1N5YA

Hiv-1 reverse transcriptase crosslinked to post-translocation aztmp-terminated dna (complex p)
Total Genus 122
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
122
sequence length
558
structure length
558
Chain Sequence
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFKKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDICKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNKGRQKVVPLTNTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDKSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLVSAGIRK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of HIV-1 Reverse Transcriptase with Pre-Translocation and Post-Translocation AZTMP-Terminated DNA
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Transferase/immune system/dna
molecule keywords 5'-D(*AP*TP*GP*C*TP*AP*GP*GP*CP*GP*CP*CP*CP*GP*AP*AP*CP*AP*G
total genus 122
structure length 558
sequence length 558
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2002-11-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 1n5yA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1n5yA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1n5yA03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1n5yA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1n5yA05
4B9TA 4CERA 1QHTA 4RW7A 4JUZA 1TVRA 4YMEA 2FBXA 4ZVGA 4Y2AA 3GYNA 3DDKA 2YV0X 4CFCA 2QK9A 1DLOA 2R2UA 2HNDA 3QGIA 3GV7B 1KHWA 4F4KA 5DGBA 3GV8B 2QKKA 3MEGA 3TAFA 3KLGB 4FS2A 4J9NA 1RT3B 4GC6A 2WRMA 2VWKA 4FLYA 5L1JA 4LSNA 4FJKA 4DTJA 4Y34A 3PJXA 2YKMB 4B3OA 4FJ5A 4CEDA 1BGXT 1C2PA 1BQMA 3QEWA 4QWBA 5T14A 4CHOA 3NAEA 1GOBA 2VA2A 1TQLA 4H4MB 2IBKA 3KHGA 4IR9A 3AVKA 3DMJB 3FFIA 3DLHA 1HPZB 1KFSA 2FVRA 1SKSA 4Y1CA 1S10A 1XWLA 2OPQA 4JRPA 4ELVA 5C25A 1RA6A 3CM6A 5L1KA 4NRTA 3WNEA 2ILZA 1RTJA 4F3OA 4CHNA 2AGQA 1DLOB 3H59A 4DMNA 2HHTA 2X6SA 3H40A 1FKPB 3KLGA 1LWEA 3H5UA 5KG7A 4DSKA 3G6YA 5F8GA 3AVIA 2G8UA 1ZTTA 4C8LA 2R8HA 2OYQA 5KFAA 4WZMA 3V9UA 4AHUA 3DLEB 5KFZA 3QERA 2ZD1A 4CECA 3F9KA 2OPRA 1U45A 4O4GA 2FJWA 1HYVA 1DTTA 2YKNB 5C42B 3TWHA 3E01A 4JS5A 2P51A 2D5RA 2RN2A 2JEGA 4QW9A 3KD1E 1IKWB 3LAKA 4DL3A 4ICLB 3DLGA 5J1EB 3H5YA 4PWDB 3LP3A 3TQ1A 1F21A 3PV8A 5KG1A 2HHQA 4GMJB 1NJZA 1XHXA 4DQSA 4Z4EA 3WNGA 2XC9A 4NLOA 2PYJA 2R8KA 1Q9YA 3H98A 4OKKA 1XR5A 1VSDA 2UUTA 2AGPA 4N47A 1KFDA 1S1XB 3OYLA 3PW4A 1S6QA 3HXMA 5CYMA 4EYIB 3EPGA 4DL6A 5KG5A 3QO9B 1KRPA 4W5NA 2R2TA 3C6TA 3NGZA 4M3UA 4J9QA 1CZBA 3CVKA 3M9OB 1IKWA 3I0SB 3TAMB 1TL1A 2F8EX 5J1EA 4HCBA 1EKEA 4FJXA 2KZZA 4K4TA 3I0RB 3FRZA 1TVRB 2IM2A 2IGIA 5KFQA 4KREA 3I5CA 4DTMA 3P1GA 2C28A 3LPUA 2IOCA 3DOKA 2G8HA 3BJYA 3AVCA 4CF9A 2R7YA 5KFOA 5KFVA 5SZTA 2ASDA 4HUFA 1SH2A 1RT3A 1LW2A 2F8SA 1VSEA 1W9HA 3BGRB 2ITGA 3DM2B 4KV8B 4FBUA 1QSLA 1ZBFA 4Z4HA 1TKXA 2XWYA 3V1RA 2WOMA 4RW6A 3PHEA 3PX4A 1N6QA 3KK2A 3KHLA 4FZYA 1RILA 3K57A 2HHXA 2CJQA 4IG0B 4DSIA 3UPFA 1ZBLA 4IG3B 4YFUA 5KT5A 4LH5A 4KB0A 4JV0A 3KHRA 1WSHA 1IH7A 3HPHA 1TK0A 2RPIA 3T3FA 1L3VA 2B4JA 5HRPA 4LQ3A 4IR1A 1JLEA 2OPSB 4TLRA 4CEOA 4M95A 3SFGA 4HCCA 3RB3A 1C0TA 3G86A 3NKYA 3VA0A 1NK7A 1RT2B 1VRTB 1RDBA 4HKQA 1TKTB 3CFRA 1S1WB 2HW3A 4I2QA 4J9SA 1JLFA 4RW9A 3CDWA 2D3ZA 1UA1A 2RKIA 3PO5A 3PX0A 5FRNA 4B3OB 2R2RA 4GVMA 1HMVA 4IH6A 4CK1A 2OPPA 4HHTA 2ZD1B 1R0AB 3H4BA 3O4NA 2VA3A 2F8TA 1WSEA 5HRNA 4M3YA 4F8RA 4DSEA 2W9BB 2IAJB 3KLEA 2UVRA 4CIFA 4AH9A 3BSNA 1I6JA 2VWJA 3KLVA 1DTQA 4ID1A 4FCYA 3L2QA 4KO0A 2JLEA 3LWMA 2UVWA 2YNIB 3HP6A 4O3NA 4FZZA 1IKYB 3BQ1A 4HTUA 5KRSA 4BE1A 1NHUA 5DQGA 4OL8A 4CJVA 2D3UA 3L3VA 1W0HA 3MXIA 4KE5A 4IRKA 2CKWA 2ZE2A 3OHAA 2E9ZA 3I8DA 3K2PA 4ZP6A 4TYAA 3LALA 1JLBA 1SH3A 2UUWA 5CYMB 1S97A 4DEZA 3DLKB 4DF8A 1S9FA 3AO5A 3OL6A 4KHUA 2P5OA 4AHSA 4CJ4A 1J5OA 4NLSA 4MH8A 4CJQA 2FLPA 4ECTA 4ZPDA 4TQSA 2I5JB 2PZSA 1UWBA 3IGNA 3MEEA 4H4OA 4OLAA 3K5MA 4FJLA 2D41A 3VQ9A 2EHGA 2ASJA 1T94A 1KSPA 2BGGA 1WSIA 1HRHA 1S6PB 4CEZA 1ASUA 4M45A 3D5MA 2YNFB 5KG3A 4DQRA 1NK5A 3NFAA 5D3GA 4LSLB 4CGGA 2BR0A 3M8RA 3I5AA 3SZ2A 2KFNA 3CO9A 2AX0A 3HM9A 4ECWA 2ILYA 1BQNA 2VG5A 3KK3A 4XO0A 3SYZA 1EP4A 4CHQA 3TANA 2ASLA 2RDIA 3QO9A 1QSSA 5J2NB 1Z25A 3CJ4A 4K8ZA 3RMCA 4IQXA 4J9KA 1JLBB 3T5LA 4WE1A 3ZSZA 1N6QB 2DY4A 3AO4A 3DLBA 3SI8A 4FJ7A 3TAMA 3UIQA 3T5KA 2IC3B 5CY4A 4K50A 1X9SA 2IJNA 4RW4A 1C1BA 1RT4B 3ISND 1NOZA 5FROA 3U3YA 2HHSA 5EWFA 2O4GA 1TP7A 3BREA 3DOKB 3BSCA 4NLTA 3QYYA 3CG7A 3NF9A 4B9VA 2V0NA 3S3NA 3DM2A 3B6PA 4KV8A 3DLEA 4F2SA 2WOMB 4CEQA 5KFDA 2DTUA 1VSKA 4Z4GA 4J2AA 5KFFA 1RYRA 4MFBA 4ECVA 3LP1A 4ED3A 5J2QA 2IMWP 3OYIA 4RW8A 1JLAA 1JXEA 2YHAA 3DRRA 2D7SA 3OLBA 4FM2A 5I3UA 1DTQB 1S49A 3OLAA 3JYTB 3OYNA 1TKTA 1FK9A 3KD5E 4ZVEA 4KB7A 5KG4A 3H4DA 4M3ZA 3RAQA 4ECSA 1S1XA 3OYFA 4CGJA 3FQLA 1ZBHA 1C1CB 5F8JA 5KG0A 4YR3A 3PW0A 3DRPA 5DQIA 3D0PA 3G0ZA 4Y1DA 4JS4A 1MU2B 1NJWA 3MXJA 3BDPA 4ID5A 5KFNA 3QEVA 3KOAA 4W5QA 2HNYA 1EX4A 3FFIB 4TY9A 4ED2A 3QIPA 4EYHB 5J2PA 1JLAB 1J9AA 4ELUA 1TL1B 5KFKA 2WK4A 3Q8SB 3RRHA 4H4OB 1XHZA 4CJ3A 4KTZA 4DL7A 2BRKA 2E6MA 1RTJB 2P1JA 4CK2A 3ZSRA 4B8AB 3IG1A 1KVCA 2Z1IA 4FW1A 3V9WA 4CHZA 4QWCA 4DS5A 1HJRA 2FC0A 3KLHA 4WFZA 5KFIA 4I2PA 2YNHA 5KFRA 4G1QA 3AVBA 2VG5B 4H8KA 1KLMA 4NLUA 3LPTA 1RTHB 3AVAA 4JV1A 4RW6B 1T7PA 4E89A 4M3RA 2IM0A 1XC9A 4DTOA 4FM1A 1NK8A 3SI6A 4IG0A 3VA3A 4M94A 5CZ1A 3HVAA 3RB6A 4JLHA 4ZVHA 2HNYB 4FBTA 2VG7B 2KTQA 3DLGB 3VQ8A 1RT7B 2IC3A 4DFKA 2AWZA 1C1BB 3QETA 4FJMA 3IN5A 4NLRA 3OL8A 4PY5A 3QGGA 2AJQA 4CJ5A 1U4BA 1VSMA 2G8FA 4KRFA 2O5DA 3G6XA 4KAIA 4B9MA 4KKOB 1NHVA 2LSNA 4DTXA 1OS5A 4Z4CA 4EP5A 1C1AA 1X9MA 1RBUA 4M3XA 4XPCA 4N56A 4HUGA 4I2PB 2HHUA 2XI3A 1SL2A 1ZBIA 2RF2A 1KLMB 1TAQA 2OPPB 1LW0B 4WE1B 2ETJA 4CHYA 5FRMA 1A5XA 3SFUA 3UDLA 3PZPA 5JS2A 2Z1HA 1JL2A 3C6TB 2FVCA 1S9EA 3EY1A 4J2DA 2PY5A 3M8PA 3L2VA 2FLNA 4K4SA 3RRGA 1SUQB 5I42A 1T03A 4BWMA 1C0MA 2IJFA 3ITHB 3LDSA 5I3UB 3C95A 1ASWA 2FBVA 1U09A 4DFMA 3SV3A 3PO4A 4F3TA 1KVBA 5KFPA 1Q8IA 3NGDA 3S3MA 1HQUA 4CEFA 3OYAA 3SCXA 2XY8A 1WNEA 5C5JA 1REVB 3G6VA 3E51A 1RCHA 5J2MB 3OSNA 3I5BA 4O3PA 4ZP8A 4DTPA 3QLHA 1A5VA 4H4MA 3AVLA 3LAMA 3TAGA 3ZSVA 3BSAA 4ZTFA 3L2UA 3TAPA 3VQBA 3QNNA 4FS1A 4PQUA 4DTUA 1TV6A 1UWBB 1KHVA 2BQ3A 3SQ0A 3L2RA 3HL8A 2KZMA 1U49A 4QPXA 3BQ0A 3OYDA 3VN5A 1QSYA 1T03B 4I7FB 4M41A 4U6PA 4G3IA 5KFJA 3B6OA 1RTIA 4FJ9A 4YP3A 5E41A 4KHWA 2W7PA 4EBEA 2ALZA 1S1WA 3PUFA 5KFYA 1BQNB 3CM5A 4ED0A 1IKVA 3AA2A 3H5XA 3HVTA 1QAIA 1RTDA 1CXUA 2AGOA 3DYAB 2YNHB 1HQEB 4O3QA 1ZTWA 4DFJA 5HLFA 1N4LA 1J53A 1D9DA 3LANA 2GIQA 4OKJA 3N6NA 4CF2A 3NE6A 1RBTA 4FJJA 4RNHA 2FVSA 4Q0BB 3OHBA 1X1PA 4I9QA 3KLIB 5KT7A 3L3UA 3VQ5A 4Y3CA 2O4IA 4DF4A 4B08A 1XR7A 4FYDA 4O0IA 4PUOA 1IKYA 3C6UB 4URSA 4KTQA 4NRUA 4DQIA 3AVNA 4G1QB 2WCXA 1JXLA 1ASVA 1X9WA 3NAIA 4FJIA 4EEYA 2XY5A 2XGQA 4ZPCA 4E1MA 3HO1A 3A2FA 4F4YA 4BDZA 5EDWA 2BQRA 2WONA 1UOCA 4FLWA 4ED8A 3SUQA 5J2QB 4CJWA 3CFPA 1C6VA 1TKZA 4CEBA 2AX1A 3DRRB 3THVA 3MAQA 4LQ9A 4B8CA 5CYQB 1IM4A 4RNFA 4E7IA 3VQQA 4IBNA 4TYBA 5L9XA 4XPEA 3AA4A 2HAIA 4KKOA 4DL4A 4CGDA 4NLPA 1VSLA 4DU4A 3V6JA 4E7HA 4R5PB 3N6MA 4URQU 3O3HA 4E7JA 3TABA 2Z1GA 1S1VB 2B6AA 4DTSA 4M42A 1EP4B 4ZPBA 3EZUA 5DK5A 1I3AA 1KVAA 5J2NA 2R2SA 3KK2B 4I9LA 1RT1A 1JKHB 1DTTB 1BCMA 4Z0UA 4IG3A 4TSXA 5K14A 2XI2A 4IRDA 4B9SA 1N48A 4CJRA 4TY8B 4IOBA 3PW5A 3OYCA 1RT6A 3CFOA 3LZIA 4J9OA 3IAYA 3V9ZA 4NYNA 5KFCA 4BE0A 5HBMB 2FJXA 2QE5A 2AQ4A 5DG8A 1BI4A 3S3OA 4K4YA 3NBPA 3IG1B 4ELTA 4RW9B 1RDDA 4FK4A 4F4WA 3SQ1A 2RKIB 5KGXA 4CF8A 4IDKA 3RBDA 3MTKA 3KLHB 4R8UA 3O3GA 1S1VA 4F50A 1RDCA 1TL3A 2J6UA 3TVKA 3NCIA 2WHOA 3V1OA 4O3OA 4DG1B 3PJWA 5DG9A 1NK6A 4ZHRA 1BQMB 3DRSB 1LWCA 2FVQA 2PYLA 1N5YB 1LAVA 2W9BA 3I0SA 1JX4A 2IS3A 1KLNA 4RU9A 2YNGA 1JIHA 1UAXA 1HYSA 4M3WA 1NK0A 2HNDB 5C25B 3VQ4A 3OS2A 1WSFA 1T3NA 2W7OA 3MEGB 1QUVA 4NLVA 3VQPA 2JEIA 3HT3A 2G8WA 3Q8RB 1B9DA 1NK4A 3PW2A 4KSEB 4BDPA 4XIUA 3VQCA 3V9XA 4FLXA 3ZSOA 5HP1A 5KFMA 2ATLA 3NL0A 5F8NA 2GV9A 2BRLA 3D28A 1VRUA 2W9CA 1NJYA 2X6NA 4IFYA 1TK5A 1L3SA 4HYKA 1SKRA 1TL3B 1VK0A 3GIIA 3EPIA 2W42A 3TAQA 3NH1A 5KFXA 4DG1A 4O4GB 1JLGA 5C42A 4ED6A 2V4QA 3RB4A 3SPYA 4RNOA 4MK8A 2OPQB 4Z4FA 2P5GA 3SQ2A 3CYMA 4B9NA 1O1WA 4DL2A 3KLIA 3ZT4A 1HYSB 4QWEA 3DI6B 3QESA 1SUQA 4CFAA 1G15A 1S6PA 4FM0A 1S0NA 1S0OA 1GX6A 1YVFA 5KTQA 4LSLA 3AO2A 3D45A 1QAJA 1RT2A 2GC8A 3OYGA 1CSJA 4QWAA 4OGEA 2HWIA 3UQSA 4KI4A 2KQ2A 3ZCMA 1S48A 4IKAA 4X2BA 4CFDA 1IKXA 3LP2A 3KMSA 2ATQA 2VG6B 4E3SA 2W9CB 2R8JA 3MECB 3QLHB 4Q5VA 1L3TA 1RTHA 4FW2A 3FSIA 4KHRA 4RZRA 1EXQA 5L1IA 1HNVB 3OS1A 2JGUA 3ZT1A 5F9NA 2W8LA 2DFEA 1WLJA 2X78A 2IAJA 1RBSA 1RT5B 1VSIA 4FLTA 5CYQA 1RT6B 3RWUA 1QQCA 4GC7A 2WTFA 1ZETA 3DOLB 1D8YA 1U48A 4W5RA 4BWJA 5EWGA 5KFEA 2IM3A 4NLXA 3AVFA 4N5SA 4OLBA 3LWLA 4U7CA 1HQEA 1RT1B 5KFTA 1BIUA 1NJXA 2GIRA 3MECA 4CEAA 4CK3A 4JV2A 4MFBB 5HRSA 1D9FA 1BL3A 3LP1B 4MK7A 4EO6A 4ECRA 1YTUA 3GIJA 1HPZA 4NCBA 3EYZA 5HBMA 3NGIA 3ZSWA 1KTQA 2YNGB 3V6HA 3T5JA 1NKEA 1BI4B 1LAWA 2DFFA 1VSHA 5KFWA 5SWMA 3WNFA 4KTWA 3T5HA 1JLCA 1FKPA 4ECUA 3KNAA 4IDKB 1JLQB 2HVIA 4ZVFA 2C2RA 4MIBA 3HPGA 5KRTA 4OPJA 1C1CA 3H2LA 3PY8A 2B43A 1K6YA 5JUMA 3ZT2A 4DLGA 2IA6A 4ED1A 2UVVA 3MR5A 4TQRA 3RR7A 3V81B 3VQAA 2C22A 4QOZB 2HHWA 1TKZB 1S5JA 3LP0B 2KFZA 3KLEB 4WFYA 3HVWA 2D0CA 2I1RA 2R8IA 4WXWA 1RT4A 1RBVA 1HARA 3IS9A 1T8EA 3AV9A 3HVRA 4CJLA 3DI6A 2GBZA 4I7FA 3OVNA 3SNNA 4CJTA 2YNIA 4IRCA 4OPKA 4NCGB 3ULDA 3QZ8A 3HPOA 4K4WA 3K5OA 5KT2A 4FJNA 5F8HA 4Q45A 1VRUB 3RMBA 1SKWA 5DQHA 3QEPA 2A1RA 4E1NA 3GQCA 1NNDA 4CFBA 2QKBA 3DLKA 3QEXA 1HNIB 1ZBUA 1D1UA 4EBCA 2AU0A 3IGVA 2HMIB 2J6SA 3SUNA 3ZT3A 1RDAA 1MMLA 3KKSA 4AILC 4DS4A 3V4IA 4C8NA 5DG7A 3RMDA 1K1SA 1L5UA 3PR5B 4CJFA 1S1UB 4O3RA 3V1QA 2ZKUA 3KK1A 4C8KA 4OKEA 3CJ0A 4IH5A 4WXOA 3NGYA 4CEEA 1LWFB 4CJSA 1YTAA 3GIKA 3N6LA 4O5BA 4C8MA 4FVMA 3PX6A 3L2WA 3HHKA 3AVJA 3MR3A 1BHLA 3LZJA 2E6LA 2XY6A 1EETB 1BIZA 4K8XA 4GW6A 4RNNA 3OL7A 2RF2B 3KJVB 3KK3B 4WYWA 2OH2A 4B9LA 1TKXB 3M8QA 4TXSA 3RR8A 2OPRB 3IRXB 2G8VA 4ZHRB 5DLFA 1HNIA 2ZQBA 2XGPA 3DLRA 3DRSA 3ALYA 3MXMA 3NHGA 4J9MA 3E01B 4ECZA 2HMIA 2I5JA 2WONB 1RDRA 3CJ3A 4OGCA 5T7BA 2E4LA 1S1UA 4MIAA 4NCAA 4J9LA 1JLEB 1D0EA 3AO3A 3MEDA 3G10A 2YNFA 4O44A 2B5JA 5C24A 1Q9XA 1GX5A 2XRIA 3UR0A 2HNZA 1VRTA 3DOLA 4DU1A 4MQ3A 1HQUB 3H5SA 4MK9A 4R0EA 4J9PA 1REVA 3MFIA 5F9LA 4KAZA 4E19A 1BCOA 4CJKA 1HMVB 4DFPA 2EC0A 3TARA 3O4QA 5KG6A 5FDLB 2JC0A 4F4ZA 4NLWA 5KFGA 3K58A 3QZ7A 1NOYA 4FJHA 1JKHA 1JLGB 4DLEA 3Q8PB 2FVPA 3PVXA 4FLVA 3QGHA 1RAJA 2F96A 3PR4A 2OZSA 3MR6A 4ZP7A 2IDOA 4Q8EA 4RW4B 4TY8A 1Y97A 4ZTJA 4BDYA 3OYJA 4KO0B 3NAHA 3TR8A 2V9WA 3MEDB 3HSTB 3OYBA 2BANB 2B5JB 5C24B 1IO2A 1VSJA 2HNZB 5KFBA 2FBTA 3SJJA 4LSNB 1C0UB 1S1TB 3OYHA 2ZE2B 4CGHA 4NLDA 3K5LA 3NH2A 3MR2A 5KFHA 3M9NB 2RDJA 4Q43A 3KMQA 1FKOA 1TK8A 4PA1A 1T05A 1SV5B 3V6DB 2Q3SA 4CIGA 4ZMMA 1ITGA 4KBIA 3NF6A 4RNMA 1A5WA 3OY9A 5KGWA 4RW8B 1LWCB 4ID5B 4YR0A 1N5YA 2JC1A 4OVLA 4NZ0A 5KFSA 1I39A 3M8PB 4KHMA 3MEEB 4L8RB 1CZ9A 3AVHA 4TN2A 3SQ4A 3QIPB 4HVJA 3AA3A 3CJ2A 2OPSA 4W5OA 3RAXA 1B92A 4CGFA 1IG9A 3ITHA 3T19A 3KLFA 3OJSA 5D3GB 5JXSA 2OA8A 4WFXA 5KG2A 2WB4A 4O55A 3F73A 1TGOA 1LWEB 2J6TA 2XCPA 2DPJA 3CWJA 1JL1A 1JLFB 1WN7A 1YVUA 1QTMA 4KPYA 4WZQA 1SL0A 3QNOA 2XY7A 1EETA 3PW7A 4IFVB 3DRPB 5HP1B 4NLGA 2V4RA 2QXFA 3VQ6A 1MU2A 3OYKA 4FLZA 2DFHA 2BQUA 3OL9A 5EU7A 4KI6A 3AA5X 3V6DA 3HKWA 5DLGA 3M8SA 3V4IB 1B9FA 4DU3A 5J2PB 2HHVA 5EUHA 4PQUB 5EWEA 4MKAA 2UVUA 5KT6A 4M3TA 3RBEA 4CJPA 3OJUA 4QCLA 1GOAA 4FJGA 3SV4A 3ISNC 3CJ5A 4KB1A 4JRQA 3EZ5A 1FXXA 4DQPA 2R8GA 3WNHA 4NLYA 2Z1JA 4R5PA 3U3GA 4LH4A 4OJRA 4FK0A 1JLQA 4EO8A 1RNHA 2NUBA 1IKVB 1Z26A 4RG8A 1S6QB 3HVTB 4KHYA 3SPZA 2FBYA 2YKMA 4ECXA 2VG6A 4QW8A 4AHVA 3U6FA 3OYEA 3ASMA 1TAUA 4DSFA 4NLQA 1S4FA 4Q8FA 2JEFA 4CESA 3DMJA 1HNVA 4EZ6A 5DMRA 5HROA 3CIZA 3VQSA 2BDPA 3NH0A 4FZXC 4CJEA 1VSFA 2HB5A 1K1QA 4Q0BA 4CIEA 3VQ7A 4EBDA 2KW4A 3L8BA 1CLQA 3IS9B 4CE9A 1WAJA 3M9MB 3MF5A 3NBPB 4FK2A 1FK9B 3QIDA 3OS0A 4BACA 1XI1A 4MKBA 1KCFA 3BQ2A 4UQGA 1QE1A 4NCGA 2BE2A 4PUOB 2DPIA 1LW2B 4FLUA 3VQEA 1U47A 3HK2A 3BGRA 1SH0A 2QV6A 1C0UA 4RUAA 1LW0A 2X74A 5J2MA 3NDKA 1ZYQA 4KHNA 4KFBA 1FKOB 3Q8QB 1S9EB 1L3UA 1S9GB 1Z4UA 1TKDA 4DSJA 4K4ZA 4URGA 5F8LA 3CDEA 1WNSA 3CDUA 3ZSXA 3ZT0A 4PWDA 1WSGA 3KTQA 3NF7A 1TV6B 3AVGA 3HP9A 5I42B 4C8OA 4NYFA 2Y1JA 2FJVA 4AHTA 2BANA 2HVHA 4E7LA 4CF1A 1LWFA 4AHCA 4KHSA 4ZPAA 4HUEA 3KLFB 4IKFA 4W5TA 4DL5A 4I2QB 1JXBA 3S9HA 4DTRA 4EZ9A 1S1TA 1HYZA 3QIOA 4AHRA 2YHBA 4Z4IA 2B6AB 3JSMA 4QAGA 3ZSQA 4IFYB 1RTDB 1WSJA 4K4XA 3TI0A 1T05B 3RMAA 4DWIA 1R0AA 4J2BA 3IRXA 3AVMA 1D5AA 1S9GA 4CGIA 3TAEA 2FLLA 5KFLA 2G8IA 4CCHA 1XR6A 3ICLA 3K5NA 3MFHA 1LV5A 4O44B 4O4RA 3GV5B 4ED7A 4LD0A 3HJFA 3JYTA 4J2EA 3K59A 5HRRA 1QS4A 2XHBA 4DQQA 3RTVA 2XO7A 3ZSYA 4RUCA 4J9RA 4CF0A 4YQWA 5L1LA 4IFVA 3QEIA 5DGAA 2E9TA 4R8UB 3NMAA 3JSMB 4N41A 3KHHA 2D0AA 5CZ2A 2Y1IA 2C2EA 3HYFA 2OZMA 4ZP9A 4E0DA 3OYMA 3BR9A 1CXQA 5JS1A 2EX3A 3H08A 3OSPA 1N56A 3NF8A 1U04A 3GILA 1RT5A 4F4XA 2JEJA 4ICLA 5F8MA 4LY7A 5KT3A 3RB0A 3KK1B 4DTNA 3V9SA 4EP4A 1C0TB 3SUPA 5KFUA 3CQ8A 3KIOA 4K4VA 3C6UA 4BE2A 4CJUA 3FQKA 3V6KA 4O0JA 4K4UA 2HWHA 1QE1B 1S0MA 2GUIA 4IH7A 2D0BA 1GOCA 3VQDA 1NKCA 2G8KA 2W9AA 3KJVA 3T1AA 2YKNA 3FDSA 3AO1A 3M8QB 1RYSA 3KKRA 2C2DA 3P83D 1SV5A 4E7KA 5F8IA 5HROB 3QINA 2W8KA 4WYLA 5K14B 5KI6A 4KHQA 4FJ8A 4RW7B 1WAFA 2VG7A 3P5JA 4Q44A 4O3SA 1RT7A 4CHPA 3BSOA 4ECQA 4YR2A 3I0RA 4B9UA 4ECYA 4F2RA 1JLCB 4DSLA 1RTIB 1SL1A 2BE2B 2IM1A 4Y2CA 2E9RX 4N76A 4NYZA 3O3FA 5KT4A 2A1SA 1YT3A 4FXDA 1IKXB 3LP2B 3SUOA 3DYAA 1NK9A 1BISA 4KFBB 4H54A 1J54A 5HLFB 1UA0A 5FDLA 1RA7A 3GIMA 1J5OB 1W25A 3C94A 2XCAA 3V81A 4QWDA 1NKBA 1RBRA 4YNQA 3LP0A
chains in the Genus database with same CATH superfamily
4RW7A 3O44A 1Y10A 2HQIA 4YMEA 4CM2A 1DLOA 2YXLA 2OANA 1ESVA 2AJFE 4ILGB 1NDPA 4J9VA 4F4KA 4DU8A 3MEGA 1NGBA 3KLGB 2I9SA 5GAHP 4FS2A 3GB0A 4KHPF 3DC2A 4DCPB 2EXUA 5DDRC 4OX9F 4PXDA 2RMLA 4QWBA 4X4NA 1GOBA 4K25A 3CCWA 1DZ5A 3KHGA 3CDBA 2RB7A 3AVKA 4QYRA 2F9JA 2CJKA 3T1HF 3A8EA 2NRVA 4KH6A 1EHWA 1HPZB 4BVPA 2FVRA 4G1PA 1HW8A 4JRPA 3SMPA 2LXIA 2QC3A 2RRNA 4NRTA 3WNEA 3SDEA 2A0FB 2LDYA 5CD4A 4A59A 3C7NA 3H40A 1OYEA 1KVKA 3RAMA 1C0FA 4OHXA 2G8UA 4CO2A 3POTB 1RTZA 2OO4A 5ETLA 2ZZMA 4CO1A 1TFWA 3IA0A 2P9KB 4USUA 3TZYA 5BPNA 2FJWA 1HI1A 1DTTA 1M5PC 1KD1T 4CM0A 1RJJA 4NYPA 2HF3A 4JS5A 1CJVA 3KDOA 2D5RA 3U27A 3LTOA 3JSYA 2HLTA 5C0YA 1A9NB 2OEJA 4ICLB 4PWDB 1Y00A 5GINA 2RQCA 4N77A 4BS2A 1HWLA 5CHIA 3TEHB 1AROP 4B3SF 1VBKA 3WNGA 3ADAC 2XC9A 3UE2A 1B0PA 1VQNN 3ET6A 5HATA 4DU7A 4L74A 3C46A 1VSDA 3CQYA 3TA0A 4Q2MA 3VEOA 1KFDA 4ZVRB 5KG5A 3MOZA 3U1LA 2CAJA 1FERA 3C15A 4I56A 1RGVA 2R2TA 3NGZA 3VAIA 3OTEA 2M7SA 2YQ3A 1HR0F 1IKWA 4CZLA 3QRQA 2FQQB 3NMUA 2KZZA 3FRZA 2W4PA 2X1BA 4K8RA 5KFQA 5BR8J 3F9MA 4KREA 2CPZA 4OZ0A 3P1GA 3LPUA 4QR2A 3DOKA 1DRZA 5DDQC 2CQ4A 5KFOA 5SZTA 1URRA 1SH2A 4PKGA 1GNKA 1CVJA 1MROA 2LQ9A 4B3MK 2IMOA 4KV8B 1QSLA 4FBUA 1ZBFA 4Z4HA 1HNZF 3PHEA 2LA6A 2EFPA 3GR1A 1NDKA 1U26A 3RYLA 2FHJA 2YX4A 2CJQA 4IG0B 4DSIA 4C11A 2AP1A 3UPFA 3C14B 5KT5A 3GFYA 3CD5A 1WSHA 2H48B 4MO5A 3C16A 5HO4A 3T3FA 2R7WA 1V5IB 2WTUA 4LQ3A 4M95A 4P7TA 3RBZA 3GP9A 1NRKA 2LFVA 3G86A 3WXIA 3JB9k 1RDBA 4HKQA 3LOUA 1YUWA 3UB5A 4RL1A 3PO5A 5FRNA 1HFEL 4GVMA 4A5BA 2BOAA 2OTLS 4IH6A 2ZD1B 3H4BA 2EBEA 2VA3A 1GLLO 1HQ2A 2A42A 3O1WA 1I94J 2CWKA 3W5YA 1LOUA 4ZK7M 2PMWA 2UVRA 3IR5B 4CIFA 3VAMA 3OPKA 1HR0K 2VWJA 4OLOA 2NS1B 2VFVA 4P75A 3LWMA 2OCEA 2CRLA 1FTRA 1YITS 3QBXA 4L3KA 1IKYB 3N28A 2OD6A 1NWKA 3MXIA 4IRKA 3I8DA 1H3DA 1IG8A 1SXLA 4TYAA 2UUWA 4NWBA 4DEZA 1S9FA 1HNZK 3CMES 2P5OA 1TL4A 2A2DA 1E3MA 2GWJA 4TVAB 1UAWA 2P9UA 1NO8A 1UVLA 4DR3J 4PKIA 4MYUA 5K5MA 4USJC 4DDFA 4LF9F 1M5KC 1ASUA 3D5MA 2CUYA 2CQIA 1YI2N 3B4DA 2IY5B 1U2RA 4OYBA 3M8RA 3SZ2A 2KFNA 5E2QA 2ILYA 2VG5A 2MSSA 1NGJA 4BRKA 4XO0A 4CHQA 2E5HA 2RDIA 3QO9A 2ZC3A 4GKKK 3ISZA 2EFOA 3RMCA 1FFWB 3CT9A 1JLBB 4MDAA 4JI4J 1RBAA 5B7WA 3VZIA 2FHJD 3AO4A 4MLHA 1P8ZA 4CI6A 2QWPA 3TVYA 1OH7A 3U7JA 4A2BA 4K50A 4RW4A 5FLXU 1BU6O 3ISND 1HPMA 5FROA 2HZVA 2DXFA 1FRMA 2MLXA 1R89A 1TP7A 3BREA 1GEHA 1FESA 3US5A 2QLFB 2NNWA 1IR2A 2CADA 2DEIA 1WTBA 3THPA 3MI7X 3U9ZA 5CAAA 3B6PA 5ETOA 1K44A 2IVYA 2GMHA 2CPFA 1OQ3A 5KFFA 2PDAA 1RYRA 2AEJA 4I0WA 4LRCA 1VQ4N 2IMWP 4RW8A 4FVUA 1V3SA 1FRHA 4PG8A 4DUZJ 5I3UA 2ZJQQ 4F3MA 5IFMA 2KXNB 3JYTB 3GSDA 5KOWA 2KKZA 1PKUA 2B4PA 4LF8J 3KD5E 4KB7A 4K0KF 1G3OA 1X5SA 3NGRA 5KG4A 1GQEA 1RBLA 1VQ6S 2DD8S 3PFOA 1S1XA 4OYOA 1ZBHA 1WHYA 1C1CB 3AJ2A 5F8JA 3EVOA 3A5MC 5AQJA 4JS4A 2J0QD 1YTYA 2P9SA 1JJHA 4ZIWA 1GMUA 3CCTA 3QEVA 4WQ5A 1GLFO 3CCQS 1XNQK 2B0GA 4EYHB 5J2PA 3TZZA 4M5JA 2GW8A 1Z2LA 4CT8A 2N4DA 3MMVA 4KTZA 1Q0NA 4PQAA 4CK2A 2BBEA 3ZSRA 2DR7A 4KY3A 4CHZA 4QWCA 2XB2D 2YX1A 3QATA 2PEHA 3KVGA 3KLHA 4DR7J 3AVBA 4GV9A 5K8MA 1UL3A 3FZMA 4ANDA 4H8KA 1KLMA 4BLGA 3LPTA 4OQJA 4JV1A 2P9NB 3HZ6A 2WVCA 1F2GA 4M3RA 4FM1A 1NK8A 4M94A 1FEHA 1CJVB 2VBWA 2ZOGA 1KAXA 2J9CA 1UPMB 4OHZA 1RWPB 1RT7B 2BUNA 1UVMA 4WYBA 2C2OB 5IWAK 3BEXA 1MMDA 2YWKA 2O8DB 1S6OA 2AJQA 2NPFA 3R8EA 2O5DA 2ZGZA 2D69A 1HKAA 3K5PA 1NHVA 4Z4CA 3JTOA 1NDCA 3BZCA 3TJ8A 4AD6A 1RHUB 2XI3A 2RF2A 2IYGA 1KLMB 1TAQA 2OPPB 1KQFB 4BC9A 3W2VA 2PI5A 4CHYA 1A5XA 4IFEA 3UDLA 3CJRA 1HBUB 3QQCD 3M8PA 4MT1A 3DRYA 3THTA 3LL3A 5A8KB 3ZTQA 5BYSA 2ZM6K 2QGFB 2FLNA 2E1AA 4CT9A 1N0UA 3BDEA 3MX2A 3C95A 3JTNA 4DFMA 1X4DA 1Q8IA 4WK3A 3WC0A 3NGDA 4KHPK 5ETQA 4CEFA 3SCXA 3TTDA 3W8PA 5C5JA 3G6VA 1RCHA 2PMZD 3OSNA 2B3TB 1IJFB 1RKJA 1RB0A 4O3PA 2QEXS 1Q95G 3LAMA 1H98A 3OA9A 3AAPA 2QLWA 3W5ZA 3C2PA 3EICA 1V5VA 1F5AA 1YQHA 4FS1A 3LA0A 2BQ3A 2GVDA 5CR4A 2KZMA 4JI2K 2VWBA 2V4JB 3CERA 4U6PA 5KFJA 3G82A 5CZVA 3HHDA 4FJ9A 5BN9A 2OP5A 4EBEA 3IWXA 4EFAC 2BJ3A 2YCHA 3PFEA 4CO3A 1SC4B 4DUYK 3LDLA 1HQEB 1KONA 5A8WB 3D9BA 1QD1A 1ILYA 2WFBA 1BOTO 4B17A 1U1NA 2NRWA 3D67A 1W7AA 2E1YA 5B0FA 3FEZA 4N7TA 2FLOA 1NSKL 1X3MA 1EAYC 1RBTA 5DO2A 1CJUA 4I68A 4KGZB 4Q0BB 3OHBA 3CCMS 1HKBA 3BR8A 2ZVSA 4FXWA 2HAFA 3FUYA 4OI4A 1KC8T 3H90A 1MW7A 3L3UA 1D8ZA 3OTOK 3M6UA 5AFUA 4O0IA 4ZA1A 4PUOA 2VICA 3UCZP 4OYPA 1F3FA 5AZJB 4DV6K 4F0KA 1X9WA 3K0SA 4CDIA 3R6GB 3A2FA 5CQGA 1IBKK 1TL7A 2CGJA 4BDZA 1O8BA 2WONA 5D77A 1APSA 1U6FA 4ED8A 1RADB 4CJWA 3CFPA 4U8YA 2XYPB 1U2VA 1UMJA 2KDOA 1XC3A 1RGIA 3MM6A 2QTWA 4IBNA 3CF5Q 2HAIA 4DU4A 2Y9HA 1VSLA 4CZGA 3ZZ0A 2AJ0A 1DBDA 2G2OA 1X7VA 1RAGB 3N6MA 2O67A 2MY8A 4DTSA 3VEVA 4K2JA 4ZPBA 3EZUA 1I3AA 5E3AA 1JKHB 3QICA 1BCMA 4J8FA 1GLCG 2N82B 4LFCK 3MD3A 2DIVA 4DV2K 2ZBRA 4ZLJA 4CZHA 3OYCA 2VGMA 1WG1A 2YHWA 3LZIA 5T41A 4J9OA 5KFCA 3MM5B 2I38A 4JI8F 4CW7B 1T95A 3IM9A 4B3TF 2BJDA 5DG8A 1BI4A 1U1RA 2Q36A 3IG1B 2W4DA 4ELTA 1KD1O 1OH8A 3TNVA 1C4AA 4F4WA 1SQFA 2V94A 2RKIB 3SQ1A 5KGXA 4R8UA 3FCVA 3IUCA 4LF5F 3MN5A 2VL1A 2L08A 1RDCA 4B02A 5K8OA 1KDNA 3W9JA 2W7AA 4WFBQ 3PJWA 1SIWB 2UXDF 2MHEA 3DRSB 2FVQA 4JB8B 4RTFD 2PYLA 3KJNB 3I0SA 1JIHA 5C2CA 2HOEA 1HYSA 1NK0A 2A6OA 4P2MA 2Q31A 2HGMA 1ZA1B 3KG1A 2JEIA 2G8WA 1NK4A 2R7XA 4XIUA 3L7UA 3VQCA 3V9XA 3RGIA 3I6PA 4BRFA 5ETSA 4FLXA 3NL0A 5F8NA 5TKYA 2BRLA 1PSDA 2X6NA 1FD2A 2R9LA 2H9ZA 4HYKA 1VK0A 2UXCK 1KQSR 2QWQA 3AA9A 3QRRA 4CJ7A 3I87A 3ETOA 2VQFK 2XS2A 1UETA 4WF9L 1BA0A 3BGFA 1N34J 1Y9OA 3SXLA 4B9NA 1O1WA 2NYHA 2P2CB 3KLIA 1YJWN 2ZBQA 4UOFA 3DI6B 3QESA 2E1RA 1NGAA 4FM0A 4OZ1A 3FZHA 1YVFA 2HIQA 3FNNA 5KTQA 3AO2A 1FDAA 1X9JA 3PIPQ 1RT2A 3O9TA 3FLCO 1FXDA 2HBLA 5AQSA 2HWIA 2HRYA 1EWRA 2ZDOA 4CYUA 3FFKB 4QIVA 4E3SA 3HFZB 3BBFA 2DJWA 1HHTP 1BDGA 3FSIA 4KHRA 2ZITA 3K7RA 4M7YA 4EGLA 5L1IA 1HNVB 2IIHA 2VIHA 4LFCJ 2JGUA 4UUXA 3ZT1A 2PT0A 1WLJA 2X78A 2IAJA 1U1PA 2AYMA 5A76A 3TW0A 4C0BA 2QWLA 1TELA 3VPZA 3UVJA 3K17A 1PBUA 4P2FA 4GC7A 3UNGC 1Y5NB 1EJ7L 1ZETA 1D8YA 2F4VF 2KHCA 4BWJA 5GAHU 2FHKA 1FVQA 4UT4A 2MZRA 4WWSA 1WORA 2HVEA 1RT1B 1YRUA 4HH1A 4CEAA 2O8FA 3MM9A 2O01C 4OI0A 1VBZA 4MK7A 2Y8WA 1PYOB 1AFJA 3GIJA 1HPZA 1IBKJ 3AODA 1QAXA 3N4WA 4JI6F 3CIPA 5HBMA 3ZSWA 1NSQA 1NKEA 4DV6J 2O8CA 5KFWA 2GVZA 2FHOB 1P1LA 3DAWA 2CH5A 2ADBA 3KNAA 2HVIA 2DKOB 3NXZA 2FSKA 2QA1A 4MIBA 1WF2A 3OTDA 4QS8A 1C1CA 3FGUA 1KVIA 4QU7A 5AR0A 5JUMA 2PN6A 1U02A 4RWTA 2DHAA 2IA6A 3BYPA 5M1OA 5KPZA 2O8FB 1VBYA 3RR7A 4B3RJ 4NYOA 2UU9J 3V81B 1WOQA 3M2VA 3BB5A 3W63A 2AJ2A 3HVWA 2D0CA 4OI3A 2RRBA 1K8AO 3RUBL 3SNNA 1ZBSA 4CJTA 1RHKB 3TJAA 4ANCA 5MLCV 3MN9A 3NS7B 3QZ8A 2HHHF 1H7XA 3T69A 2F4VK 1VGYA 1NMDA 1S79A 3RMBA 1SKWA 3LGMA 2A1RA 3R6LB 4E1NA 2CZ4A 1NNDA 4DOZA 4IJAA 1YKWA 4EU0A 2QKBA 1X4FA 1NGEA 3QT6A 3THYA 3QEXA 1HNIB 2FYXA 1FO1A 3ZT3A 4OHVA 4CJFA 1YBAA 4ZVTB 1FNOA 3BH7B 3CCUN 3EUNA 4IH5A 3VGTA 3NGYA 3SAGA 3GIKA 5E84A 4BHQA 4FVMA 4C8YA 1YLXA 3EGWB 4BC7A 2HMPA 4AQYF 2V7YA 2UV8G 4GW6A 4RNNA 1NPPA 1PYSB 1VQ7S 2RF2B 1RI7A 3OR2A 2WB1D 5AT1B 4B9LA 1C0GA 1PCAA 3A13A 3JQMA 5C12A 3IRXB 4KH1B 4JV5F 3MXMA 1K73T 2QN6B 4C0HA 2I5JA 2WONB 1WC3A 1FA0A 2BYCA 3Q8VA 2OELA 4JKGA 4MIAA 4K0KK 5JLHA 1PJ5A 4CH7A 1F3VA 4NO7A 2FY8A 3G10A 4O44A 2B5JA 3L6QA 4NA3A 4JI5F 2AZ1A 3DOLA 3W9HA 3FGVA 2CFXA 1IWGA 3JTPA 5FPDA 4R0EA 5FPEA 1U0SA 2UU9K 2DR6A 3N0VA 2HHHK 2IVNA 4KAZA 3SAFA 5AQIA 1V3RA 5D78A 3HRGA 4M1KA 5FDLB 2JC0A 1VK3A 4NLWA 5KFGA 3P6YC 4FJHA 1JKHA 1JLGB 2H5JB 4BRLA 1RWUA 3G6EN 1K0TA 3QGHA 3AXKA 4AYBD 5C2GA 4Q8EA 4JK7A 4K2XA 4OIXA 1FT8A 4ZTJA 2YI1A 2EFGA 3CCJN 2D0PA 4FWQA 4LF7K 4A62A 2KM8B 1IO2A 2XMVA 1VSJA 1S99A 3W2WA 2Q6BA 2HBZB 5M1PA 3T1YJ 3VTHA 3OD2A 1S1TB 3OYHA 1JNZB 2JZ5A 4O8UA 2RDJA 4Q43A 5HQ8A 3FMWA 2AEMA 3BO2A 2AW0A 3ULEB 4I64A 3FZ2A 4CIGA 1VISA 4ZMMA 1ITGA 1HKGA 3O9UA 3CB4A 3MGJA 4FYXB 2P9UB 3NVMA 4PRFA 4ID5B 4YR0A 2XWXA 1N5YA 4W98A 3VAFA 4OVLA 4NZ0A 5H9EJ 1I39A 1O51A 4IO8A 1PC4A 2Q0UA 4PKHA 4ED4A 4HVJA 2P9IA 3EJMA 3AA3A 2QX0A 1HBOA 3WX8A 1NPKA 4M7XA 3ITHA 3S41A 3EL2A 5DZ6A 5JXSA 4JKHA 2UYTA 3DHXA 2XCPA 4OPAA 2QWOA 1JLFB 1YVUA 4H0VB 3MR7A 2HFVA 4NLGA 2V4RA 2GHVC 2DGQA 4DMZA 2MQQA 1MU2A 4JKEA 4MMOA 1WC4A 2BQUA 4NMXA 4KI6A 5DLGA 5BXIA 2J9EA 3KXDA 2PFUA 4DXLA 3SBMA 5AXNA 3M8SA 3V4IB 1FRIA 5BRFA 3UD4P 5A2QY 2DXEA 3RBEA 3L95X 4FJGA 3SV4A 3BF1A 2A6MA 4JRQA 1ZM3A 3CGIA 4NLYA 4CVNE 4JI4F 2BJEA 3SIPB 5AQMA 2J7KA 5GMEA 3U3GA 4LH4A 1VDHA 4OJRA 4FK0A 1JLQA 4CH1A 4RR5A 1SAZA 4FWNA 1RHMB 2VQFJ 3I82A 3MN6A 2QJ3A 3VGLA 3I33A 4KHYA 3EZOA 1PILA 3EGVA 3HD2A 3ASMA 1AZSB 4ISEA 2HFNA 4CLUA 3TRGA 1M1KT 4Q8FA 3ULHA 3M5RA 3UW1A 1HNVA 1NU0A 2JFDA 4QYZK 2BDPA 3B78A 1TUVA 1VSFA 2HB5A 3VQ7A 3L8BA 2R7RA 2V68A 2E1CA 2H3EB 1YIJN 3CJCA 4ZVQB 4CZJA 3VWSA 4WU3A 1FK9B 4GO7X 4BACA 1XI1A 4MKBA 1P8GA 5E7OB 4UQGA 2DPIA 2AYBA 2OIHA 3HK2A 3ZETA 3DKDA 1C0UA 5H1SQ 3WDOA 4M5LA 2Z4PA 1XBWA 2PIIA 5J2MA 1YJVA 2E29A 4CLZA 1FKOB 3Q8QB 1S9GB 1Z4UA 2FTRA 3FK4A 1NM2A 5KQDA 3CDUA 1HNZJ 5D8HB 1X0PA 3O5TB 1WSGA 3M1VA 1TV6B 1BUPA 1YJTA 4C8OA 5I42B 1QVFR 1WUUA 2FJVA 4AHTA 3N4QA 5GAEP 2BANA 4R25A 4X62F 2FSJA 2U2FA 4CF1A 1NGCA 2ASOA 3MDQA 2H5IB 4KHSA 1SJQA 4F0HA 4I2QB 3BS9A 1R0BG 1FDDA 1R6VA 4DV2J 2YQ1A 3IWLA 2YHBA 4ZS6A 3RSEA 4K4XA 1YJ9N 4K7QA 3Q0AA 3AVMA 2F3JA 2MHNA 3A3OB 2GUPA 3EDQB 3A4TA 4X4OA 3M2VB 1DT9A 2FZCB 1ROFA 4M5MA 4BC5A 2VKZG 3D2FB 2GEMA 4H4KA 3QFUA 1VQSA 4O4RA 4JP8A 1SC6A 3D2EA 5TKWA 4J2EA 2IVPA 4PR6A 3QFWA 2CXEA 3CSKA 2VPZB 5KPRA 7FDRA 4QIWD 2VBXA 2K1RA 1WF0A 2FHMA 2Y1IA 1MSWD 5AE3A 4B3RF 4C9DA 2NZ4A 2MKYA 3O6QA 3BR9A 1UWAA 3AH6A 4UY8O 3THYB 3LDPA 3A3NB 4XH4A 2GFFA 4LF4F 2VUGA 5F8MA 4F67A 4LY7A 3RB0A 1VFJA 2HK3A 3SDEB 4OFZA 3V9SA 5GAEU 3JAMU 4HH0A 1BO5O 5KFUA 3KIOA 5AQGA 3C6UA 4KGVB 1B0TA 4CJUA 4JYAK 2Z57B 1UP1A 4O0JA 3CCVS 1VYAA 2G1HA 4PXEA 1T9TA 5BR8K 2D0BA 1GOCA 3OUYA 3C65A 2W9AA 1NGDA 3ZTSA 3AO1A 2VBZA 4KIAA 3P83D 1SV5A 3MX5A 4E7KA 2KVIA 5F3ZA 1TMJA 1WKLA 3P4UB 4FNIA 2R7SA 2MZQA 5K14B 2FZGB 4RW7B 1KOOA 2K7KA 3MPWA 4OJ3A 3VAHA 1WAFA 2VG7A 2GVDB 4TKTA 4DUZF 1PAEX 4Q44A 3CD6S 4BR7A 2XSJA 1XNRK 1RT7A 3ZXWA 1ZBTA 1G4CA 2JH3A 1YJRA 4P2XA 2E2NA 1RTIB 2FJBB 1SL1A 2BE2B 2LU2A 1PJ6A 2NXUA 2Q97A 5A8RB 3G87A 3DXMB 4WP9A 4LC9B 1VQLS 1BISA 1VAZA 3AT1B 4KFBB 1X4HA 1UFWA 1UA0A 1CS4B 3WZ0A 2M0GB 5FDLA 3PIPL 3GIMA 3E9OA 2ZH6A 1J5OB 5M1QA 4WIIA 3EXYA 4ETXA 4NXNK 1QHTA 1X4AA 4UZCA 1TVRA 3IM8A 1WC6A 4OYZA 1KQGB 2FBXA 3UFCX 4Y2AA 3GYNA 4DV5F 1YHQN 2YV0X 1S72S 1X4BA 2QK9A 2HNDA 3VR1A 3CCQN 4CI0B 2KO1A 3GV8B 1DY3A 4NLCA 3R3LA 3TAFA 4GC6A 2LQ5A 3IFRA 4NXMF 4FN5A 1RWXB 1A0OB 4FJKA 4DTJA 3DXMA 2YWGA 4FJ5A 1FJCA 4DR6J 3QEWA 1C2PA 4E8UA 2IRYA 5T14A 3ILOA 4GMKA 2VA2A 4BRDA 2IBKA 1WDDA 3DOMA 4IR9A 1WBBA 5F2RA 2ABYA 2ZZNA 3GL1A 1Q5YA 2DGVA 4DCJB 2OPQA 3OR1A 5C25A 2F9DA 1F60B 4OX8A 3PEHA 3O08A 2H5EA 2V2KA 2ILZA 1SJFA 1RTJA 4CHNA 2AGQA 3H59A 2HHTA 3N79A 4DX7A 4JAXA 2XS5A 1BG3A 5D0EA 3G4SN 4DV0K 3R6MA 2CPHA 2GNKA 2CQBA 4RO0A 5KG7A 4DSKA 2MMYA 3G6YA 4XK8C 4C8LA 4CLLA 5BPMA 2OYQA 3V9UA 2XMUA 2Y1RI 1N36J 4AHUA 3F56A 4OHYA 3F9KA 2OPRA 3ILJA 4DV4F 1U45A 4O4GA 1HYVA 2YKNB 2BOPA 3JXOA 4H5NA 3E01A 2DVIA 5BR9A 3MCNA 3ZZOA 1IKWB 2LEAA 5GAEI 4DL3A 4TU9A 3L3CA 2NLWA 2A2CA 1WD6A 2VBYA 3LP3A 3LH2S 4MAKA 1CJUB 3UI3A 3PV8A 1S59A 2HZCA 2J8SA 3SMSA 3FEXB 3L7OA 2HHQA 4GMJB 1XHXA 1U1QA 3UNYA 3JSBA 4Z4EA 5CCMA 3KG0A 3DGPA 4I67A 1OO0B 4LR7A 2X1FA 4M5IA 2MKSA 4OYAA 2R8KA 5IT9O 4DN9A 4H5WA 2Y8YA 3A5NC 1U24A 3VGKA 2UU9F 2DGXA 2UUTA 4N47A 2AGPA 3DU6A 4XEIA 3PW4A 4QR0A 4EYIB 3EPGA 3QO9B 1J5EF 3W61A 1OPZA 1JCEA 3C6TA 3WIUA 4EAHD 4M3UA 4J9QA 1CZBA 2I7PA 3VAGA 2F4FA 3I0SB 3WQPA 1TL1A 1LK7A 4CWBA 4LF8K 1BC6A 3BO4A 1OSDA 3I0RB 4AUKA 2UXBK 3FVYA 3GFZA 2M3DA 3I5CA 3WT0A 3G71S 4I6YA 3PIOQ 2LVWA 4ES3A 2BMBA 3D6HB 2R7QA 3VAJA 1HBNB 3MAAA 4Y00A 3ZFVA 2EWSA 4Y28C 1RT3A 1M90T 3IDHA 1LW2A 1W9HA 3BGRB 2ITGA 3VTIA 3FZBA 1QTNB 2GQ2A 4IO9L 2G2YA 3V1RA 4RW6A 5AQLA 3PX4A 3KK2A 2V63A 5G4DA 1EKSA 3K57A 1YF5L 1VC5A 4YFUA 4LH5A 4D3GA 1WKKA 1IH7A 3QMQA 1L3VA 5HRPA 1YWXA 1JLEA 2X1AA 3D1OA 2DISA 2MZTA 3RB3A 1C0TA 3H1VX 3NKYA 1RT2B 4K41A 5DM7L 1S1WB 1NMNA 4J9SA 1JLFA 3CDWA 2D3ZA 2EFVA 2RKIA 1TYQB 4Z7CA 4CK1A 3HULA 4BRAA 4IEIA 4HHTA 4GVBA 1NH7A 3O4NA 2P9SB 1WSEA 2R4FA 4JI0J 4GKKJ 3HHNB 1N5SA 2W9BB 2EEYA 3KLEA 4AH9A 2XSFA 3CQXA 2PC6A 5A2QU 2ERRA 4FCYA 1VQKN 2Q2RA 3ID8A 4KO0A 3L2QA 3O6WA 3PKYA 3IMQJ 4EI2A 3R5AA 3BQ1A 2FY1A 3FSYA 5KRSA 4BE1A 1IBKF 5DQGA 2RNEA 2HQCA 4CJVA 1R6YA 4RKUC 2E5IA 1TTHB 3OHAA 1P9YA 4FPRA 4ZP6A 1O6XA 1JLBA 1S97A 4DF8A 3DLKB 3OTCA 3BN4A 4LFAJ 2Q1LA 3GJTB 2P9NA 4MH8A 5JMVA 5H9EK 2FLPA 4ECTA 3UN3A 2HQGA 4I6AA 2PZSA 3R1XA 4X4PA 4OLAA 2CPXA 2DHSA 4NOHA 3MK6A 2EHGA 2ASJA 2E1PA 3AJ1A 1S6PB 2UUAF 2YNFB 4PG6A 1X4CA 3TSUA 5D3GA 4LSLB 4CGGA 2BR0A 1ICEB 2HVZA 1BQNA 3KWMA 3FSXA 3HDSA 3KK3A 4LFCF 4QS7A 1EP4A 4USKA 1IBMJ 2CA9A 4DR7F 1Z25A 1FJ7A 2O8BB 2OSQA 1WKJA 2AYEA 2BVZA 4JEPA 1QAYA 2KJWA 2O3DA 2P8IA 3CULA 4YY3F 4B3TK 2UUCF 1R8AA 4B3MF 3DLBA 1ZM9A 2UUBJ 3SI8A 1ZA2B 3TAMA 4O5FA 2IC3B 5CY4A 2BJ7A 2RU9A 3NY0A 2V8VA 1RT4B 1NOZA 5EWFA 4LMZA 4PYAA 5EN1A 1FDNA 2HZAA 5AQOA 2O4GA 2CQ3A 1K8AT 5A6WA 5ITHA 1YBTA 4Y2MA 5BRDA 2MQPA 3DLEA 1WTFA 4HL9A 2WOMB 5EX0A 1VK8A 3ZZTA 4NA2A 5LJWA 3CF5L 4P9SA 2LEBA 2PD1A 4WKRA 4K0KJ 4Z4GA 1CG2A 2E7WA 4ECVA 1KOHA 1PYTA 4DV6F 4FF4A 4ED3A 5J2QA 3OYIA 4AL5A 2GHWA 5GAGU 2YHAA 4HHHA 1Y3KA 3D0IE 3K89A 4X65J 4FM2A 2MQ8A 3DFEA 5I3PA 2ZH4A 1S49A 3I96A 2IVFB 1UVIA 3D2EB 3OYNA 1TKTA 2E5JA 5B0GA 3UCGA 1AXQA 4MKYA 1Z6RA 1X5OA 3RAQA 2DGUA 2DR8A 2LKZA 2XTJP 4QIFA 5HL7Q 3VOVA 1MLAA 1FEEA 3KYLA 5F41A 3GOIA 5KG0A 2X3DA 4YR3A 2WUSA 3DRPA 4Y1DA 1QDUB 2HS3A 4FWOA 3DXKB 1BY9A 3MXJA 5KFNA 2IHR1 5HI7A 3KOAA 2V9KA 4YOEA 1ZAXA 1K73O 1S72N 1J9AA 5KFKA 3RRHA 4H4OB 1XHZA 3D0GE 2E5GA 4A8MP 2E6MA 4FPBA 4B8AB 3HSJA 2OTLN 3WQUA 4JKBA 2Z1IA 4FW1A 3IMXA 5IM0B 1XNRJ 4JYAF 2BM0A 4DS5A 1HJRA 5EXWA 4U9RA 4LF9K 3HSGA 3NNAA 3W5XA 5KFRA 4OYXA 1UJ5A 3UN5A 1OKJA 4AM7A 1WUAA 1RTHB 1T7PA 3PYGA 3T6JA 3PSFA 1AUDA 2DK2A 3GFXA 2IM0A 4DTOA 4IG0A 2C3UA 3RB6A 4JLHA 4ZVHA 2ZNZA 5LSOA 3CCEN 1H74A 2G9OA 2VG7B 2KTQA 1WC5A 4HACB 1TUUA 3VQ8A 3J7YU 4DFKA 3ZNJ1 3CC2N 1C1BB 3QETA 2F1FA 1RWMB 2OKQA 3QGGA 2B9YA 1U4BA 1VSMA 2G8FA 4KRFA 1S22A 2LSNA 2CGLA 4EP5A 4DZ6A 4J91A 1RBUA 1SL2A 2JJ4D 4BRIA 1TL7B 1HWUA 4WE1B 3ELHA 2ITMA 2X51A 4FPAA 5FRMA 4DR4J 3SFUA 4OLPA 4IOAQ 1XN9A 5JS2A 1S9EA 2ACMA 4J2DA 1U2VB 4ZCIA 5HQMA 4L72B 4JHDB 4DPOA 1BWVA 5HAOA 5L8RC 3L2VA 2OAUA 3BKUA 2VFTA 2X7IA 5JVHL 1SUQB 2IJFA 4X4VA 3LDSA 1W97L 1ASWA 4BY9C 1U09A 2V67A 4F02A 4JKAA 4ZCKA 4KRWA 2EPIA 1XMQF 3WXLA 3S3MA 4B1YB 2ROEA 3SK3A 1MNEA 1VQNS 1FJGK 2W01A 4ZP8A 3QLHA 3FRYA 5H1SV 2HK2A 5B0EA 5C7PA 3AVLA 5LY3A 2AHOB 2V34A 3NWGA 1HWJA 2KYZA 3ZSVA 4YN3B 2DNRA 1RABB 3TAPA 5A2QO 2WSFC 3D68A 2IVOA 2XLIA 4DTUA 2P9EA 2E1MC 1ELOA 1UWBB 1Q7YT 3QRPA 4ZPVR 4QPXA 3BQ0A 5KQ8A 1KNZA 4I7FB 2HGNA 4P10A 2HKEA 3B6OA 2A6AA 3QDKA 2W7PA 4NI2A 3PUFA 5KFYA 1WG5A 1Q53A 3CM5A 4ED0A 1EIYB 4RCHA 4GKKF 3HVTA 3NCRA 3DYAB 4AQYJ 2YNHB 4AXIA 2KG1A 3ZX3A 4O3QA 1M5OC 1HBMA 1ZTWA 5HLFA 2XEXA 2VC1A 3R5DA 2V52B 1IV0A 1D9DA 3FCWA 2GIQA 2PAVA 3N6NA 4GV3A 2I2YA 4FJJA 2FVSA 1WELA 4I9QA 4M5DB 4B1XB 3KLIB 1E6VA 3VQ5A 1U0HB 4FF1A 2O4IA 3QSYB 5AQNA 1XR7A 1IKYA 2DTJA 4URSA 4DQIA 4JNEA 4G1QB 1X5TA 2WCXA 1JXLA 1Q8KA 1XEZA 4FJIA 4U7UK 5AJ3K 4EEYA 3MXHP 3LUYA 4KYZA 3MM8A 5LMNK 1UOCA 4FLWA 5LJ3Y 4OJ1A 4JI3J 2Y3YA 1UW4A 1TKZA 1GMWD 4B8CA 1LQ9A 1IM4A 4FL9A 2CZ9A 1T6DA 4RNFA 4TYBA 2XMJA 4P52A 5E5NA 5L9XA 4L76A 3U1NA 3H8YA 4DL4A 4CGDA 4NLPA 3S01A 2ZEJA 4E7HA 3VETA 1H2TZ 1UJ4A 1TUGB 2KJVA 3SMZA 4E7JA 4FKXA 2VH7A 2B6AA 1EP4B 1Y5IB 5DK5A 1KVAA 3JAMO 3KK2B 1RT1A 3TTCA 2MQNA 1ZM4A 3CCJS 1IN0A 4HTLA 5H9FJ 4IG3A 3D7SB 4B9SA 3HBTA 1F2HA 3TA2A 4DV0F 2F9WA 3CFOA 3V9ZA 4NYNA 5HBMB 5LXRA 2AQ4A 2YH1A 2B9EA 2YQ0A 1SQKA 1VR6A 3CCRS 1JJCB 2KXHA 4FK4A 1WOSA 4IDKA 3RBDA 5J1NA 3MTKA 3KLHB 1Q18A 1S1VA 3AFGA 4FP9A 4F50A 5BJRA 5HL7L 1TL3A 1CLFA 2XMWA 3SQOP 1B3TA 2IRXA 1YX2A 4O3OA 5AFUH 5DG9A 5HVHA 3G8QA 1B99A 3PACA 5FLXO 5M1KA 2XZDB 2K3IA 2E2QA 5LMNF 1LAVA 4I6MB 2W9BA 2UUBF 3NGTA 3DXSX 3T9ZA 2CYYA 4U67L 3DCAA 3O9RA 4GRSA 4OO1J 3MTJA 3T1YK 3DGVA 5EY4A 3R5GA 4NL5A 2CNNB 4DR4K 3SLCA 1ATSA 1T3NA 2W7OA 1QUVA 3OW2M 3VQPA 1YJUA 1SJ4P 3Q8RB 1B9DA 2YVSA 4BDPA 2MZ1A 3ENBA 5HP1A 4C97A 5KFMA 2ATLA 3D28A 1VRUA 4A8KA 1TK5A 3FCHA 1TL3B 3GIIA 4NX9A 3NH1A 3CCLS 2VDIA 2L41A 4ED6A 2V4QA 3RB4A 1B7YB 3SSSA 4RNOA 2XZWA 3E66A 1AYEA 2L9NA 2RS2A 1RHJB 4DL2A 4BQLA 4QWEA 2MQLA 4CFAA 1S6PA 3KZBA 3TX0A 4IDHA 2U1AA 2WAQD 3MDFA 4LSLA 3D45A 2VHGA 4UOHA 1QAJA 5CYJA 2GC8A 1U8WA 4OGEA 4F7VA 2KQ2A 4LF9J 4X2BA 4LF7F 4CFDA 2VG6B 3CNQP 2KRRA 2O8BA 1OIAA 4QJVA 3CC7N 2E5LJ 4USVA 2W9CB 4GKJK 1OVYA 3IXQA 1L3TA 1RTHA 3I31A 1N33J 4RZRA 3I9ZA 3KWGA 1NGGA 3OS1A 2GJFA 1FVSA 2UUCK 5F9NA 4BRPA 3W3SA 5L38A 1F6TA 3Q2TC 2HQDA 3J7YI 2PE8A 1X0FA 1VSIA 5CYQA 4DN0A 3FZLA 1RT6B 3M2UA 4U95A 3GG4A 5JMNA 1XUPO 3QWUA 3RWUA 2YWFA 4LRBA 4L6V3 1Y5LB 3CDAA 2ZBPA 3FBFA 3IFEA 4JI8K 3OR2B 2GZOA 5I4MA 4BRGA 4OV6A 2IM3A 3AVFA 1BIUA 3MECA 2YJFA 4CK3A 2AJ1A 3SAHA 4X62K 5AQUA 2HBMA 5AZIB 4OZNA 3OW2R 3EYZA 1OMSA 5SUHA 2EFNA 3OR1B 3VMFB 2CQ1A 1EO1A 4DV4J 2CZVC 1NGIA 2YNGB 3V6HA 2JWKA 5AQRA 1ATNA 2DFFA 2FXUA 5SWMA 2OUGA 1KVJA 4KTWA 3LGHA 1RACB 2ASYA 2W40A 4BGAA 1F9EB 2V8PA 4FWMA 5KRTA 1RAAB 3ZZRA 3UO0A 2IYIA 2G0IA 2Z0GA 1K6YA 4LVNP 5BYRA 4L73A 3ZT2A 3CE8A 3GE1A 1F5BA 3MR5A 4GVEA 4DR2F 3GU0A 5CHCB 3TYTA 2C22A 3A12A 4UF4A 2W2MP 2DNLA 4WFYA 4OV1A 2I1RA 1K8KA 3CCMN 4HI2A 1XK8A 1RBVA 2KHDA 1HARA 3C6AA 1T8EA 3AV9A 3CD0A 3ZTRA 3O5BA 2XLKA 4I7FA 4DR7K 3SSRA 1N8RT 2MB0B 3D1HA 1VHFA 4X4RA 3ULDA 1S12A 3HPOA 1K47A 5ETNA 4FJNA 2MJUA 3VGVA 2B4VA 5F0WA 4LF4K 3ETMA 2F7VA 4FKYA 3VGSA 3FC9A 2DPNA 2CQGA 2AJ4A 2BABA 4FDFA 1KKHA 3NRBA 1ZBUA 3W60A 1RDAA 4DV2F 1TL5A 4WQ4A 3SBTA 4AILC 3V4IA 3RMDA 5DG7A 1H73A 2OEMA 3PR5B 3Q24A 4DV3F 5JVGQ 4O3RA 2CG4A 2KT5A 1FCAA 4C1NI 3CJ0A 4K42A 4IOAL 4LFAK 2NZCA 5E0OA 1YTAA 1HHSA 4O5BA 4HLBA 5T7LB 3MM7A 4ETZA 4BRCA 4KPCA 1RWWB 1RCOB 4K43A 3MR3A 1BHLA 2XY6A 2P9PA 4V19S 4K8XA 5JVHQ 3CC7S 1MWMA 2CPJA 3AQPA 3MPYA 1T11A 3W8GA 3MUTP 3KJVB 2JLFA 3WX4A 3ZTPA 2DNHA 2DY9A 2OPRB 4DUZK 4PXBA 1RP5A 2E44A 3DRXA 4ZHRB 4UUWA 2CDRB 3IBCB 3UR3C 4O8KA 5L46A 3E01B 4J9MA 1LWXA 4ECZA 1Q82O 2HMIA 4JBCA 5T7BA 1RAHB 2RILA 1S1UA 4WTYA 4NCAA 3ZEUB 1JLEB 3CCES 1D0EA 1LFPA 4FYVB 2YY3A 1GX5A 1U1KA 2XRIA 3I32A 3C8YA 1UVJA 1VQPN 1OYDA 2PFDA 3W9IA 4NXMJ 4J9PA 3MFIA 4ZKAA 5F9LA 3J7ZT 4NXNF 2CQ2A 3KJFB 3J81O 3O4QA 1GTHA 4RWXA 4ZN1A 3QZ7A 2VGNA 1NOYA 4DLEA 2DO4A 4R79A 2FVPA 3TUJC 4FLVA 3QSIA 3KUEA 3MR6A 4EK2A 1XJWB 3TP2A 5LT5A 3TOQA 1Y97A 4LREA 3HSZA 4C6AA 3DDNA 5CA5A 4X4TA 3NAHA 3TR8A 3QT7A 2V9WA 3MEDB 1S7IA 1UZHA 3OYBA 5C24B 2HYIB 1GLDG 4CLYA 2RQ4A 1Z1ZA 2QL9B 1HL6A 2DGWA 3SJJA 1VQ7N 1IWAA 3O4WA 1WC1A 4LSNB 1HBNA 3MAAB 3P8BB 4G65A 4CGHA 3MR2A 1XMOK 5KFHA 1AA1B 5MLCQ 3KMQA 4ZVUB 4ZVOB 4PA1A 2QO3A 3NF6A 4N8NA 3M2RA 4F0MA 2KKHA 3B54A 3OY9A 1VQMS 3AARA 1HI0P 4N8OA 4DCOB 3OFGA 4BR5A 2FF6A 4K5RA 3ENWA 1CZ9A 3SQ4A 3QIPB 3E3XA 3M6XA 4DR2J 4W5OA 3RAXA 3W1YC 1B92A 1IG9A 5D0HA 1ZZFA 3MPUB 1ZAVA 4EHUA 1VCTA 2OA8A 3M4XA 4O55A 1S57A 4AE5A 1TGOA 2NRTA 2ZH1A 3ZZUA 3CWJA 3MCAB 1WN7A 4KPYA 2QTDA 4WZQA 4F25A 1EETA 5B0AA 4IFVB 1S76D 5HP1B 4USMA 3VQ6A 4A57A 1VQ6N 1XMOJ 2KL8A 3AA5X 1YJ7A 3V6DA 3HKWA 3R3TA 4Z94A 3AXMA 2P9GA 2D0OA 1HI8A 4HT5A 4ENOA 1B9FA 5J2PB 2RH3A 1UCNA 2HHVA 5EWEA 4JI6K 2PI4A 1FX2A 4QCLA 1GOAA 1J27A 2F40A 3QBCA 4A2AA 1FXXA 4DQPA 1YRXA 3WNHA 2Z1JA 4R5PA 4ZN3A 4LRDA 5B8HA 2OMLA 4EO8A 1RNHA 1S77D 2KU7A 4HEA9 1IKVB 1W26A 4A46A 1S6QB 4IOCL 3L7PA 3SPZA 4ECXA 3MHYA 4QW8A 4NLQA 4WTOB 2JEFA 4NXMK 4CESA 3DMJA 3QJJA 2ROGA 5DMRA 3NH0A 1O0PA 4OJHA 2YTCA 5JJBA 5D6GA 1K1QA 2P6SA 3X3UA 4IOXA 5EX5A 3MWBA 1CLQA 3THWA 2B7CB 1WAJA 2CQDA 3MF5A 4DR6K 4FK2A 3OTOJ 3MAHA 3P5BP 1DFDA 3CJKA 2R7TA 2FZKB 3CMEN 1KCFA 3Q7CA 1RE1B 4NCGA 3JS6A 5M2PA 3VQEA 2NXJA 3K8WA 3G25A 2X74A 3BZKA 2FJAB 4CD3A 3R2DJ 2XMTA 4KHNA 4X64J 4KFBA 3HOSA 3H6EA 1TKDA 2QMWA 1YI2S 4K4ZA 4JI7F 2DH7A 1VQKS 1DJ0A 2DHHA 3NF7A 4DR5J 4F04B 2Y1JA 2NRRA 2ZFHA 2HVHA 1QY7A 4AHCA 3VEXA 2AD9A 1NSAA 1WHWA 4FOEA 2V4JA 4LVOP 4W4MA 1JXBA 1RUSA 4LFBJ 4JI2J 4EZ9A 2IIRA 4BQZA 2QWRA 4AHRA 4Z4IA 3JSMA 4QAGA 3ZSQA 3EM1A 4LFBK 2EFQA 2GJ2A 5AQFA 1T05B 3RMAA 1R0AA 2G1DA 3VENA 3EGZA 2KN4A 1VJQA 2A1BA 3QFHA 4CGIA 3TAEA 2DR5A 2RDDA 4HWIA 2GS8A 1FX4A 3AOAA 1TU0B 1XR6A 3OFFA 4PXCA 2HBQB 5K8PA 1SJ3P 4U8VA 3QWPA 2XULA 3D54A 1QM9A 3NG8A 4DL0C 2QWMA 1QS4A 2A41A 4DQQA 3C3LA 1KBRA 2XO7A 1M5SA 4J90A 5DGAA 2E9TA 4BGBA 1PBAA 3NMAA 3JSMB 1D09B 5GIOA 2G13A 4N41A 3KHHA 3ATUA 3TZXA 2D0AA 1LCUA 2OZMA 2I7NA 4ZP9A 1RZMA 5AXLA 1CXQA 4OMFG 2BACA 2ZUAA 3OSPA 3NF8A 3GILA 1NB7A 1N5TA 4E2FB 1YZ7A 3HX9A 4ICLA 1MWQA 3M2UB 3GE9A 1NJIT 2O8EB 3VAKA 4WF9Q 3B4MA 4IQMA 4BE2A 3A8KA 4QQBA 2QL5B 4YY3K 4YUDA 4BR2A 1QE1B 4YOUA 4H0TB 2MEWA 4ZJQA 4C23A 3VQDA 4DV1K 3FDSA 2VZ9A 1REGX 2VPXB 3GSIA 1GAOA 3IP0A 2XMAA 5HROB 3QINA 2NR0A 3GWCA 4WYLA 4KHQA 1N32J 4KC5A 1ULRA 5CCLA 3TZWA 4CHPA 3ENVA 4ECQA 3R5BA 2W2NP 2CIMA 4WP3A 4B9UA 2O8EA 2DBBA 4LSZB 4ECYA 4Y0FA 4L3QA 3CMAS 4Y2CA 4DX5A 2PBDA 1UVNA 1I94F 4N76A 1TZ0A 1OH6A 2A1SA 2GHPA 4WPAA 1YT3A 1Z05A 3LP2B 3SUOA 2R7OA 1HWIA 4JV5J 3ZYYX 4LBHA 1RA7A 4KR0B 3BPDA 1W25A 4DR2K 2YPYA 4ES2A 4DB3A 2GAHC 4ANEA 1NKBA 1KTVA 4YNQA 4B9TA 4OYMA 4CERA 4QBUA 3MM5A 2R7UA 4JUZA 1RWNB 2ADCA 4ZVGA 3DDKA 3D6MB 2E5LF 2R2UA 3QGIA 2ZF5O 1W2BR 3GV7B 1KHWA 2QKKA 4RBUA 3G2XA 2GGPA 2LQBA 1RT3B 2WRMA 4FLYA 5L1JA 2DXDA 4LSNA 2RT3A 4Y34A 1CULB 2WZ1A 3PJXA 2UXCF 3CIMA 2YKMB 4CO5A 5GIPA 4CEDA 1BGXT 1BQMA 4CHOA 3NAEA 1QUPA 4WFAL 3S1TA 2UXDJ 4I69A 3FFIA 2UZAA 3C16B 2Z56B 1SKSA 4Y1CA 3HZGA 2W6LA 1VIXA 1S10A 1ZXOA 3F5TA 1XWLA 4M8LA 3THXB 5CD4H 1WC0A 3LDQA 1RA6A 4K59A 4YB5A 4DPTA 1YIJS 4JD2A 2ZUGA 4A48A 4FSVA 1UEKA 4F3OA 2FIUA 2XMKA 1Y4ZB 3HHLD 4DMNA 5DM6L 1VLYA 1W7WA 2X6SA 4CLPA 2ZJPQ 3H5UA 5F8GA 3W62A 1ZTTA 2R8HA 4CBXA 5KFAA 4WZMA 4JI1K 1XQIA 3QERA 3AY0A 2ZD1A 1T3OA 5ADZA 5C42B 3HHLB 4LF5J 4CLKA 3TWHA 4RUHA 2RN2A 2JEGA 4A8OA 3KD1E 4V19X 4RWWA 3NOCA 4EWTA 3HM8A 2JOQA 3DLGA 1N5QA 3OVSA 1F21A 3TQ1A 3M32B 5KG1A 4AXJA 4DPXA 4DQSA 1GK8A 2DGSA 4MO4A 3L4BC 5H9FK 3H98A 3GDQA 4OX9J 1XR5A 1D4XA 2E1ZA 1AUSL 3GG1A 4C48A 1S6QA 2LQJA 2B8QA 3D0HE 1NPRA 1KC8O 1KRPA 2HRTA 2H54B 3ZZZA 3D3CJ 2ZBIA 4ZJOA 4WP8A 3Q83A 4CLWA 3CETA 3TAMB 1CJTB 3A8YA 4HCBA 1EKEA 4K4TA 1Y64A 3LPYA 2VONA 2N3LA 1YHQS 4DTMA 5AE2A 2LLZA 1VS3A 3U9DA 3BO3A 2YBVA 4DV5K 3AVCA 4CF9A 2R7YA 5LMNJ 5KFVA 1TFYA 2BE9B 3CJTA 2ZH5A 2F8SA 1VSEA 1RU1A 4PPZA 3RVCA 1TKXA 1V4TA 4LF7J 5IC6B 5E3PA 3CCZA 4LF6J 4ID8A 4IG3B 1Q86T 4JV0A 6AT1B 1BWEA 3HPHA 1NDLA 1DHMA 1NH8A 4IR1A 4TLRA 3SCIE 1K9MT 3SFGA 1EWQA 3TSQA 4A61A 1IUJA 2HW3A 2DNZA 2NUUG 2HHHJ 4I2QA 3VEYA 1VC6A 2XS7A 2NXCA 1FF2A 1UA1A 4FWSA 2Z2LA 3AB4B 2F8HA 4B3OB 1E4FT 3POTA 3P45B 2OPPA 2QT7A 2V69A 3LDNA 2BKOA 4JOUA 1X4EA 3D6TB 2F8TA 4M3YA 1R8HA 2QZ8A 2Y0SD 4U96A 1JB0C 3T1HJ 1GLEG 4DV4K 3AD9C 1RWVB 2IAJB 1QVGM 3P49B 1DQAA 4FWLA 2D1CA 1I6JA 1XNRF 4Y6IA 2ZGYA 3ZO7A 1B7FA 4ID1A 2JLEA 4X62J 3NNCA 4DPUA 2YNIB 3HP6A 3N4PA 5AJ3F 4O3NA 3GYGA 4FZZA 3D66A 1CEZA 4HTUA 2ZKTA 4OL8A 1SJRA 4AT1B 5M1NA 1S7HA 2D74B 3L3VA 4JI0F 4KE5A 2CKWA 2W4CA 5FLXY 2QSWA 2ZJRQ 4HI1A 3GJQB 4NEYA 3E8OA 4FWRA 1FJGJ 5CYMB 2X1GA 3OL6A 3WEEA 4KHUA 4CJ4A 4M63A 4NLSA 2DCLA 4ZPDA 3P96A 4TQSA 1S0VA 2N3OA 3IGNA 2ZC4A 3MEEA 2RAQA 4OZ5A 2C1EB 4FJLA 3VQ9A 3H42A 5ETKA 4JI5K 2UUCJ 3U4LA 2BGGA 5DDOC 3J81U 1HRHA 3VESA 4CEZA 2BEFA 2GQQA 2GVZB 4M45A 4EFHA 1NK5A 1T6CA 4YOVA 4GKJJ 3H20A 3I5AA 1PC5A 3CO9A 2AX0A 4ECWA 4RLEA 2ASLA 4ZCMA 1QSSA 5J2NB 3AD7C 3CJ4A 3VZHA 4K8ZA 8AT1B 4J9KA 3I56S 3GBTA 1D3WA 3WUHA 4Z2XA 5CXTA 3ZSZA 1N6QB 1HW9A 3CW2C 1ZPWX 4P73A 2DY4A 1HBUA 2FGOA 3OTBA 5KOXA 2CJ9A 4E98A 3E9LA 3UIQA 3T5KA 4H5VA 5A0YA 1X9SA 1OY8A 2IJNA 1C1BA 1FTCA 2J0WA 3J80O 3G9CA 2GO9A 3V5RA 1LFWA 3RJMB 5DRKA 3BSCA 2HSEB 2VD3A 4NLTA 1CZAN 1U8SA 3NF9A 4B9VA 1F9FA 3AGRA 2V0NA 2VFRA 5A8RA 2MQOA 3DM2A 4KV8A 4FWPA 5M2UA 3W2VB 1H38A 1VJWA 4CEQA 2EG1A 5KFDA 5AQVA 2DTUA 1VSKA 4DR4F 1CS4A 4UZBA 1UFKA 4MFBA 4WFAQ 5GAGI 4YDUA 2LP4A 2RSQA 3EDRB 3ENOA 1JLAA 1WF1A 4YHHF 3DRRA 1K0VA 2QLBB 5IC4B 2MTLA 1CC8A 3OLBA 2BTFA 1S6UA 4ERDA 1NLVA 1AW0A 1DTQB 1OY6A 3HFVA 5LMUF 2DH9A 4UY8T 3OLAA 1CJKB 2RHSB 2CJXB 2KH9A 4ZVEA 1HJOA 2G4BA 2CGKA 3L0QA 2CPIA 4M3ZA 4ECSA 2JX2A 2JHEA 3A8IA 4QS9A 2EWHA 4CGJA 3OYFA 4KGKA 3FQLA 2I0XA 1TR0A 3JQKA 1FE4A 1YITN 1QZ5A 5DQIA 3V2UC 4B1VA 4DR1K 4YS2A 2QMXA 4UY85 1SIZA 2IDLA 4ID5A 2HNYA 1EX4A 4TY9A 1RWKB 2ZHAA 4ED2A 3Q22A 1JLAB 1Y11A 4LF8F 2WK4A 3Q8SB 4CBWA 3VEZA 4S0MA 4YB1P 4Y0WA 4DL7A 2BRKA 1RTJB 5LXYA 1P27B 4ZITA 4GKJF 2RE2A 2XQCA 4NI2B 4YEAA 3IG1A 2B7BB 2DRDA 4I4BA 1KVCA 3V9WA 2K2PA 1NEEA 2FC0A 4MLEA 3OFEA 2UUAK 5KFIA 4I2PA 2YNHA 3H1QA 4G1QA 3AVAA 4RW6B 4E89A 3J7A1 5D4OA 3CMAN 5IV4A 2GV1A 2MGZB 2H51B 3HHLA 3SI6A 2IVMA 4PZVA 5CZ1A 5LSRA 3HVAA 4MIWA 1ITPA 2ASMA 3CCSS 2HNYB 2NRXA 4CNZA 4BG8A 3DLGB 2OHDA 3BBBA 2PO4A 5AQPA 2DNQA 3IN5A 4NLRA 3OL8A 3ZLJA 4PY5A 1KP6A 1T3VA 3MN7A 2UUBK 3K9KA 3T41A 2HRUA 2QA4S 3G6XA 3NVKA 3MMBA 1XQSC 4B9MA 2EKYA 1C1AA 1X9MA 2YKPA 1WHXA 4X66K 3HI9A 4XPCA 4I2PB 3A1YG 4ZOSA 5GAHI 1H1VA 3ZETB 2KM8C 3EGNA 1LW0B 3MM8B 4X4UA 2NRHA 2V8HA 5ETVA 3PZPA 1V6HA 3O8MA 2Z1HA 3B8AX 3C6TB 2PY5A 2RUGA 4ILLA 2GX9A 1G6BA 5GMDA 4H0XB 2VJUA 4GNIA 2Z58B 4K4SA 2L3MA 4D3HA 1FRLA 5I42A 4BWMA 1OSCA 4LR8A 3ITHB 4ZVSB 2FBVA 2DNGA 3DHWC 1LKZA 1RISA 3SV3A 3PO4A 1KVBA 5KFPA 4EUVA 4CO0A 2KVQE 1RAFB 2XY8A 3J7ZO 1WNEA 4UW2A 5C2FA 2QYCA 5J2MB 2D3O1 2HHPA 3W7BA 2JVRA 2MKKA 3IO1A 2D4WA 1YK9A 3BSAA 3EXCX 3NS6A 3MWPA 4V1Ak 1FHTA 3VQBA 3QNNA 3CPWM 5U47A 4A8FA 3N9UC 2G2ZA 3IR7B 3R1LA 1KHVA 3SQ0A 1Q8BA 2QW9A 3QAUA 2GAGC 1U49A 3EZWA 4ILHA 2Z30B 4OI1A 3VN5A 1QSYA 3Q89A 2D9PA 2J9DA 2YWHA 3UKRB 4M41A 2AEFA 4KBOA 4G3IA 3OBYA 4YP3A 2MDAA 3I4PA 4B9QA 5E41A 4QIGA 4CTAA 1S1WA 2KHOA 1BQNB 3AA2A 3H5XA 2ZDPA 1RTDA 1CXUA 2HS0A 1R0CB 4JI1F 2E8AA 2YKQA 3HT0A 2C3MA 2ZJRL 3JSRA 3EMTA 1QJHA 1J53A 3BY5A 4RU2A 4C2MA 4OKJA 1H6KX 4CIOA 5LJ5Y 2D3OR 1X1PA 4KH5A 3GONA 5IOLA 1HIYA 4IXCA 3CC4N 1JJ2R 1ZPVA 4AM6A 4BREA 7FD1A 4Y3CA 2O8CB 2AT1B 5KPTA 3QT5A 1V4SA 2VQEJ 5HJYA 2HFSA 3F0NA 5BR8F 1RAEB 3GPAA 4NRUA 3MCSA 3AVNA 5ADXH 1ASVA 1BHNA 4FO0A 2P6TA 5J1PA 2XY5A 4ZLPA 4P72A 4ZPCA 2CDQA 4F4YA 1M90O 2HBYB 5J2QB 1C6VA 2DCUB 2CPEA 4CEBA 2AX1A 2UXBJ 3THVA 3MAQA 1URNA 1NXIA 4A5AA 3R2CJ 2RHQB 3UVJB 1RDWX 1F1BB 4XPEA 3AA4A 3CJ9A 4KKOA 2GA7A 2LMIA 4R5PB 2JFKA 2O1PA 5GADU 4WQ4C 3A5LC 2QMUB 1S1VB 1XERA 2DITA 2B56A 3GJSB 5L9NA 1JCGA 3VF6A 4I9LA 3A8JA 2J4RA 1R8BA 4Z0UA 4DR3F 3TR5A 2POKA 3X1LB 4TSXA 1NHKL 2XI2A 1FNXH 4IRDA 1N48A 4CJRA 4DV7K 4TY8B 2ZZTA 4IOBA 3PW5A 1VQ9N 3PJ9A 2B51A 3IAYA 4NLBA 4BE0A 2XNRA 2W1BA 3BN7A 3ILIA 3NBPA 1WWHA 3H46O 4DV3K 2JLGA 4CF8A 1W2BM 3O3GA 1ZZNA 1A7GE 1I5OB 3ILLA 4NEZA 2XG8A 1FFSB 2WHOA 3V1OA 4DG1B 5D4LA 1NK6A 2NRZA 2DRBA 1LWCA 2ZM6J 4YY3J 3DOMB 1GLJO 5L39A 1PJ7A 5MAOA 2KLAA 1JX4A 1T9WA 1KLNA 4RU9A 5C10A 4M5HA 3MPVA 2C3OA 2HNDB 5C25B 4CO4A 1IBLF 5DETA 3OS2A 3PYDA 1WSFA 3MEGB 1FWPA 2O8DA 4NLVA 1KAYA 2V6AA 2NXNA 3C7NB 3IAS9 4KSEB 6FD1A 2GWKA 3QFPA 5E3RA 3WIVA 2GV9A 4LBPA 1S5ZA 2W9CA 1T9VA 2GIFA 4IFYA 4LIWA 1Z2ZA 5JICA 3EPIA 3AOBA 5IQQA 1GH8A 4DG1A 2P9KA 4CZMA 4O4GB 3OV7A 3SPYA 1EB0A 3C14A 1FI4A 1BWFO 2E20A 4QR1A 1RU2A 1QLNA 3QBWA 1RKIA 4BCAA 3NWRA 2XSJB 2WBRA 3CEDA 1SUQA 3PHTA 1IJJA 3UKUA 4NXNJ 3J81Y 1GX6A 2OTJN 1RAIB 5HQLA 3G6ES 4CZIA 3D7EO 3OYGA 1CSJA 2QIFA 3NCQA 3UQSA 2D1KA 5IV3A 3G8SA 4KI4A 3LO3A 2ATQA 3LP2A 1WEYA 2AIRB 3M6WA 3KMSA 1J5EK 1AT1B 1U2CA 2J7WA 3FZKA 2R8JA 3MECB 4Q5VA 4EIAA 1U7LA 1EXQA 3VQTA 1K9MO 4H4KC 1VQPS 3C15B 2QA4G 3H2VE 5LM7E 3OXLA 4DR6F 2DO0A 2DFEA 2HLUA 1XNQJ 1RT5B 2ZNYA 1GMWA 4FLTA 5ADXA 2V2QA 3KWIA 2UXBF 4DBQA 3H3