1N5YA

Hiv-1 reverse transcriptase crosslinked to post-translocation aztmp-terminated dna (complex p)
Total Genus 122
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
122
sequence length
558
structure length
558
Chain Sequence
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFKKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDICKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNKGRQKVVPLTNTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDKSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLVSAGIRK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 5'-D(*AP*TP*GP*C*TP*AP*GP*GP*CP*GP*CP*CP*CP*GP*AP*AP*CP*AP*G
publication title Structure of HIV-1 Reverse Transcriptase with Pre-Translocation and Post-Translocation AZTMP-Terminated DNA
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Transferase/immune system/dna
total genus 122
structure length 558
sequence length 558
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2002-11-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 1n5yA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1n5yA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1n5yA03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1n5yA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1n5yA05
4O4RA 3ASMA 1RA7A 4BACA 3RB3A 2FBTA 1VSMA 3VQ4A 2C28A 5KG1A 4ECXA 1BISA 3HSTB 4DSIA 3HKWA 3OSPA 3ZSVA 2I5JA 1VSKA 4GC6A 2W9BB 1VSDA 4LH5A 3H98A 2O4IA 1XR7A 1WSEA 3NF7A 3H5YA 1U45A 2BANB 1JLEB 3FQKA 4TY8B 4JV0A 1JLAB 3LWLA 3Q8QB 1BI4B 4OVLA 5FDLB 3OYEA 4C8KA 3RWUA 1SL2A 4F4XA 2X6NA 2W9BA 2I5JB 4FVMA 5I42B 4IQXA 3LZJA 1CZ9A 2BANA 1JLEA 4TY8A 1KLNA 4O3QA 1KHVA 4NLGA 5JUMA 4ED7A 4Z4HA 3MXMA 3NKYA 4F4ZA 4FS2A 3JYTB 3OJSA 3NAHA 4GC7A 2JEIA 4GMJB 4M3UA 3BQ0A 4ELUA 3DLGB 2B4JA 2R7YA 5FRMA 5KGWA 3EZUA 5I42A 1BCOA 4B3OB 4HKQA 4J2DA 2D0AA 1N6QB 1CXQA 3JYTA 4JRPA 3AO1A 3C95A 3RMDA 3AVNA 1S0NA 1Q9YA 3V1RA 3SFGA 1Z4UA 3MXIA 4FJJA 3AO2A 4YR3A 4ECRA 3SZ2A 1JL2A 3OHAA 4CHNA 3NL0A 3EPIA 2R8IA 1GX5A 1VSFA 1N6QA 1XR6A 4B9NA 1LW0B 2YHBA 3D28A 2QKBA 2HAIA 4ZTJA 3OYLA 1UA1A 1CLQA 3HYFA 3VQ9A 4QWAA 2Z1IA 4WE1A 2ASJA 5HP1B 2BQRA 3N6MA 3VQ5A 2AWZA 1RT4B 1LW0A 4DTJA 4IFYB 4O44A 2G8FA 2JEGA 4Z4CA 2IJNA 4IH6A 3HL8A 4KAIA 3QINA 4XO0A 4CFDA 3RR8A 3QIDA 4RNNA 3ZCMA 3KLEB 1LWCB 1TAUA 4B08A 4ZPAA 3HHKA 4DSFA 1DLOB 4IRKA 1A5WA 4IFYA 3S3MA 3RRGA 4DQRA 4ECUA 4KHNA 2W42A 2DPJA 3NH2A 3KLEA 2VA3A 4B8CA 4DSEA 3H08A 1REVA 1QSLA 4G1QB 1TV6B 4PY5A 3H2LA 4J2AA 2XY5A 1DLOA 4RU9A 1RA6A 4IDKB 3SUPA 1S6PB 2PZSA 2BGGA 3ISNC 5KI6A 4DS4A 4CIFA 1S1XA 2WCXA 2VWKA 4KTQA 4I9LA 2C22A 1UA0A 3MAQA 4G1QA 1TV6A 3HK2A 3QZ7A 3S3NA 4ELVA 1KVCA 4DFJA 4IDKA 3MFHA 1S6PA 4E1NA 1TKDA 4EBEA 3RAQA 4FK0A 1SH2A 4DL5A 4EEYA 3KK1B 3ZSOA 4OKEA 3NCIA 4CERA 5KG2A 2V4RA 5KG3A 2GIQA 4C8OA 5DLFA 1NK5A 2BRKA 4QW8A 1RT2B 1RT7B 2JC1A 1QUVA 3T1AA 4DSLA 3M8QA 2F8SA 2VG5B 4E7KA 4DFKA 5HRRA 3CDEA 4FJ7A 5KTQA 3G0ZA 1RTHB 4CGGA 3KK1A 2IAJB 2YNFB 4RW7A 4KFBB 2DFFA 2W8KA 3QZ8A 5KFLA 3AVHA 1RT7A 4KSEB 1NKCA 3KLFB 2J6SA 2VG5A 2E6LA 2UVVA 1NKBA 1RTHA 4QOZB 2IAJA 3VQQA 3P1GA 4Q8FA 3GIMA 2YNFA 5DLGA 3FFIB 4KFBA 4RNMA 3SQ0A 3DYAB 1RDDA 1RYSA 4FM1A 5HRNA 4ELTA 3CJ3A 3KLFA 1S48A 2CJQA 2AQ4A 3DLRA 4J9MA 4DQSA 5J2QB 3L8BA 5KG0A 3TAQA 4DLEA 4M3RA 4DFPA 1S49A 1MMLA 1RT1B 5CYMB 3G10A 3FFIA 3DYAA 3VQDA 3KHRA 1K6YA 2UVUA 1D8YA 1JX4A 2PYLA 5J2QA 3Q8SB 3K5OA 1IG9A 4B9LA 3ZSXA 5F8NA 4OL8A 1RT1A 2WOMB 5CYMA 4NYNA 4DTXA 4JRQA 2P5GA 1ZTTA 4DQPA 5KG7A 3DMJA 1RBVA 3CFPA 4F50A 4HCBA 4J9NA 3LP3A 3PV8A 1BQMB 4ED1A 3B6OA 4LSLB 1K1SA 1TL1B 2D3ZA 1T03A 5KFQA 5KFKA 4BWJA 5F8IA 5CZ1A 4CFAA 2XC9A 2IS3A 2XY6A 3Q8PB 3S3OA 1JIHA 4ZP9A 4N76A 1RT5B 3HP6A 2FLLA 3AVIA 1BQMA 4LSLA 4ZP8A 1QAIA 1HARA 4MK9A 1TL1A 3OS1A 4CJKA 3QEWA 2G8KA 3M9MB 3C6TB 2B5JB 1BQNA 1WAFA 3UQSA 1NJZA 4CIGA 3CM6A 3TABA 3IN5A 2F96A 4Q5VA 3N6LA 3C6UB 3GIIA 4O3OA 3M9OB 3LP1B 5KFOA 3RMAA 4ID5A 1ASWA 2KQ2A 2IOCA 4ED6A 4K4SA 4E1MA 4FJ8A 4NYZA 3NF6A 4TXSA 2KZMA 2B5JA 3CQ8A 4XPCA 3T5LA 2HVIA 4M3XA 3SYZA 3ISND 5EWEA 3MXJA 2BRLA 4DU3A 3C6UA 1J5OB 3LP1A 1KHWA 3OL6A 4NCBA 4Y2AA 4LQ9A 4PUOB 5KG4A 3QGGA 2ZKUA 4EYHB 2HVHA 4QPXA 4CJ3A 3PW0A 1RT3B 4OJRA 4AHSA 5KFTA 4DL3A 3NGIA 4O3SA 4IRCA 3HVAA 2FVCA 1RTIB 4NRUA 3TAMB 1S1UA 1KFDA 3OYCA 1SL1A 3PX0A 4W5NA 4PUOA 5L1LA 4DQQA 3BGRB 3H4DA 4Q44A 2FLNA 2OPRB 2OA8A 3P5JA 1RT3A 1RBRA 4DL2A 3AVKA 1TKZB 2IM1A 2E4LA 3TAMA 3KNAA 3D0PA 4M3YA 3BR9A 4CK1A 3DLEB 4KHUA 4H4OA 2R2UA 3BGRA 2WONB 1QE1B 1JLQB 2OPRA 3ZT3A 3CG7A 3V6JA 2FVRA 4TLRA 1TKZA 4CHZA 4W5OA 3ZSZA 2HNZB 3KLVA 1TK5A 4OLAA 3H5SA 3DLEA 2GUIA 3AA4A 1RNHA 4CK3A 4H54A 2WONA 1QE1A 1S1VB 1EXQA 1N56A 1NHUA 2HMIB 3KHHA 4DTUA 1RT6B 3MEGB 1LAWA 3SV3A 3L3UA 1HQEA 4R8UB 4JLHA 3AVMA 5L9XA 4B8AB 4FZYA 3HVTB 4ZPBA 4B9UA 3T5KA 4OGCA 2V0NA 1S1VA 2AX0A 3EYZA 2HMIA 2ATLA 4FW2A 1FKOA 4GVMA 5HLFB 4OGEA 2HNYB 1RT6A 5HRPA 3MEGA 1C0TB 2KTQA 4K4YA 1WSGA 4FJ5A 2AGQA 5HRSA 3THVA 3DLKB 4IG3B 4YMEA 2ALZA 1X9WA 5C24B 4CCHA 4RW4B 4DLGA 4K50A 1JLCA 3CJ5A 1KLMB 3RBEA 2GIRA 5HLFA 4FXDA 2HNYA 4DF8A 1IH7A 5DGBA 4NLSA 2R8JA 4CE9A 1WSHA 3QLHB 2I1RA 3CDWA 4RUCA 3DLKA 3IRXA 2UUTA 3VQ8A 1T8EA 4IG3A 5C24A 1L3UA 3K5MA 4RW4A 4Q8EA 4DSJA 3OYDA 3RB6A 1JLFB 4YNQA 4KTWA 2QE5A 4F2SA 4ICLB 2JC0A 3CFRA 1DTQB 1X9SA 3QLHA 3TVKA 4CEEA 5DQGA 4CJEA 4HCCA 1TKXB 3F73A 1ZBIA 3D45A 4KB0A 2IGIA 1NJXA 4ID1A 1QS4A 4RW8B 4IG0A 2VG7B 3T5JA 3M9NB 1JLFA 3RB4A 4CGJA 3I8DA 4MIBA 4ICLA 1DTQA 3M8RA 1S0OA 4K8XA 4DTPA 3PJXA 1TKXA 2IC3A 3EPGA 1SKRA 4AILC 3OHBA 4J2BA 2F8EX 2IA6A 4CF9A 4RW8A 4E19A 4ED3A 4DTRA 2VG7A 3BDPA 2AGPA 3AA5X 5JS1A 3VQSA 3QIPB 3TANA 4RG8A 1WLJA 5T14A 4ECYA 2VWJA 4B9TA 4K4TA 4ZVGA 2EX3A 3U3YA 1T3NA 3ITHA 4E0DA 4N41A 5KG6A 2YNGB 4CESA 3QIPA 4FZZA 4LSNA 4K4VA 3S9HA 4K4XA 2HHWA 4FCYA 4CF1A 4LQ3A 5KFWA 5KT5A 3OYMA 3OYFA 4KV8B 2OZSA 4CJTA 2W8LA 5CYQA 4Y2CA 2YNGA 2C2RA 2JEFA 5F8HA 3AVBA 3VA0A 2G8HA 2D41A 4CJVA 5KFSA 5KFVA 3CDUA 4KV8A 3PW7A 2UVRA 3OS2A 3QEVA 1ZBLA 5KFXA 1SUQB 2OZMA 3RB0A 3E01A 2X78A 5E41A 4BE1A 2WHOA 4ECSA 4KE5A 4QWCA 4ZVFA 3QIOA 5KFDA 4FJNA 1NOZA 4MFBB 1RCHA 4WZMA 3G86A 2F8TA 3CWJA 4J9QA 3VQBA 1QQCA 1LWFB 1SUQA 3DRSB 4WE1B 2R2SA 4R0EA 1N48A 2EC0A 4EBCA 1QTMA 5HBMB 2HHXA 2ZE2A 4NLYA 1IKXB 5KFIA 3OYKA 3T19A 5KFPA 4MFBA 2FLPA 4E7LA 3GV5B 3SQ2A 2PYJA 1DTTB 4O44B 4H4MB 2PY5A 3PW5A 3GILA 1A5VA 1QAJA 1L3TA 3QETA 3OL7A 3ALYA 1LWFA 3DRSA 4M42A 4Q43A 4CGDA 4KPYA 3MR6A 2XCPA 4RNFA 5HBMA 1IKXA 4B9VA 1VSLA 4CJLA 3QEXA 2BDPA 1DTTA 1HNVB 1B9FA 4H4MA 3ZSYA 2R8GA 4EYIB 4O0JA 2DFHA 4KBIA 1C1BA 4KI4A 3KJVA 5F8JA 4EP5A 3I5AA 4TN2A 2FBYA 1REVB 4OLBA 4NCAA 5F8GA 1UOCA 3GYNA 2GV9A 1HNVA 3OYJA 4CFCA 1SH0A 5KFZA 1YT3A 4WYLA 1A5XA 1S1XB 1T7PA 4LD0A 4DU4A 1SV5B 4J9PA 4BDZA 4KREA 3H4BA 3VQEA 3TQ1A 3IG1A 1WNEA 1XC9A 4W5QA 1KVBA 4CJSA 3BQ2A 5L1KA 1L3VA 2WTFA 1N5YA 3E51A 2C2EA 1TK0A 1KVAA 4DMNA 3NH1A 1YVFA 2G8WA 1SV5A 3LPUA 2HHTA 4J2EA 3O4QA 3QNOA 3CVKA 1WSIA 2CKWA 2YV0X 4FBTA 3MR2A 3M8QB 4CEZA 1QSSA 3PW2A 1C6VA 3I0SB 2HWIA 1ZBHA 1C2PA 4C8LA 1KCFA 2Q3SA 4ZPDA 2ZQBA 5FRNA 1WSJA 5DMRA 1C0UA 4RW7B 4ECTA 1ZTWA 3KHLA 1C1CA 5KRTA 4M3TA 4MQ3A 3PUFA 1IM4A 4K4UA 5T7BA 3I0SA 3ZSQA 3OLBA 4NLQA 4E3SA 3O4NA 4Y34A 1S1WB 1S4FA 1KRPA 5F8MA 4KRFA 3SUOA 1HNIB 1S10A 3SUNA 2JLEA 2W9CB 4PQUA 1HPZB 4LY7A 1ZYQA 1S1WA 4RUAA 4B9MA 3BSCA 1JXEA 1LWEB 1NK4A 4HUFA 2HW3A 4NLUA 1F21A 3IGVA 3HO1A 4RNOA 2NUBA 1RDBA 1HNIA 4CF0A 3HPOA 3KKRA 3SQ1A 1UWBB 4ZVHA 2W9CA 1HPZA 4IR9A 2AU0A 1HYVA 1QSYA 3QEPA 4RW9B 1LWEA 1TP7A 3DOLA 1VSJA 3ULDA 3DMJB 4WYWA 3BQ1A 4F4YA 4CHOA 3Q8RB 4O55A 1SKWA 1UWBA 3VQPA 1T03B 4CJPA 3CIZA 4RW9A 3KK2B 4AHCA 3MR3A 4PWDA 4FLZA 2DPIA 4DG1B 5L1JA 4CJRA 1J9AA 1YTUA 2OPPB 3SI8A 4FJGA 1CXUA 1JKHB 1RBUA 1NHVA 4CECA 4B9SA 3KK2A 2AJQA 4QAGA 1BQNB 1NOYA 4ZMMA 5D3GA 4CGHA 4DG1A 3AV9A 3VQ6A 3O3FA 1GOBA 4YQWA 3LAMA 2OPPA 2OPQA 3PY8A 3HT3A 3K5NA 3QEIA 3V4IB 4URQU 1JKHA 2JGUA 4ID5B 3QGIA 3L2RA 2E9ZA 4E7IA 3OY9A 2KFNA 1EETB 4C8NA 4WFZA 3MFIA 4F3OA 4FS1A 4JUZA 2J6TA 4IFVB 2X74A 3PX6A 4FLXA 1Y97A 1WN7A 2XWYA 3KK3B 3V4IA 1TKTB 4O4GB 3TWHA 4K8ZA 5I3UA 5JXSA 4FLVA 3MEEB 3LANA 3V81A 3ZSRA 3OJUA 3O3HA 4DU1A 3KKSA 3B6PA 1EETA 1RDCA 5KFUA 4I9QA 4IFVA 3CJ2A 1SKSA 2WB4A 1S1UB 4DL4A 3KK3A 1O1WA 2W9AA 1TKTA 4O4GA 1FKPA 1D5AA 2HHUA 4O3PA 3MEEA 3PW4A 3CM5A 4IKAA 2KW4A 2VG6B 5KT3A 2ILZA 3V9SA 3NGZA 4Y3CA 1ASVA 1JLBB 3V6KA 1VSHA 1RYRA 2FVQA 1I6JA 4H4OB 4F4WA 3RR7A 4CHYA 2X6SA 3HPHA 2EHGA 4ECQA 2R2RA 2DY4A 4FJ9A 4YR0A 1I39A 1SH3A 3V9WA 2VG6A 3QGHA 4GW6A 1X1PA 2YNHA 2XO7A 3FDSA 1JLBA 3PO4A 4WZQA 2FVSA 1U09A 4ZHRB 3RTVA 5KFHA 3CJ0A 3NHGA 2UUWA 2XRIA 1BCMA 1WNSA 1TL3A 3OYGA 4XIUA 3HJFA 1JLGB 1WAJA 4R5PB 3GIKA 2IM2A 1HQEB 4MH8A 3AVGA 4ZHRA 1NK8A 4AHTA 1ZETA 3L2UA 4MKBA 1U49A 4DS5A 3DRRB 5DK5A 5KFJA 1XWLA 4L8RB 1XHXA 3SI6A 4DSKA 1FKOB 3H5UA 5J2MB 2ASLA 4IH5A 3IAYA 3N6NA 1JLGA 2DFEA 4R5PA 4BDYA 4KHSA 4CGFA 3U3GA 3DRRA 1TK8A 3IGNA 3NBPB 2RPIA 5CZ2A 1LAVA 1RDRA 2QV6A 3LDSA 1JLCB 5C25B 4DTSA 5J2MA 1EKEA 3OSNA 4EZ9A 4CJFA 4ED2A 3BREA 3NAEA 3H59A 4FJLA 4Q0BB 3AO4A 4EO6A 1QHTA 2D0BA 3HPGA 4CGIA 5SWMA 3IRXB 4IRDA 4G3IA 4CFBA 3CYMA 3NBPA 4BWMA 4XPEA 4EZ6A 4CEAA 4DTNA 2XGPA 5C25A 4ECWA 1W0HA 2AX1A 2XI3A 4DL7A 3F9KA 5KFYA 4Q0BA 3PR5B 1W25A 4HTUA 1LW2A 4FK2A 4RNHA 5KT7A 4URGA 3BSAA 4U7CA 4OKKA 2O5DA 1U4BA 1NK6A 3SQ4A 1S9EB 3CJ4A 3I0RA 4IG0B 4O3RA 3L2VA 4BE2A 4TQRA 2C2DA 1JXLA 1ITGA 3T5HA 3M8PB 3KLHB 4FLUA 5L1IA 2IM3A 4ED0A 3AVCA 2G8UA 2IC3B 2YKNA 4M3ZA 2Z1GA 3DI6A 1Z26A 1S9EA 3GV7B 2A1SA 2GC8A 5KFCA 2UVWA 4Y1CA 3SNNA 2FBXA 5KRSA 4OPKA 4I7FB 2ZD1B 3VQ7A 3K2PA 4KO0B 3M8PA 5J2NB 3KLHA 4FLYA 1SL0A 2OH2A 4F4KA 4CJUA 4HUEA 3OL9A 4M45A 1C1AA 4NLWA 3KD1E 4KTZA 3ITHB 1J53A 4FJXA 4KHMA 4TYAA 2FBVA 4UQGA 4I7FA 2ZD1A 4LSNB 4KO0A 5J2NA 4URSA 3KMQA 1MU2B 4KI6A 4FK4A 3NGYA 1NK0A 3LP0B 3TAPA 5EWGA 4OPJA 5CYQB 5F9LA 3SPZA 2QKKA 2V4QA 2E9RX 1NKEA 1UAXA 3KD5E 1NNDA 4KAZA 4HYKA 1MU2A 4CF2A 1HMVB 3LP0A 3UR0A 4LH4A 2P5OA 3RAXA 3QERA 3K59A 3AA2A 5F9NA 4E7JA 4FW1A 3PX4A 3E01B 5EUHA 1RDAA 1D0EA 3A2FA 3K58A 3GQCA 5KFMA 1HMVA 4WXWA 1RILA 1D9FA 3AA3A 5KG5A 4RZRA 1JLAA 2ZE2B 4MK7A 1BI4A 4CHQA 3LAKA 5FDLA 3WNGA 4QWBA 3DRPB 3OS0A 3HM9A 3TAGA 4Q45A 4FJIA 2RDJA 3MR5A 5FROA 4F3TA 4ECZA 2J6UA 2D0CA 3OYNA 3DRPA 3DLGA 1S6QB 1C1BB 4DFMA 4NLPA 4N5SA 5JS2A 3KJVB 4M94A 4B3OA 2ETJA 3RRHA 3AO3A 4TSXA 3LPTA 5KFRA 4EP4A 3MTKA 2IM0A 3H5XA 3AVLA 4O0IA 5HROB 1S6QA 1TAQA 4J9SA 3KOAA 3OLAA 2HB5A 4WFXA 1RBSA 2ITGA 3OL8A 3IG1B 5KFFA 3UPFA 4NRTA 3ZSWA 2OPSB 3NAIA 4AHRA 2IMWP 1VRUB 1HJRA 1VRTB 3OVNA 1RTDB 4CEQA 1N5YB 4FYDA 2ASDA 1HYZA 5HROA 3OYAA 3HP9A 2XCAA 4IH7A 3MF5A 3NF9A 2LSNA 1U48A 5KFAA 5HP1A 1NK9A 1XI1A 1TQLA 2XY8A 2WK4A 1RT4A 5KFNA 2OPSA 1ASUA 3CO9A 1VRUA 1VRTA 1RTDA 1HQUB 4CEBA 2E9TA 4NLTA 3VQCA 1L5UA 3U6FA 3ZT0A 4ECVA 4FLTA 1LWCA 2XY7A 1C0UB 3I5CA 4FBUA 2Y1JA 2FJXA 4CJ5A 1C1CB 3KTQA 2V9WA 3QESA 5K14B 1HQUA 1Z25A 2GBZA 4PA1A 4WFYA 2P51A 4IOBA 2YKMB 3ZT1A 2KFZA 1S0MA 3HVWA 3NMAA 4MIAA 1S1TB 3JSMB 4WXOA 2YHAA 3V6DB 4YFUA 4EBDA 2ILYA 3NH0A 4J9OA 1J54A 5K14A 1IKVB 4KKOB 4IBNA 1ZBFA 4PQUB 3WNEA 2YKMA 1HYSB 4AHUA 3V1OA 1S1TA 4E89A 1X9MA 1C0MA 4MKAA 3JSMA 4YR2A 3NE6A 3V6DA 3G6VA 4FM0A 2FVPA 3TR8A 1XR5A 2E6MA 1IKVA 4KKOA 3H40A 1GOCA 1YTAA 1EX4A 2R8HA 4Z4IA 1HYSA 2ATQA 4EO8A 3QNNA 4FZXC 3DOLB 3NF8A 2D7SA 1RT2A 4ZVEA 4FLWA 2HHQA 1RBTA 2WRMA 3QYYA 3V9UA 1D1UA 3C94A 4DL6A 4Z4GA 3RBDA 1HRHA 1S97A 3DLBA 3LZIA 4PWDB 1BHLA 4ZTFA 3AVFA 3TAFA 3BSNA 3D5MA 2YNIB 4ZP6A 3SUQA 1RAJA 1S9GB 2W7OA 4K4ZA 4DF4A 4FJHA 2KZZA 3WNHA 4CJQA 1LV5A 4F2RA 3DDKA 2A1RA 4DQIA 1VK0A 1FXXA 3KMSA 3MECB 5D3GB 1GX6A 3SCXA 2YNIA 4Z0UA 5KT2A 1NJWA 1S9GA 2OPQB 4KB1A 4AHVA 2B43A 4Y1DA 4J9RA 3O3GA 1IO2A 5DG9A 1K1QA 3TAEA 3MECA 3SV4A 4ZP7A 2DTUA 1OS5A 3PJWA 3GV8B 3ICLA 1BL3A 3ZT2A 4NCGB 4CIEA 5I3UB 4ED8A 5KGXA 3V81B 2WOMA 5SZTA 4O5BA 4CF8A 4I2PB 2XGQA 4NLDA 3V1QA 5F8LA 4CEDA 4JS5A 4TYBA 3MEDB 1Q9XA 1JL1A 4NYFA 4E7HA 1U47A 4NCGA 2R8KA 1FKPB 3CFOA 3L2QA 3DOKB 2RDIA 2Z1HA 4I2PA 1U04A 3VA3A 4TY9A 4H8KA 4CHPA 3MEDA 4F8RA 1RT5A 2QK9A 4W5TA 4KHQA 3PHEA 3V9XA 1IKYB 4KHYA 2IDOA 1BGXT 4NZ0A 3DOKA 4NLRA 2AGOA 3C6TA 3K5LA 1B92A 2P1JA 4U6PA 3FQLA 2YNHB 3AVJA 3T3FA 4Z4EA 3EY1A 1WSFA 4QWDA 3KIOA 4KHWA 1IKYA 5KFEA 3UDLA 3SFUA 5KT4A 4M41A 1KSPA 4QCLA 4CJ4A 2JEJA 1NJYA 4X2BA 5EU7A 4NLVA 4HUGA 1T94A 3QO9B 1TL3B 4ZPCA 3L2WA 1KTQA 1KFSA 4JS4A 3VQAA 1J5OA 2HHSA 2RN2A 3AO5A 2BR0A 1CSJA 2BE2B 3NDKA 4AH9A 3DM2B 1T05B 3LP2B 2BQ3A 4QWEA 4MK8A 3QO9A 4K4WA 1RTIA 3P83D 4CK2A 3EZ5A 5C42B 5DQHA 3PR4A 1IKWB 2BE2A 4HHTA 3DM2A 4DEZA 3SPYA 3LWMA 5EWFA 5J1EB 1T05A 3LP2A 4BE0A 2OYQA 4QW9A 3L3VA 1JXBA 1W9HA 1G15A 4OKJA 3HXMA 3V9ZA 2B6AB 3PVXA 1N4LA 3KLGB 4NLXA 4J9LA 4FJKA 5C42A 1IKWA 3DLHA 1L3SA 1BIZA 5J1EA 4CEOA 1Q8IA 4CJWA 2RKIB 1JLQA 3KLIB 4BDPA 5KT6A 1FK9B 3ZT4A 2B6AA 3FRZA 3M8SA 4FJMA 2O4GA 4N47A 3TI0A 2HNZA 3KLGA 2HWHA 5KFBA 1LW2B 1BIUA 3OYBA 2IBKA 3IS9B 2QXFA 4HVJA 3RMBA 5C5JA 1R0AB 2RKIA 2FJWA 4RW6B 4CEFA 2HHVA 4NLOA 3I0RB 3KLIA 4J9KA 4IKFA 4JV2A 3UIQA 1EP4B 3TARA 1FK9A 5DG8A 4I2QB 1TVRB 1RTJB 3LALA 3PZPA 1TGOA 4R8UA 2YKNB 1B9DA 1YVUA 3NGDA 3HVTA 5DG7A 3NFAA 3IS9A 3DI6B 3K57A 1R0AA 4RW6A 3I5BA 1GOAA 5DQIA 4JV1A 1VSIA 4FM2A 1I3AA 4YP3A 3VN5A 1EP4A 4N56A 1C0TA 4I2QA 1TVRA 4O3NA 1RTJA 3RMCA 5CY4A 5KFGA 4Z4FA 2FC0A 1NK7A 1XHZA 1VSEA 5EDWA 2W7PA 2XI2A 2HNDB 2BQUA 1ZBUA 4W5RA 4DTMA 2FJVA 5J2PB 2RF2B 3HVRA 1KLMA 3BJYA 3GIJA 3G6XA 3OYIA 2G8IA 4DWIA 2R2TA 2XHBA 4DTOA 4TQSA 1S9FA 1CZBA 1D9DA 3FSIA 3SJJA 1S5JA 2D5RA 2HNDA 4KB7A 5J2PA 3KHGA 2RF2A 4KHRA 4M3WA 2IJFA 2Z1JA 3OYHA 4C8MA 2VA2A 5DGAA 2G8VA 3PO5A 3WNFA 3AVAA 3G6YA 3V6HA 2D3UA 3BSOA 4IR1A 2Y1IA 4M95A
chains in the Genus database with same CATH superfamily
3BKTA 4O4RA 1GLAG 3TTCA 4LF7J 4A48A 3CXCR 3TJAA 1RA7A 1EIYB 1Y3JA 3G6ES 3O9QA 5C0YA 2CQIA 3O08A 2KL8A 1BISA 3BO4A 4M5GA 3OTOJ 2ZVIA 3TVZA 2DR8A 4QS8A 5M1KA 2O4IA 1U45A 2Z2LA 3T6BA 2BANB 4I64A 3FQKA 2X7IA 1BI4B 4WFNQ 2NRXA 3O9TA 4YOVA 5FDLB 3OYEA 2GUPA 3AA8A 6AT1B 4F4XA 5BYRA 4ANCA 2X6NA 4FVMA 4OI2A 1RWWB 3DLLL 2DNMA 1RDUA 4TY8A 1KLNA 2YX7A 2YHYA 2CQ1A 4NLGA 5JUMA 2OEJA 3K17A 3POTA 3OJSA 2CJYB 3MMAA 3BQ0A 4M3UA 2LDYA 4CLSA 4LFAK 2BYCA 4YDUA 1U1MA 1CXQA 3EEQA 1WBBA 4JRPA 1VQOS 1DHMA 3AVNA 1S0NA 3D6MB 3VF6A 4UUWA 3SFGA 5AJ3K 1Z4UA 5D15A 2QLXA 1R8PA 4YR3A 3SZ2A 2CPZA 5A6WA 4CLTA 3EPIA 1UL3A 2XMJA 2ERRA 1X9JA 1MLAA 2XHCA 2RJZA 3H6EA 2R8IA 4OYMA 3G4SN 1R8HA 2VYPA 3CGIA 1NU0A 3VQ9A 2Z1IA 3G71S 3VAGA 1OY6A 5HP1B 2BQRA 2A6OA 2XM3A 2DR5A 3PYGA 4FYWB 4B3SK 3TW0A 4OMFG 5BRFA 5C12A 4HEA9 4Z4CA 3HL8A 2UXCJ 4KAIA 3QINA 3E8OA 4L73A 3AT1B 1VQ4N 2QWLA 3MM8A 3CIPA 1FDAA 5DM6Q 1X3NA 3UKUB 5CZVA 2NPFA 2V69A 1OQ6A 3GWCA 1HNWK 4OI1A 2H3GX 2A10A 3VEWA 1QSLA 4RU9A 2CPIA 4IDKB 2PZSA 5B09A 4RUHA 4DS4A 5KI6A 1YIJN 4X66J 2VWKA 3N4WA 4I9LA 3MAQA 3M2UA 2HYIB 4G1QA 1VC0A 3S3NA 3QAUA 2M0GB 3UE2A 3CJ9A 2RUSA 2E44A 1S6PA 1TKDA 4EBEA 1KDNA 1VQKN 2B9WA 2FF6A 1SH2A 1RSCA 3NCIA 4Y2IA 1H72C 5KG3A 1RHJB 1N88A 1B70B 1RT2B 1R59O 2FHJA 2JC1A 3ZZPA 2FHOB 2CIMA 2JWNA 2F8SA 2VG5B 2EI5A 2IHR1 1UEUA 4FJ7A 3G0ZA 4M5DB 1WHVA 3C14A 3EO3A 4BRAA 4V19S 4RW7A 2W8KA 3MM7A 2XMUA 3QZ8A 3VVTA 2NR0A 4KSEB 1NKCA 1S76D 1HX1A 3R8EA 2DGXA 1NKBA 1RTHA 2NZ4A 4QOZB 2QA4G 2IAJA 2JFDA 1YI2N 3GIMA 3UD3P 1TL4A 3KDNA 1YTYA 4L3KA 5HRNA 5E3CA 4F26A 3DLRA 3Q8VA 4J9MA 3GR0A 3ATVA 2EFPA 4DLEA 1S49A 1RT1B 2CYYA 2JNJA 4XK8C 4K0KJ 2UXBK 1YUWA 3DYAA 1OPIA 1FVSA 1JX4A 3ZTQA 1UEVA 3VGKA 3O80A 5J2QA 2J9DE 3FZBA 1JJ4A 3ZSXA 2D0OA 3MM9B 4PKGA 2WOMB 5CYMA 2JVRA 3GZ7A 2V4JA 4PG8A 1VQ7N 4YDUC 1X7VA 1TL1B 4P2XA 1K44A 4LF9J 2BABA 4CFAA 2XNRA 5AQTA 2FGOA 3W8PA 3TX8A 1EQMA 3HP6A 1J5EK 4MK9A 2DGUA 2EW9A 1IBMJ 3VEOA 4YEAA 1BOTO 3HF5A 3C6AA 1NJZA 4CIGA 2NZCA 4Q5VA 3IN5A 1IJFB 2F96A 1B7FA 3M9OB 2ITMA 3ZX0A 2A42A 3QFPA 2EFQA 4USHA 4ED6A 2CFXA 4E1MA 4FJ8A 1KEKA 4M3XA 3HZEA 2WBMA 4PL7A 4J91A 4WTOB 4DU3A 1J5OB 3LP1A 4NCBA 2P9KA 3RSEB 2MKKA 4LQ9A 3ID6A 2QA4N 4ILGB 4BG9A 4EYHB 3MX2A 4CJ3A 3H20A 3R8YA 1Q53A 1B64A 4DL3A 4IRCA 3HVAA 2FVCA 4H0TB 3P5BP 4W5NA 1DBDA 3BGRB 2XYHB 5K9FA 2FLNA 4LVNP 2OPRB 1RT3A 2IM1A 3MPUB 4CBXA 3L09A 3IA0A 4UW2A 4FNHA 4KHUA 2R2UA 4USVA 2WONB 1JLQB 1WDTA 1XQIA 4BRCA 1RB0A 2B9EA 3A8KA 5IV4A 4TLRA 1TKZA 1E6VA 2CWKA 5LXRA 4FYYB 3ZSZA 1RHUB 5B0AA 2W2OP 5D4PA 3DLEA 5BR9A 5CZXA 4DUZK 1N56A 1M5OC 3U9DA 3KHHA 4JI1J 4CYUB 4DTUA 1RT6B 3D7SB 1NM2A 3CF5L 2H9ZA 1H2UX 3L3UA 4JK7A 1HQEA 4I56A 2XSJB 5K8MA 3IWNC 3HVTB 3T5KA 2PDAA 4OGCA 2FJEB 4GKJF 1S1VA 2HOEA 2D3OR 4BROA 4ES2A 1FKOA 1SKUB 2B9XA 5HLFB 5HRPA 1TL7B 4O8UA 2KTQA 2V8HA 2LA4A 1R8CA 2GHWA 8ATCB 3THVA 4YMEA 2J9DA 4CCHA 4RW4B 4JI0J 1WSHA 3SQGA 2NYHA 3CDWA 5LJ5Y 3WXIA 1RU2A 2B56A 2NXNA 3VQ8A 4ZVQB 5C24A 2GJIA 3GDQA 3TJ9A 1L3UA 4Q8EA 2XMMA 3RB6A 1JLFB 2VFVA 5A8KB 1RWOB 3BPSP 2HRUA 5A2QO 1DTQB 3QLHA 4WP8A 3MUMP 4CEEA 1X0PA 5HQMA 1ZBIA 4KB0A 1ZM9A 2IGIA 2RIJA 1S6UA 1VQNS 4RW8B 4IG0A 2YTCA 2IVFB 3LM9A 2VG7B 3HMJG 3M8RA 4DTPA 3PJXA 4U7BA 4B1UB 3EPGA 1WHWA 4J2BA 1F9EB 2F8EX 2RS2A 4DV0J 3EGVA 3VQSA 4K4TA 3DGPB 3U3YA 3CMAN 2F3JA 1NHKL 4NYOA 2FZGB 4JI5F 4DV7J 4F0HA 4JKHA 4AD6A 3BN7A 3ZTOA 4DR6J 2VV5A 3M32B 2YNGB 3BDEA 5KG6A 3SAGA 4QIWD 3M8YA 4FZZA 3NS5A 4K4VA 1CQNA 2BVZA 4FCYA 4CF1A 1KQSM 3LOUA 4KV8B 2G0JA 4CJTA 1FHTA 4LFCF 4BR7A 1YBAA 1HWLA 3GL1A 5ADXH 3VA0A 5AXNA 1Q86O 2D41A 2KHOA 3THTA 1O5JA 1SIZA 3L95X 3A3OB 1M90T 4LF4F 2UVRA 1ZBLA 2EWSA 5KFXA 5A2QU 1QVFR 5AZJA 4KR0B 2Q2RA 2X78A 4FN5A 5EVZA 4BE1A 5HANA 3EGZA 4KE5A 3QIOA 3LGNA 4AE5A 3G8QA 1JCFA 4C0BA 2Z58B 1C0FA 1S7IA 1NLVA 2AT1B 1LWFB 1SUQA 3DRSB 1BY9A 4R0EA 2DPNA 3MWPA 2EC0A 4EBCA 4M5MA 1UAWA 2SXLA 1QTMA 3BN4A 1OVQA 4H03B 2ZE2A 4NLYA 1IKXB 5KFIA 2HBKA 2ZKTA 3OYKA 2V51B 4MFBA 2CQHA 2ZJQL 5GAGI 2UP1A 4NI2B 1F5BA 3QWUA 2PY5A 2AJ4A 3GILA 3OL7A 3ALYA 4Q43A 4CGDA 4W92B 4LRCA 1EKRA 5ETRA 2VDIA 4C2MA 4RNFA 3CD7A 2R3VA 4CJLA 4P2MA 3IMXA 4CLFA 3W2VB 2XLIA 4H4MA 5IQ6A 4USMA 2BE9B 1TUYA 2ZJPL 3M6WA 5L9NA 3TUPA 4CZKA 1U1OA 2FBYA 2E5LJ 1Q5VA 3G8TA 4NCAA 2M8DB 3D2FA 1UOCA 2KU7A 2QLBB 2GV9A 3N5BA 1CJKA 1S1XB 4BRMA 1RCXB 4FVCA 3G6EN 3IG1A 1WNEA 2QYGA 4W5QA 1ZH5A 4CJSA 5A6PA 5L1KA 2ZM6K 4OYOA 4JI2K 2WTFA 1HKGA 1UVKA 1ILYA 1M5HA 1U26A 3AXKA 4DMNA 3HDSA 4PPDA 2DNPA 1SV5A 3LPUA 2ZGZA 5FLXO 3QNOA 3CVKA 5M2RA 2R9LA 4YOTA 4L76A 2H4YB 2GIFA 4NA1A 2YV0X 4BHQA 3BF3A 2RRNA 4JI7F 3I0SB 1ZBHA 3TNVA 4HH1A 5E3AA 4PRFA 2Q3SA 1X4AA 5L38A 3RGIA 5FRNA 4OYAA 1C0UA 1NPRA 2YQ1A 4CH7A 5KRTA 1ROFA 2B4VA 1BA1A 1K9MO 5EX3A 4K4UA 1OQ3A 3CULA 1W7WA 2HLTA 4CP5A 3OLBA 4HWIA 4BVOA 3TEGA 3O4NA 1S1WB 1IQTA 4B3RF 1S4FA 4OYXA 4QZVB 2H4WB 1Q81T 4OZJA 3SUOA 1S10A 1B0TA 1EX8A 1X4BA 1S3XA 2NRZA 1HNZJ 1HIYA 4WU2A 2MHEA 2XYPB 4C3KA 3HM8A 5DDRC 4B9MA 1LWEB 5FPMA 3UO0A 2WZ1A 5ADXA 3B6BA 3CCSS 2GHPA 1HNIA 4L72B 2P6SA 3SBGA 2K8GA 2WC9A 5HMXA 2AU0A 3F56A 3QEPA 5IWAF 4RW9B 1TP7A 4U8VA 1CULB 2P5VA 1H2TZ 3ULDA 4J5OA 1TUUA 2YHXA 2V7ZA 3BQ1A 1BLUA 4CHOA 1RWKB 2DRBA 2R7WA 2CJXB 3TPQA 4P2SA 5FLXU 3C2PA 3IR5B 1SKWA 1UWBA 4ZLLA 4L6V3 1NCLA 4OYIA 3PIOL 3IR7B 3VAIA 3MR3A 3OBIA 4DG1B 3GE9A 2HS0A 3UVJA 1YTUA 4BQZA 4FJGA 5CXTA 4C9DA 1R89A 2AJ2A 2CDRB 2MQ8A 1HNXF 4B9SA 4QAGA 1NOYA 1FW6A 3KFWX 4FWMA 3AV9A 4QYZK 1IWAA 3VQ6A 3LAMA 2AYMA 1QAYA 2AEMA 2OPQA 4URQU 4ID5B 3QGIA 4E7IA 2E9ZA 3P49B 3MFIA 5DM7L 4ZDNA 2J6TA 4OYPA 1Y97A 2XWYA 4O4GB 2AHOB 4ZIVA 4F7VA 1BO5O 3R1HA 2B51A 5I3UA 4FLVA 4X4UA 3OJUA 1U24A 4E2FB 2V2KA 1RDCA 5KFUA 1WI8A 1RU1A 3MCOA 4A57A 4DL4A 3KK3A 2ATCB 1TKTA 1HHQA 5D0HA 2RSQA 1URRA 2LCWA 2VJVA 3TEHB 2I7NA 2VG6B 1RHRB 3FSYA 4JHDA 1Q8KA 4CLWA 4JI3F 3DXKA 1RAAB 3C65A 1RGVA 1VSHA 1RYRA 3BH6B 4F4WA 2X6SA 3MWBA 3DHXA 2QEXN 5GIPA 4O0NA 2EHGA 4YR0A 1I39A 1SH3A 2YQ3A 3AA9A 3VAJA 1DZ5A 1ZAWA 3LQVA 3FDSA 4YOEA 1U1NA 3KVGA 2JLGA 2PA3A 5TKWA 4A59A 4ZHRB 3SAHA 2YJEA 3QATA 2P6TA 1N36K 3RUBL 4DV2K 2BUPA 2XQCA 1WNSA 1TL3A 2LQJA 4XIUA 4BRLA 3OYGA 2QWMA 3HJFA 4BR9A 1JLGB 2K7KA 4R5PB 4MH8A 4C3LA 3TYTA 2ZH8A 1ZETA 4AHTA 5DK5A 5KFJA 2W6KA 3UCZP 1UCNA 3SI6A 2ZH3A 2ASLA 2E1AA 5A2QY 2AMCB 2GMJA 1FFSB 2Q43A 2LQ8A 1JCEA 2RE1A 1TK8A 1HWUA 2LDIA 4A8XA 2RPIA 2QM1A 4JAXA 1MN7A 3THWA 5C25B 1OSDA 1Q5YA 1Q18A 5D0RA 3NAEA 3H59A 4FJLA 2H5JB 4Q0BB 4ZCMA 3OUYA 5ETMA 3IRXB 1V5IB 4IRDA 2W6LA 4G3IA 3FKBA 4CFBA 4BWMA 3EVWA 4DTNA 4K42A 1SVDA 1W0HA 2AX1A 2XI3A 3DLLQ 3JS9A 2KYXA 2KXNB 5KFYA 3F9KA 2UUBF 3M8WA 2QMWA 2N4DA 3BUZB 2AP1A 4DR4K 4YHHK 3BGFA 4DX7A 4F0MA 4X4QA 2EEYA 1S9EB 3HFVA 3I0RA 4MDBA 4O3RA 2VQEJ 4BE2A 4YDDB 4EIAA 1JXLA 2ZFHA 3M8PB 3CI5A 4LF6J 4ED0A 3ZTRA 3GV7B 1W2BR 2GC8A 3SNNA 4JOUA 2FBXA 5KRSA 2ZD1B 5L8RC 3K2PA 4QU7A 3KLHA 1EQYA 1SL0A 1BWFO 4U95A 2A3ZA 3K7RA 2OH2A 4CJUA 4TKTA 4HUEA 1SXLA 2YJFA 1R27B 3NGTA 3OW2M 3T1YK 3ITHB 1J53A 1UFKA 3AJDA 3A12A 4ANEA 2LLZA 3OVAA 2LQBA 5IWAJ 3MDQA 3HHLA 4BRDA 3VGUA 4JKGB 4ILHA 2BW2A 5LMUK 4KI6A 2R7OA 3NGSA 2RQCA 4OPJA 5CYQB 4IFEA 2DHAA 5A0YA 2BTFA 2GWJA 2MJNA 2E9RX 1RWXB 3WQPA 2MQQA 4LRBA 3QSYB 4KAZA 3B4MA 4Y2MA 1MU2A 1HMVB 3LP0A 4WQ5A 1SJ4P 1H98A 3QERA 1IBKK 1UETA 4KT0C 5F9NA 4KC5A 3KWIA 3E01B 4I6MA 3D2EA 2MKHA 3UR3C 1FA0A 1HNXJ 1RDAA 2Q97A 3K58A 3K0SA 4P6QA 4RL1A 1FDDA 5CAAA 2P9NA 2Z0GA 2WBRA 5AQYA 3R3TA 4WBFA 1GFWB 3MMCB 4N8OA 1NBWA 1TUWA 5ITHA 4JI6K 4LT6A 2ZH7A 1U8WA 3QMQA 2EWHA 4J90A 2VH7A 2QYCA 4M5JA 3WNGA 2MGZB 5BPNA 3LPEA 3OS0A 3CCWA 1QQOA 4DV3J 3L9ZA 2LVWA 4ISEA 2Y0BB 4K5RA 2QMUB 4ZJLA 2CPYA 3OYNA 4G6VB 3SEOA 2JHEA 2H5EA 4QR2A 1TTHB 4DFMA 3C46A 5JS2A 4K43A 3A3PB 3J7YP 4ETXA 2CH5A 4B3OA 2JL9A 3IRWP 2QJ3A 1XBWA 3T1HK 5CHIA 2W1BA 5EOYA 3MTKA 1MMNA 4JI3J 4DUTA 4O0IA 5HROB 1S6QA 2DNNA 5CABA 3KOAA 4WFXA 1FRLA 1LK5A 2R4FA 2CQDA 3ZX2A 2ITGA 3BZCA 3UCGA 3UE5A 1V3SA 1YZ7A 4AHRA 1V3RA 3PYEA 1EHWA 3S7RA 4PXBA 4NE9C 5T7LB 3MURP 2ASDA 3OYAA 2ZBIA 2GCFA 5KFAA 2MXYA 1G99A 2DISA 3I87A 3K9JA 3CCMS 4G65A 2O3DA 2HS3A 4DV4J 2D0PA 1RT4A 2PN6A 1ASUA 1FFWB 4DR1F 4ZN1A 1IBLF 1L5UA 2YX1A 4LF8J 2UYTA 1XNQJ 2E2OA 2VPWB 1ULRA 9ATCB 4FLTA 3HX9A 3H8YA 2QLWA 1GLLO 5E26A 3SAFA 2FJXA 4C0HA 3MCAB 3WEEB 2CXEA 2GBZA 2P51A 2GQ2A 3C3LA 3K5PA 2LFVA 2QFIA 3FE1A 3NMAA 3GCWP 3W63A 4CZEA 2XMVA 2YHAA 2F9TA 2MEWA 3V6DB 3MI7X 1U2CA 3HOTA 1M1KT 1J54A 3U1MA 1VHFA 4DDFA 2G1DA 5I3QA 3MM6B 3V1OA 4K8RA 4E89A 1C0MA 3JSMA 2PEHA 2W4DA 2VD3A 3HHLC 1XR5A 4JV5K 2MQNA 2GGPB 3QJPA 2UUBJ 3P96A 3TWZA 2VQFF 2J0QD 2OMLA 1A9NB 1I51B 3MPYA 4BRFA 3EGWB 2ATQA 4X65K 1HLWA 2OFHX 4QPTA 1JK9B 4FZXC 5AQWA 4DR2K 5IT9O 4OYWA 2ZWOA 4PYDA 3Q8YA 4NWBA 4A8QA 3MWTA 4DHVA 3HT0A 4DI6A 4Z4GA 1CJUB 1BE4A 1HRHA 4WQ5C 1S97A 3DLBA 4B1YB 2HBQB 4LRAA 4WCEL 1CJVA 1BHLA 1V6HA 4MT1A 4F04B 2RRAA 3S1TA 1MROB 4X64J 3W60A 1RHKB 5DZ6A 3WNHA 4KHPJ 2WSFC 3GFZA 3CCJS 1LV5A 4DU8A 3MAHA 4JI4F 2A1RA 2J7UA 4DPUA 1VK0A 1YJNN 2K3KA 4FWRA 3MECB 1TUVA 5D3GB 1YRXA 3SCXA 3HZ6A 4NPOA 1AFJA 1AB8A 2C2KB 4OZ5A 4AHVA 4NZ7A 2P9LA 2CZ9A 3PCOB 1T11A 1VQ9S 2WFBA 2DH8A 3VPZA 3O2IA 1DQ9A 2MSSA 1BMQB 5HJYA 4CIEA 5AQRA 4O5BA 3P6YC 1T9WA 3CW2C 2BM0A 4DZDA 3UDVA 1NH8A 4TYBA 3MEDB 2FXUA 4Y00A 3HTVA 1I1GA 1JL1A 2RB7A 3AB2B 1U47A 4QQBA 3FEXB 2FJAB 3MMVA 3AY0A 2RDIA 5AE3A 2Z1HA 4FPBA 2IVMA 2HZCA 5ETNA 1P9QC 1RT5A 2QK9A 3V9XA 1IXKA 2V67A 2H3EB 2QWQA 2IDOA 1UVNA 1BGXT 2CRLA 3G82B 4NZ0A 4J37A 2OGUA 4NLRA 3PRVA 3D6TB 2LXUA 1OPZA 4MO5A 3TA1A 4CO3A 1AZSB 1B92A 4U6PA 2VC0A 4Z4EA 2V7YA 2GEMA 3O5BA 1WSFA 2E7VA 3FBBA 1DURA 5A8WA 1ZOTA 3UDLA 4HT7A 2A0FB 2QL5B 3CCZA 2B4OA 1KSPA 2N3OA 4QCLA 2JEJA 1NJYA 3QBXA 2N7YA 4HUGA 2V50A 2CNLB 4C97A 3VQAA 2MLYA 2JDJA 2UU9K 1U6ZA 3NDKA 2L41A 1DFDA 3HHLD 3P45B 4PG6A 3TU5A 2YWEA 4JYAJ 1P9YA 4CNYA 2CPEA 4BRKA 3PR4A 2BE2A 4ED5A 3SPYA 2FIUA 5EWFA 1ZBTA 5J1EB 4BE0A 1N33F 4FWSA 3L3VA 3EKUA 1W9HA 4UQTA 3HXMA 5C2CA 3R9PA 2CJKA 4NEYA 2ZDOA 2B6AB 3VF2A 3CXCM 3QPIA 1N4LA 3KLGB 4J9LA 2AJ0A 2I38A 2DXEA 1IKWA 3DLHA 2AV5A 1Q8IA 4DR1J 1IBLJ 1AYEA 5KT6A 3FCVA 4DB3A 1DARA 3ZZRA 1OMSA 3M8SA 3JXUA 2HNZA 1LW2B 2QRRA 3NOCA 2QL7B 4ES3A 2WB1D 2IBKA 3QICA 3OYBA 3WT0A 4DR5J 5C5JA 4CEFA 4NLOA 3TVYA 1N54B 2A6MA 3J80U 1VBYA 1TVRB 1RTJB 5J1NA 3PZPA 4NYPA 2EBGA 2V9KA 5E3PA 3NGDA 3ZEUB 3K57A 3CD6S 1K8AO 4RW6A 3R6MA 2KG0A 1GOAA 5DQIA 4FM2A 3RJMB 2K3IA 2KT2A 1VK3A 3MN5A 4YP3A 1J2VA 3H46O 4N56A 1Q8BA 3RMCA 2W4CA 3UKRB 7AT1B 4A2AA 1Q7LB 5EDWA 1VSEA 4IOAL 3QT5A 2CZ4A 2RF2B 3M1VB 2Y0SD 3G6XA 2PC6A 3OYIA 4A62A 2G8IA 3WC2A 3QGPA 2ZJQQ 1S9FA 4LF5J 2HBLA 1GLDG 2PI4A 4X62F 4JI8F 4M5HA 3KHGA 2O8CB 1OYEA 2Z1JA 4DR3J 4C8MA 2VA2A 4A2BA 4GVBA 1RADB 4BGBA 1PYSB 1NGHA 1RJJA 4LJMA 4IR1A 2I5JB 2Y1IA 4M95A 1ICEB 2F1FA 4EUVA 3TSPA 1HBMB 2P9SA 2DB1A 4JI4J 4NZ6A 1VSMA 4QIFA 2C28A 3JAMO 1XJWB 3MM5B 3HSTB 2CG4A 3ZSVA 5H9EJ 3PKMA 2KYZA 1VSDA 4NXNK 4I6WA 2G1HA 3H5YA 1XMOF 1VOMA 1JLEB 1JLAB 2PIIA 3PDNA 3D2WA 5HATA 1HW8A 3RWUA 1SL2A 4AFFA 1JWWA 3OFHA 5I42B 4CLUA 3D1HA 3LZJA 2BANA 3R7SB 1FF2A 1NG9A 4O3QA 1KHVA 5JJBA 2MKSA 4EHTA 3NKYA 3MXMA 4F4ZA 3JYTB 3ZTSA 3NAHA 1IWGA 1YRUA 3ISZA 4ELUA 2RHKA 2F7VA 3R2DJ 3GMGA 1NDKA 4WKYA 1N6QB 4JKFA 2H5IB 2JRSA 3D6HB 4B3TF 3RMDA 1NMDA 1SBRA 1HKAA 3MXIA 3AO2A 3GYGA 1JL2A 4CHNA 4KGZB 3ZC4A 3J8AA 2CQPA 4DUYJ 1W97L 1VSFA 3JQMA 4RKUC 2KFYA 2KKHA 2YHBA 1AA1B 3D28A 2HAIA 4QR0A 4ZTJA 1UA1A 3OYLA 2KHDA 2B8QA 3NNHA 3WQTA 4QWAA 4WE1A 3RW6A 2ASJA 3QRQA 2RE2A 1GTHA 3A3NB 4IOCL 3NWRA 2AWZA 1VK8A 4EWTA 2E2NA 2BA9A 3P39A 1F3FA 4IFYB 1NSAA 4ENOA 4NXMF 5IXUA 2HQDA 2EBEA 4CFDA 3LF0A 5D8HB 3ZCMA 3KLEB 1LWCB 4FPAA 4ZPAA 3HHKA 4OHYA 1HBNA 1B0PA 1DLOB 4IRKA 2RD5C 2FSJA 3S3MA 2V2ZA 2W42A 2DPJA 4PQAA 3M6GA 2YWGA 4B8CA 2NXEA 4DSEA 3H08A 1N33J 1TV6B 5IT9Y 3H2LA 3PIOQ 3CCES 4HT5A 2YX4A 3VZHA 2XY5A 1RA6A 2C3PA 1VS3A 4CIFA 2WCXA 3RRKA 1NXIA 4KY3A 1OKJA 1UPPA 4MKYA 1MMDA 3QZ7A 5MLCQ 5AXKA 1VC6A 4DV6F 4DFJA 4OJGA 4IDKA 1R3NA 3RAQA 4WYBA 3AJ1A 3KK1B 5IC6B 2E8AA 4CBUA 4CLKA 2GIQA 2QWPA 5HMYA 1RT7B 2L9DA 3T1AA 4DSLA 4CZGA 5DM7Q 9RUBA 4DFKA 5HRRA 3CDEA 1IN0A 5KTQA 2YNFB 3IFRA 1EKSA 4KFBB 2DFFA 5KFLA 1BUPA 3AVHA 2QZ8A 4BC9A 2VG5A 3IFEA 3OV7A 3T9NA 1I94F 4C11B 4OX9J 3EXYA 2O8EB 4Q8FA 2AZ3A 4IO8A 3P4UB 4FM1A 2DGVA 4LFBJ 3CJ3A 2CVIA 1S48A 2XO6A 2CJQA 2AQ4A 3VEYA 5MAOA 4DQSA 4B9QA 1F9HA 3T69A 3O8MA 4X4SA 3L8BA 3TAQA 1UKUA 5DM6L 1MMLA 2ADCA 3DCAA 3ZZTA 3G10A 4YUDA 2HHHJ 3VQDA 2UVUA 2UZAA 5GMDA 3CUNA 3ZLJA 4I6AA 5EN1A 2M52A 5F8NA 4CLLA 3C19A 1RT1A 3AAWB 4DTXA 1N32F 1R6YA 3CCMN 4DQPA 3DMJA 2ZHAA 3CFPA 4MO4A 1G4CA 5JLFA 3MD3A 5AZIB 1Z2LA 1BQMB 1ACMB 2ZNZA 1K1SA 2ADBA 3M2RA 2XB2D 5KFQA 2ZUGA 5CZ1A 3S6EA 4DR6K 4BR0A 3LDOA 2IS3A 2M3DA 2MB0B 3A5OC 1JIHA 4WK1A 4ZP9A 2H51B 1K8KB 2DH9A 3IWXA 4E1JA 1QAIA 1WG5A 4PHTX 1TL1A 3C8YA 2G8KA 3HZGA 2X1GA 2B5JB 2FD2A 2CWXA 3N6LA 4XTTA 3C6UB 4KBOA 2O8DB 2XEXA 1PO6A 3SDEB 5U47A 1VQMS 4K4SA 1D8ZA 4TXSA 2KZMA 1FJEB 2GVDB 3SYZA 5EWEA 2XTJP 4DPOA 3VHQA 1U7LA 4FVUA 3OL6A 3E9PA 4PUOB 4B3TJ 5BPLA 2I0XA 1U0HB 2ZKUA 1C0GA 5KPRA 1LWXA 1OH7A 3PW0A 5ETVA 1R7IA 3DFEA 4AHSA 2C2OB 3NGIA 1RTIB 4LF2A 4H4KA 1S1UA 5C2DA 3OYCA 4GV6A 2HK3A 2P9PA 4P73A 4DQQA 2VKZG 2UUAF 3H4DA 1M5VC 4F36A 4Q44A 2YWKA 5GINA 2OA8A 4OYBA 1RBRA 3NGKA 4DL2A 4YB5A 2L08A 1Z1ZA 4UUXA 3MN9A 1FKAF 3KUEA 1LXNA 3KNAA 1KAZA 3D0PA 4H4OA 2QW9A 1UFWA 3BGRA 5BXIA 2OPRA 1UJ5A 3CG7A 3J7Z5 2KVQE 3V6JA 4KGKA 4ZPVR 2PMZD 2E2QA 1VQ5N 4OLAA 2F40A 2CQ2A 3AA4A 5H9FJ 4DV5J 2WONA 2CH6A 1FCAA 3RYLA 2CGKA 2V2QA 1IR0A 5E3RA 4LF1A 3NGRA 3W5XA 1HBUB 4QR1A 2NNWA 3ZO7A 3IBWA 2HAFA 5HVFA 3NP5A 3AVMA 3ULEB 4LBIA 4MDAA 4B8AB 1XUPO 1U1LA 3I55N 3D3CJ 3NG8A 4XEIA 2W25A 2AX0A 3EYZA 1RBOB 2ATLA 4GVMA 4BGAA 2P9IA 3OR2B 2HNYB 1RT6A 1C0TB 1WSGA 5KPTA 2AGQA 5HRSA 2XSJA 4IG3B 2R42A 2ALZA 1NGCA 3IO1A 8RUCA 1JLCA 5HLFA 4GKJK 1X31C 3JAMY 1TL7A 2AYGA 4NLSA 4CE9A 4K2JA 1H1VA 2RT3A 4RUCA 3BGOP 2DCLA 1VISA 2IYGA 4RW4A 1R8BA 1Q86T 4YORA 4UY8O 3OYDA 2I8EA 2QE5A 4MIWA 3CFRA 4YB6A 2F4VF 2CPFA 1RAGB 3A4TA 5AQOA 2YH0A 1GH8A 3T5JA 2MMYA 1JLFA 1JXVA 2Q6BA 1H74A 1Q16B 1V4SA 1DTQA 1S0OA 4K8XA 2DNOA 1T9VA 4BC5A 4AILC 3ET6B 5E33A 4RW8A 1WSVA 3Q0AA 1VQ4S 2VG7A 1VQ6S 2Z4PA 3QIPB 2KXHA 3TANA 3UFCX 3SLCA 1P8ZA 4DBQA 4ECYA 1HFEL 1N8RT 4B9TA 2HQGA 2QIFA 2F9DA 5I4MA 2QO3A 1G7CB 4KGXB 1BWEA 2GMHA 2YVSA 3O9UA 3HFZB 2Q0UA 2K2PA 1XNRF 3BZQA 4LSNA 3SSQA 4K4XA 1N32J 1FWLA 5AQQA 3MAAB 3R97A 3DGPA 3PIPL 4YS2A 3BGUA 3MMAB 3OYFA 3OYMA 1MWKA 1XIQA 2ZC4A 2W8LA 3GJSB 3JXOA 4JI5K 3PACA 3M32A 2YNGA 2C2RA 2R7RA 5F8HA 2HK2A 1LKZA 4CH0S 4IJNA 5JVGL 2G8HA 2MY8A 5KFSA 3CDUA 4KV8A 3PW7A 2MDAA 4H4KC 3OS2A 3QEVA 2IA0A 3RB0A 4BRHA 2J76E 3R1LA 4LFCK 4M5KA 4ZVFA 1AROP 4FJNA 2M9KA 1NOZA 4OLOA 4K41A 4FPIA 4CZCA 2PI5A 4WZMA 3KYLA 4HHUA 3G86A 2F8TA 3CWJA 4J9QA 3VQBA 4TU8A 3T9ZA 2E7XA 1N48A 4LF4K 5J1PA 3AAQA 1PC5A 5HBMB 4DN9A 3DC2A 1DQ8A 4W98A 2QC3A 3VOVA 2X3GA 4E7LA 3GFXA 1NDPA 4F02A 2NLXA 3OQ2A 1A5VA 1QAJA 3QETA 4HDHA 5IC4B 1LWFA 3DRSA 1YI2S 4KRWA 4KPYA 3L0QA 3EDRB 2XCPA 1TZ0A 3C16B 4PG5A 4HI2A 1IKXA 4GV9A 3OW2R 3QEXA 4CT9A 1HNVB 4NI2A 4TU7A 3F41A 2R8GA 4JD2B 4EYIB 2KI2A 2UV8A 3KJVA 1JCGA 3I5AA 3ETOA 1MWZA 3CMES 4ZJOA 1X8DA 3FMBA 2IMOA 1Q7YT 4WCEQ 4CBWA 3P8BB 3GYNA 3W2VA 3FMWA 5KFZA 4WYLA 1A5XA 1T02A 3CCTA 4BDZA 1P8GA 1U02A 3TQ1A 2UXDJ 1XC9A 4AXJA 1L3VA 3DXMB 1VQ7S 1Y11A 2VFUA 2C2EA 3HRGA 5GAEP 5DDPC 3NH1A 2J0WA 2FPHX 1N34F 1RBAA 4J2EA 3O4QA 1FXDA 2R7QA 7FDRA 1OYDA 2FC9A 4LRFA 2VBYA 2GV1A 4CEZA 1C6VA 2HWIA 2FZCB 4C8LA 1KCFA 1UFLA 2ZQBA 3TX0A 5DMRA 4RW7B 1WD6A 4ECTA 1YBUA 2OHDA 2U1AA 3KHLA 1BUXA 4ZLJA 5T7BA 3I0SA 3DKDA 3V4MA 3ZSQA 4E3SA 1RHMB 2O01C 4JI7K 2QTWA 2QA1A 2BACA 1KRPA 2V63A 4KIAA 1UJ6A 5F8MA 5IQQA 2FC8A 2BJ8A 3UDCA 2PMHA 3TA0A 3JB9k 2DNGA 1FJCA 2QA4S 1CVJA 1S1WA 4RUAA 1JXEA 1NGGA 5D4LA 1Q4RA 1GXLA 4B3RK 2BM1A 2ZOFA 3IGVA 3UWTA 4RNOA 2NUBA 4P7TA 1RDBA 3P31A 1B99A 3SMSA 3KXDA 3KKRA 3CB4A 3SQ1A 3GIRA 2F4VJ 2IVPA 4ISFA 4CD3A 1LWEA 3DOLA 4GVEA 2IDEA 3MCMA 2RVJA 2NLWA 2V4JB 1ZS6A 3VF4A 4LF7F 3L6QA 4R79A 1RBLA 3CIZA 4RW9A 4WIIA 1NNEA 4PWDA 1CULA 2HQ3A 5IWAK 2DPIA 2VDHA 5L1JA 1JMTA 3OTOF 3W66A 2CA9A 2A5XA 2OPPB 3MN6A 1BU6O 3F44A 4C1NK 2D1CA 1JKHB 2VONA 1YJUA 4U8YA 1R6VA 4CECA 3H45C 1RE1B 2UUCF 1Y64A 4CGHA 5F3ZA 4DG1A 5L46A 1NB7A 4LRDA 2G2YA 2HIYA 1GOBA 5JMVA 3HT3A 3QEIA 4ZPTR 4Y65A 2LXIA 1MWMA 2ZBCA 3U4LA 3VESA 1EETB 5ELZA 1HNXK 4WFZA 2AEFA 2DR9A 4JUZA 4IFVB 2LEBA 5F0XA 4DL0C 2ROEA 4OIXA 2P9KB 3TWHA 5AJ3J 3V81A 3L7PA 3IM9A 4DU1A 3KKSA 3B6PA 5KPZA 3R7NB 3FZLA 3WHIA 5I3PA 5AQPA 4O4GA 5IM0B 1FKPA 1D5AA 4O3PA 5GAHU 3CM5A 5M1PA 1QUPA 1WHYA 2KW4A 1Y3KA 3V9SA 3K89A 1ASVA 1JLBB 1EJ7L 2QTDA 1VC5A 1WHXA 2HS4A 2DY4A 2R2RA 1WG4A 1FRMA 4HR2A 5LXYA 3V9WA 3BPDA 2VG6A 3QGHA 4IOAQ 3OT9A 4K25A 1X1PA 1W2BM 2HGMA 2UXCF 3THXB 4JI3K 3PO4A 1WDDA 1U09A 3RTVA 1FFGB 1HNWJ 3MCNA 3UNGC 2X1AA 3CC2S 2UUWA 1TYQA 4Z7CA 2C3OA 2RUGA 1NB2A 3VGMA 1WAJA 2BKNA 3KJNB 2IM2A 3US5A 1HQEB 3SCJE 4ZHRA 3CMAS 3AOBA 2HVEA 1NK8A 4H0XB 4MKBA 3DRRB 1XWLA 3BP8A 4L8RB 5CH7B 2VU5A 1FKOB 4X84A 5J2MB 4X4NA 2YKAA 1JLGA 4R5PA 4BDYA 1BHNA 4X66F 4KHSA 3OTDA 3VGVA 4CGFA 3D3BJ 3GSDA 2KJWA 4CDIA 2IRYA 3IGNA 3SBTA 3FCWA 3J81U 1EKEA 3BGLA 5GADP 3BREA 2YKQA 3SQGB 1VHIA 4EO6A 1QHTA 3AXMA 3HPGA 2PFDA 1GAOA 2P9CA 3CYMA 2E7WA 4EZ6A 4CEAA 2NQPA 2YWHA 3EL2A 2XGPA 5C25A 2YQ0A 5C7PA 1FJGF 5E84A 2C42A 4Q0BA 2KM8C 1W25A 3EE9A 3RVCA 1NM1A 2WVCA 2O67A 5KT7A 4URGA 2KT5A 3UNYA 1VQMN 4ZLPA 4CO5A 4IG0B 3SJHA 1UVMA 5BR8F 1RQ0A 3TTFA 3QT8A 1X0FA 1WI6A 4Q2LA 2QSWA 2G8UA 2UUBK 4W90B 2CUYA 5FPNA 5B0FA 1Z26A 1S9EA 3I6PA 1W7AA 5KFCA 2UVWA 3MCPA 3PG9A 3C7NA 2UXBJ 1GLJO 4KO0B 1YRTA 3N01A 3M8PA 4U96A 2C3YA 4FLYA 1Z6RA 4A8WA 1C1AA 2C2NA 2COLA 1B3TA 1WG1A 4CLPA 3OFFA 4K0KF 5IFMA 4KHMA 2HSEB 4TYAA 1PJ6A 3KUHA 2ZD1A 4U7UK 4YOXA 4A8OA 4IOCQ 3W61A 3M30B 2FTRA 2ROPA 3NGYA 3P38A 4FK4A 2YI1A 2GS8A 5CA5A 4FPRA 4QU6A 1PYTA 3TAPA 1X4DA 1CS4A 3SPZA 3QJJA 3R2CJ 1UAXA 1DQAA 4JKGA 5FPEA 2M8HA 1GQEA 4UOFA 1J5EJ 5BREA 4WK3A 3UR0A 5GMEA 4LH4A 2HFOA 4CO0A 4LF9F 1JQGA 3AA2A 5AZJB 2BXJA 4BRGA 1SC3B 2ZITA 5I9EB 2E1YA 4WJBA 3A2FA 3MPWA 1G1XA 2UUCJ 1HMVA 1RILA 1IBMF 1OVYA 1D9FA 2Z2ZA 3AA3A 2CG8A 4ZIWA 2PFFB 2I9SA 3ZYYX 1NJIT 3AAPA 1JJHA 2YXLA 3SSSA 1X3MA 3W3SA 3CCUN 3M2VB 2ZE2B 4MK7A 3FUYA 4AL5A 4U7UD 3DNCA 4QWBA 3QQCD 4KGMA 2A2CA 3HM9A 3MMCA 3THYB 4WTYA 4OZLA 1FXLA 1NDLA 1RAEB 2OEMA 3MR5A 2FYXA 5F2RA 2MGZA 4A46A 1NH7A 3DLGA 1D9AA 3MPDA 2CPXA 4HL9A 3R5CA 3D1OA 1BA0A 3ILIA 3CPEA 3JQJA 1YJRA 5AQMA 4B3MF 4DV1F 3HD1A 1NPKA 4EP4A 2VUGA 3CCRN 2CPDA 4IYQA 4USWA 2HB5A 3TJ8A 1QQMA 3J81j 3ZNUA 3IG1B 1B7YB 3UPFA 3BF4A 4PG7A 3ZSWA 5G0RA 1RWVB 1VRUB 1HJRA 3DJCA 4H5TA 3OVNA 2DHSA 5HROA 4IH7A 4DUZJ 1ZM4A 2DNZA 3NF9A 2LSNA 2CNNB 4B1ZA 1VQ6N 1M90O 1SQEA 2HPUA 1XI1A 2WK4A 3AODA 3ID8A 3A13A 5B0DA 5T7LA 1HQUB 2HWTA 4CEBA 2E9TA 4NLTA 2UV8G 1O13A 1WELA 5M1QA 3WUHA 4ZLNA 4JI1F 3MMJA 1RK8A 4ECVA 4BR2A 1WF0A 3CC4N 1C0UB 3GU0A 3I5CA 2Y1JA 3IC1A 4CJ5A 5JMNA 1Y5NB 3GBTA 3R5AA 5GAHP 4FWQA 3B54A 5K14B 3LTOA 3PJ9A 3R5GA 4PA1A 1RAHB 4IOBA 4DR1K 2YKMB 3ZT1A 1IBLK 1S0MA 1K73O 1U2FA 2N4CA 2CQ3A 1G6BA 2W7AA 1VCTA 3O1LA 1YJTA 4A8MP 3WEEA 3DAWA 2LMIA 1P90A 3CJBA 3NH0A 1IKVB 2ZWHA 3SSRA 1MN9A 1ZBFA 4JI0F 4EHUA 3LUYA 4OV1A 4J7CA 4PXEA 1S6OA 4NMLA 1X9MA 4X4OA 4YR2A 4CQ1A 3V6DA 2DEIA 3U7JA 3G6VA 3MGJA 1UW9A 2E5JA 2FVPA 4FM0A 1FJGJ 4TVAB 2E6MA 1GOCA 1EX4A 4Y0WA 4E98A 3MM6A 5HAOA 2DKOB 3NF8A 2D7SA 2HFUA 1WTFA 4ZVEA 5BR8J 1VRQC 4H5WA 4R25A 1FTRA 3VVUA 1XTZA 3V9UA 4DX6A 3R5DA 4DL6A 3Q7CA 4V19J 2QEXS 2VQFK 3RAMA 3BSNA 3D5MA 5MLCV 2Q0RA 1L3KA 2U2FA 3ETMA 5AQNA 2OP5A 2XMAA 1Q95G 1S9GB 4FJHA 2KZZA 2QL9B 4YB7A 2MZSA 4GO5X 1RKJA 4LF5K 3VTIA 1MSWD 3CJAA 3O3LA 4DV0F 2E1CA 4H0YB 3CMEN 1FXXA 1PCAA 2ASOA 1IBCB 3GG1A 4DV7F 2CNKB 2OPQB 1BDGA 4DR6F 5DG9A 1IVZA 1ATRA 3MECA 3BEGB 4JI4K 4ZA1A 5F3TA 4L75A 4ZP7A 2D69A 1OS5A 1BL3A 1Q81O 5H9EK 1RWNB 5I3UB 1YZ6A 2M2BA 5SZTA 4CF8A 3O9RA 3ZETB 4CW7B 4TU9A 5F8LA 4USIA 4CEDA 3P3DA 1Q9XA 1PJ7A 1VDHA 4NYFA 4LUBA 3R5JB 5TKYA 3CFOA 3BM7A 3TUJC 3L2QA 3CQYA 3DOKB 3W0LA 2ZDPA 2AYEA 1NUEA 3VA3A 4TY9A 2WW4A 1B0VA 4UT4A 3MEDA 1NSPA 4W5TA 3PHEA 2OJ3A 2MLZA 3CJ7A 2BJ7A 3UI3A 7FD1A 1KQFB 3C6TA 3K5LA 3TZXA 3AGRA 2P1JA 5D4NA 4YY3F 4OX6A 3FQLA 3T3FA 3AVJA 1UVIA 2PD1A 4KHWA 4NEZA 2RU9A 3SFUA 2XMWA 4CJ4A 3J7YI 5EU7A 4NLVA 1AZSA 1HR0F 4RCHA 1TL3B 3L2WA 4JEPA 1KTQA 2B9YA 3R7BB 3C0BA 1R8AA 2EFVA 4B3MJ 4DV1J 1NZAA 2RN2A 4DOZA 3AO5A 3JTOA 2MQMA 2BR0A 4AH9A 3DM2B 2BBEA 3LP2B 2BEFA 2E5LF 5GIOA 2VBZA 3IDHA 4MK8A 1DY3A 2Y1RI 4FL9A 3NRBA 4K4WA 3GOIA 2ZM6J 3EZ5A 1X60A 4D3HA 5C42B 4JI2J 2M70A 2NXCA 3AFGA 2OYQA 1N52B 4DCPB 4DR7F 1G15A 2O8FA 1H7WA 1VQLN 3THWB 2VODA 2FJBB 3PVXA 3Q83A 3BO3A 4FJKA 2A40A 2HBYB 5AQGA 3GG0A 3W64A 1XN9A 1BIZA 5J1EA 4CJWA 2RKIB 3QFWA 3V2UC 2Y8YA 1N33K 4BCAA 3H1VX 4M63A 1U1KA 3CJCA 3OBYA 5K20B 1GMUA 1D09B 2VC1A 3ZT4A 2B6AA 4KQZA 3FRZA 4N47A 3TI0A 4BC4A 3KLGA 5KFBA 4OZ0A 3BZKA 1BIUA 3PIPQ 5T41A 1R0AB 3ENWA 2DTJA 2HBJA 3I0RB 2ASYA 2CQGA 1HWJA 4GKKF 2N82B 5DG8A 1N5VA 5B08A 5ETOA 1IUJA 4DX5A 4OPAA 5JVGQ 4R8UA 1F9FA 5K5MA 4P10A 3CCQN 3IUCA 2OFGX 2K1RB 3MZIA 4H0OA 3ZZOA 5HVGA 4ILJA 2Y1LB 3BYPA 1TVRA 1RTJA 2E1RA 5CY4A 1HNZF 5KFGA 2DVIA 3OTEA 1RWMB 3BKUA 5G4DA 3ZEUA 2XI2A 3SCKE 2HNDB 4LBPA 3WBZA 3SK3A 1KLMA 2EG2A 4AT1B 3JSRA 3HHLB 4DWIA 3F2KA 3UKRA 4HVZA 3ZZ0A 1DT9A 4UOCA 1CZBA 2H48B 3SJJA 2BJEA 4KB7A 3A1YG 4GVLA 1U1QA 5A0YB 2RF2A 3WX8A 1SJ1A 2F5GA 2HBMA 5CCLA 3M1VA 3NMRA 3I33A 2G8VA 3WNFA 2IVOA 3AVAA 2HF4A 2D3UA 1PJ5A 4FP9A 3CC2N 3ASMA 1LQ9A 3CE8A 1WORA 2ZZTA 2EFNA 2O8CA 4BACA 3RB3A 2ZEJA 4X62K 4JI8K 3VQ4A 2Z2YB 1KC8T 1KKHA 3HKWA 1SZ2A 2P9NB 1CQMA 1PIEA 2I5JA 2F63A 2W9BB 3H98A 4ED4A 4JKDA 1HBMA 1NLKL 1SJQA 4JV0A 5B0GA 3LWLA 3Q8QB 4J9UE 3KK7A 2BKOA 4ALZA 5DDOC 1V5VA 3MM5A 1MWQA 2IFXA 1DKGD 4A8KA 3M05A 1JLEA 2W40A 4EGLA 3IKMA 3W9HA 1XMOK 1BC6A 3GFHA 2V6AA 1Y7PA 4GC7A 2JEIA 1Q82T 4GMJB 2R7XA 2G2OA 2XWXA 2B4JA 1F3VA 3Q23A 5KGWA 3EZUA 5I42A 1WC4A 4B3OB 1VR6A 3EGNA 1O8BA 2VPZB 4J2DA 2FHJD 1M5PC 2D0AA 2AJFE 3JYTA 1YSJA 1P27B 1Q9YA 1VQSA 4FJJA 5HVHA 4ECRA 3NL0A 4H5NA 4IOXA 4ERDA 1GX5A 3M1FA 1N6QA 4B9NA 1LW0B 4JKBA 3ZZUA 4X4PA 4YY3J 2BW7A 1CJTB 2EG1A 2YY3A 3HYFA 4EFAC 4B3TK 5AR0A 1N36J 3JS6A 1WOPA 4DV2J 1Y5LB 3NNCA 2E66A 4FDFA 3EM1A 1RT4B 2ZZNA 4M63C 1HR0J 4O44A 2QG9B 2V2VA 2G8FA 3MXHP 3IR6B 4IH6A 2DO4A 2NRTA 4XO0A 3RR8A 1YJNS 4DSFA 2BOPA 1G2EA 3OFGA 2DIVA 2D3O1 3I9ZA 4IFYA 4WFBQ 3UN5A 1FDNA 1V4TA 5GVQA 3NH2A 4NXMK 3KLEA 3I56S 2VA3A 2QXLA 1WC5A 1REVA 3QAEA 4DR7J 4J2AA 4PABA 1DLOA 3AGKA 4DQ8A 4HHHA 2CAJA 3SCLE 1R0BG 4IQMA 3ISNC 1X4FA 2QSFA 5H9FK 3S8SA 2C22A 2NRHA 1DEJA 1TV6A 3AB4B 3HK2A 3PKYA 1HLUA 1KVCA 2E5IA 4R0JA 4E1NA 4DR4J 4MLHA 4FK0A 4EEYA 4JP8A 3ZSOA 1UEKA 4OKEA 4CERA 2V4RA 1X4GA 5DLFA 2O1PA 4C0OC 2QFJA 2BRKA 5IT0A 4GKKJ 3W1YC 4WF9L 3M8QA 4E7KA 2B4PA 1HQ2A 4DV6K 2VQEF 4CGGA 3KK1A 5LM7E 3ZTPA 2YX6A 2DGOA 1CJVB 2WAQD 2NPIA 4LF6F 1ZPWX 3NCQA 1RT7A 3RBZA 1KBRA 3KLFB 1RUSA 4P72A 4JKCA 2E6LA 2UVVA 3HLUA 4USTA 3T1YJ 2B3TB 2YNFA 5DLGA 4PKHA 3FFIB 4KFBA 4IXCA 3SQ0A 1YJWN 1RYSA 5AQUA 4ELTA 1YGYA 3TUIC 5LMUJ 3FCHA 4BQLA 4C11A 2O8EA 1HJOA 1U25A 1I94K 1FVQA 1HI1A 4CRJA 3ENHA 4FKYA 3KHRA 3K0JA 4A4JA 2OKQA 1S7HA 1D8YA 4F0KA 3BO2A 2PYLA 2VJUA 3Q8SB 5LT5A 2AIRB 4OL8A 1IBKJ 1M1KO 4QJVA 4DJBA 4NYNA 2N3LA 4C4WA 3E2EA 2P5GA 1ZTTA 1U1PA 5KG7A 1HKCA 1RBVA 4WKRA 4F50A 4HCBA 3FRYA 2L9WA 3X3UA 1YJ7A 3LP3A 1P6TA 4ED1A 3B6OA 4LSLB 1ZZFA 3H2VE 2QI2A 4I1TA 1T03A 4BWJA 4JI6J 1BG3A 3M6VA 4P7VA 1YKWA 3Q8PB 1N32K 4KH1B 1T9UA 4LIRA 4N76A 1RT5B 2FF3B 5AQJA 2FLLA 3AVIA 1BQMA 3J7ZT 4XH5A 2OD4A 1HARA 4IZ9A 4CJKA 3QEWA 2Q31A 1NO8A 4Z7YA 1WAFA 1BQNA 1QAXA 3UQSA 3CM6A 3CC7N 3LH2S 3TABA 1K8KA 6FD1A 4O3OA 4DV3F 1NMEB 4FSVA 5A8WB 1EB0A 3Q2SC 3NNAA 3LM2A 4NYZA 3CCLN 3D6RA 4YOUA 2B5JA 4JK8A 4OHWA 3CQXA 2CQ4A 3ISND 3B8AX 3T1HJ 3MXJA 2NSCA 3DXSX 3I9V9 1S77D 3C6UA 3SDEA 1KHWA 2HFSA 1F60B 5KG4A 3GONA 3QGGA 3D7EO 5CE3A 3BF1A 2HVHA 4QPXA 1PAEX 2GVDA 3W65A 1A0OB 5KFTA 4O3SA 4NRUA 3TAMB 1SL1A 5DO2A 3PX0A 2PT0A 3IP0A 4G1IA 4PUOA 5L1LA 1U0HA 1K47A 1HW9A 2ZJRL 5EHHA 3BBCA 3DRYA 1APSA 4UTGA 3O6QA 3AVKA 2E4LA 4N77A 3VZIA 4M3YA 4YB1P 1NZ8A 1UWAA 5F0UA 2NREA 1QE1B 4DV4F 2IPOB 2GVZB 3ZT3A 2UUAK 4TLQA 2ZWPA 2FVRA 4I68A 4CHZA 2NXUA 4W5OA 1VBXA 4CO1A 2HNZB 4LF8F 2ACYA 1XNQF 2GUIA 2DEJA 4H54A 4I4BA 1Z05A 2HMIB 3HD2A 2UXDK 3MEGB 2OUGA 3U9ZA 3SV3A 2VWBA 2B8PA 3UD5A 1EARA 4JLHA 5L9XA 4ZPBA 2V0NA 1YJ9N 4FW2A 4IJAA 3OXFA 4QIVA 1Y4ZB 3OD2A 1HBUA 4JV5J 1F5CA 3ULEA 3DLKB 2XSFA 4DCHA 5F41A 2V94A 4X65J 2FUG9 3CJ5A 3WZ0A 3ENBA 3QDKA 2HNYA 1IH7A 2APOA 5DGBA 1PKUA 2ZH2A 1NGFA 4BC3A 1T8EA 4IG3A 1K0VA 2VKRA 1HHTP 1R31A 4DSJA 1RLDA 2DD8S 2Q6CA 2MQLA 1MWYA 1FRJA 4DMZA 3ZNJ1 3HBTA 4BREA 4F2SA 4ICLB 2JC0A 4HHJA 3TVKA 2EC2A 2YWFA 4CJEA 4HCCA 1TKXB 4CO4A 3D45A 2FHMA 1QS4A 2DR7A 3BS9A 2P9SB 2CPJA 5AQKA 2E1ZA 3I8DA 4X64F 4MIBA 2YKOA 1QDUB 4KHPF 5M1OA 2DXDA 3IXQA 1LFPA 2IC3A 2OANA 4F25A 2F4VK 3OHBA 4CO2A 3QRPA 3H2UB 4FF2A 1E3MA 4ED3A 3BDPA 2GJ2A 2W41A 4RG8A 2XMTA 3P5TL 2EX3A 1LFWA 1RTZA 2Q36A 1T3NA 2R7TA 3ET6A 2E5GA 4H5RA 2CJBA 1ATNA 4WP9A 3BY5A 4CESA 3QIPA 1F2GA 3S9HA 4DCJB 1MDUB 3VGTA 2XBPA 4KH4A 2VFSA 2ALYB 4Y2CA 4ES1A 5AT1B 2A3JA 2W01A 3W9JA 3AVBA 1NSKL 2DIUA 1XNRK 1JNZB 3MAAA 4CJVA 3F9MA 3HSGA 2IIRA 3J7A1 2OZMA 3C15B 3FNNA 4ZJQA 2WHOA 5KFDA 2ZH9A 2KJVA 1IR1A 4GY2B 3VAMA 1QQCA 4DHYA 4WE1B 2R2SA 2G13A 4RX6A 5DETA 2M88A 4P9SA 2HQCA 2HHXA 3T19A 1WJ9A 5K8PA 1U2RA 4L3NA 3GV5B 4AQYF 1UJ4A 3SQ2A 1DTTB 2ZOMA 3OR1B 2UU9J 3GJTB 3AHPA 2AKWB 2MZTA 4BR5A 3CPWR 2IRXA 5FLXY 4HTIA 4OHXA 1QJHA 5HBMA 2WSCC 1Q1KA 1N0VC 4X4VA 1HBNB 2GQQA 4UOHA 2LECA 3MMBA 4B1WB 4OPHA 4NB4A 1CC7A 3ZSYA 4O0JA 2DFHA 4KBIA 1C1BA 1ZPVA 5F8JA 4EAHD 5M1NA 3C16A 4OLBA 4JYAF 1GLFO 2CZVC 1NGDA 2GWKA 3WX4A 1HNVA 4CFCA 3SXLA 1RABB 3R6GB 4JD2A 2Y8WA 3G9CA 5AQSA 1UVLA 4J9PA 1YITN 4KREA 2A1BA 2EFGA 1KOOA 3Q86A 4W4MA 3VQEA 1MW7A 2KLAA 1KVBA 1A7GE 5F1XA 2MKJA 5BJRA 2HG4A 4CWBA 2GO9A 1N5YA 3E51A 1TK0A 1KVAA 3UN2A 5HJXA 1VJWA 3N0VA 3HSJA 1OH5A 4QIEA 3DXMA 3G87A 4DR5F 3NEKA 4OHVA 2CGJA 1C2PA 4ZPDA 4FYXB 5CCMA 1S57A 2ZBPA 1ZTWA 1N34K 1C1CA 4MQ3A 4JN4A 3GE1A 1EO1A 2DNHA 3CIMA 4Y34A 2DJWA 4KRFA 1LEOA 1QVGR 3WXLA 2JLEA 3R5BA 2W9CB 4PQUA 2BJ3A 1HPZB 4LY7A 1ZYQA 4X4RA 1NK4A 1F21A 2A6AA 3M3ZA 1KVKA 4CF0A 1X5PA 3HPOA 4LF5F 3AJ2A 1WACA 2LXFA 4NOHA 3DOMB 2RHQB 1H3DA 3UDEA 1QSYA 4DR3F 1HYVA 3CHWA 3A0IX 3DMJB 3ELHA 2XS5A 4F4YA 1FRXA 1YHQN 3Q8RB 4WFAL 4RWWA 3O1WA 4O55A 3M2RB 3MR7A 4NXNJ 2RDDA 4CJPA 2XLKA 3KK2B 3D0IE 4WWSA 3S01A 2Q1LA 3L7UA 5KOWA 5CYJA 1J9AA 1VQ5S 4ISGA 3BR8A 5FJ4A 3BH7B 1T9TA 1KXPA 1I3OB 1UTAA 5L39A 4LF7K 3NCPA 3I56N 3OXGA 3Q2TC 5E7OB 3FK4A 1IJEB 3Q24A 1BWVA 3O3FA 4YQWA 3KDOA 3FLCO 2OPPA 4MLEA 4BRNA 1YBTA 3V4IB 2GW8A 3OTOK 4MAKA 1EZZB 1JKHA 2WVEA 3I55S 1S5ZA 5HQ8A 2KFNA 3VALA 2Q3PA 4HACB 2J4RA 4LBHA 4F3OA 1FX2A 2BKPA 1H2VZ 2UUCK 1A6LA 4ZKAA 3PX6A 4PXCA 3O5TB 3U1NA 3W7BA 5HL7Q 1S4EA 1VQPN 2BJDA 1GNKA 1KD1T 4CH1A 2MHNA 4K8ZA 3MEEB 2HZAA 3ZSRA 2F7TA 5CHCB 1XMQF 3HSDA 1EETA 3N4PA 1KVJA 5GMKa 4U9RA 4IFVA 3CJ2A 1SKSA 3GYXB 2RH3A 2OIHA 1S1UB 1ZA2B 2W9AA 4ITSA 2P9PB 4GO7X 5H1SV 2QWNA 4DUYF 3H90A 1SQKA 4EI2A 3VAKA 3S41A 1HA1A 1HBOB 3V6KA 1TL5A 4HTLA 1FESA 4H4OB 1VBKA 3RR7A 5IM0A 4AQYJ 3J80O 3HPHA 1QHAA 3CSKA 3UN3A 3WXKA 1E4GT 2A2DA 4ZVSB 3MK6A 2YNHA 1JLBA 2XS2A 2PMWA 1S0VA 3VEVA 1AW0A 2FVSA 2KH9A 3I96A 2MQOA 5KFHA 5LJWA 1U2VA 5M2UA 3ENVA 2WBNA 3ZZZA 2IJRA 3NHGA 3MOJB 3LA0A 2XRIA 5AE1A 3PLAA 5AE2A 1T95A 4CZMA 1PAUB 5RUBA 3GIKA 3THXA 2R7VA 2UXCK 2FGCA 2GO8A 1N0UA 3LL3A 2DO0A 2J7WA 3AD7C 2YH1A 2P9IB 4IH5A 4RBTA 4PKDB 3N6NA 3A8YA 5LJ3Y 2DFEA 2DK2A 1ZXOA 1KVIA 3U3GA 3M5RA 5GAEI 3DRRA 4P71A 2PGCA 3NBPB 1FE4A 3NVMA 3DXBA 3FZ2A 1LAVA 2PA8D 1JLCB 4EZ9A 5J2MA 2VIHA 3OSNA 4O5FA 4CJFA 4ED2A 3AO4A 3AY9A