1N5ZA

Complex structure of pex13p sh3 domain with a peptide of pex14p
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
71
structure length
71
Chain Sequence
EPIDPSKLEFARALYDFVPENPEMEVALKKGDLMAILSKKDPLGRDSDWWKVRTKNGNIGYIPYNYIEIIK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Topography for Independent Binding of alpha-Helical and PPII-Helical Ligands to a Peroxisomal SH3 Domain
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Protein transport
molecule keywords Peroxisomal membrane protein PAS20
total genus 13
structure length 71
sequence length 71
chains with identical sequence B
ec nomenclature
pdb deposition date 2002-11-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 1n5zA00
2RPNA 1NLOC 1OPLA 2DVJA 2DA9A 2LP5A 1PRLC 2DRMA 3TSWA 1IO6A 2JXBA 2O31A 2HEQA 1WIEA 2KRMA 4JJBA 2JS2A 4ESRA 4RTYA 5I11A 2ED0A 2DBMA 1NG2A 1AWXA 1WX6A 1BU1A 1NM7A 3VS7A 4CC7A 1QCFA 1X69A 1X27A 1JXMA 1HJDA 3REBB 4OMMA 1QKWA 1RLPC 3VS0A 1G2BA 1HSQA 1X2KA 4LN2A 1K0XA 2LJ0A 2KNBB 2ABLA 1JEGA 1K76A 2RNAA 2PZ1A 1U5SA 1T3LA 2KYBA 4J9HA 1SRMA 1XOVA 2JTEA 1SHFA 4F16A 2A36A 3NGPA 2CUBA 2RF0A 2BZ8A 3EG2A 4GBQA 5FW9A 3I35A 2PTKA 3NMZC 1SRLA 1WA7A 3GBQA 2X3XD 4OMPA 4IIMA 2EQIA 4LE9A 3M0SA 1T0JA 2LZ6B 2DL7A 4AFUC 3RNJA 3ZL7C 2FG0A 1ZUUA 2KR3A 2J6KA 1AOJA 1W70A 2DRKA 4M4ZA 4LUEA 3O5ZA 1HD3A 1NEGA 1G83A 4DEYA 1WXBA 3QWYA 5IH2A 2DF6A 1YWPA 2IIMA 2JMCA 1ZUKA 5IXFA 2D8JA 1X6GA 3I5RA 2D1XA 2W0ZA 3EG1A 2MIOA 2KROA 1GBQA 4R0KA 2KYMA 4RTWA 1QLYA 1GFCA 1UJYA 2EYZA 4J9GA 2F2XA 2GNCA 3U23A 4OMNA 1BBZA 2HSPA 1GCPA 4D8KA 4CC3A 2CSIA 2HCKA 4X1VA 2AKKA 1OEBA 2JS0A 3EHQA 2FPFA 4WCIA 2EYYA 3PVQA 1M3BA 2G6FX 1J3TA 2DX1A 2AKLA 2RQTA 4K11A 3M0PA 1UHFA 3R6NA 4J9EA 5HCKA 1ZX6A 3EGUA 1NYGA 1M3AA 5ECAA 2KXDA 2EPDA 2H8HA 4CC4B 1GL5A 4Z89A 2HDAA 4F14A 2EYWA 2EW3A 1Y0MA 2JT4A 1GBRA 2DILA 4LUDA 1E6HA 4HCKA 2JMAA 2GTOA 2RQUA 2L3SA 1PNJA 2CREA 2KRSA 1LCKA 3UA7A 2DLPA 2L2PA 2DL3A 3TVTA 1WXUA 2EBPA 1W6XA 4OMLA 2DMOA 2FEIA 2J05A 3NHNA 1E6GA 1OOTA 2O9VA 2J7IA 4HVWA 3PVLA 1AWJA 1GCQC 2NUZA 2B86A 1W1FA 2RMOA 2KEAA 2VKNA 2FPEA 2ROTA 2DE0X 2DL8A 2A28A 1YWOA 1AEYA 2ENMA 1SPKA 2AZSA 1UJ0A 1ZLMA 2CDTA 1K4US 1T3SA 2KXCA 4DEXA 1ARKA 4F17A 2ESWA 1WFWA 3JV3A 3REAB 3THKA 3PE0A 1H3HA 1GFDA 1OV3A 2I0NA 1H8KA 3VRYA 1AWWA 2YUOA 4AFZC 1GRIA 1NYFA 3H0IA 3QWXX 4OMQA 1V1CA 2GTJA 1PRMC 2XMFA 2C0TA 1TUCA 2X3WD 4J9CA 1NEBA 5L23A 4OMOA 4AFQC 2RQWA 1S1NA 2CT4A 1ZBJA 3ULRB 2FRYA 4KRTA 4J9BA 1I07A 2CUDA 1TUDA 2V1RA 5EC7A 3UA6A 3UF4A 2FO0A 2JM8A 1AZEA 2C0IA 1YP5A 1KJWA 1B07A 1I0CA 1CKBA 1JXOA 1YCSB 2O9SA 5I22A 1MV0B 4AG2C 3VS4A 1RI9A 2J6OA 2CH4A 2LX7A 4HVUA 3VS6A 2DJQA 4QT7A 1UHCA 1CKAA 3FJ5A 3H0HA 1X6BA 1UE9A 2P4RA 4JZ4A 4CC2A 5IHNA 2KBTA 2CT3A 4EIKA 2OJ2A 1UECA 2RQRA 2JW4A 1OPKA 3TSZA 1AWOA 2KGTA 2RN8A 1RUWA 2FPDA 2DL5A 1K1ZA 2EYXA 2W10A 3M0UA 2V1QA 3UATA 2FRWA 2A08A 1GCQA 3EHRA 4Y92A 5IHKA 3RBBB 1KSWA 4D8DA 3VRZA 2NWMA 1WYXA 2EGAA 2A37A 1WXTA 2DYBA 2KT8A 3NPFA 3EG3A 2MCNA 1WI7A 1M3CA 1ABOA 4J9IA 1YNZA 2F2WA 2GGRA 2YSQA 3H41A 2YDLA 3M0RA 2O2OA 3VS5A 1WDXA 2D0NA 2L3PA 1TG0A 1SSHA 1I1JA 2EKHA 2K9GA 3I5SA 4RTTA 5FWCA 2ROLA 2AZVA 2LMJA 1UG1A 1Z9QA 2LJ3A 1VYVA 2LJ1A 1UGVA 4E6RA 1NLPC 2L3QA 2D8HA 5FWBA 1EFNA 1AD5A 1M8MA 1PWTA 2YUQA 1M27C 2K2MA 2E5KA 3KFVA 1QWEA 2EGCA 1K0SA 2VWFA 1BB9A 1H92A 4ORZA 3SEMA 2K79A 2AK5A 1U06A 1UUEA 1FMKA 2YUPA 5IXBA 2BTTA 3SHWA 1AVZC 1SHGA 3M0TA 2CH4W 2QDLA 1Y57A 2LCSA 2LQWA 1U3OA 2C0OA 5GJWB 2DL4A 2M0YA 3IQLA 1WLPB 4RUGA 4RTZA 1X2QA 1FYNA 3LH5A 4JZ3A 2BZXA 2K3BA 2J06A 2KE9A 1KIKA 1YN8A 2YT6A 1ABQA 4RTVA 2HBWA 2SRCA 2OAWA 1UTIA 2SEMA 4JJDA 2MOXA 1Z9ZA 3VS2A 3I9QA 1JO8A 2PNIA 1UFFA 2ED1A 4Z88A 1UDLA 2RQVA 2YUNA 4J9DA 1VYUA 4JPBW 1M30A 2BZYA 4J9FA 1B3QA 4AG1C 2OI3A 1ZSGA 1MV3A 4ZNXA 1VA7A 4HXJA 2LQNA 1VYTA 3C0CA 1RLQC 2K7AA 1BK2A 1E7OA 3VS1A 2O88A 2LNHB 4RTXA 4HVVA 3EG0A 2F2VA 2DNUA 3CQTA 5GJVB 1CSKA 3VS3A 2KT1A 2GBQA 2EGEA 2K6DA 2JM9A 1MUZA 4AFSC 1JU5C 2L0AA 1QKXA 1AZGB 1JQQA 3M0QA 4JJCA 1PKTA 3A98A 4RTUA 1ZUYA 1N5ZA 1KFZA 2KRNA 2ECZA 2GQIA 1PKSA 1T0HA 2M51A 1K9AA 2CSQA 1PHTA 3H0FA 5IHIA 4Z8AA 2J6FA 2DBKA 4A63B 1A0NB 1X43A 2DM1A 2VVKA 1SEMA 4LNPA 4FSSA 4IIOA 4GLMA 1QWFA 2EVRA
chains in the Genus database with same CATH superfamily
2FL7A 2QGGA 4M7AF 3FB9A 1M2VB 1Q7YU 1BI1A 2DVJA 2LP5A 3EGXA 3TSWA 2O31A 3OW2S 2YXYA 2EYQA 3A1PA 4PJOD 4RTYA 4BI4A 2HMAA 2DBMA 1VQ4A 1NG2A 4M7AA 3MEUA 1NM7A 3VS7A 2LT4A 4CC7A 1VQ9T 4JJNK 3QBYA 4B6MA 4JRQA 2Z0WA 3REBB 1QKWA 1RLPC 1XJWB 3VS0A 1G2BA 3BY7A 2OTJA 4EMKC 1JEGA 3BW1A 1Q95G 1U5SA 2KYBA 3OYJA 4J9HA 1Q81R 1SHFA 1U1TA 3G4ST 3OYDA 3NGPA 3CD6Q 2CUBA 2RF0A 4KGZB 3OS1A 1RAEB 4M77E 2QQSA 4N4HA 3S3OA 1WA7A 1T0JA 2CP5A 3ZL7C 1BI3A 1TWBA 3SWNC 1G8XA 3FDRA 3GP8A 4RKUE 2J6KA 4DQ2A 4LUEA 1RAGB 1D3BB 2GF7A 3OB9A 2NYSA 2PUOB 5IXFA 4C92A 4M75E 1GBQA 4LD9K 3G71A 5GAMd 3M57A 4XAXB 5FU7C 4RTWA 5GAOp 4MZTA 1YJ9T 1UJYA 1IXDA 1YIJQ 1VQ5Q 1MNEA 3CCUQ 2F2XA 4FW2A 1WZOA 2AHJB 3QG1A 2CP6A 2HSPA 4OB3B 3CXCP 2JS0A 4WCIA 4OMFB 2E3HA 3CCQT 1IHWA 3UPUA 1J3TA 5KCHA 3JCMJ 4E7ZA 3PNWC 4O6JA 2E65A 4RCBA 4K11A 1UHFA 4M78F 1WHJA 3O8VA 1PCXA 3QIIA 5HCKA 2DD4A 4ZGJB 3LYIA 1NYGA 1OYXA 1ZA2B 1JB0E 4OB0B 1VQNA 1N27A 3E2UA 4F14A 1S72Q 1VQ8Q 1PSFA 2MAMA 1VQOT 4JUVA 3CMET 1D1CA 4BUGA 3CC7Q 5LJ3j 2D9TA 3PGGA 1BIBA 2K3XA 1VQ7Q 2CREA 2KRSA 4FU6A 3UA7A 1D0ZA 1K9MC 3TVTA 3MO8A 5CAIA 3NHNA 1E6GA 1JJ2A 2J7IA 2JUFA 2WSFE 5KYXB 1VQ7T 3M58A 1M2OA 4FSXA 1W1FA 3NTIA 2WSCE 5HY6A 2KEAA 2DL8A 2E6ZA 1SKUB 1YWOA 1VQMA 1KD1U 3E9FA 4O5VA 1UJ0A 5GANe 2H3JA 1M90R 1K4US 1T3SA 2KXCA 1ARKA 2QYZA 2LTOA 5LJ5d 1WFWA 3REAB 2E41A 1FMVA 3JCMV 2P84A 4ZN3A 4C5EA 2YWWA 2E5QA 3CCLA 4BY6B 3QWXX 4FT2A 1W2BS 1NPRA 1TUCA 3QZ9B 4AFQC 4IKFA 3S3NA 1OQKA 2FRYA 5M9OA 3UA6A 3A8LB 1OX9A 2EJ9A 4RG8A 2L3RA 1CKBA 5D7UA 2MWOA 4M78D 3OYKA 4M75D 1ZBXA 1MV0B 1I4K1 4AG2C 5J3BA 2CH4A 2HL5C 2LX7A 4HVUA 2JNGA 5DM7R 1K8AU 4QT7A 1CKAA 3FJ5A 1VQMT 4M7AG 3H0HA 1UE9A 1AT1B 3RUXA 1V76A 4EMKB 5I2SA 1O75A 1W4SA 3PMTA 3MEAA 1RAIB 1Q7YC 2RQRA 2JW4A 2QI2A 1YHQQ 4FT4A 3TSZA 2KGTA 1RUWA 2D6FA 2V1QA 3C95A 3UATA 5D6WA 3CCQQ 1QVGS 4HT9A 3EFSA 3LWHA 4D8DA 4EMKA 1VQ6A 2BKDN 4MDXA 3H6ZA 3G4SA 2NUPA 2KT8A 4KH1B 3EH2A 2HQXA 4M78E 4M7DA 1LNXA 1YI2A 5FRMA 4ME7A 2XDBA 2KVQG 3X20B 4XQ3A 3META 4PKCC 1ZSZA 1I1JA 1BI0A 1VQ8A 3OYHA 2K9GA 1YITQ 3QXEB 5GANh 2VASA 1OX8A 2JZ2A 4OGCA 2PVDB 2LJ1A 2RI3A 3ZEHA 2ZPFB 1X6OA 5FWBA 1EFNA 4CRIA 1AD5A 4QQGA 1IB8A 4XTXA 2H3EB 3ZBDA 5KH6A 3OSSC 6AT1B 3JCMe 3FC3A 5A0DA 4A4GA 2VWFA 4C5HA 1I81A 4XTUA 1Q7YR 1S72T 3UDCA 2K79A 4ZGEB 1OU9A 4PJNA 1VQ6T 2BTTA 3SHWA 3OYLA 4EMHA 2QTVA 4BI3A 5KYWA 1PSEA 2E12A 2LQ8A 3ER0A 2CH4W 3NTKA 1Y57A 2LCSA 2X4YA 3HP9A 3OYCA 2C0OA 2LCCA 3BDLA 3CPWP 2F5TX 4PK4A 2L8DA 3LH5A 3F70A 4L59A 3RR6A 4JZ3A 2J06A 2KE9A 2MMPA 2ZZDA 4M7AD 4QVDA 4C8QG 2JVVA 2LRQA 2P0KA 4VUBA 3OW2P 4RTVA 1VQ9A 3JCMf 4JJDA 2Y4YA 1WPYA 3VS2A 3I9QA 1YFNA 2A7YA 1UFFA 2DXCA 2ED1A 1YHQA 1B34A 1WQ7A 2K2VA 1YJNA 3CMAT 5J26A 2ZPEB 4M7AB 1RAHB 5CQXA 3CC7T 5LJ5h 3QYGB 1MV3A 4ZNXA 2QEXT 2V8JA 3DB4A 2O88A 4C0FA 1CSKA 3VS3A 1QVFS 2XK0A 2EGEA 2OTLT 2HSEB 2JM9A 4QQDA 2C06A 1XQHA 4JLGA 1QKXA 1AZGB 3M0QA 4JJCA 1VQPQ 1PKTA 3FLGA 1HXDA 2NUPB 1K9MU 1ZUYA 1Q82R 2QQRA 2VXEA 1PKSA 2M51A 2CSQA 1PHTA 5DLQE 3CCJQ 4BB7A 1VQ5T 1SEMA 5C6SA 4MZPA 1QWFA 1KD1C 4LXCA 3OYAA 2E70A 1NLOC 1QQJA 5GMKh 1VQLA 1OPLA 4RMOA 3DLLA 4DBRA 2Y90A 2JS2A 2XU8A 4ESRA 1KG1A 2RJEA 2F1LA 2OTLQ 2L89A 2CZ1B 1WX6A 3GPLA 1C1AA 1MHNA 1HJDA 3Q1JA 2AIRB 3CCSQ 1VQ8T 1N9SA 2FZCB 2BIVA 1YCYA 1HSQA 1X2KA 4LN2A 2CZ0B 4M75B 2OTJT 3I56T 1K9MR 1NE8A 2CGHA 4F16A 2K3YA 5FU7B 1VQ4T 2COWA 3FEOA 3I35A 1QCOA 3CC2Q 3QHSA 2AT1B 4KH0B 3BDUA 1SRLA 2QEXQ 2BE9B 4C92E 2DTHA 4OB2B 2RK2A 3CBOA 2DL7A 1M4ZA 3HSBA 3CCET 3CC4Q 4M7DG 2KR3A 2LT1A 5D6XA 4R55A 2RJFA 4M4ZA 3JB9I 4E47A 1G83A 4DEYA 4C92G 1YWPA 2IIMA 4ELYC 2CP2A 1D1AA 2WSEE 3JB9H 1VOMA 1X6GA 5FU6C 5GAN7 5CVIA 2D1XA 1N8RU 1MNDA 3EG1A 3JCMc 2DXTA 3AT1B 1JRIA 2E1HA 4PJOC 1GXIE 2ZPGB 3CCLT 2XDPA 1QLYA 4C8QC 2EYZA 1BIAA 1FX7A 3CXCS 3FIFA 1YBYA 2GNCA 2DXUA 3U23A 3CPWS 3UWNA 2LVMA 1U1SA 3OS2A 3CMAA 2AKKA 2X9HA 5CKDA 1M3BA 4C0DC 2DX1A 2FVUA 4J9EA 2QA4Q 3VUZA 1ZX6A 3M9QA 2KQWA 2JTFA 3EGUA 1YJWA 1M3AA 4FCYA 1M8VA 2KXDA 2EPDA 2H8HA 5KYUA 1Y7XA 4Z89A 2DEUA 2EW3A 5A2QE 1Y0MA 3CCJA 2JT4A 1GBRA 1RABB 3JRZA 2K5IA 4HCKA 2GTOA 2OTJQ 2CS7A 3C4SA 4WTOB 2LX9A 2GFUA 4LDVA 2L3SA 3DB3A 2CYZB 1R77A 4IUTA 2DL3A 3L2UA 4MMKA 1WXUA 1G3YA 2FZKB 3OYMA 1RADB 2DMOA 2FEIA 2J05A 2JTMA 5GAOl 3G6EA 1TXQA 4HVWA 2GFAA 5FLXE 1PD0A 2CZ7B 2VC8A 4PJOF 4M77C 4NOYA 4JS5A 2VKNA 1YITT 2ROTA 3GLXA 2DK3A 4WF2A 1AEYA 2MI6A 2ENMA 3MKDA 5GMKi 3KXTA 3CCMQ 2AZSA 1ZLMA 5AT1B 3CCSA 1QP2A 3HFNA 4F17A 1WHKA 1H641 4NL3A 1VIFA 4M7DD 3PE0A 3JCMg 2MWPA 4Q5WA 3RKWA 4FIBA 2KSSA 1GFDA 4XU3A 1H8KA 4J8OA 3DKMA 1AWWA 2YUOA 4RCCA 1NJIU 1KHIA 4N4GA 5CIUA 2PU9B 2R58A 4QVCA 1PRMC 5LJ5j 2VGMA 2X3WD 1EZZB 4J9CA 3EGDA 3QDRB 2EQJA 2RQWA 1LJOA 3SFMA 2CT4A 4IURA 4C8QE 4J9BA 4JS4A 2E64A 3UF4A 2C0IA 1YP5A 1I0CA 4BI8B 4N4IA 1BI2A 2FYKA 1G3SA 1RI9A 3LWIA 3RKXA 4C92D 2DJZA 5L8RE 3VS6A 4LDWA 1YJWQ 1X6BA 2P4RA 8ATCB 5IHNA 3URGA 1WHLA 5GAN3 4XU2A 3CD6T 1UECA 3H9NA 3CCUA 3JCMW 1OPKA 3TREA 2RJDA 2GQVA 4FYWB 4E7LA 1K1ZA 5KYUB 2ZAEA 1GCQA 3C94A 4Y92A 2NWMA 2EGAA 2A37A 2DYBA 4A4KA 2MCNA 2RM4A 3OW2A 3GNGA 1VQKQ 1M3CA 2QA4A 5IAYA 5CQYA 1VQPT 4HT8A 2YSQA 3H41A 1VQLQ 1WDXA 2DZ9A 3I56Q 4J83A 4EMGA 3OY9A 4M77B 2EKHA 5LJ5e 5KYXA 3S3MA 3JB9D 1OZ2A 4F7UG 4PJOE 1VYVA 1UGVA 3RERA 1NLPC 1R8OB 2MPXC 4LD6A 5LL6S 2HL3A 2K2MA 3HKSA 3G1JA 1VQKT 1I5OB 3VV0A 5CK9A 5GAOm 3CC4T 2EGCA 1K0SA 1H92A 4ORZA 5I21A 3X26B 1Y07A 1UUEA 4XTWA 2X35A 1MMNA 1AVZC 4II1A 1SHGA 2P0QA 4LDUA 1N8RC 3OBWA 2QDLA 2LQWA 4A4HA 2RHZA 5GJWB 2ZGWA 1VQ4Q 2F69A 2X4WA 3WVEB 3CBMA 4RUGA 4PFOA 2PUKB 4E7IA 3CCRQ 4RG2A 1PM3A 2YT6A 3QDFA 1QMCA 1ABQA 1ZA1B 1C6VX 2XKOC 3CCST 5LJ3e 2DAQA 2MOXA 4JDSA 4PLIA 3M4YA 4C5IA 1K73R 2LDMA 1JO8A 1Q86U 2DXBA 3HL8A 4Z88A 3MEWA 1LOJA 1IREB 3L2VA 4J9DA 1VYUA 1WHGA 1M30A 4PFZA 2RHUA 1UGPB 3QYHB 1YIJA 2RO0A 4HXJA 2LQNA 1VYTA 3C0CA 2K7AA 1BK2A 3M54A 5C0MA 5AYFA 2DEQA 3MP8A 4KBMB 2DNUA 2G3RA 3EFOA 2KT1A 3OYGA 2HNIA 1JQQA 3HHTB 3A98A 2WACA 4RTUA 1N8RR 1N5ZA 2A3LA 4M77F 4A4FA 2GQIA 1LVKA 1T0HA 2RI5A 1X75C 2P4TA 4Z8AA 2EJFA 2BUDA 1PC0A 4KGXB 1KQSA 2K4YA 1X43A 2DM1A 4UC4A 2VVKA 4IIOA 4DOVA 4GLMA 3G71T 2KK4A 2RPNA 3V7CA 2RHXA 1Q86R 4PFPA 1YI2Q 1Q82U 3JCMh 1PRLC 1O9SA 1WJRA 2DRMA 1IO6A 2JXBA 3A8GB 1TU0B 4JRKA 4XTZA 5I2MA 1M5Q1 1MGQA 2QA4T 1NJIC 3L2WA 2K57A 1YITA 3LW5E 5LJ3g 3VYHB 1AWXA 1BU1A 4BD3A 3TEEA 2EQKA 1VQMQ 2OX7A 4M78G 1JBMA 4OMMA 2HAXA 2L5QA 2LJ0A 3FJPA 2ABLA 2EJGA 2M1HA 1K76A 1HYOA 1T3LA 1SRMA 2JTEA 2VV5A 3J81E 2A36A 1UGRB 4PL6A 3QKJA 2BZ8A 1YJNQ 3EG2A 4GBQA 1M1KU 1WJSA 5KYWB 3CCVT 4N0AC 4C8QF 3EGXB 3PT9A 3GBQA 3CPWA 2X3XD 4IIMA 5DLOA 4OP0A 3OBYA 2EQIA 2ZPIB 1EX4A 2ZPBB 1YJNT 4M7AE 3RNJA 3M55A 2ZPHB 4ZGDB 2MK5A 3SB2A 3JCMX 4FYVB 3SWNB 3JCMP 4QW2A 1ZSZB 3O5ZA 1NEGA 1WXBA 5D6YA 5IH2A 2JMCA 5FROA 2D8JA 3I5RA 1WQWA 3QPHA 5GANf 1VIEA 2JOYA 2KROA 1QVFA 3HRUA 4KGVB 2E4HA 4R0KA 4E7HA 3VUBA 1ACMB 1QVGA 1GFCA 4L5GA 2HZYA 4QKUA 3RKYA 5KE2A 3JAME 1IGQA 2V26A 1PG5B 5GMKl 4OMNA 3GIBA 4D8KA 4CC3A 5FU6B 2CSIA 4X1VA 3HTRA 4EDUA 3EHQA 2HKNA 1MMGA 4BACA 2EYYA 4NS5A 1M1KR 3JB9G 4Z02A 2AKLA 2KI7A 3OYNA 3M0PA 1VQPA 2DIGA 4C5GA 4IUPA 3PFSA 2O4XA 5EG2A 4X34A 2CZ6B 5ECAA 5CR2A 1NBEB 4CC4B 2HDAA 2M02A 2EYWA 5CCAA 3E19A 3OS0A 3S6WA 2DD5A 2DILA 4LUDA 2XG8D 3OS5A 3NTHA 2JMAA 5IN1A 2RJCA 2RQUA 1LCKA 2X4JA 2L2PA 4CI0C 1FWZA 2X51A 2EBPA 1W6XA 4YTLA 4E7SA 1OOTA 2O9VA 5LJ3d 5LJ3h 2M16A 4J6WA 2NUZA 4IUVA 3OYIA 2B86A 2CKKA 4C8QD 3PTAA 2NLUA 3JCMQ 2FPEA 2A28A 3R6OA 2VXFA 2CP7A 3L2RA 4OB1B 1SPKA 2LCLA 1Q86C 1YJWT 3C12A 4DBHA 2DO3A 4DEXA 5GAN6 1KK7A 3JV3A 1VUBA 3THKA 2R5AA 1H3HA 4C8QA 4ZN1A 4M78C 3V7SA 2R57A 2YRDA 3VRYA 1M90U 1NZ9A 4AFZC 5GAMe 4MDWA 3G71Q 3H0IA 1V1CA 2GTJA 2XMFA 4PNOA 3OYBA 5J39A 1NEBA 3A8OB 3P8BB 3M53A 2RHIA 3E1SA 2O4XB 4J5YA 1S1NA 3RMQA 2QDYB 3ULRB 4ZTFA 3M56A 5GAN5 4M77G 2FO0A 5CKBA 3ZFJA 1KJWA 3OYFA 4KUDK 1JXOA 2XI9A 3PMIA 2KY9A 2O9SA 3PIOA 3E9GA 3VS4A 2VUBA 2J6OA 1TS9A 4GY5A 1MMAA 3JCMd 4M7DE 2DJQA 1G3TA 1VQ9Q 3CMEQ 3WXMB 4R56A 4JZ4A 1D09B 2DFUA 3KBGA 3V8LA 4EIKA 2OJ2A 1KHCA 1TUGB 1K73U 1N6AA 4MZMA 1Q82C 1JJ2S 1SG5A 1AWOA 2YHTA 2RN8A 5KYNA 2DL5A 2EYXA 2FRWA 5KE3A 4M75C 2A08A 5A0GA 1Y96A 1Y96B 3EHRA 4E7KA 1KSWA 4OVAA 3LH0A 5DY9A 5HK3A 3QZ5B 1WXTA 1G5VA 3CCVA 2M0OA 2Y4XA 1I5LA 3L1AA 2QXFA 1ABOA 1RI0A 1SF9A 1YNZA 4KUIA 1OU8A 2F2WA 2GGRA 2YDLA 1VQOA 1VQNQ 3VS5A 4QQ6A 5GAMh 2L3PA 1TG0A 5FRNA 1SSHA 1H3ZA 3I5SA 4RTTA 4E7JA 2VGNA 1KQ2A 5FWCA 1M1KC 1QVGP 2COZA 4C92B 2AZVA 4FM4B 1B34B 1UG1A 1Z9QA 2LJ3A 4E6RA 2D8HA 2FZGB 1PWTA 2YUQA 4B9WA 1ZHIA 3CCLQ 3LX7A 5GANg 2HQHA 4M78A 2YRVA 4M7AC 2E5KA 3J80E 4EPCA 2NUTA 2QQAA 2V8KA 1QWEA 1KC8U 2K5FA 1BB9A 4KT0E 3SEMA 3CD6A 1U06A 2YUPA 3OYEA 2EAYA 3RESA 5A0LA 1U3OA 2LNVA 4C8QB 2M0YA 3IQLA 1WLPB 2EKOA 2EQUA 1D1BA 3RIRA 1FYNA 1WHHA 2K3BA 2DZCA 3A8MB 4B9XA 1YN8A 3TU4K 4M75G 3JCMb 1UTIA 1W2BP 4AT1B 2MYSA 2ZCFB 3CCEQ 4FW1A 3MP6A 2PNIA 1TH7A 1UDLA 1M2VA 2YUNA 2BZYA 5GAOq 1B3QA 3MCAB 5LJ5f 3JB9J 3CCJT 1ZSGA 2DIQA 2O01E 3V8KA 5GANj 3G7ZA 3MPUB 3QSUA 2LNHB 2M9UA 2QK0A 3EG0A 1KQSS 2F2VA 1KC8R 3CQTA 1UEBA 2GBQA 2EQMA 1VQOQ 5HK0A 2RH2A 2QTXA 3DLMA 1MUZA 3CEYA 5GANd 3L42A 2DYIA 3OSVA 2DTOA 5GMKm 1KFZA 4IUUA 2KRNA 4C0DB 2ECZA 4F7UB 1BKBA 3CPFA 1QP3A 3H0FA 3A8HB 5IHIA 4C92F 3GOXA 2J6FA 1G3WA 4BDYA 3QJ6A 1A0NB 3EGDB 1WNLA 2KMTA 2QGFB 4FSSA 3HRTA 4E2FB 1F1BB 2EFIA 2B8AA 2F5KA 4F7UF 2GCXA 1YIJT 2V8IA 4MMLA 5CKFA 2X4XA 2DA9A 1BYMA 2RA2A 2HEQA 1WIEA 4XU1A 2KRMA 5IT9E 3G6EQ 3CXCA 4J7FA 4JJBA 1M90C 4M78B 1WGSA 5I11A 3FRNA 2ED0A 4BE2A 3INZA 3V8JA 3CCMT 4BY6C 3P8HA 4XU0A 2IG0A 2JJ9A 1YHQT 1QCFA 1X69A 1X27A 1JXMA 2MF2A 3CCMA 8AT1B 5GAN2 2DVEA 3OA6A 3CC7A 1K0XA 2KNBB 4X9CA 1VQ7A 2RNAA 2PZ1A 3SD4A 1XOVA 2DETA 3EFOB 5FW9A 2PTKA 3NMZC 3A5ZB 3BE3A 2HKQB 4J6YA 4JRPA 3I55T 4L6V5 1TOVA 4OMPA 3TCJA 3CCUT 1M9SA 4LE9A 3M0SA 2LZ6B 4AFUC 3TQ7P 1QCNA 2R5MA 1SSFA 2FG0A 1ZUUA 2YLBA 2FB7A 3M5AA 4XTVA 1K73C 4ATOA 2D0QB 1AOJA 3JSCA 5GAMf 1W70A 1YJ9A 1IRXA 2DRKA 4DA4A 2VYTA 4M77A 1HD3A 1W2BA 3QWYA 4C0GA 2EIFA 2DF6A 2YRCA 4HKEA 1ZUKA 2QQBA 1ZQ1A 2W0ZA 2A0FB 3P8DA 2MIOA 4HCBA 1M1GA 2JN0A 3RDVA 3LGLA 1X01A 2KYMA 2IPOB 4FL6A 4FYXB 1VQLT 3CBPA 1KQ1A 2DKGA 2PVGB 1IGUA 4J9GA 4A53A 4BDZA 1BBZA 1GCPA 3N5BB 2HCKA 3M59A 1OEBA 2FPFA 5GAOn 3PVQA 2G6FX 2PQWA 3I55A 4PJLA 2RQTA 5KCOA 3R6NA 5CO7A 1OI1A 2OAUA 2HBPA 1EIFA 1B7TA 3I56A 3OMGA 1GL5A 4Y91A 3D7SB 3EFRA 3GF5A 1KC8C 4M75A 4QVZA 4DBFA 5KYYA 1LPLA 1TSFA 1E6HA 4XTYA 3CC2T 2XDDA 4BE0A 1PNJA 2YLCA 3V7RA 1VQ6Q 1U8RA 2DLPA 1Q81C 4M7DC 4C0ZA 4M7DF 4OMLA 4M75F 3HFOA 3PVLA 1AWJA 1GCQC 4LDYA 4X9DA 1KQSP 5LJ5g 2RMOA 3CCRT 3MHXA 2LC4A 1DJ7B 3J7AF 2DE0X 4XK8E 3CC4A 1UGQB 2NUTB 1RL2A 2CP3A 2CDTA 2RK1A 4J7IA 1NJIR 2ESWA 3OYYA 1WJQA 4J6XA 4GLKA 1JJ2P 4FYYB 1OV3A 2I0NA 1TTHB 3RMSA 1GRIA 1NYFA 4OMQA 4M77D 9ATCB 1YI2T 2C0TA 3CCEA 4OGEA 5L23A 4OMOA 1K8AR 1RAFB 2DPPB 2HD0A 2QG9B 2CP0A 3L2QA 4M7DB 2HQEA 4OF1A 2E6NA 1MMDA 4DOWA 1ZBJA 3MP1A 4KRTA 1I07A 2CUDA 1TUDA 2V1RA 4HA8A 5EC7A 2JM8A 1AZEA 2RD1A 1B07A 2EWNA 1D3BA 1UGSB 3MJXA 1YCSB 2K5LA 4PJOB 5I22A 5KYYB 5GAOr 1XTDA 2QQ9A 3L2ZA 2XD0A 1R0CB 4Y28E 3CCRA 2XHCA 4PJMA 1UHCA 4LDXA 1XNIA 4ANJA 4CC2A 5CKEA 2KBTA 2CT3A 3BFMA 5GMKj 1QVFP 5LJ3f 1S72A 3QO3A 4HCCA 3ME9A 1QVPA 3G6ET 1FMWA 3T9NA 2BE7D 2FPDA 3GNFB 3M0UA 2W10A 1N9RA 4A4EA 3OMCA 5GAN4 3MEVA 3CMAQ 3VU3C 1WHMA 4F04B 5IHKA 3RBBB 3EH1A 3VRZA 3SWNA 4F7UE 2I2LA 1WYXA 3I55Q 3NPFA 4C92C 3EG3A 2VB6A 1WI7A 3QUIA 4J9IA 3ASKA 4KULA 1RAAB 1BCOA 3M0RA 2O2OA 1OZ3A 2D0NA 4BE1A 3OQ5A 1AHJB 3AHUA 3H8ZA 1KD1R 2IVWA 2ROLA 1Y71A 2LMJA 1PD1A 2L3QA 4N0AA 1P92A 1M8MA 3KUFA 1C0MA 3NFCA 3VJPA 1M27C 4HCZA 2COYA 1I8FA 2DTIA 4P5NA 5GMKe 3JB9F 3KFVA 2KAFA 1QW1A 2RI2A 1NPPA 1HK9A 3PIPA 2AK5A 4ZTJA 3X28B 3UT1A 1FMKA 4A54A 5IXBA 2LQKA 3EG9B 3EG9A 3QJYA 3M0TA 3X24B 1OULA 1R0BG 1VQNT 1BCMA 2OTLA 5GAMg 2DL4A 2QASA 2ATCB 4PJOA 3EAEA 2E3IA 4RTZA 1X2QA 2BZXA 1KIKA 2E10A 2P0PA 3CMEA 2HBWA 2RB6A 2SRCA 2OAWA 3VYGA 1D0XA 2DERA 4V2SA 2SEMA 2XIDA 1Z9ZA 4IUQA 3HRSA 3M4GA 4JRIA 2PVOB 2RQVA 4PJJA 4JPBW 4TVRA 3WVDB 3CC2A 4J9FA 4AG1C 3CCQA 2QEXA 1RACB 5GAN8 1M1FA 2OI3A 4D6WA 1VA7A 3G4SQ 1IHVA 2RHYA 4AMCA 1RLQC 3LLRA 1E7OA 3CCVQ 3VS1A 3SDZA 4RTXA 1ZSZC 1VQKA 4HVVA 1YJ9Q 5GJVB 4F7UA 2K6DA 2FHDA 4PLLA 2KDSA 4AFSC 1JU5C 2L0AA 3VKIA 4PJOG 5CKHA 1Q81U 5GAMj 4NL2A 3LGFA 2XICA 4DBQA 1FXXA 7AT1B 4JLIA 1K9AA 1IZ6A 5HKCA 2QAZA 1UB4A 1VQ5A 1K8AC 2DBKA 4A63B 4ELZC 3X25B 4LNPA 3HPWA 1D0YA 1V29B 2EVRA
chains in the Genus database with same CATH topology
2RPNA 1NLOC 1OPLA 2DVJA 2DA9A 2LP5A 1PRLC 2DRMA 3TSWA 1IO6A 2JXBA 2O31A 2HEQA 1WIEA 2KRMA 4JJBA 2JS2A 4ESRA 4RTYA 5I11A 2ED0A 2DBMA 1NG2A 1AWXA 1WX6A 1BU1A 1NM7A 3VS7A 4CC7A 1QCFA 1X69A 1X27A 1JXMA 1HJDA 3REBB 4OMMA 1QKWA 1RLPC 3VS0A 1G2BA 1HSQA 1X2KA 4LN2A 1K0XA 2LJ0A 2KNBB 2ABLA 1JEGA 1K76A 2RNAA 2PZ1A 1U5SA 1T3LA 2KYBA 4J9HA 1SRMA 1XOVA 2JTEA 1SHFA 4F16A 2A36A 3NGPA 2CUBA 2RF0A 2BZ8A 3EG2A 4GBQA 5FW9A 3I35A 2PTKA 3NMZC 1SRLA 1WA7A 3GBQA 2X3XD 4OMPA 4IIMA 2EQIA 4LE9A 3M0SA 1T0JA 2LZ6B 2DL7A 4AFUC 3RNJA 3ZL7C 2FG0A 1ZUUA 2KR3A 2J6KA 1AOJA 1W70A 2DRKA 4M4ZA 4LUEA 3O5ZA 1HD3A 1NEGA 1G83A 4DEYA 1WXBA 3QWYA 5IH2A 2DF6A 1YWPA 2IIMA 2JMCA 1ZUKA 5IXFA 2D8JA 1X6GA 3I5RA 2D1XA 2W0ZA 3EG1A 2MIOA 2KROA 1GBQA 4R0KA 2KYMA 4RTWA 1QLYA 1GFCA 1UJYA 2EYZA 4J9GA 2F2XA 2GNCA 3U23A 4OMNA 1BBZA 2HSPA 1GCPA 4D8KA 4CC3A 2CSIA 2HCKA 4X1VA 2AKKA 1OEBA 2JS0A 3EHQA 2FPFA 4WCIA 2EYYA 3PVQA 1M3BA 2G6FX 1J3TA 2DX1A 2AKLA 2RQTA 4K11A 3M0PA 1UHFA 3R6NA 4J9EA 5HCKA 1ZX6A 3EGUA 1NYGA 1M3AA 5ECAA 2KXDA 2EPDA 2H8HA 4CC4B 1GL5A 4Z89A 2HDAA 4F14A 2EYWA 2EW3A 1Y0MA 2JT4A 1GBRA 2DILA 4LUDA 1E6HA 4HCKA 2JMAA 2GTOA 2RQUA 2L3SA 1PNJA 2CREA 2KRSA 1LCKA 3UA7A 2DLPA 2L2PA 2DL3A 3TVTA 1WXUA 2EBPA 1W6XA 4OMLA 2DMOA 2FEIA 2J05A 3NHNA 1E6GA 1OOTA 2O9VA 2J7IA 4HVWA 3PVLA 1AWJA 1GCQC 2NUZA 2B86A 1W1FA 2RMOA 2KEAA 2VKNA 2FPEA 2ROTA 2DE0X 2DL8A 2A28A 1YWOA 1AEYA 2ENMA 1SPKA 2AZSA 1UJ0A 1ZLMA 2CDTA 1K4US 1T3SA 2KXCA 4DEXA 1ARKA 4F17A 2ESWA 1WFWA 3JV3A 3REAB 3THKA 3PE0A 1H3HA 1GFDA 1OV3A 2I0NA 1H8KA 3VRYA 1AWWA 2YUOA 4AFZC 1GRIA 1NYFA 3H0IA 3QWXX 4OMQA 1V1CA 2GTJA 1PRMC 2XMFA 2C0TA 1TUCA 2X3WD 4J9CA 1NEBA 5L23A 4OMOA 4AFQC 2RQWA 1S1NA 2CT4A 1ZBJA 3ULRB 2FRYA 4KRTA 4J9BA 1I07A 2CUDA 1TUDA 2V1RA 5EC7A 3UA6A 3UF4A 2FO0A 2JM8A 1AZEA 2C0IA 1YP5A 1KJWA 1B07A 1I0CA 1CKBA 1JXOA 1YCSB 2O9SA 5I22A 1MV0B 4AG2C 3VS4A 1RI9A 2J6OA 2CH4A 2LX7A 4HVUA 3VS6A 2DJQA 4QT7A 1UHCA 1CKAA 3FJ5A 3H0HA 1X6BA 1UE9A 2P4RA 4JZ4A 4CC2A 5IHNA 2KBTA 2CT3A 4EIKA 2OJ2A 1UECA 2RQRA 2JW4A 1OPKA 3TSZA 1AWOA 2KGTA 2RN8A 1RUWA 2FPDA 2DL5A 1K1ZA 2EYXA 2W10A 3M0UA 2V1QA 3UATA 2FRWA 2A08A 1GCQA 3EHRA 4Y92A 5IHKA 3RBBB 1KSWA 4D8DA 3VRZA 2NWMA 1WYXA 2EGAA 2A37A 1WXTA 2DYBA 2KT8A 3NPFA 3EG3A 2MCNA 1WI7A 1M3CA 1ABOA 4J9IA 1YNZA 2F2WA 2GGRA 2YSQA 3H41A 2YDLA 3M0RA 2O2OA 3VS5A 1WDXA 2D0NA 2L3PA 1TG0A 1SSHA 1I1JA 2EKHA 2K9GA 3I5SA 4RTTA 5FWCA 2ROLA 2AZVA 2LMJA 1UG1A 1Z9QA 2LJ3A 1VYVA 2LJ1A 1UGVA 4E6RA 1NLPC 2L3QA 2D8HA 5FWBA 1EFNA 1AD5A 1M8MA 1PWTA 2YUQA 1M27C 2K2MA 2E5KA 3KFVA 1QWEA 2EGCA 1K0SA 2VWFA 1BB9A 1H92A 4ORZA 3SEMA 2K79A 2AK5A 1U06A 1UUEA 1FMKA 2YUPA 5IXBA 2BTTA 3SHWA 1AVZC 1SHGA 3M0TA 2CH4W 2QDLA 1Y57A 2LCSA 2LQWA 1U3OA 2C0OA 5GJWB 2DL4A 2M0YA 3IQLA 1WLPB 4RUGA 4RTZA 1X2QA 1FYNA 3LH5A 4JZ3A 2BZXA 2K3BA 2J06A 2KE9A 1KIKA 1YN8A 2YT6A 1ABQA 4RTVA 2HBWA 2SRCA 2OAWA 1UTIA 2SEMA 4JJDA 2MOXA 1Z9ZA 3VS2A 3I9QA 1JO8A 2PNIA 1UFFA 2ED1A 4Z88A 1UDLA 2RQVA 2YUNA 4J9DA 1VYUA 4JPBW 1M30A 2BZYA 4J9FA 1B3QA 4AG1C 2OI3A 1ZSGA 1MV3A 4ZNXA 1VA7A 4HXJA 2LQNA 1VYTA 3C0CA 1RLQC 2K7AA 1BK2A 1E7OA 3VS1A 2O88A 2LNHB 4RTXA 4HVVA 3EG0A 2F2VA 2DNUA 3CQTA 5GJVB 1CSKA 3VS3A 2KT1A 2GBQA 2EGEA 2K6DA 2JM9A 1MUZA 4AFSC 1JU5C 2L0AA 1QKXA 1AZGB 1JQQA 3M0QA 4JJCA 1PKTA 3A98A 4RTUA 1ZUYA 1N5ZA 1KFZA 2KRNA 2ECZA 2GQIA 1PKSA 1T0HA 2M51A 1K9AA 2CSQA 1PHTA 3H0FA 5IHIA 4Z8AA 2J6FA 2DBKA 4A63B 1A0NB 1X43A 2DM1A 2VVKA 1SEMA 4LNPA 4FSSA 4IIOA 4GLMA 1QWFA 2EVRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2RPN A;  1NLO C;  1OPL A;  2DVJ A;  2DA9 A;  2LP5 A;  1PRL C;  2DRM A;  3TSW A;  1IO6 A;  2JXB A;  2O31 A;  2HEQ A;  1WIE A;  2KRM A;  4JJB A;  2JS2 A;  4ESR A;  4RTY A;  5I11 A;  2ED0 A;  2DBM A;  1NG2 A;  1AWX A;  1WX6 A;  1BU1 A;  1NM7 A;  3VS7 A;  4CC7 A;  1QCF A;  1X69 A;  1X27 A;  1JXM A;  1HJD A;  3REB B;  4OMM A;  1QKW A;  1RLP C;  3VS0 A;  1G2B A;  1HSQ A;  1X2K A;  4LN2 A;  1K0X A;  2LJ0 A;  2KNB B;  2ABL A;  1JEG A;  1K76 A;  2RNA A;  2PZ1 A;  1U5S A;  1T3L A;  2KYB A;  4J9H A;  1SRM A;  1XOV A;  2JTE A;  1SHF A;  4F16 A;  2A36 A;  3NGP A;  2CUB A;  2RF0 A;  2BZ8 A;  3EG2 A;  4GBQ A;  5FW9 A;  3I35 A;  2PTK A;  3NMZ C;  1SRL A;  1WA7 A;  3GBQ A;  2X3X D;  4OMP A;  4IIM A;  2EQI A;  4LE9 A;  3M0S A;  1T0J A;  2LZ6 B;  2DL7 A;  4AFU C;  3RNJ A;  3ZL7 C;  2FG0 A;  1ZUU A;  2KR3 A;  2J6K A;  1AOJ A;  1W70 A;  2DRK A;  4M4Z A;  4LUE A;  3O5Z A;  1HD3 A;  1NEG A;  1G83 A;  4DEY A;  1WXB A;  3QWY A;  5IH2 A;  2DF6 A;  1YWP A;  2IIM A;  2JMC A;  1ZUK A;  5IXF A;  2D8J A;  1X6G A;  3I5R A;  2D1X A;  2W0Z A;  3EG1 A;  2MIO A;  2KRO A;  1GBQ A;  4R0K A;  2KYM A;  4RTW A;  1QLY A;  1GFC A;  1UJY A;  2EYZ A;  4J9G A;  2F2X A;  2GNC A;  3U23 A;  4OMN A;  1BBZ A;  2HSP A;  1GCP A;  4D8K A;  4CC3 A;  2CSI A;  2HCK A;  4X1V A;  2AKK A;  1OEB A;  2JS0 A;  3EHQ A;  2FPF A;  4WCI A;  2EYY A;  3PVQ A;  1M3B A;  2G6F X;  1J3T A;  2DX1 A;  2AKL A;  2RQT A;  4K11 A;  3M0P A;  1UHF A;  3R6N A;  4J9E A;  5HCK A;  1ZX6 A;  3EGU A;  1NYG A;  1M3A A;  5ECA A;  2KXD A;  2EPD A;  2H8H A;  4CC4 B;  1GL5 A;  4Z89 A;  2HDA A;  4F14 A;  2EYW A;  2EW3 A;  1Y0M A;  2JT4 A;  1GBR A;  2DIL A;  4LUD A;  1E6H A;  4HCK A;  2JMA A;  2GTO A;  2RQU A;  2L3S A;  1PNJ A;  2CRE A;  2KRS A;  1LCK A;  3UA7 A;  2DLP A;  2L2P A;  2DL3 A;  3TVT A;  1WXU A;  2EBP A;  1W6X A;  4OML A;  2DMO A;  2FEI A;  2J05 A;  3NHN A;  1E6G A;  1OOT A;  2O9V A;  2J7I A;  4HVW A;  3PVL A;  1AWJ A;  1GCQ C;  2NUZ A;  2B86 A;  1W1F A;  2RMO A;  2KEA A;  2VKN A;  2FPE A;  2ROT A;  2DE0 X;  2DL8 A;  2A28 A;  1YWO A;  1AEY A;  2ENM A;  1SPK A;  2AZS A;  1UJ0 A;  1ZLM A;  2CDT A;  1K4U S;  1T3S A;  2KXC A;  4DEX A;  1ARK A;  4F17 A;  2ESW A;  1WFW A;  3JV3 A;  3REA B;  3THK A;  3PE0 A;  1H3H A;  1GFD A;  1OV3 A;  2I0N A;  1H8K A;  3VRY A;  1AWW A;  2YUO A;  4AFZ C;  1GRI A;  1NYF A;  3H0I A;  3QWX X;  4OMQ A;  1V1C A;  2GTJ A;  1PRM C;  2XMF A;  2C0T A;  1TUC A;  2X3W D;  4J9C A;  1NEB A;  5L23 A;  4OMO A;  4AFQ C;  2RQW A;  1S1N A;  2CT4 A;  1ZBJ A;  3ULR B;  2FRY A;  4KRT A;  4J9B A;  1I07 A;  2CUD A;  1TUD A;  2V1R A;  5EC7 A;  3UA6 A;  3UF4 A;  2FO0 A;  2JM8 A;  1AZE A;  2C0I A;  1YP5 A;  1KJW A;  1B07 A;  1I0C A;  1CKB A;  1JXO A;  1YCS B;  2O9S A;  5I22 A;  1MV0 B;  4AG2 C;  3VS4 A;  1RI9 A;  2J6O A;  2CH4 A;  2LX7 A;  4HVU A;  3VS6 A;  2DJQ A;  4QT7 A;  1UHC A;  1CKA A;  3FJ5 A;  3H0H A;  1X6B A;  1UE9 A;  2P4R A;  4JZ4 A;  4CC2 A;  5IHN A;  2KBT A;  2CT3 A;  4EIK A;  2OJ2 A;  1UEC A;  2RQR A;  2JW4 A;  1OPK A;  3TSZ A;  1AWO A;  2KGT A;  2RN8 A;  1RUW A;  2FPD A;  2DL5 A;  1K1Z A;  2EYX A;  2W10 A;  3M0U A;  2V1Q A;  3UAT A;  2FRW A;  2A08 A;  1GCQ A;  3EHR A;  4Y92 A;  5IHK A;  3RBB B;  1KSW A;  4D8D A;  3VRZ A;  2NWM A;  1WYX A;  2EGA A;  2A37 A;  1WXT A;  2DYB A;  2KT8 A;  3NPF A;  3EG3 A;  2MCN A;  1WI7 A;  1M3C A;  1ABO A;  4J9I A;  1YNZ A;  2F2W A;  2GGR A;  2YSQ A;  3H41 A;  2YDL A;  3M0R A;  2O2O A;  3VS5 A;  1WDX A;  2D0N A;  2L3P A;  1TG0 A;  1SSH A;  1I1J A;  2EKH A;  2K9G A;  3I5S A;  4RTT A;  5FWC A;  2ROL A;  2AZV A;  2LMJ A;  1UG1 A;  1Z9Q A;  2LJ3 A;  1VYV A;  2LJ1 A;  1UGV A;  4E6R A;  1NLP C;  2L3Q A;  2D8H A;  5FWB A;  1EFN A;  1AD5 A;  1M8M A;  1PWT A;  2YUQ A;  1M27 C;  2K2M A;  2E5K A;  3KFV A;  1QWE A;  2EGC A;  1K0S A;  2VWF A;  1BB9 A;  1H92 A;  4ORZ A;  3SEM A;  2K79 A;  2AK5 A;  1U06 A;  1UUE A;  1FMK A;  2YUP A;  5IXB A;  2BTT A;  3SHW A;  1AVZ C;  1SHG A;  3M0T A;  2CH4 W;  2QDL A;  1Y57 A;  2LCS A;  2LQW A;  1U3O A;  2C0O A;  5GJW B;  2DL4 A;  2M0Y A;  3IQL A;  1WLP B;  4RUG A;  4RTZ A;  1X2Q A;  1FYN A;  3LH5 A;  4JZ3 A;  2BZX A;  2K3B A;  2J06 A;  2KE9 A;  1KIK A;  1YN8 A;  2YT6 A;  1ABQ A;  4RTV A;  2HBW A;  2SRC A;  2OAW A;  1UTI A;  2SEM A;  4JJD A;  2MOX A;  1Z9Z A;  3VS2 A;  3I9Q A;  1JO8 A;  2PNI A;  1UFF A;  2ED1 A;  4Z88 A;  1UDL A;  2RQV A;  2YUN A;  4J9D A;  1VYU A;  4JPB W;  1M30 A;  2BZY A;  4J9F A;  1B3Q A;  4AG1 C;  2OI3 A;  1ZSG A;  1MV3 A;  4ZNX A;  1VA7 A;  4HXJ A;  2LQN A;  1VYT A;  3C0C A;  1RLQ C;  2K7A A;  1BK2 A;  1E7O A;  3VS1 A;  2O88 A;  2LNH B;  4RTX A;  4HVV A;  3EG0 A;  2F2V A;  2DNU A;  3CQT A;  5GJV B;  1CSK A;  3VS3 A;  2KT1 A;  2GBQ A;  2EGE A;  2K6D A;  2JM9 A;  1MUZ A;  4AFS C;  1JU5 C;  2L0A A;  1QKX A;  1AZG B;  1JQQ A;  3M0Q A;  4JJC A;  1PKT A;  3A98 A;  4RTU A;  1ZUY A;  1N5Z A;  1KFZ A;  2KRN A;  2ECZ A;  2GQI A;  1PKS A;  1T0H A;  2M51 A;  1K9A A;  2CSQ A;  1PHT A;  3H0F A;  5IHI A;  4Z8A A;  2J6F A;  2DBK A;  4A63 B;  1A0N B;  1X43 A;  2DM1 A;  2VVK A;  1SEM A;  4LNP A;  4FSS A;  4IIO A;  4GLM A;  1QWF A;  2EVR A; 
#chains in the Genus database with same CATH topology
 2FL7 A;  2QGG A;  4M7A F;  3FB9 A;  1M2V B;  1Q7Y U;  1BI1 A;  2DVJ A;  2LP5 A;  3EGX A;  3TSW A;  2O31 A;  3OW2 S;  2YXY A;  2EYQ A;  3A1P A;  4PJO D;  4RTY A;  4BI4 A;  2HMA A;  2DBM A;  1VQ4 A;  1NG2 A;  4M7A A;  3MEU A;  1NM7 A;  3VS7 A;  2LT4 A;  4CC7 A;  1VQ9 T;  4JJN K;  3QBY A;  4B6M A;  4JRQ A;  2Z0W A;  3REB B;  1QKW A;  1RLP C;  1XJW B;  3VS0 A;  1G2B A;  3BY7 A;  2OTJ A;  4EMK C;  1JEG A;  3BW1 A;  1Q95 G;  1U5S A;  2KYB A;  3OYJ A;  4J9H A;  1Q81 R;  1SHF A;  1U1T A;  3G4S T;  3OYD A;  3NGP A;  3CD6 Q;  2CUB A;  2RF0 A;  4KGZ B;  3OS1 A;  1RAE B;  4M77 E;  2QQS A;  4N4H A;  3S3O A;  1WA7 A;  1T0J A;  2CP5 A;  3ZL7 C;  1BI3 A;  1TWB A;  3SWN C;  1G8X A;  3FDR A;  3GP8 A;  4RKU E;  2J6K A;  4DQ2 A;  4LUE A;  1RAG B;  1D3B B;  2GF7 A;  3OB9 A;  2NYS A;  2PUO B;  5IXF A;  4C92 A;  4M75 E;  1GBQ A;  4LD9 K;  3G71 A;  5GAM d;  3M57 A;  4XAX B;  5FU7 C;  4RTW A;  5GAO p;  4MZT A;  1YJ9 T;  1UJY A;  1IXD A;  1YIJ Q;  1VQ5 Q;  1MNE A;  3CCU Q;  2F2X A;  4FW2 A;  1WZO A;  2AHJ B;  3QG1 A;  2CP6 A;  2HSP A;  4OB3 B;  3CXC P;  2JS0 A;  4WCI A;  4OMF B;  2E3H A;  3CCQ T;  1IHW A;  3UPU A;  1J3T A;  5KCH A;  3JCM J;  4E7Z A;  3PNW C;  4O6J A;  2E65 A;  4RCB A;  4K11 A;  1UHF A;  4M78 F;  1WHJ A;  3O8V A;  1PCX A;  3QII A;  5HCK A;  2DD4 A;  4ZGJ B;  3LYI A;  1NYG A;  1OYX A;  1ZA2 B;  1JB0 E;  4OB0 B;  1VQN A;  1N27 A;  3E2U A;  4F14 A;  1S72 Q;  1VQ8 Q;  1PSF A;  2MAM A;  1VQO T;  4JUV A;  3CME T;  1D1C A;  4BUG A;  3CC7 Q;  5LJ3 j;  2D9T A;  3PGG A;  1BIB A;  2K3X A;  1VQ7 Q;  2CRE A;  2KRS A;  4FU6 A;  3UA7 A;  1D0Z A;  1K9M C;  3TVT A;  3MO8 A;  5CAI A;  3NHN A;  1E6G A;  1JJ2 A;  2J7I A;  2JUF A;  2WSF E;  5KYX B;  1VQ7 T;  3M58 A;  1M2O A;  4FSX A;  1W1F A;  3NTI A;  2WSC E;  5HY6 A;  2KEA A;  2DL8 A;  2E6Z A;  1SKU B;  1YWO A;  1VQM A;  1KD1 U;  3E9F A;  4O5V A;  1UJ0 A;  5GAN e;  2H3J A;  1M90 R;  1K4U S;  1T3S A;  2KXC A;  1ARK A;  2QYZ A;  2LTO A;  5LJ5 d;  1WFW A;  3REA B;  2E41 A;  1FMV A;  3JCM V;  2P84 A;  4ZN3 A;  4C5E A;  2YWW A;  2E5Q A;  3CCL A;  4BY6 B;  3QWX X;  4FT2 A;  1W2B S;  1NPR A;  1TUC A;  3QZ9 B;  4AFQ C;  4IKF A;  3S3N A;  1OQK A;  2FRY A;  5M9O A;  3UA6 A;  3A8L B;  1OX9 A;  2EJ9 A;  4RG8 A;  2L3R A;  1CKB A;  5D7U A;  2MWO A;  4M78 D;  3OYK A;  4M75 D;  1ZBX A;  1MV0 B;  1I4K 1;  4AG2 C;  5J3B A;  2CH4 A;  2HL5 C;  2LX7 A;  4HVU A;  2JNG A;  5DM7 R;  1K8A U;  4QT7 A;  1CKA A;  3FJ5 A;  1VQM T;  4M7A G;  3H0H A;  1UE9 A;  1AT1 B;  3RUX A;  1V76 A;  4EMK B;  5I2S A;  1O75 A;  1W4S A;  3PMT A;  3MEA A;  1RAI B;  1Q7Y C;  2RQR A;  2JW4 A;  2QI2 A;  1YHQ Q;  4FT4 A;  3TSZ A;  2KGT A;  1RUW A;  2D6F A;  2V1Q A;  3C95 A;  3UAT A;  5D6W A;  3CCQ Q;  1QVG S;  4HT9 A;  3EFS A;  3LWH A;  4D8D A;  4EMK A;  1VQ6 A;  2BKD N;  4MDX A;  3H6Z A;  3G4S A;  2NUP A;  2KT8 A;  4KH1 B;  3EH2 A;  2HQX A;  4M78 E;  4M7D A;  1LNX A;  1YI2 A;  5FRM A;  4ME7 A;  2XDB A;  2KVQ G;  3X20 B;  4XQ3 A;  3MET A;  4PKC C;  1ZSZ A;  1I1J A;  1BI0 A;  1VQ8 A;  3OYH A;  2K9G A;  1YIT Q;  3QXE B;  5GAN h;  2VAS A;  1OX8 A;  2JZ2 A;  4OGC A;  2PVD B;  2LJ1 A;  2RI3 A;  3ZEH A;  2ZPF B;  1X6O A;  5FWB A;  1EFN A;  4CRI A;  1AD5 A;  4QQG A;  1IB8 A;  4XTX A;  2H3E B;  3ZBD A;  5KH6 A;  3OSS C;  6AT1 B;  3JCM e;  3FC3 A;  5A0D A;  4A4G A;  2VWF A;  4C5H A;  1I81 A;  4XTU A;  1Q7Y R;  1S72 T;  3UDC A;  2K79 A;  4ZGE B;  1OU9 A;  4PJN A;  1VQ6 T;  2BTT A;  3SHW A;  3OYL A;  4EMH A;  2QTV A;  4BI3 A;  5KYW A;  1PSE A;  2E12 A;  2LQ8 A;  3ER0 A;  2CH4 W;  3NTK A;  1Y57 A;  2LCS A;  2X4Y A;  3HP9 A;  3OYC A;  2C0O A;  2LCC A;  3BDL A;  3CPW P;  2F5T X;  4PK4 A;  2L8D A;  3LH5 A;  3F70 A;  4L59 A;  3RR6 A;  4JZ3 A;  2J06 A;  2KE9 A;  2MMP A;  2ZZD A;  4M7A D;  4QVD A;  4C8Q G;  2JVV A;  2LRQ A;  2P0K A;  4VUB A;  3OW2 P;  4RTV A;  1VQ9 A;  3JCM f;  4JJD A;  2Y4Y A;  1WPY A;  3VS2 A;  3I9Q A;  1YFN A;  2A7Y A;  1UFF A;  2DXC A;  2ED1 A;  1YHQ A;  1B34 A;  1WQ7 A;  2K2V A;  1YJN A;  3CMA T;  5J26 A;  2ZPE B;  4M7A B;  1RAH B;  5CQX A;  3CC7 T;  5LJ5 h;  3QYG B;  1MV3 A;  4ZNX A;  2QEX T;  2V8J A;  3DB4 A;  2O88 A;  4C0F A;  1CSK A;  3VS3 A;  1QVF S;  2XK0 A;  2EGE A;  2OTL T;  2HSE B;  2JM9 A;  4QQD A;  2C06 A;  1XQH A;  4JLG A;  1QKX A;  1AZG B;  3M0Q A;  4JJC A;  1VQP Q;  1PKT A;  3FLG A;  1HXD A;  2NUP B;  1K9M U;  1ZUY A;  1Q82 R;  2QQR A;  2VXE A;  1PKS A;  2M51 A;  2CSQ A;  1PHT A;  5DLQ E;  3CCJ Q;  4BB7 A;  1VQ5 T;  1SEM A;  5C6S A;  4MZP A;  1QWF A;  1KD1 C;  4LXC A;  3OYA A;  2E70 A;  1NLO C;  1QQJ A;  5GMK h;  1VQL A;  1OPL A;  4RMO A;  3DLL A;  4DBR A;  2Y90 A;  2JS2 A;  2XU8 A;  4ESR A;  1KG1 A;  2RJE A;  2F1L A;  2OTL Q;  2L89 A;  2CZ1 B;  1WX6 A;  3GPL A;  1C1A A;  1MHN A;  1HJD A;  3Q1J A;  2AIR B;  3CCS Q;  1VQ8 T;  1N9S A;  2FZC B;  2BIV A;  1YCY A;  1HSQ A;  1X2K A;  4LN2 A;  2CZ0 B;  4M75 B;  2OTJ T;  3I56 T;  1K9M R;  1NE8 A;  2CGH A;  4F16 A;  2K3Y A;  5FU7 B;  1VQ4 T;  2COW A;  3FEO A;  3I35 A;  1QCO A;  3CC2 Q;  3QHS A;  2AT1 B;  4KH0 B;  3BDU A;  1SRL A;  2QEX Q;  2BE9 B;  4C92 E;  2DTH A;  4OB2 B;  2RK2 A;  3CBO A;  2DL7 A;  1M4Z A;  3HSB A;  3CCE T;  3CC4 Q;  4M7D G;  2KR3 A;  2LT1 A;  5D6X A;  4R55 A;  2RJF A;  4M4Z A;  3JB9 I;  4E47 A;  1G83 A;  4DEY A;  4C92 G;  1YWP A;  2IIM A;  4ELY C;  2CP2 A;  1D1A A;  2WSE E;  3JB9 H;  1VOM A;  1X6G A;  5FU6 C;  5GAN 7;  5CVI A;  2D1X A;  1N8R U;  1MND A;  3EG1 A;  3JCM c;  2DXT A;  3AT1 B;  1JRI A;  2E1H A;  4PJO C;  1GXI E;  2ZPG B;  3CCL T;  2XDP A;  1QLY A;  4C8Q C;  2EYZ A;  1BIA A;  1FX7 A;  3CXC S;  3FIF A;  1YBY A;  2GNC A;  2DXU A;  3U23 A;  3CPW S;  3UWN A;  2LVM A;  1U1S A;  3OS2 A;  3CMA A;  2AKK A;  2X9H A;  5CKD A;  1M3B A;  4C0D C;  2DX1 A;  2FVU A;  4J9E A;  2QA4 Q;  3VUZ A;  1ZX6 A;  3M9Q A;  2KQW A;  2JTF A;  3EGU A;  1YJW A;  1M3A A;  4FCY A;  1M8V A;  2KXD A;  2EPD A;  2H8H A;  5KYU A;  1Y7X A;  4Z89 A;  2DEU A;  2EW3 A;  5A2Q E;  1Y0M A;  3CCJ A;  2JT4 A;  1GBR A;  1RAB B;  3JRZ A;  2K5I A;  4HCK A;  2GTO A;  2OTJ Q;  2CS7 A;  3C4S A;  4WTO B;  2LX9 A;  2GFU A;  4LDV A;  2L3S A;  3DB3 A;  2CYZ B;  1R77 A;  4IUT A;  2DL3 A;  3L2U A;  4MMK A;  1WXU A;  1G3Y A;  2FZK B;  3OYM A;  1RAD B;  2DMO A;  2FEI A;  2J05 A;  2JTM A;  5GAO l;  3G6E A;  1TXQ A;  4HVW A;  2GFA A;  5FLX E;  1PD0 A;  2CZ7 B;  2VC8 A;  4PJO F;  4M77 C;  4NOY A;  4JS5 A;  2VKN A;  1YIT T;  2ROT A;  3GLX A;  2DK3 A;  4WF2 A;  1AEY A;  2MI6 A;  2ENM A;  3MKD A;  5GMK i;  3KXT A;  3CCM Q;  2AZS A;  1ZLM A;  5AT1 B;  3CCS A;  1QP2 A;  3HFN A;  4F17 A;  1WHK A;  1H64 1;  4NL3 A;  1VIF A;  4M7D D;  3PE0 A;  3JCM g;  2MWP A;  4Q5W A;  3RKW A;  4FIB A;  2KSS A;  1GFD A;  4XU3 A;  1H8K A;  4J8O A;  3DKM A;  1AWW A;  2YUO A;  4RCC A;  1NJI U;  1KHI A;  4N4G A;  5CIU A;  2PU9 B;  2R58 A;  4QVC A;  1PRM C;  5LJ5 j;  2VGM A;  2X3W D;  1EZZ B;  4J9C A;  3EGD A;  3QDR B;  2EQJ A;  2RQW A;  1LJO A;  3SFM A;  2CT4 A;  4IUR A;  4C8Q E;  4J9B A;  4JS4 A;  2E64 A;  3UF4 A;  2C0I A;  1YP5 A;  1I0C A;  4BI8 B;  4N4I A;  1BI2 A;  2FYK A;  1G3S A;  1RI9 A;  3LWI A;  3RKX A;  4C92 D;  2DJZ A;  5L8R E;  3VS6 A;  4LDW A;  1YJW Q;  1X6B A;  2P4R A;  8ATC B;  5IHN A;  3URG A;  1WHL A;  5GAN 3;  4XU2 A;  3CD6 T;  1UEC A;  3H9N A;  3CCU A;  3JCM W;  1OPK A;  3TRE A;  2RJD A;  2GQV A;  4FYW B;  4E7L A;  1K1Z A;  5KYU B;  2ZAE A;  1GCQ A;  3C94 A;  4Y92 A;  2NWM A;  2EGA A;  2A37 A;  2DYB A;  4A4K A;  2MCN A;  2RM4 A;  3OW2 A;  3GNG A;  1VQK Q;  1M3C A;  2QA4 A;  5IAY A;  5CQY A;  1VQP T;  4HT8 A;  2YSQ A;  3H41 A;  1VQL Q;  1WDX A;  2DZ9 A;  3I56 Q;  4J83 A;  4EMG A;  3OY9 A;  4M77 B;  2EKH A;  5LJ5 e;  5KYX A;  3S3M A;  3JB9 D;  1OZ2 A;  4F7U G;  4PJO E;  1VYV A;  1UGV A;  3RER A;  1NLP C;  1R8O B;  2MPX C;  4LD6 A;  5LL6 S;  2HL3 A;  2K2M A;  3HKS A;  3G1J A;  1VQK T;  1I5O B;  3VV0 A;  5CK9 A;  5GAO m;  3CC4 T;  2EGC A;  1K0S A;  1H92 A;  4ORZ A;  5I21 A;  3X26 B;  1Y07 A;  1UUE A;  4XTW A;  2X35 A;  1MMN A;  1AVZ C;  4II1 A;  1SHG A;  2P0Q A;  4LDU A;  1N8R C;  3OBW A;  2QDL A;  2LQW A;  4A4H A;  2RHZ A;  5GJW B;  2ZGW A;  1VQ4 Q;  2F69 A;  2X4W A;  3WVE B;  3CBM A;  4RUG A;  4PFO A;  2PUK B;  4E7I A;  3CCR Q;  4RG2 A;  1PM3 A;  2YT6 A;  3QDF A;  1QMC A;  1ABQ A;  1ZA1 B;  1C6V X;  2XKO C;  3CCS T;  5LJ3 e;  2DAQ A;  2MOX A;  4JDS A;  4PLI A;  3M4Y A;  4C5I A;  1K73 R;  2LDM A;  1JO8 A;  1Q86 U;  2DXB A;  3HL8 A;  4Z88 A;  3MEW A;  1LOJ A;  1IRE B;  3L2V A;  4J9D A;  1VYU A;  1WHG A;  1M30 A;  4PFZ A;  2RHU A;  1UGP B;  3QYH B;  1YIJ A;  2RO0 A;  4HXJ A;  2LQN A;  1VYT A;  3C0C A;  2K7A A;  1BK2 A;  3M54 A;  5C0M A;  5AYF A;  2DEQ A;  3MP8 A;  4KBM B;  2DNU A;  2G3R A;  3EFO A;  2KT1 A;  3OYG A;  2HNI A;  1JQQ A;  3HHT B;  3A98 A;  2WAC A;  4RTU A;  1N8R R;  1N5Z A;  2A3L A;  4M77 F;  4A4F A;  2GQI A;  1LVK A;  1T0H A;  2RI5 A;  1X75 C;  2P4T A;  4Z8A A;  2EJF A;  2BUD A;  1PC0 A;  4KGX B;  1KQS A;  2K4Y A;  1X43 A;  2DM1 A;  4UC4 A;  2VVK A;  4IIO A;  4DOV A;  4GLM A;  3G71 T;  2KK4 A;  2RPN A;  3V7C A;  2RHX A;  1Q86 R;  4PFP A;  1YI2 Q;  1Q82 U;  3JCM h;  1PRL C;  1O9S A;  1WJR A;  2DRM A;  1IO6 A;  2JXB A;  3A8G B;  1TU0 B;  4JRK A;  4XTZ A;  5I2M A;  1M5Q 1;  1MGQ A;  2QA4 T;  1NJI C;  3L2W A;  2K57 A;  1YIT A;  3LW5 E;  5LJ3 g;  3VYH B;  1AWX A;  1BU1 A;  4BD3 A;  3TEE A;  2EQK A;  1VQM Q;  2OX7 A;  4M78 G;  1JBM A;  4OMM A;  2HAX A;  2L5Q A;  2LJ0 A;  3FJP A;  2ABL A;  2EJG A;  2M1H A;  1K76 A;  1HYO A;  1T3L A;  1SRM A;  2JTE A;  2VV5 A;  3J81 E;  2A36 A;  1UGR B;  4PL6 A;  3QKJ A;  2BZ8 A;  1YJN Q;  3EG2 A;  4GBQ A;  1M1K U;  1WJS A;  5KYW B;  3CCV T;  4N0A C;  4C8Q F;  3EGX B;  3PT9 A;  3GBQ A;  3CPW A;  2X3X D;  4IIM A;  5DLO A;  4OP0 A;  3OBY A;  2EQI A;  2ZPI B;  1EX4 A;  2ZPB B;  1YJN T;  4M7A E;  3RNJ A;  3M55 A;  2ZPH B;  4ZGD B;  2MK5 A;  3SB2 A;  3JCM X;  4FYV B;  3SWN B;  3JCM P;  4QW2 A;  1ZSZ B;  3O5Z A;  1NEG A;  1WXB A;  5D6Y A;  5IH2 A;  2JMC A;  5FRO A;  2D8J A;  3I5R A;  1WQW A;  3QPH A;  5GAN f;  1VIE A;  2JOY A;  2KRO A;  1QVF A;  3HRU A;  4KGV B;  2E4H A;  4R0K A;  4E7H A;  3VUB A;  1ACM B;  1QVG A;  1GFC A;  4L5G A;  2HZY A;  4QKU A;  3RKY A;  5KE2 A;  3JAM E;  1IGQ A;  2V26 A;  1PG5 B;  5GMK l;  4OMN A;  3GIB A;  4D8K A;  4CC3 A;  5FU6 B;  2CSI A;  4X1V A;  3HTR A;  4EDU A;  3EHQ A;  2HKN A;  1MMG A;  4BAC A;  2EYY A;  4NS5 A;  1M1K R;  3JB9 G;  4Z02 A;  2AKL A;  2KI7 A;  3OYN A;  3M0P A;  1VQP A;  2DIG A;  4C5G A;  4IUP A;  3PFS A;  2O4X A;  5EG2 A;  4X34 A;  2CZ6 B;  5ECA A;  5CR2 A;  1NBE B;  4CC4 B;  2HDA A;  2M02 A;  2EYW A;  5CCA A;  3E19 A;  3OS0 A;  3S6W A;  2DD5 A;  2DIL A;  4LUD A;  2XG8 D;  3OS5 A;  3NTH A;  2JMA A;  5IN1 A;  2RJC A;  2RQU A;  1LCK A;  2X4J A;  2L2P A;  4CI0 C;  1FWZ A;  2X51 A;  2EBP A;  1W6X A;  4YTL A;  4E7S A;  1OOT A;  2O9V A;  5LJ3 d;  5LJ3 h;  2M16 A;  4J6W A;  2NUZ A;  4IUV A;  3OYI A;  2B86 A;  2CKK A;  4C8Q D;  3PTA A;  2NLU A;  3JCM Q;  2FPE A;  2A28 A;  3R6O A;  2VXF A;  2CP7 A;  3L2R A;  4OB1 B;  1SPK A;  2LCL A;  1Q86 C;  1YJW T;  3C12 A;  4DBH A;  2DO3 A;  4DEX A;  5GAN 6;  1KK7 A;  3JV3 A;  1VUB A;  3THK A;  2R5A A;  1H3H A;  4C8Q A;  4ZN1 A;  4M78 C;  3V7S A;  2R57 A;  2YRD A;  3VRY A;  1M90 U;  1NZ9 A;  4AFZ C;  5GAM e;  4MDW A;  3G71 Q;  3H0I A;  1V1C A;  2GTJ A;  2XMF A;  4PNO A;  3OYB A;  5J39 A;  1NEB A;  3A8O B;  3P8B B;  3M53 A;  2RHI A;  3E1S A;  2O4X B;  4J5Y A;  1S1N A;  3RMQ A;  2QDY B;  3ULR B;  4ZTF A;  3M56 A;  5GAN 5;  4M77 G;  2FO0 A;  5CKB A;  3ZFJ A;  1KJW A;  3OYF A;  4KUD K;  1JXO A;  2XI9 A;  3PMI A;  2KY9 A;  2O9S A;  3PIO A;  3E9G A;  3VS4 A;  2VUB A;  2J6O A;  1TS9 A;  4GY5 A;  1MMA A;  3JCM d;  4M7D E;  2DJQ A;  1G3T A;  1VQ9 Q;  3CME Q;  3WXM B;  4R56 A;  4JZ4 A;  1D09 B;  2DFU A;  3KBG A;  3V8L A;  4EIK A;  2OJ2 A;  1KHC A;  1TUG B;  1K73 U;  1N6A A;  4MZM A;  1Q82 C;  1JJ2 S;  1SG5 A;  1AWO A;  2YHT A;  2RN8 A;  5KYN A;  2DL5 A;  2EYX A;  2FRW A;  5KE3 A;  4M75 C;  2A08 A;  5A0G A;  1Y96 A;  1Y96 B;  3EHR A;  4E7K A;  1KSW A;  4OVA A;  3LH0 A;  5DY9 A;  5HK3 A;  3QZ5 B;  1WXT A;  1G5V A;  3CCV A;  2M0O A;  2Y4X A;  1I5L A;  3L1A A;  2QXF A;  1ABO A;  1RI0 A;  1SF9 A;  1YNZ A;  4KUI A;  1OU8 A;  2F2W A;  2GGR A;  2YDL A;  1VQO A;  1VQN Q;  3VS5 A;  4QQ6 A;  5GAM h;  2L3P A;  1TG0 A;  5FRN A;  1SSH A;  1H3Z A;  3I5S A;  4RTT A;  4E7J A;  2VGN A;  1KQ2 A;  5FWC A;  1M1K C;  1QVG P;  2COZ A;  4C92 B;  2AZV A;  4FM4 B;  1B34 B;  1UG1 A;  1Z9Q A;  2LJ3 A;  4E6R A;  2D8H A;  2FZG B;  1PWT A;  2YUQ A;  4B9W A;  1ZHI A;  3CCL Q;  3LX7 A;  5GAN g;  2HQH A;  4M78 A;  2YRV A;  4M7A C;  2E5K A;  3J80 E;  4EPC A;  2NUT A;  2QQA A;  2V8K A;  1QWE A;  1KC8 U;  2K5F A;  1BB9 A;  4KT0 E;  3SEM A;  3CD6 A;  1U06 A;  2YUP A;  3OYE A;  2EAY A;  3RES A;  5A0L A;  1U3O A;  2LNV A;  4C8Q B;  2M0Y A;  3IQL A;  1WLP B;  2EKO A;  2EQU A;  1D1B A;  3RIR A;  1FYN A;  1WHH A;  2K3B A;  2DZC A;  3A8M B;  4B9X A;  1YN8 A;  3TU4 K;  4M75 G;  3JCM b;  1UTI A;  1W2B P;  4AT1 B;  2MYS A;  2ZCF B;  3CCE Q;  4FW1 A;  3MP6 A;  2PNI A;  1TH7 A;  1UDL A;  1M2V A;  2YUN A;  2BZY A;  5GAO q;  1B3Q A;  3MCA B;  5LJ5 f;  3JB9 J;  3CCJ T;  1ZSG A;  2DIQ A;  2O01 E;  3V8K A;  5GAN j;  3G7Z A;  3MPU B;  3QSU A;  2LNH B;  2M9U A;  2QK0 A;  3EG0 A;  1KQS S;  2F2V A;  1KC8 R;  3CQT A;  1UEB A;  2GBQ A;  2EQM A;  1VQO Q;  5HK0 A;  2RH2 A;  2QTX A;  3DLM A;  1MUZ A;  3CEY A;  5GAN d;  3L42 A;  2DYI A;  3OSV A;  2DTO A;  5GMK m;  1KFZ A;  4IUU A;  2KRN A;  4C0D B;  2ECZ A;  4F7U B;  1BKB A;  3CPF A;  1QP3 A;  3H0F A;  3A8H B;  5IHI A;  4C92 F;  3GOX A;  2J6F A;  1G3W A;  4BDY A;  3QJ6 A;  1A0N B;  3EGD B;  1WNL A;  2KMT A;  2QGF B;  4FSS A;  3HRT A;  4E2F B;  1F1B B;  2EFI A;  2B8A A;  2F5K A;  4F7U F;  2GCX A;  1YIJ T;  2V8I A;  4MML A;  5CKF A;  2X4X A;  2DA9 A;  1BYM A;  2RA2 A;  2HEQ A;  1WIE A;  4XU1 A;  2KRM A;  5IT9 E;  3G6E Q;  3CXC A;  4J7F A;  4JJB A;  1M90 C;  4M78 B;  1WGS A;  5I11 A;  3FRN A;  2ED0 A;  4BE2 A;  3INZ A;  3V8J A;  3CCM T;  4BY6 C;  3P8H A;  4XU0 A;  2IG0 A;  2JJ9 A;  1YHQ T;  1QCF A;  1X69 A;  1X27 A;  1JXM A;  2MF2 A;  3CCM A;  8AT1 B;  5GAN 2;  2DVE A;  3OA6 A;  3CC7 A;  1K0X A;  2KNB B;  4X9C A;  1VQ7 A;  2RNA A;  2PZ1 A;  3SD4 A;  1XOV A;  2DET A;  3EFO B;  5FW9 A;  2PTK A;  3NMZ C;  3A5Z B;  3BE3 A;  2HKQ B;  4J6Y A;  4JRP A;  3I55 T;  4L6V 5;  1TOV A;  4OMP A;  3TCJ A;  3CCU T;  1M9S A;  4LE9 A;  3M0S A;  2LZ6 B;  4AFU C;  3TQ7 P;  1QCN A;  2R5M A;  1SSF A;  2FG0 A;  1ZUU A;  2YLB A;  2FB7 A;  3M5A A;  4XTV A;  1K73 C;  4ATO A;  2D0Q B;  1AOJ A;  3JSC A;  5GAM f;  1W70 A;  1YJ9 A;  1IRX A;  2DRK A;  4DA4 A;  2VYT A;  4M77 A;  1HD3 A;  1W2B A;  3QWY A;  4C0G A;  2EIF A;  2DF6 A;  2YRC A;  4HKE A;  1ZUK A;  2QQB A;  1ZQ1 A;  2W0Z A;  2A0F B;  3P8D A;  2MIO A;  4HCB A;  1M1G A;  2JN0 A;  3RDV A;  3LGL A;  1X01 A;  2KYM A;  2IPO B;  4FL6 A;  4FYX B;  1VQL T;  3CBP A;  1KQ1 A;  2DKG A;  2PVG B;  1IGU A;  4J9G A;  4A53 A;  4BDZ A;  1BBZ A;  1GCP A;  3N5B B;  2HCK A;  3M59 A;  1OEB A;  2FPF A;  5GAO n;  3PVQ A;  2G6F X;  2PQW A;  3I55 A;  4PJL A;  2RQT A;  5KCO A;  3R6N A;  5CO7 A;  1OI1 A;  2OAU A;  2HBP A;  1EIF A;  1B7T A;  3I56 A;  3OMG A;  1GL5 A;  4Y91 A;  3D7S B;  3EFR A;  3GF5 A;  1KC8 C;  4M75 A;  4QVZ A;  4DBF A;  5KYY A;  1LPL A;  1TSF A;  1E6H A;  4XTY A;  3CC2 T;  2XDD A;  4BE0 A;  1PNJ A;  2YLC A;  3V7R A;  1VQ6 Q;  1U8R A;  2DLP A;  1Q81 C;  4M7D C;  4C0Z A;  4M7D F;  4OML A;  4M75 F;  3HFO A;  3PVL A;  1AWJ A;  1GCQ C;  4LDY A;  4X9D A;  1KQS P;  5LJ5 g;  2RMO A;  3CCR T;  3MHX A;  2LC4 A;  1DJ7 B;  3J7A F;  2DE0 X;  4XK8 E;  3CC4 A;  1UGQ B;  2NUT B;  1RL2 A;  2CP3 A;  2CDT A;  2RK1 A;  4J7I A;  1NJI R;  2ESW A;  3OYY A;  1WJQ A;  4J6X A;  4GLK A;  1JJ2 P;  4FYY B;  1OV3 A;  2I0N A;  1TTH B;  3RMS A;  1GRI A;  1NYF A;  4OMQ A;  4M77 D;  9ATC B;  1YI2 T;  2C0T A;  3CCE A;  4OGE A;  5L23 A;  4OMO A;  1K8A R;  1RAF B;  2DPP B;  2HD0 A;  2QG9 B;  2CP0 A;  3L2Q A;  4M7D B;  2HQE A;  4OF1 A;  2E6N A;  1MMD A;  4DOW A;  1ZBJ A;  3MP1 A;  4KRT A;  1I07 A;  2CUD A;  1TUD A;  2V1R A;  4HA8 A;  5EC7 A;  2JM8 A;  1AZE A;  2RD1 A;  1B07 A;  2EWN A;  1D3B A;  1UGS B;  3MJX A;  1YCS B;  2K5L A;  4PJO B;  5I22 A;  5KYY B;  5GAO r;  1XTD A;  2QQ9 A;  3L2Z A;  2XD0 A;  1R0C B;  4Y28 E;  3CCR A;  2XHC A;  4PJM A;  1UHC A;  4LDX A;  1XNI A;  4ANJ A;  4CC2 A;  5CKE A;  2KBT A;  2CT3 A;  3BFM A;  5GMK j;  1QVF P;  5LJ3 f;  1S72 A;  3QO3 A;  4HCC A;  3ME9 A;  1QVP A;  3G6E T;  1FMW A;  3T9N A;  2BE7 D;  2FPD A;  3GNF B;  3M0U A;  2W10 A;  1N9R A;  4A4E A;  3OMC A;  5GAN 4;  3MEV A;  3CMA Q;  3VU3 C;  1WHM A;  4F04 B;  5IHK A;  3RBB B;  3EH1 A;  3VRZ A;  3SWN A;  4F7U E;  2I2L A;  1WYX A;  3I55 Q;  3NPF A;  4C92 C;  3EG3 A;  2VB6 A;  1WI7 A;  3QUI A;  4J9I A;  3ASK A;  4KUL A;  1RAA B;  1BCO A;  3M0R A;  2O2O A;  1OZ3 A;  2D0N A;  4BE1 A;  3OQ5 A;  1AHJ B;  3AHU A;  3H8Z A;  1KD1 R;  2IVW A;  2ROL A;  1Y71 A;  2LMJ A;  1PD1 A;  2L3Q A;  4N0A A;  1P92 A;  1M8M A;  3KUF A;  1C0M A;  3NFC A;  3VJP A;  1M27 C;  4HCZ A;  2COY A;  1I8F A;  2DTI A;  4P5N A;  5GMK e;  3JB9 F;  3KFV A;  2KAF A;  1QW1 A;  2RI2 A;  1NPP A;  1HK9 A;  3PIP A;  2AK5 A;  4ZTJ A;  3X28 B;  3UT1 A;  1FMK A;  4A54 A;  5IXB A;  2LQK A;  3EG9 B;  3EG9 A;  3QJY A;  3M0T A;  3X24 B;  1OUL A;  1R0B G;  1VQN T;  1BCM A;  2OTL A;  5GAM g;  2DL4 A;  2QAS A;  2ATC B;  4PJO A;  3EAE A;  2E3I A;  4RTZ A;  1X2Q A;  2BZX A;  1KIK A;  2E10 A;  2P0P A;  3CME A;  2HBW A;  2RB6 A;  2SRC A;  2OAW A;  3VYG A;  1D0X A;  2DER A;  4V2S A;  2SEM A;  2XID A;  1Z9Z A;  4IUQ A;  3HRS A;  3M4G A;  4JRI A;  2PVO B;  2RQV A;  4PJJ A;  4JPB W;  4TVR A;  3WVD B;  3CC2 A;  4J9F A;  4AG1 C;  3CCQ A;  2QEX A;  1RAC B;  5GAN 8;  1M1F A;  2OI3 A;  4D6W A;  1VA7 A;  3G4S Q;  1IHV A;  2RHY A;  4AMC A;  1RLQ C;  3LLR A;  1E7O A;  3CCV Q;  3VS1 A;  3SDZ A;  4RTX A;  1ZSZ C;  1VQK A;  4HVV A;  1YJ9 Q;  5GJV B;  4F7U A;  2K6D A;  2FHD A;  4PLL A;  2KDS A;  4AFS C;  1JU5 C;  2L0A A;  3VKI A;  4PJO G;  5CKH A;  1Q81 U;  5GAM j;  4NL2 A;  3LGF A;  2XIC A;  4DBQ A;  1FXX A;  7AT1 B;  4JLI A;  1K9A A;  1IZ6 A;  5HKC A;  2QAZ A;  1UB4 A;  1VQ5 A;  1K8A C;  2DBK A;  4A63 B;  4ELZ C;  3X25 B;  4LNP A;  3HPW A;  1D0Y A;  1V29 B;  2EVR A; 
#chains in the Genus database with same CATH homology
 2RPN A;  1NLO C;  1OPL A;  2DVJ A;  2DA9 A;  2LP5 A;  1PRL C;  2DRM A;  3TSW A;  1IO6 A;  2JXB A;  2O31 A;  2HEQ A;  1WIE A;  2KRM A;  4JJB A;  2JS2 A;  4ESR A;  4RTY A;  5I11 A;  2ED0 A;  2DBM A;  1NG2 A;  1AWX A;  1WX6 A;  1BU1 A;  1NM7 A;  3VS7 A;  4CC7 A;  1QCF A;  1X69 A;  1X27 A;  1JXM A;  1HJD A;  3REB B;  4OMM A;  1QKW A;  1RLP C;  3VS0 A;  1G2B A;  1HSQ A;  1X2K A;  4LN2 A;  1K0X A;  2LJ0 A;  2KNB B;  2ABL A;  1JEG A;  1K76 A;  2RNA A;  2PZ1 A;  1U5S A;  1T3L A;  2KYB A;  4J9H A;  1SRM A;  1XOV A;  2JTE A;  1SHF A;  4F16 A;  2A36 A;  3NGP A;  2CUB A;  2RF0 A;  2BZ8 A;  3EG2 A;  4GBQ A;  5FW9 A;  3I35 A;  2PTK A;  3NMZ C;  1SRL A;  1WA7 A;  3GBQ A;  2X3X D;  4OMP A;  4IIM A;  2EQI A;  4LE9 A;  3M0S A;  1T0J A;  2LZ6 B;  2DL7 A;  4AFU C;  3RNJ A;  3ZL7 C;  2FG0 A;  1ZUU A;  2KR3 A;  2J6K A;  1AOJ A;  1W70 A;  2DRK A;  4M4Z A;  4LUE A;  3O5Z A;  1HD3 A;  1NEG A;  1G83 A;  4DEY A;  1WXB A;  3QWY A;  5IH2 A;  2DF6 A;  1YWP A;  2IIM A;  2JMC A;  1ZUK A;  5IXF A;  2D8J A;  1X6G A;  3I5R A;  2D1X A;  2W0Z A;  3EG1 A;  2MIO A;  2KRO A;  1GBQ A;  4R0K A;  2KYM A;  4RTW A;  1QLY A;  1GFC A;  1UJY A;  2EYZ A;  4J9G A;  2F2X A;  2GNC A;  3U23 A;  4OMN A;  1BBZ A;  2HSP A;  1GCP A;  4D8K A;  4CC3 A;  2CSI A;  2HCK A;  4X1V A;  2AKK A;  1OEB A;  2JS0 A;  3EHQ A;  2FPF A;  4WCI A;  2EYY A;  3PVQ A;  1M3B A;  2G6F X;  1J3T A;  2DX1 A;  2AKL A;  2RQT A;  4K11 A;  3M0P A;  1UHF A;  3R6N A;  4J9E A;  5HCK A;  1ZX6 A;  3EGU A;  1NYG A;  1M3A A;  5ECA A;  2KXD A;  2EPD A;  2H8H A;  4CC4 B;  1GL5 A;  4Z89 A;  2HDA A;  4F14 A;  2EYW A;  2EW3 A;  1Y0M A;  2JT4 A;  1GBR A;  2DIL A;  4LUD A;  1E6H A;  4HCK A;  2JMA A;  2GTO A;  2RQU A;  2L3S A;  1PNJ A;  2CRE A;  2KRS A;  1LCK A;  3UA7 A;  2DLP A;  2L2P A;  2DL3 A;  3TVT A;  1WXU A;  2EBP A;  1W6X A;  4OML A;  2DMO A;  2FEI A;  2J05 A;  3NHN A;  1E6G A;  1OOT A;  2O9V A;  2J7I A;  4HVW A;  3PVL A;  1AWJ A;  1GCQ C;  2NUZ A;  2B86 A;  1W1F A;  2RMO A;  2KEA A;  2VKN A;  2FPE A;  2ROT A;  2DE0 X;  2DL8 A;  2A28 A;  1YWO A;  1AEY A;  2ENM A;  1SPK A;  2AZS A;  1UJ0 A;  1ZLM A;  2CDT A;  1K4U S;  1T3S A;  2KXC A;  4DEX A;  1ARK A;  4F17 A;  2ESW A;  1WFW A;  3JV3 A;  3REA B;  3THK A;  3PE0 A;  1H3H A;  1GFD A;  1OV3 A;  2I0N A;  1H8K A;  3VRY A;  1AWW A;  2YUO A;  4AFZ C;  1GRI A;  1NYF A;  3H0I A;  3QWX X;  4OMQ A;  1V1C A;  2GTJ A;  1PRM C;  2XMF A;  2C0T A;  1TUC A;  2X3W D;  4J9C A;  1NEB A;  5L23 A;  4OMO A;  4AFQ C;  2RQW A;  1S1N A;  2CT4 A;  1ZBJ A;  3ULR B;  2FRY A;  4KRT A;  4J9B A;  1I07 A;  2CUD A;  1TUD A;  2V1R A;  5EC7 A;  3UA6 A;  3UF4 A;  2FO0 A;  2JM8 A;  1AZE A;  2C0I A;  1YP5 A;  1KJW A;  1B07 A;  1I0C A;  1CKB A;  1JXO A;  1YCS B;  2O9S A;  5I22 A;  1MV0 B;  4AG2 C;  3VS4 A;  1RI9 A;  2J6O A;  2CH4 A;  2LX7 A;  4HVU A;  3VS6 A;  2DJQ A;  4QT7 A;  1UHC A;  1CKA A;  3FJ5 A;  3H0H A;  1X6B A;  1UE9 A;  2P4R A;  4JZ4 A;  4CC2 A;  5IHN A;  2KBT A;  2CT3 A;  4EIK A;  2OJ2 A;  1UEC A;  2RQR A;  2JW4 A;  1OPK A;  3TSZ A;  1AWO A;  2KGT A;  2RN8 A;  1RUW A;  2FPD A;  2DL5 A;  1K1Z A;  2EYX A;  2W10 A;  3M0U A;  2V1Q A;  3UAT A;  2FRW A;  2A08 A;  1GCQ A;  3EHR A;  4Y92 A;  5IHK A;  3RBB B;  1KSW A;  4D8D A;  3VRZ A;  2NWM A;  1WYX A;  2EGA A;  2A37 A;  1WXT A;  2DYB A;  2KT8 A;  3NPF A;  3EG3 A;  2MCN A;  1WI7 A;  1M3C A;  1ABO A;  4J9I A;  1YNZ A;  2F2W A;  2GGR A;  2YSQ A;  3H41 A;  2YDL A;  3M0R A;  2O2O A;  3VS5 A;  1WDX A;  2D0N A;  2L3P A;  1TG0 A;  1SSH A;  1I1J A;  2EKH A;  2K9G A;  3I5S A;  4RTT A;  5FWC A;  2ROL A;  2AZV A;  2LMJ A;  1UG1 A;  1Z9Q A;  2LJ3 A;  1VYV A;  2LJ1 A;  1UGV A;  4E6R A;  1NLP C;  2L3Q A;  2D8H A;  5FWB A;  1EFN A;  1AD5 A;  1M8M A;  1PWT A;  2YUQ A;  1M27 C;  2K2M A;  2E5K A;  3KFV A;  1QWE A;  2EGC A;  1K0S A;  2VWF A;  1BB9 A;  1H92 A;  4ORZ A;  3SEM A;  2K79 A;  2AK5 A;  1U06 A;  1UUE A;  1FMK A;  2YUP A;  5IXB A;  2BTT A;  3SHW A;  1AVZ C;  1SHG A;  3M0T A;  2CH4 W;  2QDL A;  1Y57 A;  2LCS A;  2LQW A;  1U3O A;  2C0O A;  5GJW B;  2DL4 A;  2M0Y A;  3IQL A;  1WLP B;  4RUG A;  4RTZ A;  1X2Q A;  1FYN A;  3LH5 A;  4JZ3 A;  2BZX A;  2K3B A;  2J06 A;  2KE9 A;  1KIK A;  1YN8 A;  2YT6 A;  1ABQ A;  4RTV A;  2HBW A;  2SRC A;  2OAW A;  1UTI A;  2SEM A;  4JJD A;  2MOX A;  1Z9Z A;  3VS2 A;  3I9Q A;  1JO8 A;  2PNI A;  1UFF A;  2ED1 A;  4Z88 A;  1UDL A;  2RQV A;  2YUN A;  4J9D A;  1VYU A;  4JPB W;  1M30 A;  2BZY A;  4J9F A;  1B3Q A;  4AG1 C;  2OI3 A;  1ZSG A;  1MV3 A;  4ZNX A;  1VA7 A;  4HXJ A;  2LQN A;  1VYT A;  3C0C A;  1RLQ C;  2K7A A;  1BK2 A;  1E7O A;  3VS1 A;  2O88 A;  2LNH B;  4RTX A;  4HVV A;  3EG0 A;  2F2V A;  2DNU A;  3CQT A;  5GJV B;  1CSK A;  3VS3 A;  2KT1 A;  2GBQ A;  2EGE A;  2K6D A;  2JM9 A;  1MUZ A;  4AFS C;  1JU5 C;  2L0A A;  1QKX A;  1AZG B;  1JQQ A;  3M0Q A;  4JJC A;  1PKT A;  3A98 A;  4RTU A;  1ZUY A;  1N5Z A;  1KFZ A;  2KRN A;  2ECZ A;  2GQI A;  1PKS A;  1T0H A;  2M51 A;  1K9A A;  2CSQ A;  1PHT A;  3H0F A;  5IHI A;  4Z8A A;  2J6F A;  2DBK A;  4A63 B;  1A0N B;  1X43 A;  2DM1 A;  2VVK A;  1SEM A;  4LNP A;  4FSS A;  4IIO A;  4GLM A;  1QWF A;  2EVR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...