN8A 3D6MB 3ET6A 3MPWA 1N56A 4DDFA 3OPKA 3M6WA 5EWFA 5CABA 2X1BA 1T9YA 1U6FA 1JJCB 3OJSA 3FFIA 2HF4A 5C42A 1G7CB 3QEWA 3G9CA 3KLGA 3HT3A 3M1FA 3D2FB 3QT6A 5KFPA 3HXMA 3I33A 1NSQA 1A5XA 4C11B 4CHYA 4U67L 3NGYA 2ZM6J 3DLBA 2KXNB 3BSAA 1J27A 2X1FA 2B7BB 3M2VB 1Z4UA 4Q44A 1VC0A 3QEIA 5LJ5Y 3O3LA 4KGXB 1BGXT 1Q78A 1XIQA 4DPXA 1EWQA 1AXQA 3OL7A 5SUHA 3ENWA 3HF5A 2RPIA 3DM2B 3S8SA 2PC6A 2AP6A 3B78A 1T02A 5JS1A 3ILOA 3D6FB 2K06A 3H4DA 3EO3A 1KAZA 2VG6A 2DXEA 3O6QA 3CC2N 2QA2A 4PWUA 3NAHA 3A8EA 4QWDA 2C2NA 3UDLA 3KK2A 3IWLA 2E5HA 2EI5A 3CFRA 4ZP6A 3ENOA 4GY2B 1NXIA 3EMTA 4WE1A 1KAXA 3CJ4A 3R5BA 2LA6A 4LF7K 1TUYA 3ET6B 4CZLA 5AJ3F 1SQKA 1X4CA 5CCLA 3LWLA 3PW2A 4ECYA 1N33K 1WOSA 1YZ6A 2MQPA 3AARA 2W41A 4WXOA 3L09A 3D2EA 1QLNA 3FFIB 4LFAF 5C42B 4FS1A 3KLGB 4TLRA 3HOSA 4E8UA 3FFKB 2J9CA 3H3NO 4ZLPA 4A8XA 2QMXA 3M6XA 2IA0A 4YOTA 3ZO7A 2BMBA 2IRUA 4ZN3A 3THWA 4C4WA 3OYGA 4GNIA 3E9PA 1X4EA 1ZBFA 2MLXA 1EIYB 1X0FA 1LXJA 1GH8A 5TKWA 1LWEA 3D6HB 4DV5J 2LQ5A 5LJWA 3LA0A 3ZTQA 1X5OA 4H0VB 5FROA 1TK8A 3J80O 2EFGA 2JHEA 2FF6A 3AA2A 3P5JA 3H6EA 5ETRA 3VENA 1EKSA 5EDWA 3MCAB 1UZDA 4Y65A 5BJRA 3U7JA 1YG0A 1N4LA 4B9SA 3L0QA 5D77A 4Y28C 4ILJA 3OS1A 4DV3K 2HBLA 2VG6B 1V6HA 2W9BA 4USIA 1S5JA 2MZRA 2YTCA 4CK3A 4XH4A 4ATNA 4KHYA 2Y3YA 2OD4A 2D0AA 2XI3A 2CJXB 3KK2B 1WF1A 1C1AA 4CJFA 4OO1J 5LT5A 2XWYA 2HPUA 3FCVA 4WE1B 4DXLA 3UN5A 3AVKA 1NB2A 2HVIA 4CH0S 5AT1B 1AROP 4DKWA 1PAUB 4CZHA 2H65B 5G0RA 1B64A 4JB8B 2LMIA 1HL6A 2RNEA 2CNNB 4DR2F 3CCZA 1YIJN 3L3UA 4H0TB 4JI0K 4NYNA 1Z26A 1Q8BA 3BQ1A 4YOWA 4DR6F 3CMQA 2B51A 1NNEA 1EZZB 3D2EB 3BR9A 2UVUA 5KAKA 1UETA 3V9UA 4V19S 1WELA 4JI6F 4QS8A 4A8YA 1KVIA 4B8CA 2Q6BA 1OSDA 3THWB 4NZ6A 1K73T 3HSJA 3LDOA 2B7CB 2AKWB 2BJ9A 4H5NA 4DMZA 1LWEB 4FKYA 2LU2A 3GIRA 3DDKA 2QE5A 1NRKA 1U09A 3D9BA 3W62A 2W4DA 1T7PA 1K8KA 4Z4HA 1IR2A 4K59A 2V52B 4FKXA 2QL5B 1DGKN 3MFHA 4ECZA 2AGQA 2FJXA 3W3DA 4RX6A 2KL8A 3GIIA 3W63A 3CCMN 1SIZA 3GDQA 3ZSOA 2P1JA 2FVCA 1IXKA 1ATSA 3E3XA 2W9BB 3KK1A 1HFEL 3QESA 4NLDA 1OH8A 2KFZA 2LQ8A 1ZM2A 4RW7A 1KS2A 1WKLA 1VQ8S 4X66K 3W2VA 3HPOA 3MPDA 3L4QA 4FVMA 2UXBJ 1GX5A 2AGPA 2YWEA 4P74A 2PIIA 3LAKA 3TEHB 2M4MA 5G0RB 2F96A 4I9LA 2KFYA 5JVGQ 3RR8A 3NRBA 2Z1HA 3JAMO 4OZ1A 5LMNF 4CO1A 1BWVA 1H2UX 1VHFA 2EC2A 3QT7A 4MKBA 3P5BP 4DEZA 2XMMA 4CYUA 1NGAA 4OFZA 2A2CA 2OTJN 4IR1A 2C3MA 3H7HB 1I94K 4BQLA 4KJIA 2JWNA 4NI2A 4M3YA 4HCBA 3TZZA 4QBUA 3R1HA 1G15A 2YQ3A 3HPGA 4I9QA 2HMIA 1Q82T 4MO5A 4ANDA 4X4TA 1UWAA 5AXLA 1VQPS 1OVYA 4M5MA 2R8GA 4DV0K 4FZZA 3US5A 3BEGB 1N5QA 1H6KX 2GAHC 3OVBA 2AU0A 3MUMP 1NM2A 2CQGA 2J9EA 1SKSA 3PYGA 4U6PA 1S6OA 2EG1A 3L3VA 1TP7A 2GHPA 2IPOB 3GTYX 2ZH9A 3KK1B 1X0PA 2DIVA 2ALZA 1NK5A 2B9EA 5DZ7A 4C2MA 3DXMA 2C3UA 4FW2A 2B9YA 2W2OP 4KB1A 4MKAA 4LF4K 3KUEA 4RW7B 1Y97A 5AQUA 3VOVA 3THXA 3X3UA 2QSWA 1Q0NA 1Y10A 2FC0A 3W2VB 2MSTA 2C2ZB 1ACMB 4XIUA 1Z6RA 3VQBA 3S1TA 2RDJA 1UVMA 2E2NA 1SQFA 2ZM6F 2FJAB 4FJMA 3L2RA 3I4PA 4XO0A 1L3TA 2FDNA 5MAOA 1VJQA 5KFXA 1LW0A 4QZVB 3GLJA 2C1EB 3N0VA 1NGGA 5H9FJ 1UA1A 2YX6A 1SZ2A 5KFJA 3KLVA 3KLHA 1GMWA 1W97L 3RVCA 3C66A 4JV0A 5AFUA 1W2IA 1U1OA 5E3CA 2F4VF 2W2PP 1GK8A 1OQ3A 4ZPBA 3UIQA 3M2RA 3EY1A 1RWUA 3D68A 1PC5A 4WTOB 3VF4A 3R5DA 1VC5A 1BIZA 5ETLA 5FPDA 2BJ3A 3QERA 4CFBA 4PRFA 3AQPA 3JSYA 5B0CA 1YJWN 4NI2B 2B4JA 3K7RA 1X5SA 2HMIB 1YRXA 4BR2A 1D0EA 1IWAA 1HWJA 4DF8A 1SH3A 3FC9A 4K8RA 5DK5A 2MQQA 2HIYA 4A5BA 2GW8A 3MM5A 4JYAK 4LFBJ 2WBNA 4J9PA 4DQIA 1S1WA 2QIFA 2LQ9A 3HD2A 4WFZA 4N47A 4M5HA 2UUTA 5DLFA 4CZIA 4CJTA 2E5LJ 1AW0A 3DXMB 4Z7YA 5DDOC 2KG1A 1KNZA 4DU1A 1KHVA 3SUQA 3KHGA 5AZJA 3THXB 4O4RA 4TQRA 5JVHQ 3VAIA 2C42A 4QPTA 1X7VA 4MIBA 3VZIA 4W92B 4NE9C 1KC8T 3V5RA 3W0LA 2BQRA 4NLYA 1WC3A 3EUNA 4JNEA 1S12A 1LW0B 4LF6K 3QQCD 2A40A 1N32F 1R8CA 2OEMA 2C2DA 4GV3A 4GVLA 4P10A 3FBEA 2VGMA 1K9MO 1YLXA 3HI9A 3KLHB 2J76E 3AJ1A 1NKEA 1JCEA 3VETA 3U02A 1TL3A 4DV5F 1Q79A 5KG0A 5C2FA 4ZVUB 1BUPA 2AP1A 3M2RB 4PY5A 4CJ3A 3CFOA 5C5JA 1TYQA 4LRBA 1OY8A 1SAZA 3RG6A 4V19X 5L46A 2ASLA 1V3ZA 4TVAB 2XGQA 4NO7A 4ED3A 4OYWA 3MAHA 2PI4A 4J9MA 1KQGB 2HHVA 4DCOB 1WG4A 4WTYA 3D7SB 3RYLA 2H5EA 3VGUA 3AGRA 3CM6A 2N4CA 3D45A 2RE1A 2BANA 2ZZMA 1KKHA 1NGBA 2M9KA 1FCAA 1K0TA 1FFGB 2VBZA 2P9GA 3I87A 1WSVA 2ZHOA 5GIOA 3MM5B 3PO4A 5LSRA 3OS2A 1YT3A 3MX5A 1S1WB 2V34A 2ETJA 4L75A 3NF9A 1N0UA 2YNGA 2FHMA 1X9SA 2YKNA 4G65A 3QRRA 2BH1A 1S0MA 1WHVA 1BA1A 5AZJB 5LM7E 4CEDA 2HURA 1R0BG 3F5TA 4A8KA 3V1QA 2OPRA 5L1KA 4CZMA 3N5FA 2D41A 4ZVSB 1RBRA 5HL7L 1OPIA 2UU9J 4ETZA 4OKJA 5BRFA 2EKYA 2IHR1 2NLXA 2AYGA 1LQ9A 4QJVA 1HHSA 4HI1A 1BQMA 2HNZA 3TVZA 1BWEA 1TL3B 4L8RB 1NMNA 2FF3B 5EWEA 4CWBA 3O1LA 3AXMA 5E84A 1VQYA 3W5XA 2W9AA 2VPYB 1T3NA 1TYQB 3LF0A 2XS7A 3J81O 2BACA 2D3UA 4DTRA 3RGIA 1BG3A 2OLWA 4H5VA 1EQYA 1WUUA 1YXQA 1EQMA 5JMVA 1KFSA 4CO2A 4HTIA 5E2QA 2ABYA 2DXFA 5KT2A 2FBTA 5F3TA 4BRGA 3G6XA 1FTRA 2UXBF 4R25A 1F3FA 5DM7L 1F6TA 2BANB 4BE2A 3WXKA 4OI3A 4CEEA 2RN2A 2R7OA 1HYVA 2G8WA 5D3GA 1CULA 2E9ZA 1FXLA 2ZJQQ 4KKOB 2XS2A 4BRCA 3AO2A 3M7VA 1CLFA 4L3QA 2FGOA 3U1MA 4IO8A 2YNGB 3PRVA 2YKNB 2DNNA 4RW4A 2PDAA 4ZK7M 1FRKA 1C6VA 2DHHA 4QPXA 2OPRB 3RB0A 3AVGA 4M3RA 2DD8S 2KB2A 4RW9A 1DBDA 3NFAA 4YR3A 3A5NC 3SIPB 1DARA 5TKYA 2DITA 3PRBA 3VGTA 3ZFVA 4EBDA 3LDQA 2K7KA 3VWSA 5KI6A 1BQMB 2HQGA 2WW4A 2KYZA 3DU5A 2HNZB 4YY3J 4CJWA 4BRFA 4CJUA 4BE0A 4IG0A 2JRSA 5M1PA 5JXSA 3Q8PB 1U26A 3AVMA 4FWOA 3UNGC 2HGLA 2KKZA 5KFQA 5D4LA 3SJHA 1HD1A 1RAJA 1N52B 2XHCA 3SQOP 2IVPA 1BDGA 1TL1A 3MR6A 4FJ9A 2QRRA 2BQ3A 1NGJA 1R6VA 4CLUA 4ZLNA 3DXBA 3GILA 1NGEA 3DLJA 2CQHA 2G2YA 4GKKJ 3GG0A 1BIUA 2VDIA 2E5JA 3PKMA 3GQCA 2V8DA 5HMXA 4CJQA 2QXLA 3BB5A 4RW8A 5M1KA 5D3GB 5B0DA 1CULB 4UY8O 2VG7B 1D09B 2RU3A 2FZGB 3K5LA 5IZHA 3GBTA 1VQMS 2P5OA 1Z25A 4FJGA 2NXUA 2XYPB 3ZTOA 4P2FA 3T1YJ 3PCOB 2RAQA 2HBRB 5FLXY 3LP3A 1WF2A 4RW4B 2J8AA 1JNRB 2KYXA 4DF4A 1DJ0A 5F8JA 2CJQA 2DGQA 3R6LB 2FBXA 1ESVA 2VA2A 2A42A 2P9UA 1K44A 1Q7YO 4RW9B 2Y1RI 2HNYA 2JEJA 2B56A 1Z2LA 1SJRA 3PJ9A 4U8YA 1M5HA 3PM9A 3T9ZA 4FJXA 3C19A 1NJWA 4P75A 2R7QA 1IBKJ 1T9VA 3G6EN 2BYCA 3ZZUA 3AXKA 1JXBA 4K5SA 5B09A 2W6LA 3DGPA 4IG0B 2GIFA 2MHEA 3MDFA 1QM9A 4DSFA 3CD7A 3O6WA 1V4SA 4CHNA 5CZXA 5KFMA 1QHAA 1EP4A 3NAEA 1MWQA 3C14A 1DT9A 3FEXB 3G0ZA 1TL1B 1ZBIA 3CERA 3EXYA 2A6AA 2E1RA 3IXQA 2E5LF 1X4DA 3PY8A 1C4CA 2CNKB 1RYRA 1UTAA 1IH7A 3J80U 2ZGZA 5IC6B 1FNOA 2RHKA 3UD3P 2FLPA 5KFGA 3T3FA 1X9JA 2J6UA 4DV3F 2W1BA 1VQLN 4NX9A 3RB6A 4TU8A 4CJSA 1XN9A 1V5VA 3C6HA 4IKAA 4UQGA 3N79A 1HNZJ 3Q86A 1XQIA 2V8VA 4RW8B 2R2RA 2NZCA 2WTFA 2YNIA 1VBXA 4B3TJ 2GZOA 1IVZA 2G8UA 3SPYA 1S77D 4OPHA 2DNQA 4F9OA 2V2ZA 2MLZA 3M8YA 5A8RA 3OYBA 2F8TA 4NLTA 4DZDA 4J9KA 4PWDA 2P9UB 4DR5K 3IAM9 5C2GA 2HNYB 1U2VA 4D3HA 1XMOK 4JI0F 2O4IA 2YWWA 5IT4A 3FRZA 3HHLD 3OJUA 4J37A 4HCCA 4BLGA 2QZ8A 4N76A 2EFOA 1MWMA 2B0GA 3L2VA 1KD1T 2BXJA 2R7RA 3DOMA 3VQDA 4OJ3A 1PKUA 3B8AX 1AYEA 2G8VA 3DGPB 2ZBIA 3DKDA 2X3GA 1J54A 4TLQA 2CXEA 3VEZA 1KOOA 4X4NA 4YFUA 1YITN 4F04B 2LEAA 1KVBA 1EP4B 2CYYA 1RKJA 8AT1B 1TAUA 3R8YA 3C14B 1HIYA 4O4GA 2M5YA 4QYZJ 4F3OA 1CLQA 1RT7A 3R9LA 2G9OA 3NLCA 5M1QA 3NCQA 1TK0A 3FUYA 4RBTA 1FVQA 3SSRA 4U9RA 3DLGA 2VQFK 3I0RA 2LXUA 2BJDA 3GV7B 4FDFA 1JB0C 2E2QA 4FW1A 5HQMA 2M2BA 2ZC3A 2P8IA 1R0AA 2UU9F 1XHZA 3TRGA 2WW8A 2Z0GA 4FLZA 2YNIB 1YBTA 3CJ1A 3VVUA 3UFCX 1S99A 2VDHA 3BDEA 4DL6A 3AVBA 4BC5A 2VFVA 4W4MA 4JI5F 2K7JA 4F2RA 4H4OA 3F9KA 4OVLA 5A8RB 4EUVA 4WFYA 4IFEA 1YUWA 4Q43A 2MKJA 4AUKA 4BWJA 1NJIO 4PWDB 5KFDA 3HZ6A 1SC1B 1U2VB 1WTBA 3VGSA 2P9EA 2CPIA 3TABA 4NXMJ 3HX9A 3MMJA 1HR0K 2EX3A 2ZD1A 4IQXA 2GTDA 3DOMB 1J2VA 1VYAA 1HBMA 5ETNA 2P2CB 3BO4A 3GOIA 3DLLQ 2RHSB 1RLDA 2W7PA 4DU4A 4JV5K 4FLVA 1YTAA 5CH7B 2E9TA 3OTEA 4YUDA 3T5KA 1UEVA 2CH5A 3GJSB 4DCHA 4USMA 4O4GB 2GHWA 4OJHA 4IO1A 1RT7B 4KGZB 3DHWC 2V0NA 2ZH6A 5HK4A 1OYEA 4O55A 3NE6A 5BYQA 3BKTA 4I64A 4WF9Q 1ATNA 4I69A 2MKKA 1N8RT 3BQ0A 3DLGB 4WXWA 4XTTA 3TTDA 2L9DA 4WK1A 2OP5A 3K17A 4YOEA 3I0RB 1JCGA 1SUQA 4HL9A 5LOQA 1IKVA 4DUYK 4P72A 4GRSA 1UVKA 5K9FA 1R0AB 2FZCB 3LWMA 2FVQA 1T8EA 3L9ZA 2NYHA 5DLGA 1WEYA 2MZ1A 3FZBA 1VBZA 2BUNA 1N34J 3QLHA 1CJTA 4RNNA 2APOA 2NR0A 4DL3A 2E7WA 4DOZA 3MXIA 2MQLA 2X1GA 4YY3F 1FTCA 4H4OB 4KT0C 4CI6A 4WU2A 4FWKA 4WBFA 2B8QA 4M7YA 3IR7B 3KLIA 1FT8A 3AJDA 1A7GE 2FBYA 4FZVA 1VRTA 1WLJA 4ZA1A 2K3KA 1O5JA 4ZCKA 3RRHA 5HATA 4WKYA 1S1UA 3DWLA 1NHUA 4RWWA 4JK9A 3CCUN 4OZLA 2VF3A 2ZD1B 1VISA 4NLGA 5L1JA 3MM7A 2A2DA 3E9LA 4LFBK 1HBMB 1KR4A 2F3JA 2GQ2A 4BROA 1WC1A 2QKBA 2DPIA 3UR3C 3NVKA 4ZDNA 4JRPA 5EGYA 4KPCA 1KLMA 4I4BA 2HQDA 5F8GA 2VV5A 1VQ5S 4ED2A 4CESA 1YHQN 5C15A 3G87A 5KFYA 4WYLA 2ASOA 1MN9A 3NOCA 5FRMA 3NGTA 2OO4A 1XC3A 4WZQA 1OH6A 2ZKUA 4P52A 3OL8A 1VK0A 2K1RA 5I42A 3V4MA 1S49A 4X4PA 3OYDA 3UN2A 1XUPO 1SUQB 3PX0A 1IKVB 4TNOA 3IBWA 3VESA 2QM1A 2V7YA 2GX8A 2C2OB 2B4UA 3QLHB 1CJTB 3UW1A 1KVKA 3EGNA 4OX9J 4WP9A 4CO3A 2JGUA 2IAJA 1N6QA 1P1LA 2DFFA 4DX5A 3KK7A 1TKDA 1NPKA 4B3SJ 1R6YA 2HBZB 4FF1A 1NHKL 3AQOA 1DAXA 1TR0A 3CCLN 3CCJS 3QZ7A 3KLIB 4LF6F 1Q86O 1VRTB 2HWIA 2QL9B 1RE1B 4EZ6A 5EXWA 1S1UB 2DFEA 3MDQA 4H4KC 1ZA1B 5G4DA 2CDRB 1WNEA 1ZOTA 2L3MA 3CD0A 3UR0A 3QJLA 1WD6A 3SYZA 5HRNA 4EBEA 4QW8A 2NNWA 3MM7B 1MG7A 1S59A 2Z57B 4DL4A 3Q8SB 4ITSA 3OTOJ 2N3OA 4NYFA 4ZJOA 1UJ6A 2KT5A 1F9HA 4MYTA 1FKOA 3V6HA 2Z30B 1FERA 1KLMB 4RTFD 2UV8G 1UVNA 3CJ2A 3WC0A 4WQ5C 3S3MA 1ZXOA 1FXDA 3EDQB 1TFWA 3O4NA 2EKNA 2V8GA 1T6DA 2CQ3A 1A5WA 2OYQA 3UWTA 2K1RB 1NO8A 5I42B 1S3XA 3HHKA 3WX8A 3NCIA 3M8QA 2W9CA 1Q95G 2AA4A 5BR9A 3VV2B 3D66A 5AQZA 4G9ZA 4J91A 2VWBA 1J5EF 2NPIA 1L3KA 4E1NA 2VICA 3EDRB 2V4RA 3HHNB 1D9FA 4RUAA 3ISNC 1M1KT 5ITHA 4WFBQ 2IAJB 1N6QB 4KGKA 1QQMA 2FHKA 2CVEA 4ZTFA 3C16A 2D9OA 3O5BA 3KD5E 4F67A 4QOTA 2XHWA 2PYJA 2XMKA 1UJ5A 3EPGA 2OMOA 2DR8A 3HSTB 1RWPB 1UWBA 3G71S 1L3VA 2BRKA 2G2ZA 4CFDA 5KFHA 3NS5A 2R7WA 3DDIA 5HRSA 5KFTA 5T7LA 4AD6A 1EHWA 3PIOL 2FJBB 4EI2A 4ZIVA 4CIFA 3FEZA 4FL9A 4JHDA 4X65F 2HLUA 4FYVB 3JSBA 3Q24A 1X9WA 4JI4K 2HVHA 3ZT3A 2O8CA 4DV6J 1ZZNA 3VGLA 4EO8A 4WYBA 5F0UA 3IWXA 1IN0A 4QIEA 3IRWP 4QIWD 5J1PA 1FKOB 4DR7K 2J9DA 4ENOA 1Q9XA 1ZAXA 2WSEC 3VGMA 4Y00A 4RLEA 1AUDA 2NRZA 5GADP 4F02A 1GLDG 2FJDB 2ADCA 4F8RA 3VN5A 3NS7B 5F0XA 2ZJPL 2OTLN 2VH7A 1U1NA 3CCVN 2AF6A 3WNFA 2QSFA 2ZOFA 3W65A 1VQ7N 2HF3A 4BRDA 3T9NA 1U1PA 2WBMA 4Z4GA 1R8HA 3M8QB 3EXCX 2EW9A 2DPJA 5A0YA 3LM2A 3OVSA 1T11A 4DFMA 3ONQA 1VR6A 2IDEA 2GVDA 4AF1A 5GAEP 3HSCA 2ZBRA 3LPEA 4L3NA 2NXJA 3C16B 3RAXA 4KREA 3MUVP 4E0DA 3B6PA 5JJBA 1RK8A 1RBOB 4ES3A 5A2QU 1M5OC 3U1LA 3Q2SC 1P9YA 3SBMA 2CQBA 1UWBB 2E88A 3SQ2A 1X1PA 2VIHA 4KHUA 2PMZD 3QEXA 3KLFA 5KT4A 5T7LB