1N5ZA

Complex structure of pex13p sh3 domain with a peptide of pex14p
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
71
structure length
71
Chain Sequence
b'EPIDPSKLEFARALYDFVPENPEMEVALKKGDLMAILSKKDPLGRDSDWWKVRTKNGNIGYIPYNYIEIIK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Peroxisomal membrane protein PAS20
publication title Topography for Independent Binding of alpha-Helical and PPII-Helical Ligands to a Peroxisomal SH3 Domain
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Protein transport
total genus 13
structure length 71
sequence length 71
chains with identical sequence B
ec nomenclature
pdb deposition date 2002-11-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 1n5zA00
2FG0A 3RBBB 2KXCA 1PKSA 1H8KA 1AEYA 2QDLA 2LJ3A 3JV3A 4E6RA 2KXDA 1RI9A 1JQQA 3QWXX 1UJYA 5I11A 5FWCA 2DBMA 1WIEA 1QCFA 1NEGA 3EHRA 1WXBA 2KNBB 1SHGA 1X69A 4HVVA 2LQNA 1MUZA 3C0CA 1ZX6A 2RNAA 1WX6A 2EYYA 2JXBA 1GL5A 4RTXA 4LUEA 1BU1A 4ORZA 5IHIA 1WFWA 2C0IA 1ARKA 2HBWA 4JJBA 1M8MA 1B3QA 3EG2A 2BZYA 2FPEA 2LZ6B 1CSKA 3EG3A 2LCSA 2GNCA 2KYMA 4DEYA 2ENMA 2ESWA 1M27C 3VS2A 4RTZA 1YWOA 1AZGB 2BTTA 3M0UA 1U5SA 2F2VA 3H41A 1AVZC 4J9GA 2EPDA 1CKAA 1T3LA 3UATA 2G6FX 4D8DA 1K0XA 2L3SA 2FEIA 1JXOA 3H0IA 4JZ3A 3KFVA 2DL3A 3UA7A 4GLMA 1TUCA 1SEMA 2VWFA 1AOJA 2J6KA 3CQTA 5IXBA 2JM8A 4AFZC 4R0KA 1VYVA 3VRZA 1Z9ZA 2KR3A 2RF0A 1QWEA 4IIMA 1I1JA 2GQIA 2LNHB 1UHFA 2EKHA 4ZNXA 2DYBA 3TVTA 2H8HA 4LN2A 3VS1A 2L3QA 1ZUKA 2VVKA 2RQWA 1G2BA 3I9QA 1IO6A 2KEAA 1UDLA 3ULRB 2GBQA 1ZLMA 2M0YA 2CT4A 4F16A 3GBQA 2DILA 2L2PA 4A63B 1WYXA 4J9DA 2PTKA 4AFSC 4OMOA 4AFUC 1K76A 1GRIA 5IHKA 2YUPA 1NYFA 4K11A 2JMCA 3LH5A 1JXMA 2A36A 2EYXA 2EW3A 1J3TA 1SRLA 2HSPA 2B86A 5I22A 5GJWB 1ABQA 5GJVB 1FMKA 2ROLA 2BZXA 4OMNA 2MCNA 4LNPA 2EGEA 1QKXA 2KE9A 1AWXA 1VA7A 4JJCA 2C0TA 3PE0A 3VRYA 1VYTA 2JTEA 1OV3A 2DBKA 1H3HA 2KYBA 2EGAA 2F2XA 1I07A 1Y57A 4M4ZA 2RMOA 2XMFA 4J9IA 1CKBA 4CC2A 1E6GA 1XOVA 2KT1A 1GFDA 2NWMA 1UJ0A 2O88A 2KGTA 1U3OA 1ZUYA 3PVLA 1LCKA 4RTWA 3R6NA 2J05A 1JO8A 1WI7A 2FRYA 2JT4A 2K3BA 4CC3A 2JM9A 1UUEA 4RTTA 3EG0A 1AD5A 4OMQA 1FYNA 1NEBA 1ZUUA 2A37A 4ESRA 3VS0A 1KSWA 3VS6A 1T0HA 3REAB 2V1RA 4HVWA 2ED1A 2K79A 2HCKA 2DM1A 1BB9A 1M30A 4AFQC 5EC7A 4J9BA 1K4US 3PVQA 3FJ5A 2RQVA 1X6GA 4D8KA 1S1NA 1WDXA 3ZL7C 1M3BA 2CUBA 1WXUA 1AZEA 1PWTA 2CH4W 1UFFA 3M0PA 3EHQA 2J7IA 1JEGA 1W1FA 1E7OA 2HDAA 2O2OA 1PRLC 2DLPA 4J9CA 2LP5A 2O9VA 4DEXA 1TUDA 2RQTA 2EYWA 2DRKA 1YNZA 1W70A 3IQLA 1OPLA 1QKWA 2RPNA 2X3WD 2BZ8A 1YP5A 3UA6A 1NYGA 2J06A 1WXTA 1SRMA 2ECZA 4X1VA 5IHNA 2YUQA 2EBPA 1K1ZA 1UECA 5L23A 1RLQC 4Z89A 2DE0X 2ED0A 1OOTA 1T3SA 1GCQA 2CSQA 1PKTA 2AKKA 1YCSB 2FPDA 2JMAA 2D8HA 2NUZA 2O31A 2CH4A 2C0OA 2MIOA 2DRMA 1UE9A 1G83A 3M0QA 4J9HA 1E6HA 1U06A 3VS7A 3THKA 2K2MA 2X3XD 3EGUA 2RN8A 4IIOA 3TSWA 1QWFA 1PHTA 3VS5A 1UHCA 1GBQA 1X2KA 1Y0MA 3I5RA 2GTOA 2M51A 2P4RA 2K7AA 2SRCA 4HXJA 4J9EA 3H0HA 2L0AA 3REBB 1PNJA 2YUNA 3VS3A 1NG2A 2K9GA 3RNJA 2LJ1A 5FW9A 1HD3A 2AKLA 2J6OA 2JW4A 3EG1A 4HVUA 2LQWA 4HCKA 4OMLA 3NHNA 1RLPC 1GFCA 2YSQA 1HSQA 2D0NA 2F2WA 2HEQA 1HJDA 3A98A 3NPFA 1AWJA 2OI3A 2PZ1A 3VS4A 3M0TA 1AWWA 2RQRA 5IXFA 4Z8AA 4CC4B 2AZVA 2GGRA 4OMPA 3TSZA 1T0JA 2ABLA 1X43A 4AG1C 2E5KA 2A08A 1SPKA 1UTIA 1JU5C 2OAWA 1N5ZA 1KFZA 2JS0A 2DVJA 2KT8A 2LX7A 2KBTA 1ABOA 4J9FA 4QT7A 2V1QA 1SHFA 2DMOA 1BBZA 2FRWA 2KRSA 1KJWA 4F14A 4RTVA 3M0RA 5ECAA 2AZSA 1YWPA 2RQUA 4CC7A 2FPFA 1WLPB 3M0SA 1A0NB 2A28A 2W0ZA 2I0NA 3SEMA 1M3CA 1X27A 1EFNA 4Z88A 1ZBJA 2O9SA 2CT3A 3H0FA 4JPBW 1AWOA 2DA9A 2J6FA 2EQIA 1M3AA 2CREA 4LE9A 2CDTA 4F17A 1GCPA 1TG0A 2DJQA 2DL5A 4LUDA 4WCIA 1UGVA 1NLOC 1QLYA 3UF4A 2D8JA 1MV3A 1B07A 2KRNA 4RTYA 1YN8A 4FSSA 2KRMA 1I0CA 4GBQA 1BK2A 1K0SA 3I35A 5FWBA 1OEBA 1NM7A 2YDLA 2JS2A 1H92A 2K6DA 1GBRA 1ZSGA 2DNUA 1WA7A 2GTJA 2EVRA 1OPKA 2SEMA 2MOXA 1K9AA 1Z9QA 2FO0A 2DL4A 5HCKA 2CUDA 2D1XA 1W6XA 4JJDA 2IIMA 2VKNA 4KRTA 4OMMA 4AG2C 2DX1A 2W10A 2YT6A 2DF6A 1RUWA 1X2QA 2L3PA 2DL8A 3NMZC 2PNIA 4RTUA 2EYZA 1V1CA 2EGCA 3I5SA 3O5ZA 3QWYA 2KROA 5IH2A 4JZ4A 3SHWA 4EIKA 2CSIA 4Y92A 1MV0B 2ROTA 1UG1A 1GCQC 1NLPC 2YUOA 3U23A 1KIKA 1X6BA 4RUGA 2DL7A 1SSHA 2OJ2A 1PRMC 3NGPA 2LMJA 2AK5A 1VYUA 2LJ0A
chains in the Genus database with same CATH superfamily
1VQ8T 1AEYA 2QDLA 4XTWA 4OGEA 3TREA 3ZFJA 3CBPA 3MEUA 4J6YA 3CMEQ 5FWCA 1WXBA 1K8AC 2LQNA 4PJOC 1HYOA 2ZPEB 1MUZA 4E2FB 3AT1B 4B9WA 2K5FA 4MZPA 2JXBA 4FSXA 4RTXA 4LUEA 4C8QA 4L5GA 1TS9A 1BU1A 3QDFA 4X9DA 2RHZA 4M77F 5GANe 2BZYA 2RHIA 1BCOA 1YI2T 1RABB 5LL6S 5CKDA 3RKXA 3EFOB 1VQOQ 2KYMA 1YCYA 2RD1A 3P8BB 4DEYA 2ESWA 4KH0B 1M27C 4LDWA 3HPWA 3M4GA 5KE3A 1TUGB 4PJMA 2BTTA 5FRMA 1ZHIA 1VQLQ 3BY7A 2QEXQ 4JRKA 2F2VA 3QZ9B 2P4TA 1CKAA 2DXTA 2KY9A 2ZPIB 3OYMA 3J80E 1VQ7Q 4JZ3A 2DTOA 1TSFA 3FC3A 4Y91A 1M1KC 1XTDA 4GY5A 2DL3A 2IG0A 3L2UA 4GLMA 1XNIA 4R55A 1AOJA 3CQTA 3FJPA 3OYDA 5IXBA 3CCET 4AFZC 4IURA 1UB4A 3PFSA 4R0KA 3VRZA 3RERA 2RF0A 1QWEA 4CI0C 1EIFA 2EKHA 2DAQA 2B8AA 1WZOA 4M77G 3DLMA 1X01A 2VVKA 2HQHA 1G2BA 3I9QA 5GMKh 3LW5E 3LWHA 4A4EA 4V2SA 1TU0B 3GBQA 2DILA 3GPLA 4OMFB 4MDWA 1K73R 3CCSQ 1R77A 2MK5A 2PUKB 3CCQT 4BD3A 4AFUC 2NUPA 2R57A 1K76A 1GRIA 1S72Q 2YUPA 1QP3A 2JMCA 3JCMh 2HKNA 1I5OB 3LGFA 1VQ5T 1ABQA 5GJVB 2ROLA 2E64A 4XU1A 5FLXE 4FW1A 3LGLA 3OYJA 2M02A 1OULA 2KE9A 1VA7A 4JJCA 1VYTA 2EGAA 4B6MA 3UWNA 5CVIA 1I07A 1Y57A 5L8RE 3BDUA 3KUFA 2XMFA 4J9IA 1CKBA 7AT1B 1FMVA 3GNGA 3QJYA 4FYWB 1UJ0A 3CC2T 5KE2A 3VUBA 2E65A 3G7ZA 1ZUYA 2P0QA 1KQSS 3R6NA 2K2VA 4M7DB 1JO8A 2K3BA 3X25B 2KDSA 1AD5A 4OMQA 1KD1C 1NEBA 2A37A 3JB9F 1KSWA 1SSFA 3G71Q 2CZ0B 4J6WA 2FZCB 3UT1A 1M30A 4BB7A 2DPPB 1K4US 2RQVA 1MNEA 2RJDA 2CUBA 1RAFB 2F1LA 1TH7A 1UFFA 3M0PA 2IVWA 1JEGA 3E19A 4HCZA 3CCVT 1PRLC 3PGGA 2VV5A 5LJ5h 2DLPA 4J9CA 2O9VA 5GANh 1Q95G 3HKSA 1TUDA 4MDXA 1M8VA 1YITA 3IQLA 4M77A 1I81A 2RPNA 4X34A 2BZ8A 4QVDA 2BIVA 1WXTA 2M1HA 2ECZA 2BE7D 1OU8A 2OTLT 2KSSA 4M7DG 2EBPA 5L23A 1H3ZA 2MWPA 2RJFA 3A1PA 4Z89A 3OMCA 4BE1A 4PK4A 3KBGA 2HZYA 5LJ3g 4ATOA 2OTJT 2H3JA 2AKKA 3A8HB 1W2BA 3WXMB 5CIUA 2DK3A 3H6ZA 4EMHA 2VGNA 1YJWT 1WJSA 3VS7A 3CXCP 3EH2A 2K2MA 2JTMA 4M78F 2FZGB 6AT1B 1B34B 1IXDA 3TSWA 3URGA 1QWFA 1PHTA 3VS5A 3L2WA 3PIPA 4J83A 3CBMA 1QW1A 2K7AA 2SRCA 3H0HA 2E4HA 2QA4A 2ZPGB 1PNJA 4UC4A 1I5LA 1NG2A 2DXCA 3OS5A 2K9GA 4N4HA 3MEVA 3MP6A 3GLXA 3OBYA 1HD3A 2JW4A 2J6OA 1VQKQ 1PSEA 1RLPC 2XU8A 4NL3A 2FB7A 4ZGDB 1Q81R 1VQ9A 2HEQA 1VQPQ 3DB4A 2PZ1A 3VS4A 3M0TA 5GMKl 4M7DE 1DJ7B 5IXFA 2DTHA 2HD0A 3G4ST 2GCXA 2DZCA 4DOVA 2KQWA 3C94A 4BY6B 4XU0A 1SPKA 2CYZB 1JU5C 1YBYA 4ZN3A 3DB3A 3OYIA 3S3NA 5GMKi 3L42A 1UGSB 1TTHB 5FU6B 1VIFA 2LX7A 3M57A 2KRSA 2QQRA 1MHNA 5ECAA 5GAMe 1WQ7A 1B7TA 3HL8A 2OAUA 1YWPA 2LTOA 3LLRA 2RQUA 3EFRA 4CC7A 3FLGA 4JS4A 1WLPB 1A0NB 1WHLA 4C8QC 1MMNA 4PL6A 4Z88A 1ZBJA 3RMQA 1IGUA 1Y7XA 2BKDN 3H0FA 3TCJA 2D9TA 2XKOC 1V76A 3RIRA 1LVKA 3CC4A 2PUOB 1NLOC 2EQUA 2PVDB 4FM4B 1B07A 1OZ3A 1PD0A 4KGXB 3OYFA 2NUTA 4A4FA 1K0SA 3I35A 3OMGA 1N8RC 5KH6A 2JS2A 1GBRA 1ZSGA 2DNUA 4F7UF 2GTJA 4OB3B 4RMOA 4KULA 1OI1A 1YJ9A 2KMTA 3C4SA 4XU2A 4JJDA 2IIMA 3G6EA 4AG2C 4QKUA 2YT6A 3SDZA 1BI0A 2L3PA 3MPUB 3M4YA 4FW2A 3AHUA 3SFMA 2RI3A 2EFIA 2D0QB 1BYMA 4J7IA 4Y28E 1UG1A 3CC2Q 3QO3A 5J39A 2YUOA 2QQAA 1X6BA 4F04B 2LMJA 2AK5A 1VYUA 3RUXA 2QAZA 2RM4A 3JSCA 2FG0A 5CCAA 2DIQA 1SF9A 3LWIA 1SKUB 1M9SA 3GF5A 8ATCB 2K3YA 2P0KA 4M78A 1C6VX 3CCJT 3OSSC 3ZEHA 1SHGA 4HVVA 3G71A 3C0CA 1ZX6A 2RNAA 4M7AB 3JCMP 2L89A 4LD9K 2HSEB 1VQ6A 5LJ3j 1WFWA 2C0IA 1YIJA 1M90R 4EMKB 1JB0E 2DD5A 3RR6A 4C0DB 1B3QA 3EG2A 4C92B 1YJNA 3E9GA 1Y07A 4NOYA 1KQSP 3EG3A 4M7DD 1YWOA 2M0OA 1VUBA 1G3YA 1Q86U 1U5SA 2OTLQ 3H41A 5CQYA 4BI3A 3UATA 1KD1R 2G6FX 1Q82C 1NPPA 2FEIA 3CD6A 5HKCA 3H0IA 1K9MU 1BI3A 1NE8A 1O75A 3KFVA 2RB6A 2Z0WA 3I55A 3I56T 5DLOA 2DJZA 1TUCA 2J6KA 2R58A 5GAMh 2JM8A 1KC8U 5GMKm 1VYVA 2QGFB 1Z9ZA 4XTZA 1YITQ 4IIMA 2GQIA 1ZQ1A 1UHFA 3OY9A 5HY6A 4PJLA 2H8HA 2BE9B 2NUPB 4OGCA 4IUVA 4JRIA 1XJWB 3CCRA 5GAMf 2RQWA 4KUIA 4RCBA 5HK3A 1NJIR 1HXDA 4OB1B 1UDLA 3JCMJ 4M77C 3JAME 2GBQA 1VQ8A 4JUVA 4HT9A 4D6WA 5AT1B 2EQKA 4F16A 4XTYA 4J9DA 4C5HA 5LJ3d 2VC8A 5IHKA 1Q81C 1NYFA 2F69A 4K11A 4ZGJB 1JXMA 1D1BA 2A36A 2HSPA 2DVEA 1WHHA 3CXCA 1FMKA 2CKKA 2MCNA 4BACA 5KYYA 5GAN5 4LNPA 3UPUA 4F7UA 3O8VA 2EGEA 2CP2A 2X9HA 3E2UA 1AWXA 1YI2A 3OYKA 4BE0A 4QW2A 2HKQB 3PE0A 3C95A 5DLQE 2QA4Q 4O5VA 4E7ZA 1OV3A 2KYBA 3QBYA 4ELYC 2RMOA 3PMTA 4HT8A 4NS5A 1E6GA 2WSEE 1JJ2P 1YFNA 1GFDA 3V8LA 4AMCA 2RI5A 1Y71A 2DO3A 2KGTA 3JCMc 4M7AE 1SG5A 1VQ9Q 2J05A 2MPXC 4CC3A 2JZ2A 1PM3A 3JCMV 3V7SA 3H8ZA 1NPRA 3CCEA 1T0HA 1NZ9A 4A4GA 2EJFA 2HMAA 1I8FA 2DM1A 1BB9A 1RAGB 1RACB 1ZA2B 5D6XA 1M2VB 2PVGB 4D8KA 1S1NA 1QCOA 4A4HA 3V8JA 4M75B 2JNGA 1AZEA 1RAIB 4N0AA 1KQ1A 1W1FA 5A0GA 1D3BA 5C6SA 3CCQA 2RQTA 2YXYA 3L2RA 3QKJA 1W70A 4XTXA 1UGPB 3CC7T 1QKWA 2X3WD 1JRIA 1YP5A 2E6NA 2A7YA 2J06A 1VQ5A 3OW2A 3CC4Q 1SRMA 4X1VA 5IHNA 2LQKA 2YUQA 1R0CB 5GMKj 1UECA 4JS5A 1EX4A 3OYNA 2QASA 2DE0X 2ZAEA 1OOTA 3VUZA 1T3SA 2XDDA 2V8IA 2JMAA 2VASA 3DLLA 4HKEA 4A54A 2CH4A 1K73U 3M0QA 4J9HA 2KAFA 3OS2A 4PJOB 3A8LB 2QXFA 1D09B 2X4XA 2LX9A 5J3BA 1YJ9Q 3CC2A 4XTUA 3THKA 1MMAA 1BI1A 2RN8A 4IIOA 2CP3A 3OBWA 4E47A 3ASKA 4C0FA 3G6EQ 1N8RR 4RCCA 4C5IA 2RH2A 2M51A 1G3SA 3M9QA 3CCLT 1QP2A 4J9EA 5KYUB 1UGQB 2EKOA 1BIAA 3M58A 3Q1JA 2JUFA 2YUNA 5IAYA 1KQ2A 1I4K1 4DOWA 3VS3A 1M90C 3OYEA 1YHQT 1D1AA 1HK9A 2I2LA 2LJ1A 3RESA 3NHNA 1GFCA 1M5Q1 3VU3C 3X28B 1HSQA 5GAOq 2CP7A 4BUGA 2QTVA 2BUDA 3CCVA 4M7DF 1VQ4T 3S3OA 4Z8AA 1GXIE 1FX7A 2GGRA 2XG8D 3L2ZA 3OYAA 4OMPA 3TSZA 2ABLA 3SWNA 1G8XA 3JCMb 1RI0A 5A0LA 1VQNT 1N5ZA 3QHSA 4OF1A 3CPWP 1KG1A 2DVJA 2OTLA 2DETA 4M78C 1ABOA 4QT7A 2LC4A 1VQ6Q 2QQSA 1YIJQ 1KJWA 4M7AD 4M75E 1YJNQ 3MO8A 5LJ5j 2OTJA 1KQSA 3LYIA 5KCHA 2A28A 3SEMA 4C92D 1EFNA 4OB2B 1NJIC 2O9SA 1WJQA 3PMIA 2EQIA 1YJWA 2CDTA 2K4YA 1GCPA 1TG0A 2DJQA 4LUDA 4WCIA 1UGVA 1W2BS 1MV3A 3GP8A 3CD6Q 4RTYA 1N27A 2KRMA 4GBQA 3I55Q 2E1HA 2LRQA 1OEBA 1NM7A 2YDLA 3EGXB 2EWNA 3M55A 1Q82R 5DM7R 5KYXA 4NL2A 1WNLA 2FO0A 5FU7C 2DL4A 2K5LA 5HCKA 3CCRQ 3H9NA 1MMDA 1PC0A 1QQJA 2COZA 2DTIA 1Q7YU 1VQ8Q 4E7LA 2G3RA 2DF6A 2RHXA 1RUWA 2DL8A 3EH1A 3G4SA 3A5ZB 4WTOB 1M4ZA 3I5SA 2M16A 3CMAT 2MYSA 4JZ4A 2X4YA 3SHWA 4EIKA 3HTRA 2CSIA 3E1SA 5A0DA 4XK8E 1GCQC 4M78B 2EQMA 2M9UA 4PLIA 1WQWA 1KIKA 4RUGA 2XDPA 3CCMT 1BIBA 1X75C 3NGPA 2DEUA 4C0GA 4LDVA 3P8HA 2NLUA 1OX8A 2RJCA 2E3HA 2ZGWA 2KXCA 1QVGS 1PKSA 1H8KA 4Q5WA 1YI2Q 3SB2A 4JLIA 3JV3A 4E6RA 4FYVB 3CCUT 5GAOr 2KXDA 3L2QA 2ZPHB 1JQQA 2A3LA 4E7KA 5I11A 2DBMA 2FZKB 2KK4A 3EHRA 3JB9I 4PNOA 1X69A 3NTHA 5KYWA 2LCLA 2O4XA 5GAOl 5CAIA 5LJ3e 3WVEB 4O6JA 1JJ2A 3F70A 1LOJA 1GL5A 4LDUA 1OX9A 1IGQA 4ORZA 1ARKA 2HBWA 4JJBA 2EQJA 3C12A 3D7SB 1MMGA 2FPEA 1PSFA 3SD4A 1QVFS 1ZA1B 3HHTB 1CSKA 2LCSA 3CMET 1ZSZC 3CCEQ 5I21A 1K8AU 4RTZA 3MCAB 3OB9A 3R6OA 4HCCA 1AZGB 4M7DA 2E5QA 2QTXA 1AVZC 1BCMA 4D8DA 3A8OB 2RHYA 1ZBXA 3QG1A 1K0XA 1JXOA 3QPHA 4QQ6A 5CKHA 1VQOT 4M75D 4QQGA 3CCQQ 5FROA 2DD4A 4HCBA 4XAXB 1U1SA 1I1JA 2LNHB 4N0AC 1IB8A 1Y96A 3OS0A 5HK0A 4LN2A 3VS1A 2QEXT 1VQLT 1VQ5Q 1ZUKA 1WHMA 2EYQA 2V8KA 4EMGA 2E70A 2F5TX 1M1KU 1VQ7T 4LDXA 4IUQA 5KYNA 2L2PA 4PLLA 3FRNA 1VIEA 3INZA 2RO0A 2HL5C 4FT2A 4F7UB 3CCJA 2QI2A 2DFUA 2XI9A 2EYXA 1H641 2EW3A 1J3TA 1SRLA 4J5YA 2B86A 1IHVA 2BZXA 4PJOD 3MKDA 5FRNA 1F1BB 3CPFA 1QKXA 3LX7A 3OYBA 3OYLA 2MMPA 2LVMA 4AT1B 4XQ3A 5GAOn 2C0TA 3CCST 2E3IA 3VRYA 3DKMA 2PVOB 4C8QB 2DBKA 1H3HA 1S72T 1B34A 1ACMB 4M4ZA 3OYGA 3CBOA 2JJ9A 3TQ7P 1XOVA 4PKCC 1FXXA 2KT1A 5GAN8 1FWZA 4IUPA 3MHXA 3JCMg 4M7AF 1IZ6A 1TWBA 3PVLA 1LCKA 3NTKA 2QYZA 1M1GA 4RTWA 1WI7A 2FRYA 2VXFA 3CCVQ 1UUEA 4RTTA 4C92F 3I56A 1M90U 1FYNA 1ZUUA 4ESRA 2GFAA 3HRSA 4JRQA 3REAB 2V1RA 4HVWA 2K79A 2VXEA 1D3BB 4AFQC 3LH0A 3CPWA 4JDSA 3WVDB 2CGHA 1X6GA 2QK0A 3JCMQ 2XD0A 1AT1B 1KHCA 5LJ3h 3SWNC 2HBPA 3EG9A 3ZL7C 4KH1B 1PWTA 3EHQA 2VGMA 1KD1U 2OTJQ 2A0FB 1Q86R 5CKEA 3EGDA 4EDUA 5LJ3f 2COYA 4IUUA 4LXCA 2EYWA 4BI8B 5GMKe 4ME7A 1OPLA 4BDYA 4M7AG 1K9MR 3UA6A 1NYGA 1YJWQ 3TEEA 3S3MA 5GAOm 3CEYA 1K1ZA 3ME9A 4ANJA 2Y90A 4C92G 1VQMA 1KC8R 3GNFB 2EAYA 5GAN7 1W2BP 3CMAQ 2LDMA 1GCQA 2CSQA 2L5QA 2L8DA 2R5MA 3OS1A 1YCSB 1R0BG 2D8HA 2PU9B 2DZ9A 3MP1A 2O31A 2MIOA 2C0OA 2F5KA 5LJ5g 2DRMA 1UE9A 1G83A 1E6HA 5GANg 3M54A 2VYTA 3EGUA 1RADB 2X4JA 1U8RA 4XTVA 5KCOA 3ZBDA 3PTAA 4IKFA 1Y0MA 1C1AA 3T9NA 3I5RA 2GTOA 1R8OB 1VQMT 3HSBA 5CK9A 3OYHA 3GIBA 3GOXA 3G4SQ 2L0AA 3REBB 4DBHA 2VUBA 4C8QE 3M59A 4YTLA 1VOMA 4DA4A 3RNJA 2X51A 1N9RA 4IUTA 3SWNB 3EG1A 1TXQA 4HVUA 4QQDA 5CQXA 2LQWA 4HCKA 4OMLA 4DBFA 3QSUA 2E12A 4M78D 1ZSZA 1HJDA 4MMKA 5EG2A 3NPFA 1AWJA 2K3XA 4RG2A 2LT4A 1AWWA 1BI2A 2RQRA 2AZVA 5CKFA 4ZTFA 4X9CA 4C92E 1T0JA 4KGZB 1QVGP 1X43A 4AG1C 2A08A 3CC7A 3N5BB 1PG5B 1UTIA 2H3EB 2OAWA 3P8DA 1VQKT 2JS0A 2KBTA 5GAN6 5LJ5e 3FIFA 2V1QA 2DMOA 3JCMX 1BBZA 4M77B 2FRWA 4F14A 4JRPA 1VQPT 4M75F 4RTVA 2MWOA 4XU3A 2FPFA 4II1A 4A4KA 2HAXA 3M0SA 1KK7A 4M7AA 3OW2S 2I0NA 3NTIA 1M3CA 1X27A 1QVFP 2QGGA 2CT3A 4JPBW 4EMKA 3J7AF 4C92A 1OZ2A 2E10A 2CREA 4LE9A 2WSFE 4C0ZA 4F17A 3V7CA 2DL5A 4ELZC 3UF4A 1N9SA 2JN0A 2KRNA 5KYXB 1YN8A 4FSSA 1G3TA 4M7DC 1X6OA 3CCLA 2E6ZA 1OYXA 4QVZA 2XDBA 2RJEA 4E7SA 4MMLA 1H92A 2K6DA 1YHQA 2JTFA 2EVRA 2RK2A 2SEMA 4OVAA 5DY9A 4PJOF 5AYFA 1K9AA 1Z9QA 2WSCE 1PCXA 2D1XA 1G5VA 4M75G 2CP5A 2VKNA 1D0YA 4LD6A 2DX1A 2QQ9A 1VQ4A 1X2QA 2PNIA 1N8RU 1V1CA 2EGCA 3QWYA 3OSVA 2KROA 5IH2A 3CCJQ 2AHJB 2GQVA 2P0PA 5D7UA 1MV0B 2ROTA 3L2VA 1VQNA 1KHIA 2OJ2A 5KYWB 3JB9J 2QG9B 2O4XB 4DBRA 2IPOB 3JCMf 4FYYB 1IRXA 2ZZDA 1XQHA 4B9XA 3RBBB 2LJ3A 4TVRA 1RI9A 1M2OA 3UDCA 3X24B 3QWXX 1UJYA 1UEBA 1WIEA 1FMWA 1NEGA 1QCFA 4PJOG 3BDLA 2KNBB 4N4IA 4C8QD 2V26A 2YRVA 1WX6A 9ATCB 2EYYA 2DKGA 4PFZA 1Q86C 5GAOp 3QJ6A 5IHIA 2DXUA 3JCMd 1M8MA 3RKWA 4M77E 3MJXA 1K9MC 3I56Q 5GAN4 2LZ6B 2GNCA 4RG8A 2ENMA 1RAAB 5GANj 3VS2A 1KC8C 2AIRB 4FL6A 4FCYA 3M0UA 2NUTB 2HL3A 2E41A 4J9GA 2EPDA 3QZ5B 1T3LA 5I2MA 3EFOA 2L3SA 1IHWA 1RL2A 1Y96B 3MEAA 2WACA 2PQWA 3RDVA 3UA7A 3L1AA 3QYHB 1SEMA 2VWFA 1RAEB 3CMAA 1W4SA 1M2VA 2KR3A 2RHUA 4M75A 1WPYA 1LNXA 3KXTA 4BY6C 5LJ5f 5GAN2 2CP6A 4ZNXA 2DYBA 3TVTA 4BDZA 2YLCA 2QQBA 5GANf 2L3QA 4PJOE 3CCMA 5FU6C 1Q82U 2CP0A 1IO6A 2KEAA 3ULRB 3JB9G 1VQMQ 1AHJB 1ZLMA 4ZN1A 2M0YA 2CT4A 4A63B 1WYXA 3CCUA 2LNVA 2PTKA 5M9OA 2EJGA 4AFSC 3OYYA 1QVPA 4OMOA 2FHDA 3BW1A 1YITT 3LH5A 2HQEA 2XHCA 5LJ5d 5GAMg 1Q7YR 5I22A 1V29B 5GJWB 2LQ8A 5GANd 4PFPA 5C0MA 4OMNA 1QMCA 3JB9H 2KI7A 3ER0A 5IT9E 1LJOA 4PJOA 3HRUA 5CKBA 2GF7A 3QDRB 1JJ2S 3VKIA 3J81E 3CMEA 8AT1B 2ZPBB 4FIBA 4J6XA 2JTEA 4KBMB 1MGQA 1Q81U 3E9FA 2LCCA 2JVVA 2F2XA 4BE2A 4OB0B 5D6WA 2RK1A 4CC2A 1QCNA 2FYKA 4HA8A 3QXEB 3FDRA 2ATCB 1MNDA 2L3RA 2NWMA 2X4WA 4J7FA 2O88A 5KYUA 1U3OA 4ZGEB 3RMSA 1C0MA 4J8OA 3OYCA 3M56A 1OQKA 1P92A 2JT4A 3G1JA 2JM9A 3PT9A 3EG0A 3X26B 3S6WA 2JOYA 3EG9B 4N4GA 4JLGA 2K5IA 3JRZA 2QA4T 1VQOA 1RAHB 3VJPA 3VS0A 1UGRB 1QVGA 2GFUA 2ZPFB 3VS6A 2HNIA 5J26A 2ED1A 4M78G 2HCKA 3CC7Q 5EC7A 4J9BA 3EGDB 1VQLA 5FU7B 3PVQA 2QEXA 2XIDA 3FJ5A 1WDXA 1PD1A 1M3BA 3OA6A 1VQ9T 1WXUA 1VQ7A 2CH4W 1K8AR 4PFOA 4L59A 2J7IA 2HDAA 1E7OA 2XK0A 5D6YA 2O2OA 4DQ2A 4M77D 3VYHB 2LP5A 4DEXA 4RKUE 3X20B 2DRKA 1YNZA 1QVFA 3M53A 2CZ1B 4E7IA 1K73C 4ZTJA 2XICA 3OW2P 2V8JA 2YWWA 4OP0A 4WF2A 2ZCFB 4M7AC 3QYGB 1RLQC 2YRCA 4A53A 2EIFA 3EFSA 3TU4K 4EMKC 4BI4A 4PJNA 3HP9A 2ED0A 4C0DC 4C92C 3CCLQ 3CCSA 1PKTA 2DYIA 5KYYB 5I2SA 2Y4XA 2FPDA 2NUZA 1S72A 1U1TA 3BFMA 1YHQQ 1O9SA 4GLKA 4MZTA 4E7HA 2YLBA 1D0ZA 2DXBA 1U06A 2VB6A 1M1KR 2CZ7B 3MEWA 3CC4T 2X3XD 4M78E 2EJ9A 3EGXA 3OQ5A 1UHCA 1GBQA 1X2KA 3V7RA 1N6AA 2COWA 4C5EA 1VQ4Q 1NBEB 2P4RA 4P5NA 4HXJA 4DBQA 1ZSZB 3JCMW 4MZMA 4C8QF 3A8GB 2K57A 2HQXA 2YRDA 4VUBA 4Z02A 4LDYA 3VYGA 5FW9A 1VQNQ 2AKLA 1YJ9T 3HFNA 1WHJA 4FU6A 1JBMA 2YSQA 2D0NA 3G6ET 1WGSA 4QVCA 2F2WA 2AT1B 3A98A 2OX7A 2OI3A 4F7UG 4CC4B 1BKBA 3CPWS 1D0XA 3NFCA 2E5KA 2RI2A 1OU9A 2X35A 1KFZA 2C06A 2KT8A 3HRTA 3QUIA 3HFOA 1EZZB 4J9FA 1SHFA 2P84A 1LPLA 3M0RA 2AZSA 4C8QG 3PIOA 1WHGA 3META 2CS7A 2QDYB 1D1CA 2W0ZA 3VV0A 1G3WA 1TOVA 5GAMj 2NYSA 3G71T 3JB9D 1AWOA 2DA9A 2J6FA 2DEQA 3RKYA 3QIIA 1M3AA 2RA2A 4JJNK 3MP8A 1QLYA 2D8JA 1VQ6T 1YIJT 3A8MB 2Y4YA 1I0CA 4L6V5 1YJNT 5IN1A 1Q7YC 2R5AA 1BK2A 5FWBA 3JCMe 3EAEA 2FVUA 2MI6A 1NJIU 3PNWC 3CXCS 1WJRA 5CO7A 1WA7A 1OPKA 4F7UE 2MOXA 5GAN3 2MF2A 3CCMQ 2CUDA 1W6XA 2YHTA 4KGVB 3FEOA 4KT0E 4OMMA 4KRTA 5CR2A 2LT1A 3CD6T 2DIGA 4M75C 2W10A 3V8KA 2FL7A 2D6FA 4KUDK 2O01E 4PJJA 4R56A 3NMZC 3I55T 3CCUQ 4C5GA 4RTUA 2EYZA 2CZ6B 3O5ZA 2KVQG 3BE3A 4FYXB 4Y92A 1NLPC 1VQKA 2MAMA 3U23A 4CRIA 2DERA 2DL7A 1SSHA 4EPCA 1M1FA 5A2QE 5GAMd 1IREB 1PRMC 4E7JA 4FT4A 3CCRT 1WHKA 2LJ0A 3M5AA 1VQPA 3FB9A
chains in the Genus database with same CATH topology
2FG0A 3RBBB 2KXCA 1PKSA 1H8KA 1AEYA 2QDLA 2LJ3A 3JV3A 4E6RA 2KXDA 1RI9A 1JQQA 3QWXX 1UJYA 5I11A 5FWCA 2DBMA 1WIEA 1QCFA 1NEGA 3EHRA 1WXBA 2KNBB 1SHGA 1X69A 4HVVA 2LQNA 1MUZA 3C0CA 1ZX6A 2RNAA 1WX6A 2EYYA 2JXBA 1GL5A 4RTXA 4LUEA 1BU1A 4ORZA 5IHIA 1WFWA 2C0IA 1ARKA 2HBWA 4JJBA 1M8MA 1B3QA 3EG2A 2BZYA 2FPEA 2LZ6B 1CSKA 3EG3A 2LCSA 2GNCA 2KYMA 4DEYA 2ENMA 2ESWA 1M27C 3VS2A 4RTZA 1YWOA 1AZGB 2BTTA 3M0UA 1U5SA 2F2VA 3H41A 1AVZC 4J9GA 2EPDA 1CKAA 1T3LA 3UATA 2G6FX 4D8DA 1K0XA 2L3SA 2FEIA 1JXOA 3H0IA 4JZ3A 3KFVA 2DL3A 3UA7A 4GLMA 1TUCA 1SEMA 2VWFA 1AOJA 2J6KA 3CQTA 5IXBA 2JM8A 4AFZC 4R0KA 1VYVA 3VRZA 1Z9ZA 2KR3A 2RF0A 1QWEA 4IIMA 1I1JA 2GQIA 2LNHB 1UHFA 2EKHA 4ZNXA 2DYBA 3TVTA 2H8HA 4LN2A 3VS1A 2L3QA 1ZUKA 2VVKA 2RQWA 1G2BA 3I9QA 1IO6A 2KEAA 1UDLA 3ULRB 2GBQA 1ZLMA 2M0YA 2CT4A 4F16A 3GBQA 2DILA 2L2PA 4A63B 1WYXA 4J9DA 2PTKA 4AFSC 4OMOA 4AFUC 1K76A 1GRIA 5IHKA 2YUPA 1NYFA 4K11A 2JMCA 3LH5A 1JXMA 2A36A 2EYXA 2EW3A 1J3TA 1SRLA 2HSPA 2B86A 5I22A 5GJWB 1ABQA 5GJVB 1FMKA 2ROLA 2BZXA 4OMNA 2MCNA 4LNPA 2EGEA 1QKXA 2KE9A 1AWXA 1VA7A 4JJCA 2C0TA 3PE0A 3VRYA 1VYTA 2JTEA 1OV3A 2DBKA 1H3HA 2KYBA 2EGAA 2F2XA 1I07A 1Y57A 4M4ZA 2RMOA 2XMFA 4J9IA 1CKBA 4CC2A 1E6GA 1XOVA 2KT1A 1GFDA 2NWMA 1UJ0A 2O88A 2KGTA 1U3OA 1ZUYA 3PVLA 1LCKA 4RTWA 3R6NA 2J05A 1JO8A 1WI7A 2FRYA 2JT4A 2K3BA 4CC3A 2JM9A 1UUEA 4RTTA 3EG0A 1AD5A 4OMQA 1FYNA 1NEBA 1ZUUA 2A37A 4ESRA 3VS0A 1KSWA 3VS6A 1T0HA 3REAB 2V1RA 4HVWA 2ED1A 2K79A 2HCKA 2DM1A 1BB9A 1M30A 4AFQC 5EC7A 4J9BA 1K4US 3PVQA 3FJ5A 2RQVA 1X6GA 4D8KA 1S1NA 1WDXA 3ZL7C 1M3BA 2CUBA 1WXUA 1AZEA 1PWTA 2CH4W 1UFFA 3M0PA 3EHQA 2J7IA 1JEGA 1W1FA 1E7OA 2HDAA 2O2OA 1PRLC 2DLPA 4J9CA 2LP5A 2O9VA 4DEXA 1TUDA 2RQTA 2EYWA 2DRKA 1YNZA 1W70A 3IQLA 1OPLA 1QKWA 2RPNA 2X3WD 2BZ8A 1YP5A 3UA6A 1NYGA 2J06A 1WXTA 1SRMA 2ECZA 4X1VA 5IHNA 2YUQA 2EBPA 1K1ZA 1UECA 5L23A 1RLQC 4Z89A 2DE0X 2ED0A 1OOTA 1T3SA 1GCQA 2CSQA 1PKTA 2AKKA 1YCSB 2FPDA 2JMAA 2D8HA 2NUZA 2O31A 2CH4A 2C0OA 2MIOA 2DRMA 1UE9A 1G83A 3M0QA 4J9HA 1E6HA 1U06A 3VS7A 3THKA 2K2MA 2X3XD 3EGUA 2RN8A 4IIOA 3TSWA 1QWFA 1PHTA 3VS5A 1UHCA 1GBQA 1X2KA 1Y0MA 3I5RA 2GTOA 2M51A 2P4RA 2K7AA 2SRCA 4HXJA 4J9EA 3H0HA 2L0AA 3REBB 1PNJA 2YUNA 3VS3A 1NG2A 2K9GA 3RNJA 2LJ1A 5FW9A 1HD3A 2AKLA 2J6OA 2JW4A 3EG1A 4HVUA 2LQWA 4HCKA 4OMLA 3NHNA 1RLPC 1GFCA 2YSQA 1HSQA 2D0NA 2F2WA 2HEQA 1HJDA 3A98A 3NPFA 1AWJA 2OI3A 2PZ1A 3VS4A 3M0TA 1AWWA 2RQRA 5IXFA 4Z8AA 4CC4B 2AZVA 2GGRA 4OMPA 3TSZA 1T0JA 2ABLA 1X43A 4AG1C 2E5KA 2A08A 1SPKA 1UTIA 1JU5C 2OAWA 1N5ZA 1KFZA 2JS0A 2DVJA 2KT8A 2LX7A 2KBTA 1ABOA 4J9FA 4QT7A 2V1QA 1SHFA 2DMOA 1BBZA 2FRWA 2KRSA 1KJWA 4F14A 4RTVA 3M0RA 5ECAA 2AZSA 1YWPA 2RQUA 4CC7A 2FPFA 1WLPB 3M0SA 1A0NB 2A28A 2W0ZA 2I0NA 3SEMA 1M3CA 1X27A 1EFNA 4Z88A 1ZBJA 2O9SA 2CT3A 3H0FA 4JPBW 1AWOA 2DA9A 2J6FA 2EQIA 1M3AA 2CREA 4LE9A 2CDTA 4F17A 1GCPA 1TG0A 2DJQA 2DL5A 4LUDA 4WCIA 1UGVA 1NLOC 1QLYA 3UF4A 2D8JA 1MV3A 1B07A 2KRNA 4RTYA 1YN8A 4FSSA 2KRMA 1I0CA 4GBQA 1BK2A 1K0SA 3I35A 5FWBA 1OEBA 1NM7A 2YDLA 2JS2A 1H92A 2K6DA 1GBRA 1ZSGA 2DNUA 1WA7A 2GTJA 2EVRA 1OPKA 2SEMA 2MOXA 1K9AA 1Z9QA 2FO0A 2DL4A 5HCKA 2CUDA 2D1XA 1W6XA 4JJDA 2IIMA 2VKNA 4KRTA 4OMMA 4AG2C 2DX1A 2W10A 2YT6A 2DF6A 1RUWA 1X2QA 2L3PA 2DL8A 3NMZC 2PNIA 4RTUA 2EYZA 1V1CA 2EGCA 3I5SA 3O5ZA 3QWYA 2KROA 5IH2A 4JZ4A 3SHWA 4EIKA 2CSIA 4Y92A 1MV0B 2ROTA 1UG1A 1GCQC 1NLPC 2YUOA 3U23A 1KIKA 1X6BA 4RUGA 2DL7A 1SSHA 2OJ2A 1PRMC 3NGPA 2LMJA 2AK5A 1VYUA 2LJ0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2FG0 A;  3RBB B;  2KXC A;  1PKS A;  1H8K A;  1AEY A;  2QDL A;  2LJ3 A;  3JV3 A;  4E6R A;  2KXD A;  1RI9 A;  1JQQ A;  3QWX X;  1UJY A;  5I11 A;  5FWC A;  2DBM A;  1WIE A;  1QCF A;  1NEG A;  3EHR A;  1WXB A;  2KNB B;  1SHG A;  1X69 A;  4HVV A;  2LQN A;  1MUZ A;  3C0C A;  1ZX6 A;  2RNA A;  1WX6 A;  2EYY A;  2JXB A;  1GL5 A;  4RTX A;  4LUE A;  1BU1 A;  4ORZ A;  5IHI A;  1WFW A;  2C0I A;  1ARK A;  2HBW A;  4JJB A;  1M8M A;  1B3Q A;  3EG2 A;  2BZY A;  2FPE A;  2LZ6 B;  1CSK A;  3EG3 A;  2LCS A;  2GNC A;  2KYM A;  4DEY A;  2ENM A;  2ESW A;  1M27 C;  3VS2 A;  4RTZ A;  1YWO A;  1AZG B;  2BTT A;  3M0U A;  1U5S A;  2F2V A;  3H41 A;  1AVZ C;  4J9G A;  2EPD A;  1CKA A;  1T3L A;  3UAT A;  2G6F X;  4D8D A;  1K0X A;  2L3S A;  2FEI A;  1JXO A;  3H0I A;  4JZ3 A;  3KFV A;  2DL3 A;  3UA7 A;  4GLM A;  1TUC A;  1SEM A;  2VWF A;  1AOJ A;  2J6K A;  3CQT A;  5IXB A;  2JM8 A;  4AFZ C;  4R0K A;  1VYV A;  3VRZ A;  1Z9Z A;  2KR3 A;  2RF0 A;  1QWE A;  4IIM A;  1I1J A;  2GQI A;  2LNH B;  1UHF A;  2EKH A;  4ZNX A;  2DYB A;  3TVT A;  2H8H A;  4LN2 A;  3VS1 A;  2L3Q A;  1ZUK A;  2VVK A;  2RQW A;  1G2B A;  3I9Q A;  1IO6 A;  2KEA A;  1UDL A;  3ULR B;  2GBQ A;  1ZLM A;  2M0Y A;  2CT4 A;  4F16 A;  3GBQ A;  2DIL A;  2L2P A;  4A63 B;  1WYX A;  4J9D A;  2PTK A;  4AFS C;  4OMO A;  4AFU C;  1K76 A;  1GRI A;  5IHK A;  2YUP A;  1NYF A;  4K11 A;  2JMC A;  3LH5 A;  1JXM A;  2A36 A;  2EYX A;  2EW3 A;  1J3T A;  1SRL A;  2HSP A;  2B86 A;  5I22 A;  5GJW B;  1ABQ A;  5GJV B;  1FMK A;  2ROL A;  2BZX A;  4OMN A;  2MCN A;  4LNP A;  2EGE A;  1QKX A;  2KE9 A;  1AWX A;  1VA7 A;  4JJC A;  2C0T A;  3PE0 A;  3VRY A;  1VYT A;  2JTE A;  1OV3 A;  2DBK A;  1H3H A;  2KYB A;  2EGA A;  2F2X A;  1I07 A;  1Y57 A;  4M4Z A;  2RMO A;  2XMF A;  4J9I A;  1CKB A;  4CC2 A;  1E6G A;  1XOV A;  2KT1 A;  1GFD A;  2NWM A;  1UJ0 A;  2O88 A;  2KGT A;  1U3O A;  1ZUY A;  3PVL A;  1LCK A;  4RTW A;  3R6N A;  2J05 A;  1JO8 A;  1WI7 A;  2FRY A;  2JT4 A;  2K3B A;  4CC3 A;  2JM9 A;  1UUE A;  4RTT A;  3EG0 A;  1AD5 A;  4OMQ A;  1FYN A;  1NEB A;  1ZUU A;  2A37 A;  4ESR A;  3VS0 A;  1KSW A;  3VS6 A;  1T0H A;  3REA B;  2V1R A;  4HVW A;  2ED1 A;  2K79 A;  2HCK A;  2DM1 A;  1BB9 A;  1M30 A;  4AFQ C;  5EC7 A;  4J9B A;  1K4U S;  3PVQ A;  3FJ5 A;  2RQV A;  1X6G A;  4D8K A;  1S1N A;  1WDX A;  3ZL7 C;  1M3B A;  2CUB A;  1WXU A;  1AZE A;  1PWT A;  2CH4 W;  1UFF A;  3M0P A;  3EHQ A;  2J7I A;  1JEG A;  1W1F A;  1E7O A;  2HDA A;  2O2O A;  1PRL C;  2DLP A;  4J9C A;  2LP5 A;  2O9V A;  4DEX A;  1TUD A;  2RQT A;  2EYW A;  2DRK A;  1YNZ A;  1W70 A;  3IQL A;  1OPL A;  1QKW A;  2RPN A;  2X3W D;  2BZ8 A;  1YP5 A;  3UA6 A;  1NYG A;  2J06 A;  1WXT A;  1SRM A;  2ECZ A;  4X1V A;  5IHN A;  2YUQ A;  2EBP A;  1K1Z A;  1UEC A;  5L23 A;  1RLQ C;  4Z89 A;  2DE0 X;  2ED0 A;  1OOT A;  1T3S A;  1GCQ A;  2CSQ A;  1PKT A;  2AKK A;  1YCS B;  2FPD A;  2JMA A;  2D8H A;  2NUZ A;  2O31 A;  2CH4 A;  2C0O A;  2MIO A;  2DRM A;  1UE9 A;  1G83 A;  3M0Q A;  4J9H A;  1E6H A;  1U06 A;  3VS7 A;  3THK A;  2K2M A;  2X3X D;  3EGU A;  2RN8 A;  4IIO A;  3TSW A;  1QWF A;  1PHT A;  3VS5 A;  1UHC A;  1GBQ A;  1X2K A;  1Y0M A;  3I5R A;  2GTO A;  2M51 A;  2P4R A;  2K7A A;  2SRC A;  4HXJ A;  4J9E A;  3H0H A;  2L0A A;  3REB B;  1PNJ A;  2YUN A;  3VS3 A;  1NG2 A;  2K9G A;  3RNJ A;  2LJ1 A;  5FW9 A;  1HD3 A;  2AKL A;  2J6O A;  2JW4 A;  3EG1 A;  4HVU A;  2LQW A;  4HCK A;  4OML A;  3NHN A;  1RLP C;  1GFC A;  2YSQ A;  1HSQ A;  2D0N A;  2F2W A;  2HEQ A;  1HJD A;  3A98 A;  3NPF A;  1AWJ A;  2OI3 A;  2PZ1 A;  3VS4 A;  3M0T A;  1AWW A;  2RQR A;  5IXF A;  4Z8A A;  4CC4 B;  2AZV A;  2GGR A;  4OMP A;  3TSZ A;  1T0J A;  2ABL A;  1X43 A;  4AG1 C;  2E5K A;  2A08 A;  1SPK A;  1UTI A;  1JU5 C;  2OAW A;  1N5Z A;  1KFZ A;  2JS0 A;  2DVJ A;  2KT8 A;  2LX7 A;  2KBT A;  1ABO A;  4J9F A;  4QT7 A;  2V1Q A;  1SHF A;  2DMO A;  1BBZ A;  2FRW A;  2KRS A;  1KJW A;  4F14 A;  4RTV A;  3M0R A;  5ECA A;  2AZS A;  1YWP A;  2RQU A;  4CC7 A;  2FPF A;  1WLP B;  3M0S A;  1A0N B;  2A28 A;  2W0Z A;  2I0N A;  3SEM A;  1M3C A;  1X27 A;  1EFN A;  4Z88 A;  1ZBJ A;  2O9S A;  2CT3 A;  3H0F A;  4JPB W;  1AWO A;  2DA9 A;  2J6F A;  2EQI A;  1M3A A;  2CRE A;  4LE9 A;  2CDT A;  4F17 A;  1GCP A;  1TG0 A;  2DJQ A;  2DL5 A;  4LUD A;  4WCI A;  1UGV A;  1NLO C;  1QLY A;  3UF4 A;  2D8J A;  1MV3 A;  1B07 A;  2KRN A;  4RTY A;  1YN8 A;  4FSS A;  2KRM A;  1I0C A;  4GBQ A;  1BK2 A;  1K0S A;  3I35 A;  5FWB A;  1OEB A;  1NM7 A;  2YDL A;  2JS2 A;  1H92 A;  2K6D A;  1GBR A;  1ZSG A;  2DNU A;  1WA7 A;  2GTJ A;  2EVR A;  1OPK A;  2SEM A;  2MOX A;  1K9A A;  1Z9Q A;  2FO0 A;  2DL4 A;  5HCK A;  2CUD A;  2D1X A;  1W6X A;  4JJD A;  2IIM A;  2VKN A;  4KRT A;  4OMM A;  4AG2 C;  2DX1 A;  2W10 A;  2YT6 A;  2DF6 A;  1RUW A;  1X2Q A;  2L3P A;  2DL8 A;  3NMZ C;  2PNI A;  4RTU A;  2EYZ A;  1V1C A;  2EGC A;  3I5S A;  3O5Z A;  3QWY A;  2KRO A;  5IH2 A;  4JZ4 A;  3SHW A;  4EIK A;  2CSI A;  4Y92 A;  1MV0 B;  2ROT A;  1UG1 A;  1GCQ C;  1NLP C;  2YUO A;  3U23 A;  1KIK A;  1X6B A;  4RUG A;  2DL7 A;  1SSH A;  2OJ2 A;  1PRM C;  3NGP A;  2LMJ A;  2AK5 A;  1VYU A;  2LJ0 A; 
#chains in the Genus database with same CATH topology
 1VQ8 T;  1AEY A;  2QDL A;  4XTW A;  4OGE A;  3TRE A;  3ZFJ A;  3CBP A;  3MEU A;  4J6Y A;  3CME Q;  5FWC A;  1WXB A;  1K8A C;  2LQN A;  4PJO C;  1HYO A;  2ZPE B;  1MUZ A;  4E2F B;  3AT1 B;  4B9W A;  2K5F A;  4MZP A;  2JXB A;  4FSX A;  4RTX A;  4LUE A;  4C8Q A;  4L5G A;  1TS9 A;  1BU1 A;  3QDF A;  4X9D A;  2RHZ A;  4M77 F;  5GAN e;  2BZY A;  2RHI A;  1BCO A;  1YI2 T;  1RAB B;  5LL6 S;  5CKD A;  3RKX A;  3EFO B;  1VQO Q;  2KYM A;  1YCY A;  2RD1 A;  3P8B B;  4DEY A;  2ESW A;  4KH0 B;  1M27 C;  4LDW A;  3HPW A;  3M4G A;  5KE3 A;  1TUG B;  4PJM A;  2BTT A;  5FRM A;  1ZHI A;  1VQL Q;  3BY7 A;  2QEX Q;  4JRK A;  2F2V A;  3QZ9 B;  2P4T A;  1CKA A;  2DXT A;  2KY9 A;  2ZPI B;  3OYM A;  3J80 E;  1VQ7 Q;  4JZ3 A;  2DTO A;  1TSF A;  3FC3 A;  4Y91 A;  1M1K C;  1XTD A;  4GY5 A;  2DL3 A;  2IG0 A;  3L2U A;  4GLM A;  1XNI A;  4R55 A;  1AOJ A;  3CQT A;  3FJP A;  3OYD A;  5IXB A;  3CCE T;  4AFZ C;  4IUR A;  1UB4 A;  3PFS A;  4R0K A;  3VRZ A;  3RER A;  2RF0 A;  1QWE A;  4CI0 C;  1EIF A;  2EKH A;  2DAQ A;  2B8A A;  1WZO A;  4M77 G;  3DLM A;  1X01 A;  2VVK A;  2HQH A;  1G2B A;  3I9Q A;  5GMK h;  3LW5 E;  3LWH A;  4A4E A;  4V2S A;  1TU0 B;  3GBQ A;  2DIL A;  3GPL A;  4OMF B;  4MDW A;  1K73 R;  3CCS Q;  1R77 A;  2MK5 A;  2PUK B;  3CCQ T;  4BD3 A;  4AFU C;  2NUP A;  2R57 A;  1K76 A;  1GRI A;  1S72 Q;  2YUP A;  1QP3 A;  2JMC A;  3JCM h;  2HKN A;  1I5O B;  3LGF A;  1VQ5 T;  1ABQ A;  5GJV B;  2ROL A;  2E64 A;  4XU1 A;  5FLX E;  4FW1 A;  3LGL A;  3OYJ A;  2M02 A;  1OUL A;  2KE9 A;  1VA7 A;  4JJC A;  1VYT A;  2EGA A;  4B6M A;  3UWN A;  5CVI A;  1I07 A;  1Y57 A;  5L8R E;  3BDU A;  3KUF A;  2XMF A;  4J9I A;  1CKB A;  7AT1 B;  1FMV A;  3GNG A;  3QJY A;  4FYW B;  1UJ0 A;  3CC2 T;  5KE2 A;  3VUB A;  2E65 A;  3G7Z A;  1ZUY A;  2P0Q A;  1KQS S;  3R6N A;  2K2V A;  4M7D B;  1JO8 A;  2K3B A;  3X25 B;  2KDS A;  1AD5 A;  4OMQ A;  1KD1 C;  1NEB A;  2A37 A;  3JB9 F;  1KSW A;  1SSF A;  3G71 Q;  2CZ0 B;  4J6W A;  2FZC B;  3UT1 A;  1M30 A;  4BB7 A;  2DPP B;  1K4U S;  2RQV A;  1MNE A;  2RJD A;  2CUB A;  1RAF B;  2F1L A;  1TH7 A;  1UFF A;  3M0P A;  2IVW A;  1JEG A;  3E19 A;  4HCZ A;  3CCV T;  1PRL C;  3PGG A;  2VV5 A;  5LJ5 h;  2DLP A;  4J9C A;  2O9V A;  5GAN h;  1Q95 G;  3HKS A;  1TUD A;  4MDX A;  1M8V A;  1YIT A;  3IQL A;  4M77 A;  1I81 A;  2RPN A;  4X34 A;  2BZ8 A;  4QVD A;  2BIV A;  1WXT A;  2M1H A;  2ECZ A;  2BE7 D;  1OU8 A;  2OTL T;  2KSS A;  4M7D G;  2EBP A;  5L23 A;  1H3Z A;  2MWP A;  2RJF A;  3A1P A;  4Z89 A;  3OMC A;  4BE1 A;  4PK4 A;  3KBG A;  2HZY A;  5LJ3 g;  4ATO A;  2OTJ T;  2H3J A;  2AKK A;  3A8H B;  1W2B A;  3WXM B;  5CIU A;  2DK3 A;  3H6Z A;  4EMH A;  2VGN A;  1YJW T;  1WJS A;  3VS7 A;  3CXC P;  3EH2 A;  2K2M A;  2JTM A;  4M78 F;  2FZG B;  6AT1 B;  1B34 B;  1IXD A;  3TSW A;  3URG A;  1QWF A;  1PHT A;  3VS5 A;  3L2W A;  3PIP A;  4J83 A;  3CBM A;  1QW1 A;  2K7A A;  2SRC A;  3H0H A;  2E4H A;  2QA4 A;  2ZPG B;  1PNJ A;  4UC4 A;  1I5L A;  1NG2 A;  2DXC A;  3OS5 A;  2K9G A;  4N4H A;  3MEV A;  3MP6 A;  3GLX A;  3OBY A;  1HD3 A;  2JW4 A;  2J6O A;  1VQK Q;  1PSE A;  1RLP C;  2XU8 A;  4NL3 A;  2FB7 A;  4ZGD B;  1Q81 R;  1VQ9 A;  2HEQ A;  1VQP Q;  3DB4 A;  2PZ1 A;  3VS4 A;  3M0T A;  5GMK l;  4M7D E;  1DJ7 B;  5IXF A;  2DTH A;  2HD0 A;  3G4S T;  2GCX A;  2DZC A;  4DOV A;  2KQW A;  3C94 A;  4BY6 B;  4XU0 A;  1SPK A;  2CYZ B;  1JU5 C;  1YBY A;  4ZN3 A;  3DB3 A;  3OYI A;  3S3N A;  5GMK i;  3L42 A;  1UGS B;  1TTH B;  5FU6 B;  1VIF A;  2LX7 A;  3M57 A;  2KRS A;  2QQR A;  1MHN A;  5ECA A;  5GAM e;  1WQ7 A;  1B7T A;  3HL8 A;  2OAU A;  1YWP A;  2LTO A;  3LLR A;  2RQU A;  3EFR A;  4CC7 A;  3FLG A;  4JS4 A;  1WLP B;  1A0N B;  1WHL A;  4C8Q C;  1MMN A;  4PL6 A;  4Z88 A;  1ZBJ A;  3RMQ A;  1IGU A;  1Y7X A;  2BKD N;  3H0F A;  3TCJ A;  2D9T A;  2XKO C;  1V76 A;  3RIR A;  1LVK A;  3CC4 A;  2PUO B;  1NLO C;  2EQU A;  2PVD B;  4FM4 B;  1B07 A;  1OZ3 A;  1PD0 A;  4KGX B;  3OYF A;  2NUT A;  4A4F A;  1K0S A;  3I35 A;  3OMG A;  1N8R C;  5KH6 A;  2JS2 A;  1GBR A;  1ZSG A;  2DNU A;  4F7U F;  2GTJ A;  4OB3 B;  4RMO A;  4KUL A;  1OI1 A;  1YJ9 A;  2KMT A;  3C4S A;  4XU2 A;  4JJD A;  2IIM A;  3G6E A;  4AG2 C;  4QKU A;  2YT6 A;  3SDZ A;  1BI0 A;  2L3P A;  3MPU B;  3M4Y A;  4FW2 A;  3AHU A;  3SFM A;  2RI3 A;  2EFI A;  2D0Q B;  1BYM A;  4J7I A;  4Y28 E;  1UG1 A;  3CC2 Q;  3QO3 A;  5J39 A;  2YUO A;  2QQA A;  1X6B A;  4F04 B;  2LMJ A;  2AK5 A;  1VYU A;  3RUX A;  2QAZ A;  2RM4 A;  3JSC A;  2FG0 A;  5CCA A;  2DIQ A;  1SF9 A;  3LWI A;  1SKU B;  1M9S A;  3GF5 A;  8ATC B;  2K3Y A;  2P0K A;  4M78 A;  1C6V X;  3CCJ T;  3OSS C;  3ZEH A;  1SHG A;  4HVV A;  3G71 A;  3C0C A;  1ZX6 A;  2RNA A;  4M7A B;  3JCM P;  2L89 A;  4LD9 K;  2HSE B;  1VQ6 A;  5LJ3 j;  1WFW A;  2C0I A;  1YIJ A;  1M90 R;  4EMK B;  1JB0 E;  2DD5 A;  3RR6 A;  4C0D B;  1B3Q A;  3EG2 A;  4C92 B;  1YJN A;  3E9G A;  1Y07 A;  4NOY A;  1KQS P;  3EG3 A;  4M7D D;  1YWO A;  2M0O A;  1VUB A;  1G3Y A;  1Q86 U;  1U5S A;  2OTL Q;  3H41 A;  5CQY A;  4BI3 A;  3UAT A;  1KD1 R;  2G6F X;  1Q82 C;  1NPP A;  2FEI A;  3CD6 A;  5HKC A;  3H0I A;  1K9M U;  1BI3 A;  1NE8 A;  1O75 A;  3KFV A;  2RB6 A;  2Z0W A;  3I55 A;  3I56 T;  5DLO A;  2DJZ A;  1TUC A;  2J6K A;  2R58 A;  5GAM h;  2JM8 A;  1KC8 U;  5GMK m;  1VYV A;  2QGF B;  1Z9Z A;  4XTZ A;  1YIT Q;  4IIM A;  2GQI A;  1ZQ1 A;  1UHF A;  3OY9 A;  5HY6 A;  4PJL A;  2H8H A;  2BE9 B;  2NUP B;  4OGC A;  4IUV A;  4JRI A;  1XJW B;  3CCR A;  5GAM f;  2RQW A;  4KUI A;  4RCB A;  5HK3 A;  1NJI R;  1HXD A;  4OB1 B;  1UDL A;  3JCM J;  4M77 C;  3JAM E;  2GBQ A;  1VQ8 A;  4JUV A;  4HT9 A;  4D6W A;  5AT1 B;  2EQK A;  4F16 A;  4XTY A;  4J9D A;  4C5H A;  5LJ3 d;  2VC8 A;  5IHK A;  1Q81 C;  1NYF A;  2F69 A;  4K11 A;  4ZGJ B;  1JXM A;  1D1B A;  2A36 A;  2HSP A;  2DVE A;  1WHH A;  3CXC A;  1FMK A;  2CKK A;  2MCN A;  4BAC A;  5KYY A;  5GAN 5;  4LNP A;  3UPU A;  4F7U A;  3O8V A;  2EGE A;  2CP2 A;  2X9H A;  3E2U A;  1AWX A;  1YI2 A;  3OYK A;  4BE0 A;  4QW2 A;  2HKQ B;  3PE0 A;  3C95 A;  5DLQ E;  2QA4 Q;  4O5V A;  4E7Z A;  1OV3 A;  2KYB A;  3QBY A;  4ELY C;  2RMO A;  3PMT A;  4HT8 A;  4NS5 A;  1E6G A;  2WSE E;  1JJ2 P;  1YFN A;  1GFD A;  3V8L A;  4AMC A;  2RI5 A;  1Y71 A;  2DO3 A;  2KGT A;  3JCM c;  4M7A E;  1SG5 A;  1VQ9 Q;  2J05 A;  2MPX C;  4CC3 A;  2JZ2 A;  1PM3 A;  3JCM V;  3V7S A;  3H8Z A;  1NPR A;  3CCE A;  1T0H A;  1NZ9 A;  4A4G A;  2EJF A;  2HMA A;  1I8F A;  2DM1 A;  1BB9 A;  1RAG B;  1RAC B;  1ZA2 B;  5D6X A;  1M2V B;  2PVG B;  4D8K A;  1S1N A;  1QCO A;  4A4H A;  3V8J A;  4M75 B;  2JNG A;  1AZE A;  1RAI B;  4N0A A;  1KQ1 A;  1W1F A;  5A0G A;  1D3B A;  5C6S A;  3CCQ A;  2RQT A;  2YXY A;  3L2R A;  3QKJ A;  1W70 A;  4XTX A;  1UGP B;  3CC7 T;  1QKW A;  2X3W D;  1JRI A;  1YP5 A;  2E6N A;  2A7Y A;  2J06 A;  1VQ5 A;  3OW2 A;  3CC4 Q;  1SRM A;  4X1V A;  5IHN A;  2LQK A;  2YUQ A;  1R0C B;  5GMK j;  1UEC A;  4JS5 A;  1EX4 A;  3OYN A;  2QAS A;  2DE0 X;  2ZAE A;  1OOT A;  3VUZ A;  1T3S A;  2XDD A;  2V8I A;  2JMA A;  2VAS A;  3DLL A;  4HKE A;  4A54 A;  2CH4 A;  1K73 U;  3M0Q A;  4J9H A;  2KAF A;  3OS2 A;  4PJO B;  3A8L B;  2QXF A;  1D09 B;  2X4X A;  2LX9 A;  5J3B A;  1YJ9 Q;  3CC2 A;  4XTU A;  3THK A;  1MMA A;  1BI1 A;  2RN8 A;  4IIO A;  2CP3 A;  3OBW A;  4E47 A;  3ASK A;  4C0F A;  3G6E Q;  1N8R R;  4RCC A;  4C5I A;  2RH2 A;  2M51 A;  1G3S A;  3M9Q A;  3CCL T;  1QP2 A;  4J9E A;  5KYU B;  1UGQ B;  2EKO A;  1BIA A;  3M58 A;  3Q1J A;  2JUF A;  2YUN A;  5IAY A;  1KQ2 A;  1I4K 1;  4DOW A;  3VS3 A;  1M90 C;  3OYE A;  1YHQ T;  1D1A A;  1HK9 A;  2I2L A;  2LJ1 A;  3RES A;  3NHN A;  1GFC A;  1M5Q 1;  3VU3 C;  3X28 B;  1HSQ A;  5GAO q;  2CP7 A;  4BUG A;  2QTV A;  2BUD A;  3CCV A;  4M7D F;  1VQ4 T;  3S3O A;  4Z8A A;  1GXI E;  1FX7 A;  2GGR A;  2XG8 D;  3L2Z A;  3OYA A;  4OMP A;  3TSZ A;  2ABL A;  3SWN A;  1G8X A;  3JCM b;  1RI0 A;  5A0L A;  1VQN T;  1N5Z A;  3QHS A;  4OF1 A;  3CPW P;  1KG1 A;  2DVJ A;  2OTL A;  2DET A;  4M78 C;  1ABO A;  4QT7 A;  2LC4 A;  1VQ6 Q;  2QQS A;  1YIJ Q;  1KJW A;  4M7A D;  4M75 E;  1YJN Q;  3MO8 A;  5LJ5 j;  2OTJ A;  1KQS A;  3LYI A;  5KCH A;  2A28 A;  3SEM A;  4C92 D;  1EFN A;  4OB2 B;  1NJI C;  2O9S A;  1WJQ A;  3PMI A;  2EQI A;  1YJW A;  2CDT A;  2K4Y A;  1GCP A;  1TG0 A;  2DJQ A;  4LUD A;  4WCI A;  1UGV A;  1W2B S;  1MV3 A;  3GP8 A;  3CD6 Q;  4RTY A;  1N27 A;  2KRM A;  4GBQ A;  3I55 Q;  2E1H A;  2LRQ A;  1OEB A;  1NM7 A;  2YDL A;  3EGX B;  2EWN A;  3M55 A;  1Q82 R;  5DM7 R;  5KYX A;  4NL2 A;  1WNL A;  2FO0 A;  5FU7 C;  2DL4 A;  2K5L A;  5HCK A;  3CCR Q;  3H9N A;  1MMD A;  1PC0 A;  1QQJ A;  2COZ A;  2DTI A;  1Q7Y U;  1VQ8 Q;  4E7L A;  2G3R A;  2DF6 A;  2RHX A;  1RUW A;  2DL8 A;  3EH1 A;  3G4S A;  3A5Z B;  4WTO B;  1M4Z A;  3I5S A;  2M16 A;  3CMA T;  2MYS A;  4JZ4 A;  2X4Y A;  3SHW A;  4EIK A;  3HTR A;  2CSI A;  3E1S A;  5A0D A;  4XK8 E;  1GCQ C;  4M78 B;  2EQM A;  2M9U A;  4PLI A;  1WQW A;  1KIK A;  4RUG A;  2XDP A;  3CCM T;  1BIB A;  1X75 C;  3NGP A;  2DEU A;  4C0G A;  4LDV A;  3P8H A;  2NLU A;  1OX8 A;  2RJC A;  2E3H A;  2ZGW A;  2KXC A;  1QVG S;  1PKS A;  1H8K A;  4Q5W A;  1YI2 Q;  3SB2 A;  4JLI A;  3JV3 A;  4E6R A;  4FYV B;  3CCU T;  5GAO r;  2KXD A;  3L2Q A;  2ZPH B;  1JQQ A;  2A3L A;  4E7K A;  5I11 A;  2DBM A;  2FZK B;  2KK4 A;  3EHR A;  3JB9 I;  4PNO A;  1X69 A;  3NTH A;  5KYW A;  2LCL A;  2O4X A;  5GAO l;  5CAI A;  5LJ3 e;  3WVE B;  4O6J A;  1JJ2 A;  3F70 A;  1LOJ A;  1GL5 A;  4LDU A;  1OX9 A;  1IGQ A;  4ORZ A;  1ARK A;  2HBW A;  4JJB A;  2EQJ A;  3C12 A;  3D7S B;  1MMG A;  2FPE A;  1PSF A;  3SD4 A;  1QVF S;  1ZA1 B;  3HHT B;  1CSK A;  2LCS A;  3CME T;  1ZSZ C;  3CCE Q;  5I21 A;  1K8A U;  4RTZ A;  3MCA B;  3OB9 A;  3R6O A;  4HCC A;  1AZG B;  4M7D A;  2E5Q A;  2QTX A;  1AVZ C;  1BCM A;  4D8D A;  3A8O B;  2RHY A;  1ZBX A;  3QG1 A;  1K0X A;  1JXO A;  3QPH A;  4QQ6 A;  5CKH A;  1VQO T;  4M75 D;  4QQG A;  3CCQ Q;  5FRO A;  2DD4 A;  4HCB A;  4XAX B;  1U1S A;  1I1J A;  2LNH B;  4N0A C;  1IB8 A;  1Y96 A;  3OS0 A;  5HK0 A;  4LN2 A;  3VS1 A;  2QEX T;  1VQL T;  1VQ5 Q;  1ZUK A;  1WHM A;  2EYQ A;  2V8K A;  4EMG A;  2E70 A;  2F5T X;  1M1K U;  1VQ7 T;  4LDX A;  4IUQ A;  5KYN A;  2L2P A;  4PLL A;  3FRN A;  1VIE A;  3INZ A;  2RO0 A;  2HL5 C;  4FT2 A;  4F7U B;  3CCJ A;  2QI2 A;  2DFU A;  2XI9 A;  2EYX A;  1H64 1;  2EW3 A;  1J3T A;  1SRL A;  4J5Y A;  2B86 A;  1IHV A;  2BZX A;  4PJO D;  3MKD A;  5FRN A;  1F1B B;  3CPF A;  1QKX A;  3LX7 A;  3OYB A;  3OYL A;  2MMP A;  2LVM A;  4AT1 B;  4XQ3 A;  5GAO n;  2C0T A;  3CCS T;  2E3I A;  3VRY A;  3DKM A;  2PVO B;  4C8Q B;  2DBK A;  1H3H A;  1S72 T;  1B34 A;  1ACM B;  4M4Z A;  3OYG A;  3CBO A;  2JJ9 A;  3TQ7 P;  1XOV A;  4PKC C;  1FXX A;  2KT1 A;  5GAN 8;  1FWZ A;  4IUP A;  3MHX A;  3JCM g;  4M7A F;  1IZ6 A;  1TWB A;  3PVL A;  1LCK A;  3NTK A;  2QYZ A;  1M1G A;  4RTW A;  1WI7 A;  2FRY A;  2VXF A;  3CCV Q;  1UUE A;  4RTT A;  4C92 F;  3I56 A;  1M90 U;  1FYN A;  1ZUU A;  4ESR A;  2GFA A;  3HRS A;  4JRQ A;  3REA B;  2V1R A;  4HVW A;  2K79 A;  2VXE A;  1D3B B;  4AFQ C;  3LH0 A;  3CPW A;  4JDS A;  3WVD B;  2CGH A;  1X6G A;  2QK0 A;  3JCM Q;  2XD0 A;  1AT1 B;  1KHC A;  5LJ3 h;  3SWN C;  2HBP A;  3EG9 A;  3ZL7 C;  4KH1 B;  1PWT A;  3EHQ A;  2VGM A;  1KD1 U;  2OTJ Q;  2A0F B;  1Q86 R;  5CKE A;  3EGD A;  4EDU A;  5LJ3 f;  2COY A;  4IUU A;  4LXC A;  2EYW A;  4BI8 B;  5GMK e;  4ME7 A;  1OPL A;  4BDY A;  4M7A G;  1K9M R;  3UA6 A;  1NYG A;  1YJW Q;  3TEE A;  3S3M A;  5GAO m;  3CEY A;  1K1Z A;  3ME9 A;  4ANJ A;  2Y90 A;  4C92 G;  1VQM A;  1KC8 R;  3GNF B;  2EAY A;  5GAN 7;  1W2B P;  3CMA Q;  2LDM A;  1GCQ A;  2CSQ A;  2L5Q A;  2L8D A;  2R5M A;  3OS1 A;  1YCS B;  1R0B G;  2D8H A;  2PU9 B;  2DZ9 A;  3MP1 A;  2O31 A;  2MIO A;  2C0O A;  2F5K A;  5LJ5 g;  2DRM A;  1UE9 A;  1G83 A;  1E6H A;  5GAN g;  3M54 A;  2VYT A;  3EGU A;  1RAD B;  2X4J A;  1U8R A;  4XTV A;  5KCO A;  3ZBD A;  3PTA A;  4IKF A;  1Y0M A;  1C1A A;  3T9N A;  3I5R A;  2GTO A;  1R8O B;  1VQM T;  3HSB A;  5CK9 A;  3OYH A;  3GIB A;  3GOX A;  3G4S Q;  2L0A A;  3REB B;  4DBH A;  2VUB A;  4C8Q E;  3M59 A;  4YTL A;  1VOM A;  4DA4 A;  3RNJ A;  2X51 A;  1N9R A;  4IUT A;  3SWN B;  3EG1 A;  1TXQ A;  4HVU A;  4QQD A;  5CQX A;  2LQW A;  4HCK A;  4OML A;  4DBF A;  3QSU A;  2E12 A;  4M78 D;  1ZSZ A;  1HJD A;  4MMK A;  5EG2 A;  3NPF A;  1AWJ A;  2K3X A;  4RG2 A;  2LT4 A;  1AWW A;  1BI2 A;  2RQR A;  2AZV A;  5CKF A;  4ZTF A;  4X9C A;  4C92 E;  1T0J A;  4KGZ B;  1QVG P;  1X43 A;  4AG1 C;  2A08 A;  3CC7 A;  3N5B B;  1PG5 B;  1UTI A;  2H3E B;  2OAW A;  3P8D A;  1VQK T;  2JS0 A;  2KBT A;  5GAN 6;  5LJ5 e;  3FIF A;  2V1Q A;  2DMO A;  3JCM X;  1BBZ A;  4M77 B;  2FRW A;  4F14 A;  4JRP A;  1VQP T;  4M75 F;  4RTV A;  2MWO A;  4XU3 A;  2FPF A;  4II1 A;  4A4K A;  2HAX A;  3M0S A;  1KK7 A;  4M7A A;  3OW2 S;  2I0N A;  3NTI A;  1M3C A;  1X27 A;  1QVF P;  2QGG A;  2CT3 A;  4JPB W;  4EMK A;  3J7A F;  4C92 A;  1OZ2 A;  2E10 A;  2CRE A;  4LE9 A;  2WSF E;  4C0Z A;  4F17 A;  3V7C A;  2DL5 A;  4ELZ C;  3UF4 A;  1N9S A;  2JN0 A;  2KRN A;  5KYX B;  1YN8 A;  4FSS A;  1G3T A;  4M7D C;  1X6O A;  3CCL A;  2E6Z A;  1OYX A;  4QVZ A;  2XDB A;  2RJE A;  4E7S A;  4MML A;  1H92 A;  2K6D A;  1YHQ A;  2JTF A;  2EVR A;  2RK2 A;  2SEM A;  4OVA A;  5DY9 A;  4PJO F;  5AYF A;  1K9A A;  1Z9Q A;  2WSC E;  1PCX A;  2D1X A;  1G5V A;  4M75 G;  2CP5 A;  2VKN A;  1D0Y A;  4LD6 A;  2DX1 A;  2QQ9 A;  1VQ4 A;  1X2Q A;  2PNI A;  1N8R U;  1V1C A;  2EGC A;  3QWY A;  3OSV A;  2KRO A;  5IH2 A;  3CCJ Q;  2AHJ B;  2GQV A;  2P0P A;  5D7U A;  1MV0 B;  2ROT A;  3L2V A;  1VQN A;  1KHI A;  2OJ2 A;  5KYW B;  3JB9 J;  2QG9 B;  2O4X B;  4DBR A;  2IPO B;  3JCM f;  4FYY B;  1IRX A;  2ZZD A;  1XQH A;  4B9X A;  3RBB B;  2LJ3 A;  4TVR A;  1RI9 A;  1M2O A;  3UDC A;  3X24 B;  3QWX X;  1UJY A;  1UEB A;  1WIE A;  1FMW A;  1NEG A;  1QCF A;  4PJO G;  3BDL A;  2KNB B;  4N4I A;  4C8Q D;  2V26 A;  2YRV A;  1WX6 A;  9ATC B;  2EYY A;  2DKG A;  4PFZ A;  1Q86 C;  5GAO p;  3QJ6 A;  5IHI A;  2DXU A;  3JCM d;  1M8M A;  3RKW A;  4M77 E;  3MJX A;  1K9M C;  3I56 Q;  5GAN 4;  2LZ6 B;  2GNC A;  4RG8 A;  2ENM A;  1RAA B;  5GAN j;  3VS2 A;  1KC8 C;  2AIR B;  4FL6 A;  4FCY A;  3M0U A;  2NUT B;  2HL3 A;  2E41 A;  4J9G A;  2EPD A;  3QZ5 B;  1T3L A;  5I2M A;  3EFO A;  2L3S A;  1IHW A;  1RL2 A;  1Y96 B;  3MEA A;  2WAC A;  2PQW A;  3RDV A;  3UA7 A;  3L1A A;  3QYH B;  1SEM A;  2VWF A;  1RAE B;  3CMA A;  1W4S A;  1M2V A;  2KR3 A;  2RHU A;  4M75 A;  1WPY A;  1LNX A;  3KXT A;  4BY6 C;  5LJ5 f;  5GAN 2;  2CP6 A;  4ZNX A;  2DYB A;  3TVT A;  4BDZ A;  2YLC A;  2QQB A;  5GAN f;  2L3Q A;  4PJO E;  3CCM A;  5FU6 C;  1Q82 U;  2CP0 A;  1IO6 A;  2KEA A;  3ULR B;  3JB9 G;  1VQM Q;  1AHJ B;  1ZLM A;  4ZN1 A;  2M0Y A;  2CT4 A;  4A63 B;  1WYX A;  3CCU A;  2LNV A;  2PTK A;  5M9O A;  2EJG A;  4AFS C;  3OYY A;  1QVP A;  4OMO A;  2FHD A;  3BW1 A;  1YIT T;  3LH5 A;  2HQE A;  2XHC A;  5LJ5 d;  5GAM g;  1Q7Y R;  5I22 A;  1V29 B;  5GJW B;  2LQ8 A;  5GAN d;  4PFP A;  5C0M A;  4OMN A;  1QMC A;  3JB9 H;  2KI7 A;  3ER0 A;  5IT9 E;  1LJO A;  4PJO A;  3HRU A;  5CKB A;  2GF7 A;  3QDR B;  1JJ2 S;  3VKI A;  3J81 E;  3CME A;  8AT1 B;  2ZPB B;  4FIB A;  4J6X A;  2JTE A;  4KBM B;  1MGQ A;  1Q81 U;  3E9F A;  2LCC A;  2JVV A;  2F2X A;  4BE2 A;  4OB0 B;  5D6W A;  2RK1 A;  4CC2 A;  1QCN A;  2FYK A;  4HA8 A;  3QXE B;  3FDR A;  2ATC B;  1MND A;  2L3R A;  2NWM A;  2X4W A;  4J7F A;  2O88 A;  5KYU A;  1U3O A;  4ZGE B;  3RMS A;  1C0M A;  4J8O A;  3OYC A;  3M56 A;  1OQK A;  1P92 A;  2JT4 A;  3G1J A;  2JM9 A;  3PT9 A;  3EG0 A;  3X26 B;  3S6W A;  2JOY A;  3EG9 B;  4N4G A;  4JLG A;  2K5I A;  3JRZ A;  2QA4 T;  1VQO A;  1RAH B;  3VJP A;  3VS0 A;  1UGR B;  1QVG A;  2GFU A;  2ZPF B;  3VS6 A;  2HNI A;  5J26 A;  2ED1 A;  4M78 G;  2HCK A;  3CC7 Q;  5EC7 A;  4J9B A;  3EGD B;  1VQL A;  5FU7 B;  3PVQ A;  2QEX A;  2XID A;  3FJ5 A;  1WDX A;  1PD1 A;  1M3B A;  3OA6 A;  1VQ9 T;  1WXU A;  1VQ7 A;  2CH4 W;  1K8A R;  4PFO A;  4L59 A;  2J7I A;  2HDA A;  1E7O A;  2XK0 A;  5D6Y A;  2O2O A;  4DQ2 A;  4M77 D;  3VYH B;  2LP5 A;  4DEX A;  4RKU E;  3X20 B;  2DRK A;  1YNZ A;  1QVF A;  3M53 A;  2CZ1 B;  4E7I A;  1K73 C;  4ZTJ A;  2XIC A;  3OW2 P;  2V8J A;  2YWW A;  4OP0 A;  4WF2 A;  2ZCF B;  4M7A C;  3QYG B;  1RLQ C;  2YRC A;  4A53 A;  2EIF A;  3EFS A;  3TU4 K;  4EMK C;  4BI4 A;  4PJN A;  3HP9 A;  2ED0 A;  4C0D C;  4C92 C;  3CCL Q;  3CCS A;  1PKT A;  2DYI A;  5KYY B;  5I2S A;  2Y4X A;  2FPD A;  2NUZ A;  1S72 A;  1U1T A;  3BFM A;  1YHQ Q;  1O9S A;  4GLK A;  4MZT A;  4E7H A;  2YLB A;  1D0Z A;  2DXB A;  1U06 A;  2VB6 A;  1M1K R;  2CZ7 B;  3MEW A;  3CC4 T;  2X3X D;  4M78 E;  2EJ9 A;  3EGX A;  3OQ5 A;  1UHC A;  1GBQ A;  1X2K A;  3V7R A;  1N6A A;  2COW A;  4C5E A;  1VQ4 Q;  1NBE B;  2P4R A;  4P5N A;  4HXJ A;  4DBQ A;  1ZSZ B;  3JCM W;  4MZM A;  4C8Q F;  3A8G B;  2K57 A;  2HQX A;  2YRD A;  4VUB A;  4Z02 A;  4LDY A;  3VYG A;  5FW9 A;  1VQN Q;  2AKL A;  1YJ9 T;  3HFN A;  1WHJ A;  4FU6 A;  1JBM A;  2YSQ A;  2D0N A;  3G6E T;  1WGS A;  4QVC A;  2F2W A;  2AT1 B;  3A98 A;  2OX7 A;  2OI3 A;  4F7U G;  4CC4 B;  1BKB A;  3CPW S;  1D0X A;  3NFC A;  2E5K A;  2RI2 A;  1OU9 A;  2X35 A;  1KFZ A;  2C06 A;  2KT8 A;  3HRT A;  3QUI A;  3HFO A;  1EZZ B;  4J9F A;  1SHF A;  2P84 A;  1LPL A;  3M0R A;  2AZS A;  4C8Q G;  3PIO A;  1WHG A;  3MET A;  2CS7 A;  2QDY B;  1D1C A;  2W0Z A;  3VV0 A;  1G3W A;  1TOV A;  5GAM j;  2NYS A;  3G71 T;  3JB9 D;  1AWO A;  2DA9 A;  2J6F A;  2DEQ A;  3RKY A;  3QII A;  1M3A A;  2RA2 A;  4JJN K;  3MP8 A;  1QLY A;  2D8J A;  1VQ6 T;  1YIJ T;  3A8M B;  2Y4Y A;  1I0C A;  4L6V 5;  1YJN T;  5IN1 A;  1Q7Y C;  2R5A A;  1BK2 A;  5FWB A;  3JCM e;  3EAE A;  2FVU A;  2MI6 A;  1NJI U;  3PNW C;  3CXC S;  1WJR A;  5CO7 A;  1WA7 A;  1OPK A;  4F7U E;  2MOX A;  5GAN 3;  2MF2 A;  3CCM Q;  2CUD A;  1W6X A;  2YHT A;  4KGV B;  3FEO A;  4KT0 E;  4OMM A;  4KRT A;  5CR2 A;  2LT1 A;  3CD6 T;  2DIG A;  4M75 C;  2W10 A;  3V8K A;  2FL7 A;  2D6F A;  4KUD K;  2O01 E;  4PJJ A;  4R56 A;  3NMZ C;  3I55 T;  3CCU Q;  4C5G A;  4RTU A;  2EYZ A;  2CZ6 B;  3O5Z A;  2KVQ G;  3BE3 A;  4FYX B;  4Y92 A;  1NLP C;  1VQK A;  2MAM A;  3U23 A;  4CRI A;  2DER A;  2DL7 A;  1SSH A;  4EPC A;  1M1F A;  5A2Q E;  5GAM d;  1IRE B;  1PRM C;  4E7J A;  4FT4 A;  3CCR T;  1WHK A;  2LJ0 A;  3M5A A;  1VQP A;  3FB9 A; 
#chains in the Genus database with same CATH homology
 2FG0 A;  3RBB B;  2KXC A;  1PKS A;  1H8K A;  1AEY A;  2QDL A;  2LJ3 A;  3JV3 A;  4E6R A;  2KXD A;  1RI9 A;  1JQQ A;  3QWX X;  1UJY A;  5I11 A;  5FWC A;  2DBM A;  1WIE A;  1QCF A;  1NEG A;  3EHR A;  1WXB A;  2KNB B;  1SHG A;  1X69 A;  4HVV A;  2LQN A;  1MUZ A;  3C0C A;  1ZX6 A;  2RNA A;  1WX6 A;  2EYY A;  2JXB A;  1GL5 A;  4RTX A;  4LUE A;  1BU1 A;  4ORZ A;  5IHI A;  1WFW A;  2C0I A;  1ARK A;  2HBW A;  4JJB A;  1M8M A;  1B3Q A;  3EG2 A;  2BZY A;  2FPE A;  2LZ6 B;  1CSK A;  3EG3 A;  2LCS A;  2GNC A;  2KYM A;  4DEY A;  2ENM A;  2ESW A;  1M27 C;  3VS2 A;  4RTZ A;  1YWO A;  1AZG B;  2BTT A;  3M0U A;  1U5S A;  2F2V A;  3H41 A;  1AVZ C;  4J9G A;  2EPD A;  1CKA A;  1T3L A;  3UAT A;  2G6F X;  4D8D A;  1K0X A;  2L3S A;  2FEI A;  1JXO A;  3H0I A;  4JZ3 A;  3KFV A;  2DL3 A;  3UA7 A;  4GLM A;  1TUC A;  1SEM A;  2VWF A;  1AOJ A;  2J6K A;  3CQT A;  5IXB A;  2JM8 A;  4AFZ C;  4R0K A;  1VYV A;  3VRZ A;  1Z9Z A;  2KR3 A;  2RF0 A;  1QWE A;  4IIM A;  1I1J A;  2GQI A;  2LNH B;  1UHF A;  2EKH A;  4ZNX A;  2DYB A;  3TVT A;  2H8H A;  4LN2 A;  3VS1 A;  2L3Q A;  1ZUK A;  2VVK A;  2RQW A;  1G2B A;  3I9Q A;  1IO6 A;  2KEA A;  1UDL A;  3ULR B;  2GBQ A;  1ZLM A;  2M0Y A;  2CT4 A;  4F16 A;  3GBQ A;  2DIL A;  2L2P A;  4A63 B;  1WYX A;  4J9D A;  2PTK A;  4AFS C;  4OMO A;  4AFU C;  1K76 A;  1GRI A;  5IHK A;  2YUP A;  1NYF A;  4K11 A;  2JMC A;  3LH5 A;  1JXM A;  2A36 A;  2EYX A;  2EW3 A;  1J3T A;  1SRL A;  2HSP A;  2B86 A;  5I22 A;  5GJW B;  1ABQ A;  5GJV B;  1FMK A;  2ROL A;  2BZX A;  4OMN A;  2MCN A;  4LNP A;  2EGE A;  1QKX A;  2KE9 A;  1AWX A;  1VA7 A;  4JJC A;  2C0T A;  3PE0 A;  3VRY A;  1VYT A;  2JTE A;  1OV3 A;  2DBK A;  1H3H A;  2KYB A;  2EGA A;  2F2X A;  1I07 A;  1Y57 A;  4M4Z A;  2RMO A;  2XMF A;  4J9I A;  1CKB A;  4CC2 A;  1E6G A;  1XOV A;  2KT1 A;  1GFD A;  2NWM A;  1UJ0 A;  2O88 A;  2KGT A;  1U3O A;  1ZUY A;  3PVL A;  1LCK A;  4RTW A;  3R6N A;  2J05 A;  1JO8 A;  1WI7 A;  2FRY A;  2JT4 A;  2K3B A;  4CC3 A;  2JM9 A;  1UUE A;  4RTT A;  3EG0 A;  1AD5 A;  4OMQ A;  1FYN A;  1NEB A;  1ZUU A;  2A37 A;  4ESR A;  3VS0 A;  1KSW A;  3VS6 A;  1T0H A;  3REA B;  2V1R A;  4HVW A;  2ED1 A;  2K79 A;  2HCK A;  2DM1 A;  1BB9 A;  1M30 A;  4AFQ C;  5EC7 A;  4J9B A;  1K4U S;  3PVQ A;  3FJ5 A;  2RQV A;  1X6G A;  4D8K A;  1S1N A;  1WDX A;  3ZL7 C;  1M3B A;  2CUB A;  1WXU A;  1AZE A;  1PWT A;  2CH4 W;  1UFF A;  3M0P A;  3EHQ A;  2J7I A;  1JEG A;  1W1F A;  1E7O A;  2HDA A;  2O2O A;  1PRL C;  2DLP A;  4J9C A;  2LP5 A;  2O9V A;  4DEX A;  1TUD A;  2RQT A;  2EYW A;  2DRK A;  1YNZ A;  1W70 A;  3IQL A;  1OPL A;  1QKW A;  2RPN A;  2X3W D;  2BZ8 A;  1YP5 A;  3UA6 A;  1NYG A;  2J06 A;  1WXT A;  1SRM A;  2ECZ A;  4X1V A;  5IHN A;  2YUQ A;  2EBP A;  1K1Z A;  1UEC A;  5L23 A;  1RLQ C;  4Z89 A;  2DE0 X;  2ED0 A;  1OOT A;  1T3S A;  1GCQ A;  2CSQ A;  1PKT A;  2AKK A;  1YCS B;  2FPD A;  2JMA A;  2D8H A;  2NUZ A;  2O31 A;  2CH4 A;  2C0O A;  2MIO A;  2DRM A;  1UE9 A;  1G83 A;  3M0Q A;  4J9H A;  1E6H A;  1U06 A;  3VS7 A;  3THK A;  2K2M A;  2X3X D;  3EGU A;  2RN8 A;  4IIO A;  3TSW A;  1QWF A;  1PHT A;  3VS5 A;  1UHC A;  1GBQ A;  1X2K A;  1Y0M A;  3I5R A;  2GTO A;  2M51 A;  2P4R A;  2K7A A;  2SRC A;  4HXJ A;  4J9E A;  3H0H A;  2L0A A;  3REB B;  1PNJ A;  2YUN A;  3VS3 A;  1NG2 A;  2K9G A;  3RNJ A;  2LJ1 A;  5FW9 A;  1HD3 A;  2AKL A;  2J6O A;  2JW4 A;  3EG1 A;  4HVU A;  2LQW A;  4HCK A;  4OML A;  3NHN A;  1RLP C;  1GFC A;  2YSQ A;  1HSQ A;  2D0N A;  2F2W A;  2HEQ A;  1HJD A;  3A98 A;  3NPF A;  1AWJ A;  2OI3 A;  2PZ1 A;  3VS4 A;  3M0T A;  1AWW A;  2RQR A;  5IXF A;  4Z8A A;  4CC4 B;  2AZV A;  2GGR A;  4OMP A;  3TSZ A;  1T0J A;  2ABL A;  1X43 A;  4AG1 C;  2E5K A;  2A08 A;  1SPK A;  1UTI A;  1JU5 C;  2OAW A;  1N5Z A;  1KFZ A;  2JS0 A;  2DVJ A;  2KT8 A;  2LX7 A;  2KBT A;  1ABO A;  4J9F A;  4QT7 A;  2V1Q A;  1SHF A;  2DMO A;  1BBZ A;  2FRW A;  2KRS A;  1KJW A;  4F14 A;  4RTV A;  3M0R A;  5ECA A;  2AZS A;  1YWP A;  2RQU A;  4CC7 A;  2FPF A;  1WLP B;  3M0S A;  1A0N B;  2A28 A;  2W0Z A;  2I0N A;  3SEM A;  1M3C A;  1X27 A;  1EFN A;  4Z88 A;  1ZBJ A;  2O9S A;  2CT3 A;  3H0F A;  4JPB W;  1AWO A;  2DA9 A;  2J6F A;  2EQI A;  1M3A A;  2CRE A;  4LE9 A;  2CDT A;  4F17 A;  1GCP A;  1TG0 A;  2DJQ A;  2DL5 A;  4LUD A;  4WCI A;  1UGV A;  1NLO C;  1QLY A;  3UF4 A;  2D8J A;  1MV3 A;  1B07 A;  2KRN A;  4RTY A;  1YN8 A;  4FSS A;  2KRM A;  1I0C A;  4GBQ A;  1BK2 A;  1K0S A;  3I35 A;  5FWB A;  1OEB A;  1NM7 A;  2YDL A;  2JS2 A;  1H92 A;  2K6D A;  1GBR A;  1ZSG A;  2DNU A;  1WA7 A;  2GTJ A;  2EVR A;  1OPK A;  2SEM A;  2MOX A;  1K9A A;  1Z9Q A;  2FO0 A;  2DL4 A;  5HCK A;  2CUD A;  2D1X A;  1W6X A;  4JJD A;  2IIM A;  2VKN A;  4KRT A;  4OMM A;  4AG2 C;  2DX1 A;  2W10 A;  2YT6 A;  2DF6 A;  1RUW A;  1X2Q A;  2L3P A;  2DL8 A;  3NMZ C;  2PNI A;  4RTU A;  2EYZ A;  1V1C A;  2EGC A;  3I5S A;  3O5Z A;  3QWY A;  2KRO A;  5IH2 A;  4JZ4 A;  3SHW A;  4EIK A;  2CSI A;  4Y92 A;  1MV0 B;  2ROT A;  1UG1 A;  1GCQ C;  1NLP C;  2YUO A;  3U23 A;  1KIK A;  1X6B A;  4RUG A;  2DL7 A;  1SSH A;  2OJ2 A;  1PRM C;  3NGP A;  2LMJ A;  2AK5 A;  1VYU A;  2LJ0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...