1N5ZA

Complex structure of pex13p sh3 domain with a peptide of pex14p
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
71
structure length
71
Chain Sequence
EPIDPSKLEFARALYDFVPENPEMEVALKKGDLMAILSKKDPLGRDSDWWKVRTKNGNIGYIPYNYIEIIK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Topography for Independent Binding of alpha-Helical and PPII-Helical Ligands to a Peroxisomal SH3 Domain
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Protein transport
molecule keywords Peroxisomal membrane protein PAS20
total genus 13
structure length 71
sequence length 71
chains with identical sequence B
ec nomenclature
pdb deposition date 2002-11-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 1n5zA00
4HXJA 2YT6A 4ZNXA 2X3WD 3LH5A 1QKWA 1UGVA 2O9SA 2JM8A 1PRLC 3VS4A 1J3TA 2YUOA 4QT7A 1M8MA 2GNCA 1ZBJA 5IXBA 2F2XA 2LQWA 1U3OA 1B07A 1YCSB 1XOVA 2W0ZA 2CT4A 2J7IA 1GL5A 2V1QA 1ZUUA 1GBQA 2KR3A 4AG2C 1GCPA 2K2MA 2QDLA 3UA6A 1NEBA 1KIKA 2JTEA 4EIKA 2MCNA 5IHNA 3VS5A 1G83A 2AZVA 4RTUA 1MV3A 3TSZA 2DL4A 2EYXA 1Z9QA 2AK5A 4AFSC 2KBTA 2PTKA 2KYMA 1UG1A 2EPDA 2KXDA 4DEYA 3QWXX 1WXTA 2A08A 1BBZA 1WI7A 3FJ5A 1KFZA 2EBPA 2BZXA 3KFVA 3UATA 1B3QA 2CUBA 3EG1A 2O2OA 4LE9A 1WIEA 1K0SA 3NGPA 2E5KA 1M3BA 2D0NA 4Z88A 2H8HA 2ROLA 4CC2A 1YP5A 2FPFA 3A98A 4CC3A 3SEMA 2VKNA 4Z89A 2CUDA 2J6OA 2LNHB 3JV3A 3REAB 2SEMA 3TSWA 1JEGA 1N5ZA 1SHGA 4J9BA 2DF6A 2EVRA 1SRLA 1NYFA 3H0HA 3PVLA 2OAWA 3M0PA 2M51A 1MV0B 1PWTA 1G2BA 2DL3A 1IO6A 3IQLA 2KT8A 1NLPC 1HD3A 2LQNA 4M4ZA 5L23A 2PNIA 1T0JA 1X43A 2HDAA 2OI3A 4J9FA 1V1CA 1UHFA 3REBB 2A28A 2VWFA 4OMLA 2W10A 2NWMA 4F16A 2GBQA 1ZX6A 2OJ2A 2JS2A 2JMAA 2K7AA 2F2WA 2P4RA 1K76A 4Z8AA 2LMJA 3EG0A 2FEIA 1X69A 1NYGA 1PNJA 2BTTA 3M0QA 4AFZC 4LNPA 1KSWA 4R0KA 4LUEA 4OMPA 3NMZC 4RTZA 1NG2A 4RTYA 1SSHA 2EQIA 4J9GA 2O9VA 2RN8A 1E6GA 1S1NA 1UJ0A 2DMOA 2LX7A 3U23A 1AEYA 3EG3A 2LCSA 2K3BA 2JM9A 1X27A 3H0IA 1YNZA 5HCKA 1CSKA 2C0IA 4GBQA 1NEGA 1YN8A 2KNBB 1PKTA 4HVWA 1FYNA 1QWEA 2J6KA 2CREA 1GRIA 1ABQA 3GBQA 2JW4A 2DRMA 1X6BA 1U5SA 2KRSA 2KYBA 2KRMA 1OV3A 1X6GA 4JJCA 1X2QA 1BU1A 4X1VA 2CH4W 1UJYA 1MUZA 1YWOA 3EG2A 2MOXA 1T0HA 1UE9A 2I0NA 4D8DA 2KRNA 1K1ZA 4JPBW 4ORZA 2GQIA 2D8JA 2GTOA 2LJ0A 1W1FA 3NHNA 1QCFA 4F14A 2YSQA 4FSSA 2KT1A 5IHIA 3VS6A 2FRYA 4RTVA 2DM1A 4AFQC 1T3LA 2V1RA 2KXCA 3I9QA 1OPKA 2A36A 1U06A 1UHCA 3I5SA 1JU5C 1TUDA 2DX1A 1OPLA 1SPKA 4GLMA 2G6FX 2EGCA 1K0XA 2FPEA 1GFDA 2YUPA 1WDXA 1W70A 4OMOA 2DE0X 1Y0MA 3PE0A 2VVKA 2ESWA 1A0NB 1AZGB 2RPNA 4DEXA 4OMQA 1I1JA 2DBMA 2JS0A 1PKSA 2ED1A 2AZSA 1I07A 1AWXA 2FO0A 2CDTA 2B86A 3RBBB 1VYTA 3THKA 1JQQA 1JXMA 1WXUA 3EHRA 1WYXA 2PZ1A 2KROA 3RNJA 1WA7A 3NPFA 1H8KA 1RLQC 2EGEA 1ZLMA 3H0FA 1CKAA 2HCKA 2RMOA 4JZ3A 1GCQA 1LCKA 4Y92A 1SEMA 1PHTA 4D8KA 3H41A 3M0RA 3VRZA 3SHWA 2J06A 2YDLA 4AFUC 1TG0A 2C0TA 4A63B 3VS3A 3PVQA 2CH4A 4J9HA 2HBWA 4RTWA 5EC7A 3ZL7C 2DL5A 2FRWA 4J9IA 5FWCA 1QLYA 2DRKA 4JZ4A 2K79A 2A37A 4RUGA 3M0TA 4LUDA 1I0CA 1RLPC 2ED0A 1AOJA 1M30A 2KE9A 4K11A 1JO8A 2L0AA 1TUCA 1FMKA 4IIMA 1E7OA 5IXFA 1WFWA 4JJDA 1M3CA 1VYVA 4IIOA 2RQWA 2EYZA 1QWFA 1JXOA 1BK2A 4HCKA 5IHKA 2JT4A 1H92A 2FG0A 1RUWA 3CQTA 2RNAA 3VS1A 5IH2A 3I35A 2DL8A 3VRYA 4KRTA 4J9EA 1AWOA 2HSPA 1WXBA 4RTTA 4F17A 1ZUKA 2EKHA 3EGUA 1NM7A 2EW3A 4LN2A 4CC7A 3C0CA 2ENMA 1Y57A 4HVUA 1ARKA 2FPDA 2M0YA 4OMNA 1K9AA 1UECA 2DYBA 2KEAA 2ROTA 2ABLA 5I22A 1HSQA 1W6XA 2HEQA 2JXBA 5FWBA 3M0SA 2O88A 2X3XD 4E6RA 2DJQA 2IIMA 2L3PA 2D8HA 2L3SA 1AVZC 2ECZA 2D1XA 2LJ3A 2DLPA 1AZEA 2RQRA 2K6DA 2BZYA 2LZ6B 3VS0A 2DNUA 1VA7A 3QWYA 1UTIA 1PRMC 1T3SA 4ESRA 1ZSGA 2RQUA 2EYWA 2YUQA 1OOTA 2XMFA 5GJWB 2RQVA 1OEBA 3O5ZA 2RF0A 1SRMA 2DILA 1GFCA 4CC4B 2CT3A 1WX6A 2AKLA 3UA7A 2GGRA 1M27C 1ZUYA 5FW9A 3M0UA 2NUZA 2SRCA 1QKXA 1UDLA 2DA9A 1HJDA 1Z9ZA 2L2PA 4WCIA 4J9DA 1WLPB 1BB9A 2KGTA 4AG1C 3EHQA 1YWPA 2EGAA 2DVJA 5ECAA 3VS2A 2CSIA 2LP5A 1RI9A 3UF4A 5I11A 1H3HA 1CKBA 2DBKA 1AWJA 4HVVA 1VYUA 1EFNA 2O31A 1NLOC 2BZ8A 2F2VA 4JJBA 1E6HA 1UUEA 4J9CA 4OMMA 3R6NA 4RTXA 1GCQC 3I5RA 3VS7A 1SHFA 2C0OA 2MIOA 2K9GA 5GJVB 2L3QA 1X2KA 2J05A 2EYYA 2GTJA 1GBRA 2RQTA 2LJ1A 1KJWA 1UFFA 1AD5A 1K4US 2JMCA 2YUNA 3ULRB 2DL7A 2CSQA 2AKKA 1AWWA 1M3AA 3TVTA 2J6FA 1ABOA
chains in the Genus database with same CATH superfamily
3OYKA 4C5IA 1QKWA 2O9SA 2JM8A 3VS4A 1QMCA 2EQMA 2YUOA 4QT7A 1NJIU 1M8MA 2E64A 2P0KA 2F2XA 1U3OA 1B07A 1YCSB 3EAEA 2CT4A 2J7IA 2KR3A 1R0CB 1HYOA 2RD1A 4AG2C 5LJ5h 5KCOA 3L1AA 2LDMA 5LJ3j 1G83A 2AZVA 2DL4A 3QSUA 1Z9QA 3AHUA 2KBTA 3QKJA 5FU6C 3FEOA 2OTLA 2K3YA 2KXDA 4DEYA 1RAIB 4LD6A 5GAN3 1VQ5Q 4PL6A 4LD9K 2GQVA 3EFOA 1Q86U 2HD0A 4HT9A 4RG2A 4XTVA 1M1KC 4LE9A 1WIEA 3HPWA 1KD1R 3D7SB 1M3BA 1TWBA 2H8HA 2FPFA 4C92F 4C0FA 2RI5A 3CD6A 3A98A 4B9XA 4CC3A 2KVQG 3SFMA 3SEMA 3CMEQ 3ER0A 1ZSZA 2J6OA 4M75B 3REAB 2M1HA 1KD1C 3TSWA 1JEGA 3CCSA 3FC3A 3A1PA 1N5ZA 5KYYA 2KQWA 1VQLQ 3CCUQ 3I56A 3C12A 2DJZA 1NPRA 3HKSA 4QW2A 3G4ST 1NZ9A 5GAOm 1NE8A 2BE7D 2VASA 2DIGA 1D09B 2KK4A 3CC2A 1I5OB 5L23A 1T0JA 2PNIA 2HDAA 2FL7A 1V1CA 3URGA 1VQPT 4PFZA 3M59A 4HKEA 2CP7A 4OMLA 2RH2A 2W10A 2DFUA 1B34A 5HY6A 4LXCA 3RUXA 2GBQA 1P92A 1ZX6A 2OJ2A 5J26A 1YJWT 2KI7A 1WHJA 4BD3A 5KYWB 4C92G 1NYGA 4MZMA 4M7DE 2YWWA 4AFZC 4QVCA 3WXMB 3V8JA 1VQ9A 1K9MC 1M4ZA 3NMZC 2CYZB 4RTZA 4KBMB 3CC7T 2E6ZA 2EQIA 2NUTB 3U23A 2DMOA 1H3ZA 2LCSA 1YHQA 1UGQB 4E7SA 2JM9A 1X27A 2RHYA 2QA4A 1YNZA 5HCKA 2C0IA 3OYMA 4M78E 1YBYA 1PKTA 3JRZA 1VQ9Q 3CPWA 4J7IA 2CREA 1IRXA 1MMAA 2EQUA 3BDUA 3OYCA 4E7JA 2QK0A 3VJPA 3DLMA 1U5SA 2DTIA 3JCMQ 4NOYA 1BI2A 2E3HA 2QA4Q 5FU6B 4JLIA 2K5IA 4A4HA 2QG9B 4JS4A 2KMTA 4XTYA 5GMKm 2R5MA 1YIJT 2I0NA 1M8VA 1D3BB 4JPBW 4OGEA 2GQIA 2HMAA 4N4IA 2MK5A 1ZA2B 3M5AA 4XTXA 1YHQQ 4XK8E 4X34A 3L2QA 3RMSA 1T3LA 2CZ7B 3I9QA 2Y4YA 5GMKj 4IUPA 2Y4XA 1KC8C 1TUDA 2X4YA 1VQ5A 4GLMA 3JCMJ 3CCET 2G6FX 1K0XA 2YUPA 1W70A 3OSVA 3CC2Q 1TOVA 1IXDA 1Q82R 3UWNA 2ESWA 1A0NB 1YITQ 1WNLA 2RK2A 3OYLA 3JCMf 3EH1A 2AZSA 3NFCA 2RJCA 2CDTA 2B86A 3RIRA 1JXMA 3OS1A 2DAQA 1LPLA 3NPFA 1RLQC 2EGEA 2OTJT 1YJ9Q 2RHIA 3QZ9B 3JAME 3BE3A 5LJ3e 4Y92A 4FYXB 3MCAB 2X4XA 2J06A 4GLKA 1X75C 2QEXT 4PJNA 5GAN5 4LDUA 2Y90A 3EFRA 3ZFJA 4J9HA 4FYWB 1QCOA 1PSFA 2DL5A 2YRCA 1RL2A 3BDLA 1WJSA 2K79A 4C92A 5D7UA 2CP0A 3M0TA 5L8RE 2VGMA 2CZ6B 1M2VB 1M30A 3S3MA 1D1AA 2E10A 3CCLQ 1UEBA 1TUCA 1BKBA 1E7OA 4VUBA 1VQ7Q 1C0MA 1VYVA 4M78B 2RJEA 4LDVA 1JXOA 4PKCC 1BK2A 5CVIA 4M7DA 2JT4A 2PUOB 3L42A 1K73R 1RUWA 3I55Q 2RNAA 3M57A 2COZA 3QJ6A 4FT2A 4KRTA 3SDZA 3X20B 1ACMB 2HSPA 1KQ1A 1F1BB 3FDRA 2JZ2A 1K73C 1Q86R 1G8XA 2DK3A 2M0OA 1NM7A 4EPCA 4LN2A 3C0CA 3MEAA 4N4GA 5I2MA 1I5LA 4M77A 2LVMA 4A53A 4KT0E 4OMNA 4JS5A 4M75D 3CMAQ 1VQPA 1VQ8T 4N0AC 2ZGWA 2DYBA 2ABLA 4EMHA 2O88A 4V2SA 5GANj 2D8HA 3M58A 2QAZA 3HRTA 3ZEHA 1Q7YU 4II1A 1FMWA 2ECZA 2D1XA 2LJ3A 4M7DD 4XTUA 1Y7XA 2OX7A 1QP2A 2LZ6B 3JB9F 5GANh 4PJOG 2L5QA 2O4XB 1OZ3A 3EFSA 1UTIA 2DD4A 1N9RA 2LT1A 4ESRA 1PD1A 1ZSGA 2RQUA 1VQMT 2R57A 4F7UF 2XMFA 2ZPHB 5DLQE 3O5ZA 1MHNA 1TU0B 1GFCA 2JUFA 3JSCA 4ZGEB 5LJ3g 3QHSA 1ZA1B 1ZUYA 3M0UA 2NUZA 2DIQA 2WACA 4ATOA 3CCMT 1UDLA 2CKKA 1D3BA 4M75E 7AT1B 2YLBA 4XTZA 4PJOA 4AG1C 2DVJA 1VQOT 3VKIA 3VS2A 2XG8D 4C8QA 1BIAA 3KBGA 2E1HA 2M02A 5CAIA 3A8HB 3DB3A 4HVVA 2DYIA 1NLOC 2BZ8A 5GMKl 1K8AR 1TTHB 4J9CA 3NTIA 4J5YA 2MIOA 4M78C 2DZCA 3CCRQ 2L3QA 4ZN1A 1YHQT 1UGSB 2DEUA 1BI3A 2RQTA 4B9WA 1O75A 3E19A 1BIBA 4ELYC 3CBOA 1VQNQ 1M3AA 2RK1A 3JCMb 5KE2A 5FU7B 2J6FA 1LNXA 1WPYA 4QQGA 2YT6A 1UGVA 1TXQA 3VUBA 4PJMA 1Q81C 1J3TA 3L2WA 2GNCA 2HSEB 4PLLA 2K2VA 1PM3A 4L6V5 3DKMA 1VQ6Q 3CPFA 2K5FA 1ZSZB 2LQWA 4ME7A 2X4WA 1XOVA 3RR6A 1KD1U 5GMKi 4WF2A 2COWA 3LLRA 3UA6A 2DXTA 5IHNA 3VS5A 8AT1B 2C06A 2ZZDA 3FB9A 3L2UA 3G4SA 3A8MB 2HAXA 2VC8A 5CKBA 2AK5A 2DZ9A 2PTKA 2RHZA 1IREB 4OGCA 4J83A 5IT9E 5LJ3d 3OMCA 3QWXX 1WXTA 2YRDA 2XKOC 4D6WA 1WI7A 2JTFA 3FJ5A 2EBPA 4M7AF 2WSEE 1KC8U 5GAOl 3QYHB 2CUBA 1YJNT 1M1KU 3QJYA 2G3RA 3CPWS 1K0SA 4IUVA 2E5KA 5GAMg 4Z88A 2ROLA 1TS9A 1JJ2A 2VKNA 3JCMe 2CUDA 4FW2A 3GOXA 2LNHB 2QDYB 1W2BS 1SSFA 4MDXA 3V8KA 3JCMP 1WZOA 2Z0WA 1NYFA 2F5KA 1N8RC 2OAWA 2OTLT 3P8HA 1U8RA 1VQ7T 2E6NA 1PWTA 1G2BA 4E47A 2IG0A 3QZ5B 1IO6A 2V26A 1NLPC 5DM7R 5GANf 1HD3A 3VU3C 1X43A 1UHFA 3JCMc 1G3SA 2NYSA 1M2VA 1QVGP 3M55A 1GXIE 5J3BA 2JS2A 2JMAA 2F2WA 2ZPEB 4C92B 1VUBA 1ZBXA 1K76A 3CCEA 2LMJA 4BY6C 3EG0A 2FEIA 3OYJA 3OYFA 1PNJA 2BTTA 3RESA 3M0QA 5FU7C 3M9QA 4M77E 4LNPA 4LUEA 1VQ9T 1RAEB 1SSHA 1DJ7B 4J9GA 4E7KA 3HSBA 4C8QG 2H3JA 2K3BA 1D1CA 4HCCA 1CSKA 1NPPA 1YN8A 1X01A 5CKEA 2HZYA 4HVWA 1QWEA 1D0YA 3G71Q 1ABQA 2COYA 3GBQA 1JJ2P 1LJOA 3CXCA 2DRMA 1X6BA 2LTOA 3NTKA 2MWOA 2KYBA 1K8AC 5KYXA 2KRMA 1XNIA 2RHXA 3OS5A 4F04B 1OV3A 1EX4A 4JJCA 1N27A 3V8LA 5AT1B 4KUIA 2D9TA 2DEQA 4D8DA 4MDWA 1PCXA 3ZBDA 2FB7A 3NHNA 4GY5A 4F14A 1O9SA 2IVWA 3J80E 5GAN6 2QQBA 3CC4A 3LX7A 2E5QA 3TEEA 2DM1A 4OB1B 3RMQA 2YLCA 1KHCA 2QEXA 1V29B 4FYVB 4M78A 1VQ4A 2FPEA 5CO7A 3CCLA 4OMOA 2DE0X 4MMKA 1Y0MA 3PE0A 3GNFB 4XU2A 4FM4B 5KYYB 2RPNA 5LJ3h 3QPHA 1I1JA 2DBMA 5HK0A 2GFAA 1PKSA 3CC2T 2K3XA 1D1BA 3P8BB 1VYTA 3THKA 1QW1A 1WYXA 2KROA 2X35A 2VV5A 2AT1B 3OB9A 2RMOA 4C0DC 2F5TX 4JZ3A 5GANg 1GCQA 3M53A 1W4SA 4NL2A 3H41A 2DTOA 3G1JA 1Y07A 1VQ5T 1QVPA 2WSCE 3UT1A 1YI2T 3MP6A 4KULA 3UPUA 4PK4A 3MPUB 4A63B 3VS3A 1IZ6A 2XDBA 2YXYA 3TQ7P 2QEXQ 3OYGA 5FWCA 1Q81R 1YITA 2A37A 4RUGA 2XDDA 4LUDA 1I0CA 1RLPC 1AOJA 4QQDA 3GP8A 1JO8A 4L59A 2XICA 3CC4Q 3QDFA 4F7UB 4R55A 1WFWA 4IURA 4JJDA 2OAUA 1Q95G 4M7AA 1R8OB 1MNDA 4BI8B 2FG0A 2RJDA 3CQTA 5KE3A 2LCCA 3QG1A 1OX9A 1U1TA 3I35A 1VQPQ 2DXBA 3JCMd 2E41A 3EGDB 3I55A 1WXBA 4F17A 3EG9A 1ZUKA 2P0PA 2EW3A 1WQ7A 2B8AA 4HVUA 3OQ5A 3CC7A 2E65A 3EGDA 4F7UG 3V7CA 1VQOQ 4PJOD 4M78D 4NS5A 5I22A 1HSQA 2PVGB 2HEQA 5C6SA 2JXBA 2DTHA 5FWBA 4C8QD 1N9SA 1HK9A 2DJQA 4EMKC 1FXXA 2I2LA 1VQ7A 3OS0A 3NTHA 2RQRA 2K6DA 3OYEA 4M75G 1RI0A 1UGPB 3HRUA 2YHTA 1S72T 1Q82C 3E2UA 2LC4A 3JB9J 1IGQA 5GJWB 2PVDB 3CCVQ 5GAMh 4JUVA 1EZZB 1SRMA 4C0DB 2DILA 2CT3A 4OF1A 3BW1A 2AKLA 3HFOA 4C0ZA 2GGRA 3G4SQ 5FW9A 2SRCA 1WHLA 4DOWA 3A8LB 3PIOA 4PJOE 2L2PA 3CXCS 1BB9A 3EHQA 1Q82U 4IKFA 2EGAA 3E9FA 4C8QE 3VYHB 4MMLA 2CSIA 3OW2A 5I11A 3GNGA 1Y96B 1AWJA 4L5GA 1EFNA 1I8FA 5GAMj 3MHXA 3CCEQ 2F2VA 1RAGB 1E6HA 1UUEA 3R6NA 4RTXA 1GCQC 2FZKB 4E7IA 2QXFA 2J05A 2CP3A 1VQMQ 2XIDA 1GBRA 3T9NA 2LJ1A 1UFFA 1AD5A 1IB8A 1YJNQ 2DXUA 3RKWA 1WQWA 1AWWA 1X6OA 3PFSA 4QKUA 4HXJA 4M78F 2X3WD 4IUUA 1PD0A 1VOMA 4R56A 2JNGA 2X4JA 4Z02A 3CCMQ 2QGFB 4M7AE 4CI0C 2QA4T 1B34B 2MYSA 2PU9B 5DY9A 2V1QA 1IGUA 1GBQA 2DD5A 1GCPA 2ZCFB 3SWNB 2K2MA 2QDLA 2MCNA 1W2BA 1H641 4RTUA 3TSZA 4RMOA 3HL8A 4FL6A 4AFSC 2V8KA 1K73U 2KYMA 5LJ5f 2RI2A 3FRNA 2FHDA 3OW2P 3CCVA 3L2RA 1ZHIA 2M16A 2A08A 1QP3A 3CCLT 1EIFA 1BBZA 1I4K1 3N5BB 4PJOF 1OU9A 1KFZA 4BDYA 3KFVA 3UATA 1B3QA 2GCXA 4BB7A 5GAN8 2O2OA 2P84A 3CCQQ 3NGPA 1G5VA 2D0NA 3GPLA 4OMFB 3M4GA 4CC2A 4ANJA 1YP5A 4C5EA 2K4YA 3RERA 5I21A 3JV3A 1VQKT 2SEMA 5KYWA 3JCMV 1SHGA 1VQKA 1IHWA 2DF6A 2EVRA 3JB9I 3TREA 1SRLA 3H0HA 3OYDA 5A0DA 1OULA 3G71T 5GAN4 2HNIA 4XQ3A 1MV0B 2DL3A 2D6FA 4JRKA 1VQLA 2RB6A 3IQLA 2KT8A 2E4HA 2LQNA 2RO0A 1Y96A 1YFNA 4M4ZA 3VV0A 2EQJA 2F1LA 4HT8A 1Y71A 3REBB 2NUPB 4ZGDB 2A28A 3R6OA 4PFOA 1G3YA 1WGSA 2DPPB 3HP9A 2HBPA 2NWMA 4F16A 4KGZB 2K7AA 2P4RA 2EIFA 1M2OA 3OMGA 3X25B 3MP8A 3CD6Q 4FW1A 1MNEA 1QVFS 1NG2A 3TCJA 4FT4A 5HKCA 4FCYA 1UJ0A 1S1NA 2LX7A 2JOYA 1G3WA 4FIBA 1KQSS 4WTOB 4DBFA 3H0IA 4MZTA 1LVKA 1G3TA 1NEGA 2J6KA 4C92D 1GRIA 1UB4A 3SWNC 2JW4A 4RG8A 2KRSA 5KYXB 5A0GA 3G6ET 4M77G 1ZQ1A 3LWIA 4X1VA 2CH4W 4HCBA 4IUQA 4QVZA 3EG2A 2JN0A 4C8QC 4NL3A 2MOXA 4FSXA 3J81E 1PC0A 3JCMh 4JRQA 2KRNA 2V8JA 1HXDA 4RCBA 1I81A 2ZPIB 2GTOA 3PTAA 3CCMA 3C94A 1QCFA 3OYNA 1VQ4T 3S6WA 2PUKB 4FSSA 2KT1A 5IHIA 3H6ZA 3HHTB 1BCOA 9ATCB 2V1RA 3ME9A 1OPKA 4XAXB 3PGGA 2A36A 4M77B 3I5SA 5KYUA 1JU5C 1XQHA 2DX1A 1OPLA 4XTWA 5I2SA 2ZPFB 3PIPA 2RHUA 1GFDA 1UGRB 1WDXA 3PMTA 3EH2A 3CEYA 3V7RA 3C95A 4A4EA 1W2BP 2CP6A 3CCQA 1MMDA 4PFPA 4OMQA 5AYFA 3M4YA 2X9HA 2A7YA 1M1GA 4BDZA 4Y91A 2QTVA 1I07A 1AWXA 2QTXA 2MWPA 3FLGA 2FO0A 4M7AD 3RBBB 4DOVA 5KH6A 5IN1A 2PZ1A 4JLGA 2KY9A 4M7DG 1MMNA 1ZLMA 2EQKA 3DLLA 1SG5A 5LJ5d 1KHIA 1RACB 1KG1A 2HCKA 2E3IA 1ZSZC 2VUBA 3A8GB 5GAN2 4J6XA 2JTMA 1LCKA 2BE9B 3PMIA 4M7AC 3QBYA 4M78G 4J8OA 1YI2Q 1QVGA 1SEMA 1M90C 4C0GA 4D8KA 3Q1JA 3CBMA 1YIJA 2LNVA 4A4GA 5CKFA 4MZPA 1KK7A 4A54A 4AFUC 5CKHA 2RI3A 1TG0A 3O8VA 3CC4T 1OYXA 3A5ZB 3KXTA 1VQMA 4JRIA 3CBPA 2CH4A 5EC7A 3ZL7C 2FZCB 4HA8A 4J9IA 1QLYA 4JZ4A 1B7TA 2ATCB 2LQKA 2ED0A 2HQXA 2L0AA 2V8IA 2XDPA 2MAMA 1YJ9A 5FROA 2QQRA 5FRNA 3HFNA 3OYIA 1S72Q 2RQWA 1M90U 2EYZA 3MEWA 1U1SA 5IHKA 1Q81U 1VQ6T 3CXCP 5KYUB 1H92A 4C8QB 3BFMA 1XJWB 3VS1A 3I56Q 3CCUA 3VRYA 2IPOB 3P8DA 3EGXB 4Y28E 5GAOn 1AWOA 1D0ZA 3HTRA 2EKHA 3EGUA 4Q5WA 2ENMA 1WJRA 1Y57A 1ARKA 3OS2A 4DA4A 4YTLA 4JJNK 1MGQA 4M77C 2KEAA 2ROTA 4X9CA 1SKUB 4RCCA 3M0SA 2X3XD 1WHMA 4E6RA 3S3NA 1YJNA 1JJ2S 5GANe 2IIMA 2L3PA 2R58A 2RJFA 1AVZC 4X9DA 2LX9A 4ELZC 2DLPA 1AZEA 1OQKA 2EFIA 1QVGS 4C8QF 4PLIA 1SF9A 2NLUA 2JVVA 2LRQA 1OX8A 5GAOp 2EYWA 4BE0A 2XK0A 2L89A 3CCJT 1FWZA 1M90R 3OW2S 3INZA 1V76A 1OEBA 1WHHA 2CP5A 1M5Q1 2OTLQ 1IHVA 2ZPGB 3CC7Q 2VXFA 4C92E 1WX6A 2EWNA 4M7AB 4LDXA 2GF7A 1QKXA 3CCVT 2EYQA 4PJOC 1HJDA 3X28B 1Z9ZA 2QQAA 1WLPB 3C4SA 4KH1B 4FYYB 5ECAA 3X24B 1BCMA 1JRIA 2EAYA 3CCSQ 2DERA 3G7ZA 1VQ6A 2FYKA 1CKBA 2DBKA 2P4TA 4TVRA 3G6EA 3QYGB 4IUTA 1VYUA 3LGLA 4PJLA 3JB9H 3EFOB 3OA6A 4JJBA 1Q7YC 4BI4A 3MEVA 4OMMA 3JCMX 3VS7A 3ASKA 1SHFA 1JBMA 5GMKh 4ZTJA 1X2KA 2EJGA 2QQSA 2EYYA 5FRMA 3VYGA 1K4US 3CCRA 2YUNA 3ULRB 2CSQA 2AKKA 1YCYA 2YUQA 1ABOA 4BE1A 3OBWA 3A8OB 4ZNXA 3LH5A 4QQ6A 1VQOA 4LDYA 1PRLC 4E7ZA 5GAMd 1ZBJA 5IXBA 1YJWA 3EG9B 1XTDA 4M7AG 1TSFA 4JDSA 1AT1B 3PT9A 3CMEA 2NUPA 2W0ZA 1GL5A 2X51A 1ZUUA 1VIFA 1Q86C 3LYIA 1KIKA 1NEBA 2JTEA 4EIKA 3FJPA 2CZ1B 3LH0A 4M7DC 1MV3A 2EYXA 2D0QB 2OTJQ 3FIFA 1YJ9T 3L2ZA 3MJXA 8ATCB 3F70A 3G71A 2BUDA 2YRVA 1UG1A 3CCQT 2EPDA 2H3EB 4XU1A 1K9MR 5GAMf 2HL3A 1NBEB 3HRSA 2KDSA 4N4HA 4EMGA 4M75F 3GIBA 2R5AA 2BZXA 2NUTA 1MMGA 2VXEA 3EG1A 2QGGA 1FX7A 3OYHA 1N6AA 2LT4A 4J6YA 5CQXA 1C6VX 1FMVA 3OYYA 4BACA 4C5HA 4Z89A 1N8RU 4PJOB 5A0LA 3M56A 4J9BA 2FZGB 1VIEA 2L3RA 3PVLA 3GF5A 2M51A 3M0PA 3TU4K 4EDUA 1JB0E 1VQKQ 2XU8A 3CCJA 4BI3A 1VQLT 1NJIR 2OI3A 4J9FA 2VWFA 5LJ5e 2O01E 5J39A 4KGVB 2EKOA 5D6XA 3CCST 3CPWP 2HL5C 2GFUA 4N0AA 1RABB 4Z8AA 4C5GA 1TUGB 4QVDA 1VQ4Q 1QVFP 1X69A 1K8AU 2E12A 2RA2A 2CGHA 3X26B 2MF2A 4ZN3A 4EMKB 2CP2A 1KSWA 4R0KA 3S3OA 4OMPA 5GANd 4RTYA 4UC4A 3CMET 4J7FA 2O9VA 2RN8A 1E6GA 4F7UE 1AEYA 3JB9G 3EG3A 3OYAA 2ZAEA 3G6EQ 4GBQA 3EGXA 2VB6A 2KNBB 5DLOA 2XI9A 1FYNA 5KYNA 1VQNT 1BI0A 3VUZA 1YITT 4XU0A 1WHKA 4A4KA 3OBYA 5A2QE 2KSSA 4BE2A 4M7DB 1Q7YR 1X6GA 2CZ0B 1X2QA 1BU1A 2A0FB 1UJYA 1MUZA 1YWOA 1RAHB 2AIRB 2XHCA 1T0HA 1K9MU 2AHJB 3QUIA 3QIIA 3H8ZA 1UE9A 1K1ZA 4ORZA 3OY9A 2D8JA 2LJ0A 1W1FA 5LJ3f 1LOJA 1KQSA 5EG2A 2YSQA 1M1KR 3AT1B 3VS6A 2FRYA 3CD6T 4RTVA 4AFQC 2DXCA 2KXCA 2XD0A 1U06A 2MMPA 3E9GA 1UHCA 3LWHA 1C1AA 1NJIC 1N8RR 3E1SA 1SPKA 1KC8R 4KGXB 2EGCA 2MI6A 3MP1A 1PSEA 2QQ9A 2F69A 4DQ2A 2VVKA 4ZTFA 2K57A 1AZGB 3OSSC 4OVAA 5FLXE 5CIUA 5IAYA 2BIVA 4DEXA 2K5LA 2DKGA 2JS0A 4HCZA 2ED1A 2PVOB 3META 3WVDB 4E2FB 1M9SA 1TH7A 2QYZA 5LJ5g 5CKDA 1JQQA 1WXUA 3EHRA 3RNJA 5CQYA 1WA7A 1H8KA 4DBQA 2QASA 3I56T 3H0FA 1CKAA 1YIJQ 2CS7A 2JJ9A 5GAMe 5M9OA 2HQEA 2DETA 1PHTA 3WVEB 1R77A 3M0RA 4OB0B 3VRZA 5C0MA 3PNWC 3SHWA 2LCLA 2YDLA 3BY7A 3H9NA 3SB2A 2P0QA 1VQ8Q 2DVEA 3LW5E 1VQ8A 3J7AF 5GAOq 2C0TA 5KCHA 3PVQA 1KQSP 5CCAA 2HBWA 4RTWA 3JCMW 2FRWA 2DO3A 3RKYA 2HKQB 2DRKA 4O6JA 1VQNA 1RADB 4K11A 1PG5B 2KE9A 1R0BG 2L8DA 1FMKA 3CCUT 2EJFA 4IIMA 5IXFA 1M3CA 4DBRA 4IIOA 1RAFB 1QWFA 1OU8A 3V7SA 4RKUE 4HCKA 5CR2A 2EJ9A 3LGFA 1M1FA 5IH2A 2DL8A 5CK9A 5LJ5j 4J9EA 3QO3A 5GAOr 3UDCA 4RTTA 3MKDA 3QXEB 5GAN7 2VGNA 4CC7A 3I55T 4E7HA 3MO8A 2FPDA 2M0YA 5D6YA 1K9AA 1UECA 4C92C 3L2VA 4PNOA 4BY6B 4EMKA 2M9UA 2WSFE 1W6XA 4OB2B 4AMCA 4P5NA 3JB9D 6AT1B 4FU6A 1S72A 2L3SA 3CMAT 2ZPBB 3KUFA 1QQJA 2BZYA 3SD4A 3VS0A 2BKDN 4J6WA 2DNUA 1VA7A 1RAAB 3QWYA 5LL6S 2OTJA 1PRMC 4PJJA 1T3SA 2A3LA 1OOTA 1YI2A 3SWNA 2RQVA 2LQ8A 4B6MA 2FVUA 4CRIA 2RF0A 1KQ2A 3OYBA 5D6WA 4LDWA 4CC4B 3MEUA 4DBHA 3UA7A 1M27C 4XU3A 4O5VA 2KAFA 2PQWA 3CCJQ 4M7DF 3QDRB 4M75C 2DA9A 2QI2A 1WJQA 4F7UA 4KUDK 1BYMA 4M77D 4WCIA 4J9DA 1OI1A 3M54A 2KGTA 4M75A 1YWPA 4OP0A 4M77F 2MPXC 4A4FA 4BUGA 2LP5A 1RI9A 2RM4A 3UF4A 2HKNA 3RKXA 1YJWQ 1H3HA 1D0XA 1BI1A 2HQHA 4ZGJB 2O31A 2O4XA 1OZ2A 5GMKe 4E7LA 3GLXA 1WHGA 3I5RA 3RDVA 3JCMg 2C0OA 3CMAA 2K9GA 5GJVB 4JRPA 1QCNA 2GTJA 1KJWA 5HK3A 2JMCA 1QVFA 4OB3B 2VYTA 2DL7A 4AT1B 1AHJB 3DB4A 3TVTA 2E70A 4KH0B 3CCRT
chains in the Genus database with same CATH topology
4HXJA 2YT6A 4ZNXA 2X3WD 3LH5A 1QKWA 1UGVA 2O9SA 2JM8A 1PRLC 3VS4A 1J3TA 2YUOA 4QT7A 1M8MA 2GNCA 1ZBJA 5IXBA 2F2XA 2LQWA 1U3OA 1B07A 1YCSB 1XOVA 2W0ZA 2CT4A 2J7IA 1GL5A 2V1QA 1ZUUA 1GBQA 2KR3A 4AG2C 1GCPA 2K2MA 2QDLA 3UA6A 1NEBA 1KIKA 2JTEA 4EIKA 2MCNA 5IHNA 3VS5A 1G83A 2AZVA 4RTUA 1MV3A 3TSZA 2DL4A 2EYXA 1Z9QA 2AK5A 4AFSC 2KBTA 2PTKA 2KYMA 1UG1A 2EPDA 2KXDA 4DEYA 3QWXX 1WXTA 2A08A 1BBZA 1WI7A 3FJ5A 1KFZA 2EBPA 2BZXA 3KFVA 3UATA 1B3QA 2CUBA 3EG1A 2O2OA 4LE9A 1WIEA 1K0SA 3NGPA 2E5KA 1M3BA 2D0NA 4Z88A 2H8HA 2ROLA 4CC2A 1YP5A 2FPFA 3A98A 4CC3A 3SEMA 2VKNA 4Z89A 2CUDA 2J6OA 2LNHB 3JV3A 3REAB 2SEMA 3TSWA 1JEGA 1N5ZA 1SHGA 4J9BA 2DF6A 2EVRA 1SRLA 1NYFA 3H0HA 3PVLA 2OAWA 3M0PA 2M51A 1MV0B 1PWTA 1G2BA 2DL3A 1IO6A 3IQLA 2KT8A 1NLPC 1HD3A 2LQNA 4M4ZA 5L23A 2PNIA 1T0JA 1X43A 2HDAA 2OI3A 4J9FA 1V1CA 1UHFA 3REBB 2A28A 2VWFA 4OMLA 2W10A 2NWMA 4F16A 2GBQA 1ZX6A 2OJ2A 2JS2A 2JMAA 2K7AA 2F2WA 2P4RA 1K76A 4Z8AA 2LMJA 3EG0A 2FEIA 1X69A 1NYGA 1PNJA 2BTTA 3M0QA 4AFZC 4LNPA 1KSWA 4R0KA 4LUEA 4OMPA 3NMZC 4RTZA 1NG2A 4RTYA 1SSHA 2EQIA 4J9GA 2O9VA 2RN8A 1E6GA 1S1NA 1UJ0A 2DMOA 2LX7A 3U23A 1AEYA 3EG3A 2LCSA 2K3BA 2JM9A 1X27A 3H0IA 1YNZA 5HCKA 1CSKA 2C0IA 4GBQA 1NEGA 1YN8A 2KNBB 1PKTA 4HVWA 1FYNA 1QWEA 2J6KA 2CREA 1GRIA 1ABQA 3GBQA 2JW4A 2DRMA 1X6BA 1U5SA 2KRSA 2KYBA 2KRMA 1OV3A 1X6GA 4JJCA 1X2QA 1BU1A 4X1VA 2CH4W 1UJYA 1MUZA 1YWOA 3EG2A 2MOXA 1T0HA 1UE9A 2I0NA 4D8DA 2KRNA 1K1ZA 4JPBW 4ORZA 2GQIA 2D8JA 2GTOA 2LJ0A 1W1FA 3NHNA 1QCFA 4F14A 2YSQA 4FSSA 2KT1A 5IHIA 3VS6A 2FRYA 4RTVA 2DM1A 4AFQC 1T3LA 2V1RA 2KXCA 3I9QA 1OPKA 2A36A 1U06A 1UHCA 3I5SA 1JU5C 1TUDA 2DX1A 1OPLA 1SPKA 4GLMA 2G6FX 2EGCA 1K0XA 2FPEA 1GFDA 2YUPA 1WDXA 1W70A 4OMOA 2DE0X 1Y0MA 3PE0A 2VVKA 2ESWA 1A0NB 1AZGB 2RPNA 4DEXA 4OMQA 1I1JA 2DBMA 2JS0A 1PKSA 2ED1A 2AZSA 1I07A 1AWXA 2FO0A 2CDTA 2B86A 3RBBB 1VYTA 3THKA 1JQQA 1JXMA 1WXUA 3EHRA 1WYXA 2PZ1A 2KROA 3RNJA 1WA7A 3NPFA 1H8KA 1RLQC 2EGEA 1ZLMA 3H0FA 1CKAA 2HCKA 2RMOA 4JZ3A 1GCQA 1LCKA 4Y92A 1SEMA 1PHTA 4D8KA 3H41A 3M0RA 3VRZA 3SHWA 2J06A 2YDLA 4AFUC 1TG0A 2C0TA 4A63B 3VS3A 3PVQA 2CH4A 4J9HA 2HBWA 4RTWA 5EC7A 3ZL7C 2DL5A 2FRWA 4J9IA 5FWCA 1QLYA 2DRKA 4JZ4A 2K79A 2A37A 4RUGA 3M0TA 4LUDA 1I0CA 1RLPC 2ED0A 1AOJA 1M30A 2KE9A 4K11A 1JO8A 2L0AA 1TUCA 1FMKA 4IIMA 1E7OA 5IXFA 1WFWA 4JJDA 1M3CA 1VYVA 4IIOA 2RQWA 2EYZA 1QWFA 1JXOA 1BK2A 4HCKA 5IHKA 2JT4A 1H92A 2FG0A 1RUWA 3CQTA 2RNAA 3VS1A 5IH2A 3I35A 2DL8A 3VRYA 4KRTA 4J9EA 1AWOA 2HSPA 1WXBA 4RTTA 4F17A 1ZUKA 2EKHA 3EGUA 1NM7A 2EW3A 4LN2A 4CC7A 3C0CA 2ENMA 1Y57A 4HVUA 1ARKA 2FPDA 2M0YA 4OMNA 1K9AA 1UECA 2DYBA 2KEAA 2ROTA 2ABLA 5I22A 1HSQA 1W6XA 2HEQA 2JXBA 5FWBA 3M0SA 2O88A 2X3XD 4E6RA 2DJQA 2IIMA 2L3PA 2D8HA 2L3SA 1AVZC 2ECZA 2D1XA 2LJ3A 2DLPA 1AZEA 2RQRA 2K6DA 2BZYA 2LZ6B 3VS0A 2DNUA 1VA7A 3QWYA 1UTIA 1PRMC 1T3SA 4ESRA 1ZSGA 2RQUA 2EYWA 2YUQA 1OOTA 2XMFA 5GJWB 2RQVA 1OEBA 3O5ZA 2RF0A 1SRMA 2DILA 1GFCA 4CC4B 2CT3A 1WX6A 2AKLA 3UA7A 2GGRA 1M27C 1ZUYA 5FW9A 3M0UA 2NUZA 2SRCA 1QKXA 1UDLA 2DA9A 1HJDA 1Z9ZA 2L2PA 4WCIA 4J9DA 1WLPB 1BB9A 2KGTA 4AG1C 3EHQA 1YWPA 2EGAA 2DVJA 5ECAA 3VS2A 2CSIA 2LP5A 1RI9A 3UF4A 5I11A 1H3HA 1CKBA 2DBKA 1AWJA 4HVVA 1VYUA 1EFNA 2O31A 1NLOC 2BZ8A 2F2VA 4JJBA 1E6HA 1UUEA 4J9CA 4OMMA 3R6NA 4RTXA 1GCQC 3I5RA 3VS7A 1SHFA 2C0OA 2MIOA 2K9GA 5GJVB 2L3QA 1X2KA 2J05A 2EYYA 2GTJA 1GBRA 2RQTA 2LJ1A 1KJWA 1UFFA 1AD5A 1K4US 2JMCA 2YUNA 3ULRB 2DL7A 2CSQA 2AKKA 1AWWA 1M3AA 3TVTA 2J6FA 1ABOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4HXJ A;  2YT6 A;  4ZNX A;  2X3W D;  3LH5 A;  1QKW A;  1UGV A;  2O9S A;  2JM8 A;  1PRL C;  3VS4 A;  1J3T A;  2YUO A;  4QT7 A;  1M8M A;  2GNC A;  1ZBJ A;  5IXB A;  2F2X A;  2LQW A;  1U3O A;  1B07 A;  1YCS B;  1XOV A;  2W0Z A;  2CT4 A;  2J7I A;  1GL5 A;  2V1Q A;  1ZUU A;  1GBQ A;  2KR3 A;  4AG2 C;  1GCP A;  2K2M A;  2QDL A;  3UA6 A;  1NEB A;  1KIK A;  2JTE A;  4EIK A;  2MCN A;  5IHN A;  3VS5 A;  1G83 A;  2AZV A;  4RTU A;  1MV3 A;  3TSZ A;  2DL4 A;  2EYX A;  1Z9Q A;  2AK5 A;  4AFS C;  2KBT A;  2PTK A;  2KYM A;  1UG1 A;  2EPD A;  2KXD A;  4DEY A;  3QWX X;  1WXT A;  2A08 A;  1BBZ A;  1WI7 A;  3FJ5 A;  1KFZ A;  2EBP A;  2BZX A;  3KFV A;  3UAT A;  1B3Q A;  2CUB A;  3EG1 A;  2O2O A;  4LE9 A;  1WIE A;  1K0S A;  3NGP A;  2E5K A;  1M3B A;  2D0N A;  4Z88 A;  2H8H A;  2ROL A;  4CC2 A;  1YP5 A;  2FPF A;  3A98 A;  4CC3 A;  3SEM A;  2VKN A;  4Z89 A;  2CUD A;  2J6O A;  2LNH B;  3JV3 A;  3REA B;  2SEM A;  3TSW A;  1JEG A;  1N5Z A;  1SHG A;  4J9B A;  2DF6 A;  2EVR A;  1SRL A;  1NYF A;  3H0H A;  3PVL A;  2OAW A;  3M0P A;  2M51 A;  1MV0 B;  1PWT A;  1G2B A;  2DL3 A;  1IO6 A;  3IQL A;  2KT8 A;  1NLP C;  1HD3 A;  2LQN A;  4M4Z A;  5L23 A;  2PNI A;  1T0J A;  1X43 A;  2HDA A;  2OI3 A;  4J9F A;  1V1C A;  1UHF A;  3REB B;  2A28 A;  2VWF A;  4OML A;  2W10 A;  2NWM A;  4F16 A;  2GBQ A;  1ZX6 A;  2OJ2 A;  2JS2 A;  2JMA A;  2K7A A;  2F2W A;  2P4R A;  1K76 A;  4Z8A A;  2LMJ A;  3EG0 A;  2FEI A;  1X69 A;  1NYG A;  1PNJ A;  2BTT A;  3M0Q A;  4AFZ C;  4LNP A;  1KSW A;  4R0K A;  4LUE A;  4OMP A;  3NMZ C;  4RTZ A;  1NG2 A;  4RTY A;  1SSH A;  2EQI A;  4J9G A;  2O9V A;  2RN8 A;  1E6G A;  1S1N A;  1UJ0 A;  2DMO A;  2LX7 A;  3U23 A;  1AEY A;  3EG3 A;  2LCS A;  2K3B A;  2JM9 A;  1X27 A;  3H0I A;  1YNZ A;  5HCK A;  1CSK A;  2C0I A;  4GBQ A;  1NEG A;  1YN8 A;  2KNB B;  1PKT A;  4HVW A;  1FYN A;  1QWE A;  2J6K A;  2CRE A;  1GRI A;  1ABQ A;  3GBQ A;  2JW4 A;  2DRM A;  1X6B A;  1U5S A;  2KRS A;  2KYB A;  2KRM A;  1OV3 A;  1X6G A;  4JJC A;  1X2Q A;  1BU1 A;  4X1V A;  2CH4 W;  1UJY A;  1MUZ A;  1YWO A;  3EG2 A;  2MOX A;  1T0H A;  1UE9 A;  2I0N A;  4D8D A;  2KRN A;  1K1Z A;  4JPB W;  4ORZ A;  2GQI A;  2D8J A;  2GTO A;  2LJ0 A;  1W1F A;  3NHN A;  1QCF A;  4F14 A;  2YSQ A;  4FSS A;  2KT1 A;  5IHI A;  3VS6 A;  2FRY A;  4RTV A;  2DM1 A;  4AFQ C;  1T3L A;  2V1R A;  2KXC A;  3I9Q A;  1OPK A;  2A36 A;  1U06 A;  1UHC A;  3I5S A;  1JU5 C;  1TUD A;  2DX1 A;  1OPL A;  1SPK A;  4GLM A;  2G6F X;  2EGC A;  1K0X A;  2FPE A;  1GFD A;  2YUP A;  1WDX A;  1W70 A;  4OMO A;  2DE0 X;  1Y0M A;  3PE0 A;  2VVK A;  2ESW A;  1A0N B;  1AZG B;  2RPN A;  4DEX A;  4OMQ A;  1I1J A;  2DBM A;  2JS0 A;  1PKS A;  2ED1 A;  2AZS A;  1I07 A;  1AWX A;  2FO0 A;  2CDT A;  2B86 A;  3RBB B;  1VYT A;  3THK A;  1JQQ A;  1JXM A;  1WXU A;  3EHR A;  1WYX A;  2PZ1 A;  2KRO A;  3RNJ A;  1WA7 A;  3NPF A;  1H8K A;  1RLQ C;  2EGE A;  1ZLM A;  3H0F A;  1CKA A;  2HCK A;  2RMO A;  4JZ3 A;  1GCQ A;  1LCK A;  4Y92 A;  1SEM A;  1PHT A;  4D8K A;  3H41 A;  3M0R A;  3VRZ A;  3SHW A;  2J06 A;  2YDL A;  4AFU C;  1TG0 A;  2C0T A;  4A63 B;  3VS3 A;  3PVQ A;  2CH4 A;  4J9H A;  2HBW A;  4RTW A;  5EC7 A;  3ZL7 C;  2DL5 A;  2FRW A;  4J9I A;  5FWC A;  1QLY A;  2DRK A;  4JZ4 A;  2K79 A;  2A37 A;  4RUG A;  3M0T A;  4LUD A;  1I0C A;  1RLP C;  2ED0 A;  1AOJ A;  1M30 A;  2KE9 A;  4K11 A;  1JO8 A;  2L0A A;  1TUC A;  1FMK A;  4IIM A;  1E7O A;  5IXF A;  1WFW A;  4JJD A;  1M3C A;  1VYV A;  4IIO A;  2RQW A;  2EYZ A;  1QWF A;  1JXO A;  1BK2 A;  4HCK A;  5IHK A;  2JT4 A;  1H92 A;  2FG0 A;  1RUW A;  3CQT A;  2RNA A;  3VS1 A;  5IH2 A;  3I35 A;  2DL8 A;  3VRY A;  4KRT A;  4J9E A;  1AWO A;  2HSP A;  1WXB A;  4RTT A;  4F17 A;  1ZUK A;  2EKH A;  3EGU A;  1NM7 A;  2EW3 A;  4LN2 A;  4CC7 A;  3C0C A;  2ENM A;  1Y57 A;  4HVU A;  1ARK A;  2FPD A;  2M0Y A;  4OMN A;  1K9A A;  1UEC A;  2DYB A;  2KEA A;  2ROT A;  2ABL A;  5I22 A;  1HSQ A;  1W6X A;  2HEQ A;  2JXB A;  5FWB A;  3M0S A;  2O88 A;  2X3X D;  4E6R A;  2DJQ A;  2IIM A;  2L3P A;  2D8H A;  2L3S A;  1AVZ C;  2ECZ A;  2D1X A;  2LJ3 A;  2DLP A;  1AZE A;  2RQR A;  2K6D A;  2BZY A;  2LZ6 B;  3VS0 A;  2DNU A;  1VA7 A;  3QWY A;  1UTI A;  1PRM C;  1T3S A;  4ESR A;  1ZSG A;  2RQU A;  2EYW A;  2YUQ A;  1OOT A;  2XMF A;  5GJW B;  2RQV A;  1OEB A;  3O5Z A;  2RF0 A;  1SRM A;  2DIL A;  1GFC A;  4CC4 B;  2CT3 A;  1WX6 A;  2AKL A;  3UA7 A;  2GGR A;  1M27 C;  1ZUY A;  5FW9 A;  3M0U A;  2NUZ A;  2SRC A;  1QKX A;  1UDL A;  2DA9 A;  1HJD A;  1Z9Z A;  2L2P A;  4WCI A;  4J9D A;  1WLP B;  1BB9 A;  2KGT A;  4AG1 C;  3EHQ A;  1YWP A;  2EGA A;  2DVJ A;  5ECA A;  3VS2 A;  2CSI A;  2LP5 A;  1RI9 A;  3UF4 A;  5I11 A;  1H3H A;  1CKB A;  2DBK A;  1AWJ A;  4HVV A;  1VYU A;  1EFN A;  2O31 A;  1NLO C;  2BZ8 A;  2F2V A;  4JJB A;  1E6H A;  1UUE A;  4J9C A;  4OMM A;  3R6N A;  4RTX A;  1GCQ C;  3I5R A;  3VS7 A;  1SHF A;  2C0O A;  2MIO A;  2K9G A;  5GJV B;  2L3Q A;  1X2K A;  2J05 A;  2EYY A;  2GTJ A;  1GBR A;  2RQT A;  2LJ1 A;  1KJW A;  1UFF A;  1AD5 A;  1K4U S;  2JMC A;  2YUN A;  3ULR B;  2DL7 A;  2CSQ A;  2AKK A;  1AWW A;  1M3A A;  3TVT A;  2J6F A;  1ABO A; 
#chains in the Genus database with same CATH topology
 3OYK A;  4C5I A;  1QKW A;  2O9S A;  2JM8 A;  3VS4 A;  1QMC A;  2EQM A;  2YUO A;  4QT7 A;  1NJI U;  1M8M A;  2E64 A;  2P0K A;  2F2X A;  1U3O A;  1B07 A;  1YCS B;  3EAE A;  2CT4 A;  2J7I A;  2KR3 A;  1R0C B;  1HYO A;  2RD1 A;  4AG2 C;  5LJ5 h;  5KCO A;  3L1A A;  2LDM A;  5LJ3 j;  1G83 A;  2AZV A;  2DL4 A;  3QSU A;  1Z9Q A;  3AHU A;  2KBT A;  3QKJ A;  5FU6 C;  3FEO A;  2OTL A;  2K3Y A;  2KXD A;  4DEY A;  1RAI B;  4LD6 A;  5GAN 3;  1VQ5 Q;  4PL6 A;  4LD9 K;  2GQV A;  3EFO A;  1Q86 U;  2HD0 A;  4HT9 A;  4RG2 A;  4XTV A;  1M1K C;  4LE9 A;  1WIE A;  3HPW A;  1KD1 R;  3D7S B;  1M3B A;  1TWB A;  2H8H A;  2FPF A;  4C92 F;  4C0F A;  2RI5 A;  3CD6 A;  3A98 A;  4B9X A;  4CC3 A;  2KVQ G;  3SFM A;  3SEM A;  3CME Q;  3ER0 A;  1ZSZ A;  2J6O A;  4M75 B;  3REA B;  2M1H A;  1KD1 C;  3TSW A;  1JEG A;  3CCS A;  3FC3 A;  3A1P A;  1N5Z A;  5KYY A;  2KQW A;  1VQL Q;  3CCU Q;  3I56 A;  3C12 A;  2DJZ A;  1NPR A;  3HKS A;  4QW2 A;  3G4S T;  1NZ9 A;  5GAO m;  1NE8 A;  2BE7 D;  2VAS A;  2DIG A;  1D09 B;  2KK4 A;  3CC2 A;  1I5O B;  5L23 A;  1T0J A;  2PNI A;  2HDA A;  2FL7 A;  1V1C A;  3URG A;  1VQP T;  4PFZ A;  3M59 A;  4HKE A;  2CP7 A;  4OML A;  2RH2 A;  2W10 A;  2DFU A;  1B34 A;  5HY6 A;  4LXC A;  3RUX A;  2GBQ A;  1P92 A;  1ZX6 A;  2OJ2 A;  5J26 A;  1YJW T;  2KI7 A;  1WHJ A;  4BD3 A;  5KYW B;  4C92 G;  1NYG A;  4MZM A;  4M7D E;  2YWW A;  4AFZ C;  4QVC A;  3WXM B;  3V8J A;  1VQ9 A;  1K9M C;  1M4Z A;  3NMZ C;  2CYZ B;  4RTZ A;  4KBM B;  3CC7 T;  2E6Z A;  2EQI A;  2NUT B;  3U23 A;  2DMO A;  1H3Z A;  2LCS A;  1YHQ A;  1UGQ B;  4E7S A;  2JM9 A;  1X27 A;  2RHY A;  2QA4 A;  1YNZ A;  5HCK A;  2C0I A;  3OYM A;  4M78 E;  1YBY A;  1PKT A;  3JRZ A;  1VQ9 Q;  3CPW A;  4J7I A;  2CRE A;  1IRX A;  1MMA A;  2EQU A;  3BDU A;  3OYC A;  4E7J A;  2QK0 A;  3VJP A;  3DLM A;  1U5S A;  2DTI A;  3JCM Q;  4NOY A;  1BI2 A;  2E3H A;  2QA4 Q;  5FU6 B;  4JLI A;  2K5I A;  4A4H A;  2QG9 B;  4JS4 A;  2KMT A;  4XTY A;  5GMK m;  2R5M A;  1YIJ T;  2I0N A;  1M8V A;  1D3B B;  4JPB W;  4OGE A;  2GQI A;  2HMA A;  4N4I A;  2MK5 A;  1ZA2 B;  3M5A A;  4XTX A;  1YHQ Q;  4XK8 E;  4X34 A;  3L2Q A;  3RMS A;  1T3L A;  2CZ7 B;  3I9Q A;  2Y4Y A;  5GMK j;  4IUP A;  2Y4X A;  1KC8 C;  1TUD A;  2X4Y A;  1VQ5 A;  4GLM A;  3JCM J;  3CCE T;  2G6F X;  1K0X A;  2YUP A;  1W70 A;  3OSV A;  3CC2 Q;  1TOV A;  1IXD A;  1Q82 R;  3UWN A;  2ESW A;  1A0N B;  1YIT Q;  1WNL A;  2RK2 A;  3OYL A;  3JCM f;  3EH1 A;  2AZS A;  3NFC A;  2RJC A;  2CDT A;  2B86 A;  3RIR A;  1JXM A;  3OS1 A;  2DAQ A;  1LPL A;  3NPF A;  1RLQ C;  2EGE A;  2OTJ T;  1YJ9 Q;  2RHI A;  3QZ9 B;  3JAM E;  3BE3 A;  5LJ3 e;  4Y92 A;  4FYX B;  3MCA B;  2X4X A;  2J06 A;  4GLK A;  1X75 C;  2QEX T;  4PJN A;  5GAN 5;  4LDU A;  2Y90 A;  3EFR A;  3ZFJ A;  4J9H A;  4FYW B;  1QCO A;  1PSF A;  2DL5 A;  2YRC A;  1RL2 A;  3BDL A;  1WJS A;  2K79 A;  4C92 A;  5D7U A;  2CP0 A;  3M0T A;  5L8R E;  2VGM A;  2CZ6 B;  1M2V B;  1M30 A;  3S3M A;  1D1A A;  2E10 A;  3CCL Q;  1UEB A;  1TUC A;  1BKB A;  1E7O A;  4VUB A;  1VQ7 Q;  1C0M A;  1VYV A;  4M78 B;  2RJE A;  4LDV A;  1JXO A;  4PKC C;  1BK2 A;  5CVI A;  4M7D A;  2JT4 A;  2PUO B;  3L42 A;  1K73 R;  1RUW A;  3I55 Q;  2RNA A;  3M57 A;  2COZ A;  3QJ6 A;  4FT2 A;  4KRT A;  3SDZ A;  3X20 B;  1ACM B;  2HSP A;  1KQ1 A;  1F1B B;  3FDR A;  2JZ2 A;  1K73 C;  1Q86 R;  1G8X A;  2DK3 A;  2M0O A;  1NM7 A;  4EPC A;  4LN2 A;  3C0C A;  3MEA A;  4N4G A;  5I2M A;  1I5L A;  4M77 A;  2LVM A;  4A53 A;  4KT0 E;  4OMN A;  4JS5 A;  4M75 D;  3CMA Q;  1VQP A;  1VQ8 T;  4N0A C;  2ZGW A;  2DYB A;  2ABL A;  4EMH A;  2O88 A;  4V2S A;  5GAN j;  2D8H A;  3M58 A;  2QAZ A;  3HRT A;  3ZEH A;  1Q7Y U;  4II1 A;  1FMW A;  2ECZ A;  2D1X A;  2LJ3 A;  4M7D D;  4XTU A;  1Y7X A;  2OX7 A;  1QP2 A;  2LZ6 B;  3JB9 F;  5GAN h;  4PJO G;  2L5Q A;  2O4X B;  1OZ3 A;  3EFS A;  1UTI A;  2DD4 A;  1N9R A;  2LT1 A;  4ESR A;  1PD1 A;  1ZSG A;  2RQU A;  1VQM T;  2R57 A;  4F7U F;  2XMF A;  2ZPH B;  5DLQ E;  3O5Z A;  1MHN A;  1TU0 B;  1GFC A;  2JUF A;  3JSC A;  4ZGE B;  5LJ3 g;  3QHS A;  1ZA1 B;  1ZUY A;  3M0U A;  2NUZ A;  2DIQ A;  2WAC A;  4ATO A;  3CCM T;  1UDL A;  2CKK A;  1D3B A;  4M75 E;  7AT1 B;  2YLB A;  4XTZ A;  4PJO A;  4AG1 C;  2DVJ A;  1VQO T;  3VKI A;  3VS2 A;  2XG8 D;  4C8Q A;  1BIA A;  3KBG A;  2E1H A;  2M02 A;  5CAI A;  3A8H B;  3DB3 A;  4HVV A;  2DYI A;  1NLO C;  2BZ8 A;  5GMK l;  1K8A R;  1TTH B;  4J9C A;  3NTI A;  4J5Y A;  2MIO A;  4M78 C;  2DZC A;  3CCR Q;  2L3Q A;  4ZN1 A;  1YHQ T;  1UGS B;  2DEU A;  1BI3 A;  2RQT A;  4B9W A;  1O75 A;  3E19 A;  1BIB A;  4ELY C;  3CBO A;  1VQN Q;  1M3A A;  2RK1 A;  3JCM b;  5KE2 A;  5FU7 B;  2J6F A;  1LNX A;  1WPY A;  4QQG A;  2YT6 A;  1UGV A;  1TXQ A;  3VUB A;  4PJM A;  1Q81 C;  1J3T A;  3L2W A;  2GNC A;  2HSE B;  4PLL A;  2K2V A;  1PM3 A;  4L6V 5;  3DKM A;  1VQ6 Q;  3CPF A;  2K5F A;  1ZSZ B;  2LQW A;  4ME7 A;  2X4W A;  1XOV A;  3RR6 A;  1KD1 U;  5GMK i;  4WF2 A;  2COW A;  3LLR A;  3UA6 A;  2DXT A;  5IHN A;  3VS5 A;  8AT1 B;  2C06 A;  2ZZD A;  3FB9 A;  3L2U A;  3G4S A;  3A8M B;  2HAX A;  2VC8 A;  5CKB A;  2AK5 A;  2DZ9 A;  2PTK A;  2RHZ A;  1IRE B;  4OGC A;  4J83 A;  5IT9 E;  5LJ3 d;  3OMC A;  3QWX X;  1WXT A;  2YRD A;  2XKO C;  4D6W A;  1WI7 A;  2JTF A;  3FJ5 A;  2EBP A;  4M7A F;  2WSE E;  1KC8 U;  5GAO l;  3QYH B;  2CUB A;  1YJN T;  1M1K U;  3QJY A;  2G3R A;  3CPW S;  1K0S A;  4IUV A;  2E5K A;  5GAM g;  4Z88 A;  2ROL A;  1TS9 A;  1JJ2 A;  2VKN A;  3JCM e;  2CUD A;  4FW2 A;  3GOX A;  2LNH B;  2QDY B;  1W2B S;  1SSF A;  4MDX A;  3V8K A;  3JCM P;  1WZO A;  2Z0W A;  1NYF A;  2F5K A;  1N8R C;  2OAW A;  2OTL T;  3P8H A;  1U8R A;  1VQ7 T;  2E6N A;  1PWT A;  1G2B A;  4E47 A;  2IG0 A;  3QZ5 B;  1IO6 A;  2V26 A;  1NLP C;  5DM7 R;  5GAN f;  1HD3 A;  3VU3 C;  1X43 A;  1UHF A;  3JCM c;  1G3S A;  2NYS A;  1M2V A;  1QVG P;  3M55 A;  1GXI E;  5J3B A;  2JS2 A;  2JMA A;  2F2W A;  2ZPE B;  4C92 B;  1VUB A;  1ZBX A;  1K76 A;  3CCE A;  2LMJ A;  4BY6 C;  3EG0 A;  2FEI A;  3OYJ A;  3OYF A;  1PNJ A;  2BTT A;  3RES A;  3M0Q A;  5FU7 C;  3M9Q A;  4M77 E;  4LNP A;  4LUE A;  1VQ9 T;  1RAE B;  1SSH A;  1DJ7 B;  4J9G A;  4E7K A;  3HSB A;  4C8Q G;  2H3J A;  2K3B A;  1D1C A;  4HCC A;  1CSK A;  1NPP A;  1YN8 A;  1X01 A;  5CKE A;  2HZY A;  4HVW A;  1QWE A;  1D0Y A;  3G71 Q;  1ABQ A;  2COY A;  3GBQ A;  1JJ2 P;  1LJO A;  3CXC A;  2DRM A;  1X6B A;  2LTO A;  3NTK A;  2MWO A;  2KYB A;  1K8A C;  5KYX A;  2KRM A;  1XNI A;  2RHX A;  3OS5 A;  4F04 B;  1OV3 A;  1EX4 A;  4JJC A;  1N27 A;  3V8L A;  5AT1 B;  4KUI A;  2D9T A;  2DEQ A;  4D8D A;  4MDW A;  1PCX A;  3ZBD A;  2FB7 A;  3NHN A;  4GY5 A;  4F14 A;  1O9S A;  2IVW A;  3J80 E;  5GAN 6;  2QQB A;  3CC4 A;  3LX7 A;  2E5Q A;  3TEE A;  2DM1 A;  4OB1 B;  3RMQ A;  2YLC A;  1KHC A;  2QEX A;  1V29 B;  4FYV B;  4M78 A;  1VQ4 A;  2FPE A;  5CO7 A;  3CCL A;  4OMO A;  2DE0 X;  4MMK A;  1Y0M A;  3PE0 A;  3GNF B;  4XU2 A;  4FM4 B;  5KYY B;  2RPN A;  5LJ3 h;  3QPH A;  1I1J A;  2DBM A;  5HK0 A;  2GFA A;  1PKS A;  3CC2 T;  2K3X A;  1D1B A;  3P8B B;  1VYT A;  3THK A;  1QW1 A;  1WYX A;  2KRO A;  2X35 A;  2VV5 A;  2AT1 B;  3OB9 A;  2RMO A;  4C0D C;  2F5T X;  4JZ3 A;  5GAN g;  1GCQ A;  3M53 A;  1W4S A;  4NL2 A;  3H41 A;  2DTO A;  3G1J A;  1Y07 A;  1VQ5 T;  1QVP A;  2WSC E;  3UT1 A;  1YI2 T;  3MP6 A;  4KUL A;  3UPU A;  4PK4 A;  3MPU B;  4A63 B;  3VS3 A;  1IZ6 A;  2XDB A;  2YXY A;  3TQ7 P;  2QEX Q;  3OYG A;  5FWC A;  1Q81 R;  1YIT A;  2A37 A;  4RUG A;  2XDD A;  4LUD A;  1I0C A;  1RLP C;  1AOJ A;  4QQD A;  3GP8 A;  1JO8 A;  4L59 A;  2XIC A;  3CC4 Q;  3QDF A;  4F7U B;  4R55 A;  1WFW A;  4IUR A;  4JJD A;  2OAU A;  1Q95 G;  4M7A A;  1R8O B;  1MND A;  4BI8 B;  2FG0 A;  2RJD A;  3CQT A;  5KE3 A;  2LCC A;  3QG1 A;  1OX9 A;  1U1T A;  3I35 A;  1VQP Q;  2DXB A;  3JCM d;  2E41 A;  3EGD B;  3I55 A;  1WXB A;  4F17 A;  3EG9 A;  1ZUK A;  2P0P A;  2EW3 A;  1WQ7 A;  2B8A A;  4HVU A;  3OQ5 A;  3CC7 A;  2E65 A;  3EGD A;  4F7U G;  3V7C A;  1VQO Q;  4PJO D;  4M78 D;  4NS5 A;  5I22 A;  1HSQ A;  2PVG B;  2HEQ A;  5C6S A;  2JXB A;  2DTH A;  5FWB A;  4C8Q D;  1N9S A;  1HK9 A;  2DJQ A;  4EMK C;  1FXX A;  2I2L A;  1VQ7 A;  3OS0 A;  3NTH A;  2RQR A;  2K6D A;  3OYE A;  4M75 G;  1RI0 A;  1UGP B;  3HRU A;  2YHT A;  1S72 T;  1Q82 C;  3E2U A;  2LC4 A;  3JB9 J;  1IGQ A;  5GJW B;  2PVD B;  3CCV Q;  5GAM h;  4JUV A;  1EZZ B;  1SRM A;  4C0D B;  2DIL A;  2CT3 A;  4OF1 A;  3BW1 A;  2AKL A;  3HFO A;  4C0Z A;  2GGR A;  3G4S Q;  5FW9 A;  2SRC A;  1WHL A;  4DOW A;  3A8L B;  3PIO A;  4PJO E;  2L2P A;  3CXC S;  1BB9 A;  3EHQ A;  1Q82 U;  4IKF A;  2EGA A;  3E9F A;  4C8Q E;  3VYH B;  4MML A;  2CSI A;  3OW2 A;  5I11 A;  3GNG A;  1Y96 B;  1AWJ A;  4L5G A;  1EFN A;  1I8F A;  5GAM j;  3MHX A;  3CCE Q;  2F2V A;  1RAG B;  1E6H A;  1UUE A;  3R6N A;  4RTX A;  1GCQ C;  2FZK B;  4E7I A;  2QXF A;  2J05 A;  2CP3 A;  1VQM Q;  2XID A;  1GBR A;  3T9N A;  2LJ1 A;  1UFF A;  1AD5 A;  1IB8 A;  1YJN Q;  2DXU A;  3RKW A;  1WQW A;  1AWW A;  1X6O A;  3PFS A;  4QKU A;  4HXJ A;  4M78 F;  2X3W D;  4IUU A;  1PD0 A;  1VOM A;  4R56 A;  2JNG A;  2X4J A;  4Z02 A;  3CCM Q;  2QGF B;  4M7A E;  4CI0 C;  2QA4 T;  1B34 B;  2MYS A;  2PU9 B;  5DY9 A;  2V1Q A;  1IGU A;  1GBQ A;  2DD5 A;  1GCP A;  2ZCF B;  3SWN B;  2K2M A;  2QDL A;  2MCN A;  1W2B A;  1H64 1;  4RTU A;  3TSZ A;  4RMO A;  3HL8 A;  4FL6 A;  4AFS C;  2V8K A;  1K73 U;  2KYM A;  5LJ5 f;  2RI2 A;  3FRN A;  2FHD A;  3OW2 P;  3CCV A;  3L2R A;  1ZHI A;  2M16 A;  2A08 A;  1QP3 A;  3CCL T;  1EIF A;  1BBZ A;  1I4K 1;  3N5B B;  4PJO F;  1OU9 A;  1KFZ A;  4BDY A;  3KFV A;  3UAT A;  1B3Q A;  2GCX A;  4BB7 A;  5GAN 8;  2O2O A;  2P84 A;  3CCQ Q;  3NGP A;  1G5V A;  2D0N A;  3GPL A;  4OMF B;  3M4G A;  4CC2 A;  4ANJ A;  1YP5 A;  4C5E A;  2K4Y A;  3RER A;  5I21 A;  3JV3 A;  1VQK T;  2SEM A;  5KYW A;  3JCM V;  1SHG A;  1VQK A;  1IHW A;  2DF6 A;  2EVR A;  3JB9 I;  3TRE A;  1SRL A;  3H0H A;  3OYD A;  5A0D A;  1OUL A;  3G71 T;  5GAN 4;  2HNI A;  4XQ3 A;  1MV0 B;  2DL3 A;  2D6F A;  4JRK A;  1VQL A;  2RB6 A;  3IQL A;  2KT8 A;  2E4H A;  2LQN A;  2RO0 A;  1Y96 A;  1YFN A;  4M4Z A;  3VV0 A;  2EQJ A;  2F1L A;  4HT8 A;  1Y71 A;  3REB B;  2NUP B;  4ZGD B;  2A28 A;  3R6O A;  4PFO A;  1G3Y A;  1WGS A;  2DPP B;  3HP9 A;  2HBP A;  2NWM A;  4F16 A;  4KGZ B;  2K7A A;  2P4R A;  2EIF A;  1M2O A;  3OMG A;  3X25 B;  3MP8 A;  3CD6 Q;  4FW1 A;  1MNE A;  1QVF S;  1NG2 A;  3TCJ A;  4FT4 A;  5HKC A;  4FCY A;  1UJ0 A;  1S1N A;  2LX7 A;  2JOY A;  1G3W A;  4FIB A;  1KQS S;  4WTO B;  4DBF A;  3H0I A;  4MZT A;  1LVK A;  1G3T A;  1NEG A;  2J6K A;  4C92 D;  1GRI A;  1UB4 A;  3SWN C;  2JW4 A;  4RG8 A;  2KRS A;  5KYX B;  5A0G A;  3G6E T;  4M77 G;  1ZQ1 A;  3LWI A;  4X1V A;  2CH4 W;  4HCB A;  4IUQ A;  4QVZ A;  3EG2 A;  2JN0 A;  4C8Q C;  4NL3 A;  2MOX A;  4FSX A;  3J81 E;  1PC0 A;  3JCM h;  4JRQ A;  2KRN A;  2V8J A;  1HXD A;  4RCB A;  1I81 A;  2ZPI B;  2GTO A;  3PTA A;  3CCM A;  3C94 A;  1QCF A;  3OYN A;  1VQ4 T;  3S6W A;  2PUK B;  4FSS A;  2KT1 A;  5IHI A;  3H6Z A;  3HHT B;  1BCO A;  9ATC B;  2V1R A;  3ME9 A;  1OPK A;  4XAX B;  3PGG A;  2A36 A;  4M77 B;  3I5S A;  5KYU A;  1JU5 C;  1XQH A;  2DX1 A;  1OPL A;  4XTW A;  5I2S A;  2ZPF B;  3PIP A;  2RHU A;  1GFD A;  1UGR B;  1WDX A;  3PMT A;  3EH2 A;  3CEY A;  3V7R A;  3C95 A;  4A4E A;  1W2B P;  2CP6 A;  3CCQ A;  1MMD A;  4PFP A;  4OMQ A;  5AYF A;  3M4Y A;  2X9H A;  2A7Y A;  1M1G A;  4BDZ A;  4Y91 A;  2QTV A;  1I07 A;  1AWX A;  2QTX A;  2MWP A;  3FLG A;  2FO0 A;  4M7A D;  3RBB B;  4DOV A;  5KH6 A;  5IN1 A;  2PZ1 A;  4JLG A;  2KY9 A;  4M7D G;  1MMN A;  1ZLM A;  2EQK A;  3DLL A;  1SG5 A;  5LJ5 d;  1KHI A;  1RAC B;  1KG1 A;  2HCK A;  2E3I A;  1ZSZ C;  2VUB A;  3A8G B;  5GAN 2;  4J6X A;  2JTM A;  1LCK A;  2BE9 B;  3PMI A;  4M7A C;  3QBY A;  4M78 G;  4J8O A;  1YI2 Q;  1QVG A;  1SEM A;  1M90 C;  4C0G A;  4D8K A;  3Q1J A;  3CBM A;  1YIJ A;  2LNV A;  4A4G A;  5CKF A;  4MZP A;  1KK7 A;  4A54 A;  4AFU C;  5CKH A;  2RI3 A;  1TG0 A;  3O8V A;  3CC4 T;  1OYX A;  3A5Z B;  3KXT A;  1VQM A;  4JRI A;  3CBP A;  2CH4 A;  5EC7 A;  3ZL7 C;  2FZC B;  4HA8 A;  4J9I A;  1QLY A;  4JZ4 A;  1B7T A;  2ATC B;  2LQK A;  2ED0 A;  2HQX A;  2L0A A;  2V8I A;  2XDP A;  2MAM A;  1YJ9 A;  5FRO A;  2QQR A;  5FRN A;  3HFN A;  3OYI A;  1S72 Q;  2RQW A;  1M90 U;  2EYZ A;  3MEW A;  1U1S A;  5IHK A;  1Q81 U;  1VQ6 T;  3CXC P;  5KYU B;  1H92 A;  4C8Q B;  3BFM A;  1XJW B;  3VS1 A;  3I56 Q;  3CCU A;  3VRY A;  2IPO B;  3P8D A;  3EGX B;  4Y28 E;  5GAO n;  1AWO A;  1D0Z A;  3HTR A;  2EKH A;  3EGU A;  4Q5W A;  2ENM A;  1WJR A;  1Y57 A;  1ARK A;  3OS2 A;  4DA4 A;  4YTL A;  4JJN K;  1MGQ A;  4M77 C;  2KEA A;  2ROT A;  4X9C A;  1SKU B;  4RCC A;  3M0S A;  2X3X D;  1WHM A;  4E6R A;  3S3N A;  1YJN A;  1JJ2 S;  5GAN e;  2IIM A;  2L3P A;  2R58 A;  2RJF A;  1AVZ C;  4X9D A;  2LX9 A;  4ELZ C;  2DLP A;  1AZE A;  1OQK A;  2EFI A;  1QVG S;  4C8Q F;  4PLI A;  1SF9 A;  2NLU A;  2JVV A;  2LRQ A;  1OX8 A;  5GAO p;  2EYW A;  4BE0 A;  2XK0 A;  2L89 A;  3CCJ T;  1FWZ A;  1M90 R;  3OW2 S;  3INZ A;  1V76 A;  1OEB A;  1WHH A;  2CP5 A;  1M5Q 1;  2OTL Q;  1IHV A;  2ZPG B;  3CC7 Q;  2VXF A;  4C92 E;  1WX6 A;  2EWN A;  4M7A B;  4LDX A;  2GF7 A;  1QKX A;  3CCV T;  2EYQ A;  4PJO C;  1HJD A;  3X28 B;  1Z9Z A;  2QQA A;  1WLP B;  3C4S A;  4KH1 B;  4FYY B;  5ECA A;  3X24 B;  1BCM A;  1JRI A;  2EAY A;  3CCS Q;  2DER A;  3G7Z A;  1VQ6 A;  2FYK A;  1CKB A;  2DBK A;  2P4T A;  4TVR A;  3G6E A;  3QYG B;  4IUT A;  1VYU A;  3LGL A;  4PJL A;  3JB9 H;  3EFO B;  3OA6 A;  4JJB A;  1Q7Y C;  4BI4 A;  3MEV A;  4OMM A;  3JCM X;  3VS7 A;  3ASK A;  1SHF A;  1JBM A;  5GMK h;  4ZTJ A;  1X2K A;  2EJG A;  2QQS A;  2EYY A;  5FRM A;  3VYG A;  1K4U S;  3CCR A;  2YUN A;  3ULR B;  2CSQ A;  2AKK A;  1YCY A;  2YUQ A;  1ABO A;  4BE1 A;  3OBW A;  3A8O B;  4ZNX A;  3LH5 A;  4QQ6 A;  1VQO A;  4LDY A;  1PRL C;  4E7Z A;  5GAM d;  1ZBJ A;  5IXB A;  1YJW A;  3EG9 B;  1XTD A;  4M7A G;  1TSF A;  4JDS A;  1AT1 B;  3PT9 A;  3CME A;  2NUP A;  2W0Z A;  1GL5 A;  2X51 A;  1ZUU A;  1VIF A;  1Q86 C;  3LYI A;  1KIK A;  1NEB A;  2JTE A;  4EIK A;  3FJP A;  2CZ1 B;  3LH0 A;  4M7D C;  1MV3 A;  2EYX A;  2D0Q B;  2OTJ Q;  3FIF A;  1YJ9 T;  3L2Z A;  3MJX A;  8ATC B;  3F70 A;  3G71 A;  2BUD A;  2YRV A;  1UG1 A;  3CCQ T;  2EPD A;  2H3E B;  4XU1 A;  1K9M R;  5GAM f;  2HL3 A;  1NBE B;  3HRS A;  2KDS A;  4N4H A;  4EMG A;  4M75 F;  3GIB A;  2R5A A;  2BZX A;  2NUT A;  1MMG A;  2VXE A;  3EG1 A;  2QGG A;  1FX7 A;  3OYH A;  1N6A A;  2LT4 A;  4J6Y A;  5CQX A;  1C6V X;  1FMV A;  3OYY A;  4BAC A;  4C5H A;  4Z89 A;  1N8R U;  4PJO B;  5A0L A;  3M56 A;  4J9B A;  2FZG B;  1VIE A;  2L3R A;  3PVL A;  3GF5 A;  2M51 A;  3M0P A;  3TU4 K;  4EDU A;  1JB0 E;  1VQK Q;  2XU8 A;  3CCJ A;  4BI3 A;  1VQL T;  1NJI R;  2OI3 A;  4J9F A;  2VWF A;  5LJ5 e;  2O01 E;  5J39 A;  4KGV B;  2EKO A;  5D6X A;  3CCS T;  3CPW P;  2HL5 C;  2GFU A;  4N0A A;  1RAB B;  4Z8A A;  4C5G A;  1TUG B;  4QVD A;  1VQ4 Q;  1QVF P;  1X69 A;  1K8A U;  2E12 A;  2RA2 A;  2CGH A;  3X26 B;  2MF2 A;  4ZN3 A;  4EMK B;  2CP2 A;  1KSW A;  4R0K A;  3S3O A;  4OMP A;  5GAN d;  4RTY A;  4UC4 A;  3CME T;  4J7F A;  2O9V A;  2RN8 A;  1E6G A;  4F7U E;  1AEY A;  3JB9 G;  3EG3 A;  3OYA A;  2ZAE A;  3G6E Q;  4GBQ A;  3EGX A;  2VB6 A;  2KNB B;  5DLO A;  2XI9 A;  1FYN A;  5KYN A;  1VQN T;  1BI0 A;  3VUZ A;  1YIT T;  4XU0 A;  1WHK A;  4A4K A;  3OBY A;  5A2Q E;  2KSS A;  4BE2 A;  4M7D B;  1Q7Y R;  1X6G A;  2CZ0 B;  1X2Q A;  1BU1 A;  2A0F B;  1UJY A;  1MUZ A;  1YWO A;  1RAH B;  2AIR B;  2XHC A;  1T0H A;  1K9M U;  2AHJ B;  3QUI A;  3QII A;  3H8Z A;  1UE9 A;  1K1Z A;  4ORZ A;  3OY9 A;  2D8J A;  2LJ0 A;  1W1F A;  5LJ3 f;  1LOJ A;  1KQS A;  5EG2 A;  2YSQ A;  1M1K R;  3AT1 B;  3VS6 A;  2FRY A;  3CD6 T;  4RTV A;  4AFQ C;  2DXC A;  2KXC A;  2XD0 A;  1U06 A;  2MMP A;  3E9G A;  1UHC A;  3LWH A;  1C1A A;  1NJI C;  1N8R R;  3E1S A;  1SPK A;  1KC8 R;  4KGX B;  2EGC A;  2MI6 A;  3MP1 A;  1PSE A;  2QQ9 A;  2F69 A;  4DQ2 A;  2VVK A;  4ZTF A;  2K57 A;  1AZG B;  3OSS C;  4OVA A;  5FLX E;  5CIU A;  5IAY A;  2BIV A;  4DEX A;  2K5L A;  2DKG A;  2JS0 A;  4HCZ A;  2ED1 A;  2PVO B;  3MET A;  3WVD B;  4E2F B;  1M9S A;  1TH7 A;  2QYZ A;  5LJ5 g;  5CKD A;  1JQQ A;  1WXU A;  3EHR A;  3RNJ A;  5CQY A;  1WA7 A;  1H8K A;  4DBQ A;  2QAS A;  3I56 T;  3H0F A;  1CKA A;  1YIJ Q;  2CS7 A;  2JJ9 A;  5GAM e;  5M9O A;  2HQE A;  2DET A;  1PHT A;  3WVE B;  1R77 A;  3M0R A;  4OB0 B;  3VRZ A;  5C0M A;  3PNW C;  3SHW A;  2LCL A;  2YDL A;  3BY7 A;  3H9N A;  3SB2 A;  2P0Q A;  1VQ8 Q;  2DVE A;  3LW5 E;  1VQ8 A;  3J7A F;  5GAO q;  2C0T A;  5KCH A;  3PVQ A;  1KQS P;  5CCA A;  2HBW A;  4RTW A;  3JCM W;  2FRW A;  2DO3 A;  3RKY A;  2HKQ B;  2DRK A;  4O6J A;  1VQN A;  1RAD B;  4K11 A;  1PG5 B;  2KE9 A;  1R0B G;  2L8D A;  1FMK A;  3CCU T;  2EJF A;  4IIM A;  5IXF A;  1M3C A;  4DBR A;  4IIO A;  1RAF B;  1QWF A;  1OU8 A;  3V7S A;  4RKU E;  4HCK A;  5CR2 A;  2EJ9 A;  3LGF A;  1M1F A;  5IH2 A;  2DL8 A;  5CK9 A;  5LJ5 j;  4J9E A;  3QO3 A;  5GAO r;  3UDC A;  4RTT A;  3MKD A;  3QXE B;  5GAN 7;  2VGN A;  4CC7 A;  3I55 T;  4E7H A;  3MO8 A;  2FPD A;  2M0Y A;  5D6Y A;  1K9A A;  1UEC A;  4C92 C;  3L2V A;  4PNO A;  4BY6 B;  4EMK A;  2M9U A;  2WSF E;  1W6X A;  4OB2 B;  4AMC A;  4P5N A;  3JB9 D;  6AT1 B;  4FU6 A;  1S72 A;  2L3S A;  3CMA T;  2ZPB B;  3KUF A;  1QQJ A;  2BZY A;  3SD4 A;  3VS0 A;  2BKD N;  4J6W A;  2DNU A;  1VA7 A;  1RAA B;  3QWY A;  5LL6 S;  2OTJ A;  1PRM C;  4PJJ A;  1T3S A;  2A3L A;  1OOT A;  1YI2 A;  3SWN A;  2RQV A;  2LQ8 A;  4B6M A;  2FVU A;  4CRI A;  2RF0 A;  1KQ2 A;  3OYB A;  5D6W A;  4LDW A;  4CC4 B;  3MEU A;  4DBH A;  3UA7 A;  1M27 C;  4XU3 A;  4O5V A;  2KAF A;  2PQW A;  3CCJ Q;  4M7D F;  3QDR B;  4M75 C;  2DA9 A;  2QI2 A;  1WJQ A;  4F7U A;  4KUD K;  1BYM A;  4M77 D;  4WCI A;  4J9D A;  1OI1 A;  3M54 A;  2KGT A;  4M75 A;  1YWP A;  4OP0 A;  4M77 F;  2MPX C;  4A4F A;  4BUG A;  2LP5 A;  1RI9 A;  2RM4 A;  3UF4 A;  2HKN A;  3RKX A;  1YJW Q;  1H3H A;  1D0X A;  1BI1 A;  2HQH A;  4ZGJ B;  2O31 A;  2O4X A;  1OZ2 A;  5GMK e;  4E7L A;  3GLX A;  1WHG A;  3I5R A;  3RDV A;  3JCM g;  2C0O A;  3CMA A;  2K9G A;  5GJV B;  4JRP A;  1QCN A;  2GTJ A;  1KJW A;  5HK3 A;  2JMC A;  1QVF A;  4OB3 B;  2VYT A;  2DL7 A;  4AT1 B;  1AHJ B;  3DB4 A;  3TVT A;  2E70 A;  4KH0 B;  3CCR T; 
#chains in the Genus database with same CATH homology
 4HXJ A;  2YT6 A;  4ZNX A;  2X3W D;  3LH5 A;  1QKW A;  1UGV A;  2O9S A;  2JM8 A;  1PRL C;  3VS4 A;  1J3T A;  2YUO A;  4QT7 A;  1M8M A;  2GNC A;  1ZBJ A;  5IXB A;  2F2X A;  2LQW A;  1U3O A;  1B07 A;  1YCS B;  1XOV A;  2W0Z A;  2CT4 A;  2J7I A;  1GL5 A;  2V1Q A;  1ZUU A;  1GBQ A;  2KR3 A;  4AG2 C;  1GCP A;  2K2M A;  2QDL A;  3UA6 A;  1NEB A;  1KIK A;  2JTE A;  4EIK A;  2MCN A;  5IHN A;  3VS5 A;  1G83 A;  2AZV A;  4RTU A;  1MV3 A;  3TSZ A;  2DL4 A;  2EYX A;  1Z9Q A;  2AK5 A;  4AFS C;  2KBT A;  2PTK A;  2KYM A;  1UG1 A;  2EPD A;  2KXD A;  4DEY A;  3QWX X;  1WXT A;  2A08 A;  1BBZ A;  1WI7 A;  3FJ5 A;  1KFZ A;  2EBP A;  2BZX A;  3KFV A;  3UAT A;  1B3Q A;  2CUB A;  3EG1 A;  2O2O A;  4LE9 A;  1WIE A;  1K0S A;  3NGP A;  2E5K A;  1M3B A;  2D0N A;  4Z88 A;  2H8H A;  2ROL A;  4CC2 A;  1YP5 A;  2FPF A;  3A98 A;  4CC3 A;  3SEM A;  2VKN A;  4Z89 A;  2CUD A;  2J6O A;  2LNH B;  3JV3 A;  3REA B;  2SEM A;  3TSW A;  1JEG A;  1N5Z A;  1SHG A;  4J9B A;  2DF6 A;  2EVR A;  1SRL A;  1NYF A;  3H0H A;  3PVL A;  2OAW A;  3M0P A;  2M51 A;  1MV0 B;  1PWT A;  1G2B A;  2DL3 A;  1IO6 A;  3IQL A;  2KT8 A;  1NLP C;  1HD3 A;  2LQN A;  4M4Z A;  5L23 A;  2PNI A;  1T0J A;  1X43 A;  2HDA A;  2OI3 A;  4J9F A;  1V1C A;  1UHF A;  3REB B;  2A28 A;  2VWF A;  4OML A;  2W10 A;  2NWM A;  4F16 A;  2GBQ A;  1ZX6 A;  2OJ2 A;  2JS2 A;  2JMA A;  2K7A A;  2F2W A;  2P4R A;  1K76 A;  4Z8A A;  2LMJ A;  3EG0 A;  2FEI A;  1X69 A;  1NYG A;  1PNJ A;  2BTT A;  3M0Q A;  4AFZ C;  4LNP A;  1KSW A;  4R0K A;  4LUE A;  4OMP A;  3NMZ C;  4RTZ A;  1NG2 A;  4RTY A;  1SSH A;  2EQI A;  4J9G A;  2O9V A;  2RN8 A;  1E6G A;  1S1N A;  1UJ0 A;  2DMO A;  2LX7 A;  3U23 A;  1AEY A;  3EG3 A;  2LCS A;  2K3B A;  2JM9 A;  1X27 A;  3H0I A;  1YNZ A;  5HCK A;  1CSK A;  2C0I A;  4GBQ A;  1NEG A;  1YN8 A;  2KNB B;  1PKT A;  4HVW A;  1FYN A;  1QWE A;  2J6K A;  2CRE A;  1GRI A;  1ABQ A;  3GBQ A;  2JW4 A;  2DRM A;  1X6B A;  1U5S A;  2KRS A;  2KYB A;  2KRM A;  1OV3 A;  1X6G A;  4JJC A;  1X2Q A;  1BU1 A;  4X1V A;  2CH4 W;  1UJY A;  1MUZ A;  1YWO A;  3EG2 A;  2MOX A;  1T0H A;  1UE9 A;  2I0N A;  4D8D A;  2KRN A;  1K1Z A;  4JPB W;  4ORZ A;  2GQI A;  2D8J A;  2GTO A;  2LJ0 A;  1W1F A;  3NHN A;  1QCF A;  4F14 A;  2YSQ A;  4FSS A;  2KT1 A;  5IHI A;  3VS6 A;  2FRY A;  4RTV A;  2DM1 A;  4AFQ C;  1T3L A;  2V1R A;  2KXC A;  3I9Q A;  1OPK A;  2A36 A;  1U06 A;  1UHC A;  3I5S A;  1JU5 C;  1TUD A;  2DX1 A;  1OPL A;  1SPK A;  4GLM A;  2G6F X;  2EGC A;  1K0X A;  2FPE A;  1GFD A;  2YUP A;  1WDX A;  1W70 A;  4OMO A;  2DE0 X;  1Y0M A;  3PE0 A;  2VVK A;  2ESW A;  1A0N B;  1AZG B;  2RPN A;  4DEX A;  4OMQ A;  1I1J A;  2DBM A;  2JS0 A;  1PKS A;  2ED1 A;  2AZS A;  1I07 A;  1AWX A;  2FO0 A;  2CDT A;  2B86 A;  3RBB B;  1VYT A;  3THK A;  1JQQ A;  1JXM A;  1WXU A;  3EHR A;  1WYX A;  2PZ1 A;  2KRO A;  3RNJ A;  1WA7 A;  3NPF A;  1H8K A;  1RLQ C;  2EGE A;  1ZLM A;  3H0F A;  1CKA A;  2HCK A;  2RMO A;  4JZ3 A;  1GCQ A;  1LCK A;  4Y92 A;  1SEM A;  1PHT A;  4D8K A;  3H41 A;  3M0R A;  3VRZ A;  3SHW A;  2J06 A;  2YDL A;  4AFU C;  1TG0 A;  2C0T A;  4A63 B;  3VS3 A;  3PVQ A;  2CH4 A;  4J9H A;  2HBW A;  4RTW A;  5EC7 A;  3ZL7 C;  2DL5 A;  2FRW A;  4J9I A;  5FWC A;  1QLY A;  2DRK A;  4JZ4 A;  2K79 A;  2A37 A;  4RUG A;  3M0T A;  4LUD A;  1I0C A;  1RLP C;  2ED0 A;  1AOJ A;  1M30 A;  2KE9 A;  4K11 A;  1JO8 A;  2L0A A;  1TUC A;  1FMK A;  4IIM A;  1E7O A;  5IXF A;  1WFW A;  4JJD A;  1M3C A;  1VYV A;  4IIO A;  2RQW A;  2EYZ A;  1QWF A;  1JXO A;  1BK2 A;  4HCK A;  5IHK A;  2JT4 A;  1H92 A;  2FG0 A;  1RUW A;  3CQT A;  2RNA A;  3VS1 A;  5IH2 A;  3I35 A;  2DL8 A;  3VRY A;  4KRT A;  4J9E A;  1AWO A;  2HSP A;  1WXB A;  4RTT A;  4F17 A;  1ZUK A;  2EKH A;  3EGU A;  1NM7 A;  2EW3 A;  4LN2 A;  4CC7 A;  3C0C A;  2ENM A;  1Y57 A;  4HVU A;  1ARK A;  2FPD A;  2M0Y A;  4OMN A;  1K9A A;  1UEC A;  2DYB A;  2KEA A;  2ROT A;  2ABL A;  5I22 A;  1HSQ A;  1W6X A;  2HEQ A;  2JXB A;  5FWB A;  3M0S A;  2O88 A;  2X3X D;  4E6R A;  2DJQ A;  2IIM A;  2L3P A;  2D8H A;  2L3S A;  1AVZ C;  2ECZ A;  2D1X A;  2LJ3 A;  2DLP A;  1AZE A;  2RQR A;  2K6D A;  2BZY A;  2LZ6 B;  3VS0 A;  2DNU A;  1VA7 A;  3QWY A;  1UTI A;  1PRM C;  1T3S A;  4ESR A;  1ZSG A;  2RQU A;  2EYW A;  2YUQ A;  1OOT A;  2XMF A;  5GJW B;  2RQV A;  1OEB A;  3O5Z A;  2RF0 A;  1SRM A;  2DIL A;  1GFC A;  4CC4 B;  2CT3 A;  1WX6 A;  2AKL A;  3UA7 A;  2GGR A;  1M27 C;  1ZUY A;  5FW9 A;  3M0U A;  2NUZ A;  2SRC A;  1QKX A;  1UDL A;  2DA9 A;  1HJD A;  1Z9Z A;  2L2P A;  4WCI A;  4J9D A;  1WLP B;  1BB9 A;  2KGT A;  4AG1 C;  3EHQ A;  1YWP A;  2EGA A;  2DVJ A;  5ECA A;  3VS2 A;  2CSI A;  2LP5 A;  1RI9 A;  3UF4 A;  5I11 A;  1H3H A;  1CKB A;  2DBK A;  1AWJ A;  4HVV A;  1VYU A;  1EFN A;  2O31 A;  1NLO C;  2BZ8 A;  2F2V A;  4JJB A;  1E6H A;  1UUE A;  4J9C A;  4OMM A;  3R6N A;  4RTX A;  1GCQ C;  3I5R A;  3VS7 A;  1SHF A;  2C0O A;  2MIO A;  2K9G A;  5GJV B;  2L3Q A;  1X2K A;  2J05 A;  2EYY A;  2GTJ A;  1GBR A;  2RQT A;  2LJ1 A;  1KJW A;  1UFF A;  1AD5 A;  1K4U S;  2JMC A;  2YUN A;  3ULR B;  2DL7 A;  2CSQ A;  2AKK A;  1AWW A;  1M3A A;  3TVT A;  2J6F A;  1ABO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...