1N5ZA

Complex structure of pex13p sh3 domain with a peptide of pex14p
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
71
structure length
71
Chain Sequence
EPIDPSKLEFARALYDFVPENPEMEVALKKGDLMAILSKKDPLGRDSDWWKVRTKNGNIGYIPYNYIEIIK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Peroxisomal membrane protein PAS20
publication title Topography for Independent Binding of alpha-Helical and PPII-Helical Ligands to a Peroxisomal SH3 Domain
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Protein transport
total genus 13
structure length 71
sequence length 71
chains with identical sequence B
ec nomenclature
pdb deposition date 2002-11-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 1n5zA00
5GJWB 1G2BA 2K3BA 1GL5A 2FG0A 4HCKA 1CSKA 3VS1A 1ABQA 3SEMA 1SHGA 1PKSA 2DL7A 2EGCA 2IIMA 1RI9A 3C0CA 5FW9A 1GCQC 4RTWA 2KRMA 2V1RA 1VYTA 1M3BA 2EYZA 2L3QA 2RQTA 3R6NA 2VWFA 4ORZA 1Y57A 2EPDA 1K4US 1J3TA 3EGUA 1CKBA 2JMCA 3U23A 1UE9A 1SSHA 1PKTA 2HSPA 1HSQA 1JO8A 1Z9QA 2PNIA 2P4RA 3VS0A 3NPFA 4K11A 3PVQA 3H0HA 5EC7A 1YNZA 3A98A 2O9VA 1AWOA 3M0UA 2PZ1A 2DBMA 2FPFA 2FPDA 2KBTA 4OMOA 2ABLA 1GBRA 2FEIA 1UGVA 4CC4B 1QLYA 3I5SA 3TSWA 1E6HA 1UDLA 2EYYA 1WXTA 2DX1A 1ZUYA 4J9DA 5FWBA 4F17A 1I1JA 2RQWA 2DMOA 4F14A 2CUBA 5ECAA 1QKXA 4OMNA 3VS5A 2LX7A 1KSWA 1W70A 1X69A 2F2WA 2RMOA 2YSQA 4AFSC 2J05A 4J9CA 4JJDA 2HBWA 3H41A 2DJQA 4RTYA 2O31A 1M30A 1NYFA 2D1XA 4JZ3A 1B07A 2LZ6B 3I35A 2RN8A 2J7IA 2J6OA 2NWMA 1I0CA 1WLPB 1YWOA 4JPBW 1NEBA 1A0NB 1JEGA 2FO0A 1OPKA 1XOVA 5IHIA 1ZUKA 4HXJA 2YUPA 5FWCA 2JS0A 1UG1A 3REBB 1WI7A 1VYUA 4QT7A 1N5ZA 1KIKA 3RNJA 2OAWA 3TSZA 4RUGA 3PE0A 1UUEA 2F2XA 2GNCA 2K7AA 4AFQC 4IIOA 2K79A 2ROTA 3CQTA 4HVWA 2CH4A 2KXCA 3VS3A 1AZGB 2A28A 2O9SA 2DL8A 2DLPA 2DRMA 3I9QA 3VS2A 1Z9ZA 1NEGA 3VRZA 5IH2A 1U3OA 2JT4A 2KRNA 1TUDA 2JTEA 2CDTA 1QWFA 1NLPC 2D8HA 3H0FA 3VS7A 2F2VA 3REAB 4DEYA 2J6KA 3EHRA 1PWTA 2AZVA 2XMFA 2RQVA 1YWPA 1H3HA 1FMKA 1WDXA 2HDAA 2L2PA 1LCKA 4OMPA 1RUWA 4Z8AA 1K0SA 1JXMA 4CC3A 2C0IA 2FRYA 4M4ZA 1JU5C 2BZXA 2VKNA 4Z89A 1SRMA 2PTKA 2DA9A 2KXDA 1UJYA 3JV3A 2ED1A 2KT8A 1YN8A 1WFWA 3M0RA 1WXBA 2GTJA 1K0XA 4RTVA 3IQLA 2GGRA 2YUOA 1MV3A 2LJ1A 1PRLC 1HD3A 2M51A 2DL5A 2NUZA 2CSIA 1E7OA 2EW3A 2J6FA 2YDLA 2KNBB 1K1ZA 4A63B 2CT3A 1E6GA 4WCIA 4RTZA 2E5KA 2L3PA 2K6DA 1Y0MA 3EHQA 2HCKA 4IIMA 1T3LA 2D0NA 2DILA 2GQIA 2LCSA 2JMAA 2OJ2A 1SRLA 1AVZC 1W1FA 1AWJA 2EQIA 5IHKA 2AK5A 3VS4A 1QWEA 2EGEA 3LH5A 2KR3A 4J9FA 3QWYA 5IXFA 2AZSA 1WXUA 2OI3A 1AD5A 1GFDA 2DL3A 4X1VA 1RLQC 1AOJA 2W10A 2EYWA 2ROLA 4D8DA 1OOTA 2RF0A 3RBBB 3FJ5A 2DL4A 1X6BA 1X43A 4LN2A 2KYMA 2D8JA 1ZLMA 1TUCA 2RQRA 2LMJA 1K9AA 2KYBA 3ULRB 2EYXA 3M0QA 1WX6A 5GJVB 2LP5A 1UTIA 4JJBA 3O5ZA 1H8KA 3TVTA 5IXBA 1KFZA 1RLPC 2CREA 2ENMA 1K76A 2JM8A 4GLMA 1B3QA 1UHCA 1BBZA 2EGAA 2HEQA 2A08A 1U06A 1ZX6A 1CKAA 5IHNA 2RQUA 4ZNXA 4HVUA 3EG1A 4FSSA 1AEYA 2CH4W 1H92A 2KEAA 1SHFA 1ZBJA 1AZEA 1BB9A 2H8HA 2CT4A 1NG2A 2FPEA 1YP5A 4Z88A 1I07A 2KE9A 4J9EA 4E6RA 1ARKA 2GBQA 5L23A 2CSQA 5I11A 1VYVA 2O2OA 2B86A 2LQNA 3EG3A 4OMQA 4RTUA 2M0YA 2C0TA 1X2KA 4AFZC 3M0SA 1PHTA 4D8KA 1X2QA 1T0JA 1IO6A 4CC7A 2AKLA 1MUZA 2SRCA 2JW4A 1OPLA 2EBPA 1MV0B 2JM9A 2SEMA 1TG0A 2DRKA 3SHWA 1WYXA 2YT6A 4LE9A 4R0KA 4RTXA 2DYBA 1UECA 3EG0A 2CUDA 4ESRA 1EFNA 1ZUUA 2ESWA 2BZ8A 1NLOC 2KT1A 4J9BA 3VRYA 4HVVA 1GCQA 1QKWA 1NM7A 4F16A 1M8MA 3NMZC 2BZYA 2LJ3A 4JJCA 4LUEA 1V1CA 1W6XA 2ED0A 2K9GA 2VVKA 2JXBA 3NHNA 5HCKA 2MCNA 1HJDA 1GFCA 2DBKA 1G83A 2C0OA 3M0PA 4LNPA 3UA6A 4AG2C 1NYGA 4J9IA 2L0AA 2L3SA 4GBQA 4OMLA 1T0HA 1PRMC 1VA7A 1PNJA 1X6GA 1U5SA 4J9HA 1WA7A 2EKHA 1BK2A 2KROA 2DNUA 2I0NA 1ABOA 2MIOA 3UATA 1UJ0A 2DM1A 2W0ZA 2FRWA 3H0IA 3THKA 3GBQA 4OMMA 1WIEA 3UA7A 2O88A 3NGPA 2RNAA 1AWWA 2V1QA 1QCFA 2LQWA 4KRTA 4RTTA 1BU1A 1X27A 2DE0X 2QDLA 4J9GA 1AWXA 1OEBA 3PVLA 2KRSA 4JZ4A 3ZL7C 1OV3A 1UHFA 2X3XD 3UF4A 2ECZA 1M3CA 3M0TA 4AG1C 2AKKA 2A37A 2BTTA 4LUDA 2DF6A 1FYNA 2KGTA 1KJWA 1SPKA 1SEMA 2K2MA 2LJ0A 2RPNA 4Y92A 4AFUC 1M3AA 2MOXA 1GCPA 2YUNA 2G6FX 1YCSB 1JQQA 1JXOA 3I5RA 4EIKA 3VS6A 3EG2A 1M27C 2DVJA 1UFFA 2GTOA 2LNHB 1GBQA 3KFVA 5I22A 2J06A 2JS2A 1ZSGA 2X3WD 3QWXX 4DEXA 1S1NA 1GRIA 2EVRA 2YUQA 2A36A 1T3SA 4CC2A
chains in the Genus database with same CATH superfamily
5GJWB 1G2BA 1GL5A 2FG0A 5KYYA 3H8ZA 4KH1B 1RABB 1C1AA 4KH0B 4XK8E 1MNEA 1SHGA 4IUUA 3SDZA 2DL7A 2EGCA 1Q81R 3CC7T 3BFMA 5IT9E 2LDMA 4N0AA 1PG5B 3CC4Q 1Y57A 3BW1A 2EWNA 1VQNT 3U23A 5I2MA 1SSHA 2AIRB 1HSQA 3GLXA 2PNIA 5LJ5d 3SD4A 1VQKT 1RAGB 1KD1U 4FYYB 3VS0A 3HRSA 4KUDK 2NUTB 3PVQA 3H0HA 5EC7A 3CC2A 3A98A 3M0UA 4BDYA 5GANf 2KBTA 2X4YA 4OMOA 1YI2A 1GBRA 2QI2A 3JRZA 1AHJB 1D1BA 3G71Q 3CCLQ 2ZPHB 2O4XA 5A2QE 4DQ2A 2EJ9A 3TU4K 1JJ2S 3TEEA 4J6XA 5GANg 4F14A 1UB4A 2BE7D 1WHLA 1RAAB 2J05A 2M9UA 4J9CA 3H41A 2LQKA 5LJ3f 2O31A 4JJNK 1M30A 1NYFA 1B07A 2LZ6B 3SFMA 3L2RA 2DEQA 2FZGB 4XAXB 1I0CA 4JPBW 5GAMf 2DXUA 4NOYA 2FO0A 2NYSA 4C8QB 2RJDA 5A0DA 2XU8A 2CKKA 3MEAA 2CS7A 1WI7A 4QT7A 5LJ3g 1KIKA 3RNJA 4C92C 3VJPA 1UUEA 4AFQC 1C0MA 4PLIA 3OS1A 4JS5A 1M90R 3CQTA 5A0LA 5GAMg 4M7DF 3CEYA 4RG2A 2DL8A 3I9QA 4EMHA 4Z02A 2LQ8A 2KRNA 4QVZA 3R6OA 2QDYB 1QWFA 2FVUA 2COYA 2E41A 2QASA 1JRIA 2MPXC 3OA6A 1YWPA 5DM7R 4C5IA 1QP3A 1FMKA 2E10A 3C4SA 4M75B 2MK5A 3CCUT 2Y4XA 4OMPA 3LGFA 5GMKe 1K0SA 1JXMA 1M4ZA 2F1LA 2FRYA 1WPYA 3RERA 2KXDA 4X9CA 1UJYA 2M0OA 3GPLA 2EAYA 4PJJA 2H3EB 2MF2A 4XTXA 1Q86U 3ZFJA 4RG8A 5GANj 3IQLA 1RAEB 1Q7YR 3MPUB 2YUOA 4JRQA 3LX7A 3DLLA 2M51A 2RA2A 4DBFA 1Q95G 2NUZA 2CSIA 1VQ6Q 3OYFA 1Y07A 1QVFS 3OMCA 1O75A 2O4XB 2E5KA 2K5IA 3RESA 2L3PA 3CCUQ 2K6DA 3V7SA 1T3LA 4MMKA 2DILA 2GQIA 1YJ9A 2PUOB 2OJ2A 1OYXA 1SRLA 4BACA 2DIGA 3CCEA 1IHVA 3EG9A 3VS4A 2KR3A 5LJ3j 2FZKB 2DL3A 1YJNA 2KK4A 1EX4A 1RLQC 3CMEQ 4M7DG 3CCET 1OU8A 2RF0A 2EQKA 3RBBB 2PVGB 1KC8U 2XKOC 2D8JA 3JCMW 3ER0A 1K9MR 4LDVA 4CI0C 2LMJA 3M0QA 4BE1A 3ZEHA 1PCXA 2ZZDA 3RKWA 4QQGA 3CPWP 4ANJA 1VQOT 1RL2A 3EGDB 2HL5C 2OX7A 2E3IA 3NFCA 4WF2A 5FU6B 1BBZA 2EGAA 2HEQA 3LW5E 1LVKA 4C92B 4A4FA 4RMOA 2KEAA 2NUPA 1W2BS 4M7DD 2E6ZA 4Q5WA 3FRNA 3OYLA 2E70A 4Z88A 4QVCA 5D6WA 1VQ8A 4E6RA 2GQVA 3QJYA 3JCMe 4MDXA 1VUBA 5I11A 2E12A 4J5YA 3EG3A 3OYMA 2LQNA 1KQSS 3CCVQ 1X2KA 4D8KA 4XTVA 1T0JA 4PLLA 1IO6A 2OTJT 1QP2A 2AKLA 3CXCA 2JW4A 4AMCA 5KYXB 5CKDA 1MV0B 2DK3A 2ATCB 1RAIB 3L2UA 3AHUA 3OYCA 5A0GA 2EYQA 1LJOA 4FL6A 4XQ3A 2JNGA 3EG0A 4ESRA 1EFNA 3S6WA 2QYZA 4FT4A 3CBPA 4HVVA 5GMKm 3GF5A 3FEOA 1NM7A 3NMZC 2LJ3A 2CYZB 3X28B 4M78E 1V1CA 5CO7A 2K5LA 1VQ4Q 2K9GA 1D3BB 2IG0A 1UGPB 1Q81U 4OB0B 1HJDA 2VB6A 5KYUA 1QCNA 4GBQA 1NE8A 4PFPA 4EMKC 2HL3A 3EAEA 1P92A 4J9HA 1OQKA 1BK2A 4C5HA 2KROA 2DZ9A 1TH7A 4J7IA 2DM1A 3P8BB 2M1HA 3OMGA 3CMAT 4E7KA 2DD5A 3H0IA 5CKBA 4PJNA 2XI9A 3RR6A 3FB9A 5IN1A 2V1QA 2LQWA 4KRTA 4XTYA 2EKOA 1OULA 2QDLA 3G4SA 4PK4A 2KRSA 2D6FA 4PFOA 3JCMd 2CZ1B 3BDUA 3MEVA 5C6SA 3A1PA 3TCJA 4AG1C 2V26A 5CCAA 5CAIA 4LUDA 1G8XA 1FYNA 3QPHA 1SEMA 3EH2A 2RPNA 1WZOA 4IKFA 1YBYA 1WNLA 3KUFA 5FROA 3M5AA 1YCSB 1KQ1A 3G4ST 2QQBA 1IGUA 1JXOA 3I5RA 3VS6A 1NBEB 3EG2A 1M27C 1UFFA 2LNHB 2XIDA 3QZ9B 3JCMQ 2EQJA 3OYBA 2RJEA 1S1NA 3HL8A 5GAMh 3JCMX 3BDLA 4WTOB 3HSBA 2YUQA 2V8IA 3BY7A 1T3SA 3URGA 4M77F 4F7UA 1X6OA 1MGQA 4C8QE 2QQAA 3VS1A 4E7IA 1ABQA 2KY9A 2YXYA 3J81E 1K73U 1KK7A 2IIMA 1RI9A 2AHJB 1N9RA 1GCQC 3OYNA 2I2LA 5FRMA 1ZSZC 4RTWA 2V1RA 1M90U 2AT1B 2EYZA 3R6NA 3G6EQ 2EPDA 3A8HB 4FYWB 1PKTA 4PJOE 1Z9QA 1G3WA 2P4RA 3M59A 3CCMA 3VYHB 3I55Q 1KC8R 2DFUA 1ZSZA 2O9VA 4XU0A 1M2OA 1HK9A 1PD1A 2DO3A 2KI7A 3V7CA 2YWWA 3X26B 1YIJA 1UGVA 3GNFB 2QGGA 4MMLA 1VQPQ 3CCMT 1E6HA 2L5QA 3S3MA 1M2VB 1VQMQ 4J9DA 2D9TA 2O01E 4F17A 2CP2A 2P0QA 3A5ZB 2XK0A 3EFOA 3OYIA 2DMOA 3CBOA 4OMNA 1YIJT 1YITA 2LX7A 3V8LA 1O9SA 5IAYA 1KSWA 1W70A 2F2WA 2L89A 2RMOA 4LDWA 4EMKB 2DVEA 3CCSQ 2F69A 1S72T 1VQ7T 5L8RE 3CCQA 4KGVB 2DYIA 4RTYA 2JVVA 2D1XA 4JZ3A 3I35A 3OY9A 5D7UA 2NWMA 4LD6A 1NEBA 4ZN1A 8AT1B 1YITT 1JEGA 2CZ6B 3LLRA 4M77G 4IUQA 2VXEA 1ZUKA 1I5OB 3MEWA 4M7DA 3CCQT 4PJOC 2YUPA 5FWCA 1G3TA 2LVMA 2RD1A 4FYXB 1VYUA 2E65A 3L2QA 1N5ZA 1IREB 4RUGA 3PE0A 1S72Q 5KE3A 2K79A 3CC4A 5KE2A 4HVWA 2CH4A 1OX8A 4X9DA 4LDYA 3H6ZA 2DLPA 3CCRA 1YFNA 3RUXA 4PL6A 3GNGA 5HK3A 2V8JA 5LJ5f 2JT4A 4M78B 2P0PA 1TUDA 4F7UB 4N0AC 4N4IA 1QW1A 2K3YA 5GANe 2HKQB 2ZPIB 3VS7A 4LXCA 4M7AG 2F2VA 4DEYA 4NL3A 3RMQA 3JCMc 1RADB 1ZQ1A 5GAOn 2J6KA 3A8GB 3EHRA 4L6V5 1WDXA 2HDAA 3CCRT 1RUWA 4B9XA 2QEXA 1MMGA 4Z8AA 1VQLA 4M4ZA 5CVIA 4Z89A 1SRMA 2XDBA 3OBWA 1TXQA 3OB9A 2KT8A 2CGHA 3RDVA 3MP8A 4HCZA 1WXBA 2GTJA 1X75C 2PQWA 4RTVA 2LX9A 4C92E 2QEXT 1FWZA 2R5AA 2OTLQ 5LJ3e 1VQLT 3C94A 2DZCA 4M78F 5D6YA 3NTKA 2J6FA 2YDLA 3VUZA 5GMKl 1QVGA 1D09B 7AT1B 3CC7Q 2X4XA 4M7AD 3CC2T 2A0FB 1UEBA 3CPWA 1VQNQ 3V8JA 1AVZC 4MZTA 1W1FA 4A4EA 2ZPEB 5IHKA 5KH6A 4OB3B 3META 1YI2T 2EGEA 3LH5A 1VQKQ 1M8VA 3CCJA 4HT9A 2DD4A 4C0FA 3QWYA 1NJIC 3UPUA 1WXUA 1AD5A 2BKDN 5FLXE 2LT1A 2EYWA 2FYKA 2ROLA 3OW2A 3FLGA 4D8DA 5CKFA 4FT2A 2G3RA 3FJ5A 2E1HA 3CCJT 4ZGDB 3E19A 4OMFB 3TQ7P 1ZLMA 5GANd 3SB2A 3HKSA 5GMKi 3SWNC 1TUCA 2RQRA 3I56A 1K9AA 5CK9A 3ULRB 1WX6A 2LT4A 4CRIA 3M58A 4JJBA 3TVTA 5IXBA 1K73R 1RLPC 1VQ9A 1FMVA 2ENMA 4PJOB 4UC4A 3OYHA 1B3QA 3SWNA 1C6VX 2LRQA 4X34A 3I56T 1ZBXA 4IURA 4P5NA 3EG1A 1TTHB 4FSSA 4BB7A 1AEYA 3PFSA 2QA4A 1H92A 3HHTB 1SHFA 5KYYB 3H9NA 1AZEA 2H8HA 1VQ9T 4BD3A 3JB9J 3N5BB 5LJ3d 4A53A 2K5FA 3CPFA 4C8QF 3PGGA 4J9EA 2GBQA 1U1SA 2DERA 4E7JA 2QA4T 5DY9A 2X51A 2DETA 4BI8B 2RHIA 2C0TA 1JBMA 1PHTA 4N4GA 1I81A 1QVPA 1UGSB 2SRCA 4OB1B 2YLCA 3OQ5A 2JM9A 1MMNA 1WYXA 2YT6A 5GAN5 4R0KA 4F04B 3EGXA 2YLBA 4A4KA 2ESWA 2BZ8A 2Y4YA 2KT1A 4J9BA 4ZTJA 2R5MA 2HMAA 2XD0A 1SSFA 1BKBA 1QKWA 1D0YA 4HA8A 2LCCA 4M75F 2BZYA 4LUEA 5I21A 1OU9A 2ED0A 1PM3A 2VVKA 1XJWB 3PTAA 1R77A 5HCKA 2ZCFB 2FL7A 1G83A 3FIFA 3M0PA 3UA6A 4DA4A 4J9IA 2L3SA 3CD6A 4OMLA 1T0HA 5CKEA 1PRMC 4IUPA 1VA7A 2XG8D 1PNJA 1YJ9T 4DOVA 1JB0E 5GAMj 1WA7A 4BY6C 2DXBA 4B6MA 5GAN4 3CXCS 1M5Q1 4HT8A 2W0ZA 2PVDB 2WSCE 2RO0A 4IUVA 1YJNT 3CD6T 1HXDA 2O88A 1QVGP 4ZN3A 1N8RC 2HQEA 4C8QG 4JLGA 2RNAA 2VASA 3HP9A 1AWWA 1QCFA 2DTOA 1BU1A 3PIOA 3PMIA 4J9GA 1PSEA 3PVLA 2BUDA 3ZL7C 3SWNB 1UHFA 3UF4A 1M3CA 3QSUA 3CCVA 1EIFA 1FMWA 2A37A 1WQ7A 3WVEB 3CCEQ 4HCCA 1FX7A 1D1AA 2RJCA 2LJ0A 1BCOA 1BIAA 1M1KC 3D7SB 4C5GA 4B9WA 2FB7A 3C95A 3OW2P 4BDZA 1YJNQ 2GCXA 4M77A 3FDRA 1BYMA 1GBQA 3P8HA 1KHCA 1QVFA 1K8AC 3QUIA 3JB9F 3JB9I 1KHIA 2XICA 4RKUE 4DEXA 1M9SA 2DPPB 2LTOA 1VQOQ 1NJIR 1GRIA 2EVRA 1B34A 5KYNA 1R0CB 4M75G 2A36A 4JS4A 4CC2A 4M7AC 4E47A 2K3BA 2CP3A 3GP8A 4HCKA 3AT1B 1CSKA 1VQ8T 1PKSA 1TU0B 3X24B 5GAOr 3A8MB 2COZA 5FW9A 1Y71A 3EGXB 2KRMA 3OYEA 4C92F 1VYTA 4ORZA 3RMSA 4M7AA 1PSFA 2CP5A 1UE9A 2D0QB 3LH0A 2ZGWA 2HD0A 2HSPA 2K4YA 5LJ5h 3NPFA 2XDPA 4D6WA 3M57A 4K11A 4OVAA 1LNXA 3EG9B 2DKGA 2EQUA 2WSEE 1QQJA 3QYHB 2DBMA 4F7UE 3QG1A 2OTJQ 5DLQE 1XNIA 4E7LA 3LYIA 4CC4B 3TSWA 3V7RA 1JJ2P 6AT1B 4M75D 3JCMf 2DX1A 1ZUYA 5FWBA 1I1JA 3A8LB 3DLMA 2JUFA 2RQWA 3L42A 1AT1B 2CUBA 3MP1A 5ECAA 1QKXA 1VQ5A 1W2BA 1X69A 2MI6A 2HBWA 1YHQA 4MDWA 1MMDA 3OYGA 2HBPA 3JCMg 2E3HA 2JTMA 3JB9G 1WQWA 2JTFA 2RN8A 2J7IA 2J6OA 1YWOA 4OGEA 1SG5A 1VQ5T 1A0NB 2QTXA 2ZPBB 2GFAA 2F5KA 2E6NA 3JCMJ 1KG1A 1RACB 1KQSA 4E2FB 5FU7C 1TWBA 4HXJA 1RI0A 3EFRA 1YHQT 2NUPB 3BE3A 1YJWA 3L1AA 3REBB 4ZGEB 1WJRA 4KBMB 2CP0A 3CMAQ 4C92G 3TSZA 4A4GA 2GNCA 2K7AA 3A8OB 3G6EA 2ROTA 3E1SA 1PD0A 3QDFA 5AT1B 3GOXA 1AZGB 1IXDA 2O9SA 1IHWA 2KAFA 2DRMA 5KCOA 1Z9ZA 1NEGA 1YJWT 5IH2A 3CBMA 8ATCB 3FC3A 2JTEA 2CDTA 3LWHA 2D8HA 1QMCA 2E4HA 5FRNA 4M7DE 3MKDA 1PWTA 2AZVA 1H3HA 4C0ZA 2L2PA 1LCKA 5HY6A 1VQPA 4HCBA 3G4SQ 1TS9A 1Y96A 1Q82C 2M16A 3LGLA 3HFNA 2PTKA 2DA9A 2RK1A 9ATCB 3JV3A 1BI3A 1N8RR 2ED1A 3QZ5B 4J7FA 1YN8A 4DBRA 1WFWA 2QGFB 1K0XA 2GGRA 3CCSA 1QVFP 1HD3A 2QQ9A 3X20B 2DL5A 4XTZA 1D0ZA 1E7OA 2EW3A 5M9OA 1F1BB 3ZBDA 2YRCA 1M1GA 2IVWA 3P8DA 2KNBB 5KYUB 1IZ6A 4A63B 2CT3A 5GAN6 4WCIA 2R58A 4RTZA 2EJGA 1M1KR 4ELYC 1Y0MA 4MZMA 3EHQA 2HCKA 4IIMA 3T9NA 1I8FA 2LCSA 2JMAA 1N27A 4ATOA 4O6JA 3OS0A 2AK5A 3OYDA 1K8AR 4JUVA 4PKCC 3KBGA 2F5TX 1Y7XA 4J9FA 5IXFA 2AZSA 2OI3A 3MHXA 2OAUA 4X1VA 5HKCA 5EG2A 4M7DC 2HSEB 2B8AA 1NPPA 2BIVA 3G7ZA 2W10A 1WGSA 1B7TA 4C5EA 3Q1JA 2CZ7B 4QVDA 1X43A 3UDCA 3CCMQ 4KGZB 3WXMB 1FXXA 1LPLA 2P0KA 4NL2A 1OZ2A 4QW2A 1VOMA 4VUBA 3MJXA 1YIJQ 1G5VA 1KFZA 1Q7YC 1ZA1B 1X01A 5KYWA 1VQ7Q 5FU7B 1R0BG 3OYJA 5LL6S 1UHCA 4NS5A 5GMKh 1W2BP 4C8QA 2A08A 1U06A 2JOYA 2HZYA 3WVDB 3X25B 1ACMB 4ZNXA 5J39A 1YCYA 1H641 1MNDA 1YITQ 3HFOA 3MP6A 4EPCA 1RAHB 3JCMP 1BB9A 4BI4A 2LCLA 3HRTA 2CT4A 2K2VA 2WACA 1NG2A 1G3SA 3CC4T 4J6WA 3CCQQ 4JRKA 1ARKA 2RHXA 1KQSP 3G71A 3CCLA 3KXTA 3MEUA 4M77D 5LJ5g 1VYVA 2O2OA 2B86A 2VXFA 4FU6A 2K3XA 4RTUA 2ZAEA 4AFZC 1G3YA 1R8OB 2R57A 1ZSZB 1VQKA 5CR2A 4QQ6A 1OPLA 2EBPA 3M56A 2VUBA 3OYAA 1BI2A 2CZ0B 2DRKA 2QQSA 3G71T 3CCLT 2MAMA 2M02A 2LNVA 4M75A 4LE9A 1K9MC 3JCMV 4F7UF 2OTLT 1UECA 2PVOB 2CUDA 4ELZC 5GAMe 3CCRQ 1NJIU 2HQHA 4LD9K 1EZZB 5GAOm 2COWA 4R56A 3EFOB 2RK2A 1PC0A 1VIFA 4ZTFA 1W6XA 2LC4A 3VUBA 3L2ZA 3OBYA 4E7SA 2Z0WA 1GFCA 2DBKA 2C0OA 1BI0A 3FJPA 1KD1C 1ZA2B 4AG2C 2QEXQ 3M55A 2QTVA 4HKEA 1VQLQ 1X6GA 3M53A 3PMTA 2X4JA 2EKHA 1OX9A 1U1TA 2VC8A 1ABOA 2MIOA 2P4TA 3EFSA 4M7DB 3ASKA 2FRWA 3GIBA 3CC2Q 3THKA 2YRDA 3GBQA 5C0MA 4OMMA 1Q82R 2XHCA 1WIEA 1GXIE 4XU3A 4JRIA 4A54A 1YI2Q 5KYWB 4LDXA 4YTLA 2E5QA 5DLOA 2FHDA 1AWXA 4JZ4A 2HNIA 1KQ2A 2RJFA 3JCMh 2X3XD 4FSXA 4RCBA 5LJ5j 2X4WA 5CQYA 2BTTA 3PT9A 4KULA 2KGTA 1SKUB 3DKMA 5FU6C 1SPKA 2K2MA 2KQWA 4Y92A 1GCPA 2G6FX 3CCJQ 1H3ZA 5I2SA 2VYTA 1VQ6A 1JQQA 4M78G 3J80E 4F7UG 3EGDA 1MMAA 2GTOA 4ZGJB 5I22A 4FW2A 5GAOq 3CCUA 1ZSGA 2X3WD 5GAMd 1XTDA 2YHTA 1LOJA 4PFZA 4MZPA 4A4HA 4C92A 3OS2A 2C06A 1VQ6T 1JJ2A 3I56Q 3UWNA 4PJOF 4J8OA 3SEMA 3C0CA 2MMPA 1VQ9Q 1M3BA 2L3QA 2RQTA 2VWFA 4Y28E 3CMEA 3QYGB 4M77E 1K4US 1J3TA 3EGUA 1CKBA 2JMCA 2PU9B 4C0GA 4TVRA 1JO8A 2ZPFB 3PIPA 4OF1A 3UT1A 5GAN7 1BI1A 4OB2B 3J7AF 2QA4Q 2GFUA 3DB3A 1YNZA 4M78D 1AWOA 5KYXA 2PZ1A 3CMET 2FPFA 2FPDA 2ABLA 2FEIA 2QQRA 1QLYA 2IPOB 3I5SA 1Q86C 4R55A 2RB6A 2GF7A 1UDLA 2EYYA 1WXTA 4M7AE 1N8RU 4IUTA 4FCYA 4BUGA 2EJFA 4JLIA 2MYSA 2DXTA 1OI1A 3HPWA 4JDSA 4O5VA 3VS5A 4AFSC 2YSQA 2H3JA 1D3BA 4XU1A 4JJDA 2V8KA 3NTHA 2DJQA 4PNOA 1HYOA 1M1KU 1TUGB 2L8DA 1WLPB 1VQOA 2X35A 2RM4A 1OPKA 2RHZA 4M77C 1XOVA 5CIUA 3QBYA 4FW1A 5IHIA 1YJ9Q 1N9SA 2EFIA 1WHMA 1UGRB 1K8AU 5AYFA 2JS0A 1UG1A 4PJOG 2HQXA 3PNWC 2DJZA 4E7ZA 4OP0A 4II1A 2OAWA 4AT1B 1W4SA 1KC8C 2F2XA 2JJ9A 1NZ9A 4IIOA 3E9FA 1D1CA 3CD6Q 4OGCA 1DJ7B 2KXCA 3CCVT 3VS3A 2A28A 3OYYA 2VGNA 3VS2A 4DBHA 3VRZA 1U3OA 4ME7A 3M4YA 1KD1R 1NLPC 5GAN2 3H0FA 3OSVA 3REAB 2QK0A 4C8QD 1UGQB 3M54A 4C0DC 1VQ4A 4KT0E 2XMFA 2RQVA 2OTJA 4PJLA 3MCAB 2JN0A 2YRVA 1WHGA 2BE9B 2DTIA 4CC3A 2EIFA 3JSCA 4RCCA 2C0IA 1JU5C 2BZXA 2VKNA 2KSSA 4PJOD 4XTUA 1VQ4T 2DTHA 1WJSA 3M0RA 3C12A 3S3OA 2CP7A 4L59A 1MV3A 2LJ1A 1PRLC 1N6AA 1MHNA 1D0XA 2P84A 1I4K1 3QKJA 1K1ZA 4QQDA 5KCHA 1VQ8Q 2RI2A 1E6GA 2RI3A 2VGMA 4Y91A 4DOWA 5GAOl 2DEUA 5J26A 5GMKj 1IGQA 3QHSA 2RH2A 2E64A 4QKUA 2D0NA 2RHUA 1IRXA 1AWJA 2EQIA 4PJMA 1QWEA 5GAN3 4BE0A 3HTRA 1TSFA 3CMAA 1GFDA 1BCMA 1AOJA 4BY6B 2DXCA 3S3NA 1M2VA 1OOTA 3NTIA 2DL4A 1X6BA 1Q81C 4DBQA 4LN2A 2KYMA 2L3RA 5CQXA 3ME9A 5GANh 4V2SA 4EMKA 2KYBA 4EDUA 2EYXA 5GJVB 4J6YA 2LP5A 2A3LA 4FM4B 1UTIA 3O5ZA 1H8KA 4M77B 4LDUA 2Y90A 5HK0A 1ZHIA 5CKHA 2CREA 3E9GA 2KMTA 1K76A 2JM8A 4GLMA 5D6XA 1WHKA 1RAFB 1OZ3A 1ZX6A 1M1FA 1CKAA 1B34B 5IHNA 2RQUA 4HVUA 4JRPA 2CH4W 1VQ5Q 3INZA 3I55A 1Q86R 3HRUA 1ZBJA 1Q82U 4L5GA 4M78C 2FPEA 3G6ET 1YP5A 3O8VA 4KUIA 1YHQQ 3OYKA 3JB9D 2HKNA 5LJ3h 1I07A 2KE9A 5GAOp 2FZCB 5L23A 2KVQG 1TOVA 4M7AB 1WHJA 2CSQA 1V29B 1VQMA 3I55T 3QJ6A 3E2UA 4C0DB 4OMQA 5J3BA 4M78A 2M0YA 2RI5A 3JCMb 3M0SA 3VU3C 1X2QA 1YJWQ 4CC7A 1SF9A 1MUZA 4C92D 2SEMA 1VQPT 1TG0A 4E7HA 2QXFA 3SHWA 1VQMT 3JB9H 1U8RA 4RTXA 1IB8A 2DYBA 2MWOA 2VV5A 3QDRB 4FIBA 1ZUUA 1K73C 4XU2A 1NLOC 3VRYA 2PUKB 1GCQA 3CCST 3L2VA 1M90C 4F16A 1M8MA 4JJCA 2HAXA 2NUTA 1NPRA 4M7AF 2DIQA 2JXBA 3NHNA 4FYVB 2KDSA 2EQMA 2MCNA 3QIIA 4LNPA 1VQ7A 1S72A 1NYGA 2L0AA 3VYGA 2QG9B 4M75E 2RHYA 3CXCP 4XTWA 1U5SA 2A7YA 4J83A 5LJ5e 3OSSC 1I5LA 3JAME 2DNUA 2I0NA 3VV0A 3UATA 4GY5A 1Q7YU 1UJ0A 3RKYA 2X9HA 3G1JA 1BIBA 3L2WA 3F70A 4N4HA 3UA7A 1WJQA 4C8QC 4BE2A 3NGPA 2ZPGB 3VKIA 4RTTA 1X27A 2DE0X 2NLUA 1QVGS 1OEBA 2DAQA 1OV3A 3V8KA 2ECZA 4EMGA 1WHHA 3M0TA 3CPWS 2AKKA 3LWIA 2XDDA 2DF6A 1KJWA 2WSFE 3M4GA 2K57A 1VIEA 1V76A 4AFUC 2QAZA 1M3AA 2MOXA 3TREA 2YUNA 5GAN8 3EH1A 2MWPA 2OTLA 2CP6A 4EIKA 3MO8A 3RIRA 2DVJA 3KFVA 2J06A 3M9QA 4PJOA 3OW2S 1Y96B 3RKXA 1QCOA 2JS2A 3DB4A 3QO3A 3QWXX 3QXEB 4KGXB 3CC7A 1XQHA 4GLKA 4M75C 2JZ2A 1K9MU 3OS5A 1VQNA 4BI3A
chains in the Genus database with same CATH topology
5GJWB 1G2BA 2K3BA 1GL5A 2FG0A 4HCKA 1CSKA 3VS1A 1ABQA 3SEMA 1SHGA 1PKSA 2DL7A 2EGCA 2IIMA 1RI9A 3C0CA 5FW9A 1GCQC 4RTWA 2KRMA 2V1RA 1VYTA 1M3BA 2EYZA 2L3QA 2RQTA 3R6NA 2VWFA 4ORZA 1Y57A 2EPDA 1K4US 1J3TA 3EGUA 1CKBA 2JMCA 3U23A 1UE9A 1SSHA 1PKTA 2HSPA 1HSQA 1JO8A 1Z9QA 2PNIA 2P4RA 3VS0A 3NPFA 4K11A 3PVQA 3H0HA 5EC7A 1YNZA 3A98A 2O9VA 1AWOA 3M0UA 2PZ1A 2DBMA 2FPFA 2FPDA 2KBTA 4OMOA 2ABLA 1GBRA 2FEIA 1UGVA 4CC4B 1QLYA 3I5SA 3TSWA 1E6HA 1UDLA 2EYYA 1WXTA 2DX1A 1ZUYA 4J9DA 5FWBA 4F17A 1I1JA 2RQWA 2DMOA 4F14A 2CUBA 5ECAA 1QKXA 4OMNA 3VS5A 2LX7A 1KSWA 1W70A 1X69A 2F2WA 2RMOA 2YSQA 4AFSC 2J05A 4J9CA 4JJDA 2HBWA 3H41A 2DJQA 4RTYA 2O31A 1M30A 1NYFA 2D1XA 4JZ3A 1B07A 2LZ6B 3I35A 2RN8A 2J7IA 2J6OA 2NWMA 1I0CA 1WLPB 1YWOA 4JPBW 1NEBA 1A0NB 1JEGA 2FO0A 1OPKA 1XOVA 5IHIA 1ZUKA 4HXJA 2YUPA 5FWCA 2JS0A 1UG1A 3REBB 1WI7A 1VYUA 4QT7A 1N5ZA 1KIKA 3RNJA 2OAWA 3TSZA 4RUGA 3PE0A 1UUEA 2F2XA 2GNCA 2K7AA 4AFQC 4IIOA 2K79A 2ROTA 3CQTA 4HVWA 2CH4A 2KXCA 3VS3A 1AZGB 2A28A 2O9SA 2DL8A 2DLPA 2DRMA 3I9QA 3VS2A 1Z9ZA 1NEGA 3VRZA 5IH2A 1U3OA 2JT4A 2KRNA 1TUDA 2JTEA 2CDTA 1QWFA 1NLPC 2D8HA 3H0FA 3VS7A 2F2VA 3REAB 4DEYA 2J6KA 3EHRA 1PWTA 2AZVA 2XMFA 2RQVA 1YWPA 1H3HA 1FMKA 1WDXA 2HDAA 2L2PA 1LCKA 4OMPA 1RUWA 4Z8AA 1K0SA 1JXMA 4CC3A 2C0IA 2FRYA 4M4ZA 1JU5C 2BZXA 2VKNA 4Z89A 1SRMA 2PTKA 2DA9A 2KXDA 1UJYA 3JV3A 2ED1A 2KT8A 1YN8A 1WFWA 3M0RA 1WXBA 2GTJA 1K0XA 4RTVA 3IQLA 2GGRA 2YUOA 1MV3A 2LJ1A 1PRLC 1HD3A 2M51A 2DL5A 2NUZA 2CSIA 1E7OA 2EW3A 2J6FA 2YDLA 2KNBB 1K1ZA 4A63B 2CT3A 1E6GA 4WCIA 4RTZA 2E5KA 2L3PA 2K6DA 1Y0MA 3EHQA 2HCKA 4IIMA 1T3LA 2D0NA 2DILA 2GQIA 2LCSA 2JMAA 2OJ2A 1SRLA 1AVZC 1W1FA 1AWJA 2EQIA 5IHKA 2AK5A 3VS4A 1QWEA 2EGEA 3LH5A 2KR3A 4J9FA 3QWYA 5IXFA 2AZSA 1WXUA 2OI3A 1AD5A 1GFDA 2DL3A 4X1VA 1RLQC 1AOJA 2W10A 2EYWA 2ROLA 4D8DA 1OOTA 2RF0A 3RBBB 3FJ5A 2DL4A 1X6BA 1X43A 4LN2A 2KYMA 2D8JA 1ZLMA 1TUCA 2RQRA 2LMJA 1K9AA 2KYBA 3ULRB 2EYXA 3M0QA 1WX6A 5GJVB 2LP5A 1UTIA 4JJBA 3O5ZA 1H8KA 3TVTA 5IXBA 1KFZA 1RLPC 2CREA 2ENMA 1K76A 2JM8A 4GLMA 1B3QA 1UHCA 1BBZA 2EGAA 2HEQA 2A08A 1U06A 1ZX6A 1CKAA 5IHNA 2RQUA 4ZNXA 4HVUA 3EG1A 4FSSA 1AEYA 2CH4W 1H92A 2KEAA 1SHFA 1ZBJA 1AZEA 1BB9A 2H8HA 2CT4A 1NG2A 2FPEA 1YP5A 4Z88A 1I07A 2KE9A 4J9EA 4E6RA 1ARKA 2GBQA 5L23A 2CSQA 5I11A 1VYVA 2O2OA 2B86A 2LQNA 3EG3A 4OMQA 4RTUA 2M0YA 2C0TA 1X2KA 4AFZC 3M0SA 1PHTA 4D8KA 1X2QA 1T0JA 1IO6A 4CC7A 2AKLA 1MUZA 2SRCA 2JW4A 1OPLA 2EBPA 1MV0B 2JM9A 2SEMA 1TG0A 2DRKA 3SHWA 1WYXA 2YT6A 4LE9A 4R0KA 4RTXA 2DYBA 1UECA 3EG0A 2CUDA 4ESRA 1EFNA 1ZUUA 2ESWA 2BZ8A 1NLOC 2KT1A 4J9BA 3VRYA 4HVVA 1GCQA 1QKWA 1NM7A 4F16A 1M8MA 3NMZC 2BZYA 2LJ3A 4JJCA 4LUEA 1V1CA 1W6XA 2ED0A 2K9GA 2VVKA 2JXBA 3NHNA 5HCKA 2MCNA 1HJDA 1GFCA 2DBKA 1G83A 2C0OA 3M0PA 4LNPA 3UA6A 4AG2C 1NYGA 4J9IA 2L0AA 2L3SA 4GBQA 4OMLA 1T0HA 1PRMC 1VA7A 1PNJA 1X6GA 1U5SA 4J9HA 1WA7A 2EKHA 1BK2A 2KROA 2DNUA 2I0NA 1ABOA 2MIOA 3UATA 1UJ0A 2DM1A 2W0ZA 2FRWA 3H0IA 3THKA 3GBQA 4OMMA 1WIEA 3UA7A 2O88A 3NGPA 2RNAA 1AWWA 2V1QA 1QCFA 2LQWA 4KRTA 4RTTA 1BU1A 1X27A 2DE0X 2QDLA 4J9GA 1AWXA 1OEBA 3PVLA 2KRSA 4JZ4A 3ZL7C 1OV3A 1UHFA 2X3XD 3UF4A 2ECZA 1M3CA 3M0TA 4AG1C 2AKKA 2A37A 2BTTA 4LUDA 2DF6A 1FYNA 2KGTA 1KJWA 1SPKA 1SEMA 2K2MA 2LJ0A 2RPNA 4Y92A 4AFUC 1M3AA 2MOXA 1GCPA 2YUNA 2G6FX 1YCSB 1JQQA 1JXOA 3I5RA 4EIKA 3VS6A 3EG2A 1M27C 2DVJA 1UFFA 2GTOA 2LNHB 1GBQA 3KFVA 5I22A 2J06A 2JS2A 1ZSGA 2X3WD 3QWXX 4DEXA 1S1NA 1GRIA 2EVRA 2YUQA 2A36A 1T3SA 4CC2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5GJW B;  1G2B A;  2K3B A;  1GL5 A;  2FG0 A;  4HCK A;  1CSK A;  3VS1 A;  1ABQ A;  3SEM A;  1SHG A;  1PKS A;  2DL7 A;  2EGC A;  2IIM A;  1RI9 A;  3C0C A;  5FW9 A;  1GCQ C;  4RTW A;  2KRM A;  2V1R A;  1VYT A;  1M3B A;  2EYZ A;  2L3Q A;  2RQT A;  3R6N A;  2VWF A;  4ORZ A;  1Y57 A;  2EPD A;  1K4U S;  1J3T A;  3EGU A;  1CKB A;  2JMC A;  3U23 A;  1UE9 A;  1SSH A;  1PKT A;  2HSP A;  1HSQ A;  1JO8 A;  1Z9Q A;  2PNI A;  2P4R A;  3VS0 A;  3NPF A;  4K11 A;  3PVQ A;  3H0H A;  5EC7 A;  1YNZ A;  3A98 A;  2O9V A;  1AWO A;  3M0U A;  2PZ1 A;  2DBM A;  2FPF A;  2FPD A;  2KBT A;  4OMO A;  2ABL A;  1GBR A;  2FEI A;  1UGV A;  4CC4 B;  1QLY A;  3I5S A;  3TSW A;  1E6H A;  1UDL A;  2EYY A;  1WXT A;  2DX1 A;  1ZUY A;  4J9D A;  5FWB A;  4F17 A;  1I1J A;  2RQW A;  2DMO A;  4F14 A;  2CUB A;  5ECA A;  1QKX A;  4OMN A;  3VS5 A;  2LX7 A;  1KSW A;  1W70 A;  1X69 A;  2F2W A;  2RMO A;  2YSQ A;  4AFS C;  2J05 A;  4J9C A;  4JJD A;  2HBW A;  3H41 A;  2DJQ A;  4RTY A;  2O31 A;  1M30 A;  1NYF A;  2D1X A;  4JZ3 A;  1B07 A;  2LZ6 B;  3I35 A;  2RN8 A;  2J7I A;  2J6O A;  2NWM A;  1I0C A;  1WLP B;  1YWO A;  4JPB W;  1NEB A;  1A0N B;  1JEG A;  2FO0 A;  1OPK A;  1XOV A;  5IHI A;  1ZUK A;  4HXJ A;  2YUP A;  5FWC A;  2JS0 A;  1UG1 A;  3REB B;  1WI7 A;  1VYU A;  4QT7 A;  1N5Z A;  1KIK A;  3RNJ A;  2OAW A;  3TSZ A;  4RUG A;  3PE0 A;  1UUE A;  2F2X A;  2GNC A;  2K7A A;  4AFQ C;  4IIO A;  2K79 A;  2ROT A;  3CQT A;  4HVW A;  2CH4 A;  2KXC A;  3VS3 A;  1AZG B;  2A28 A;  2O9S A;  2DL8 A;  2DLP A;  2DRM A;  3I9Q A;  3VS2 A;  1Z9Z A;  1NEG A;  3VRZ A;  5IH2 A;  1U3O A;  2JT4 A;  2KRN A;  1TUD A;  2JTE A;  2CDT A;  1QWF A;  1NLP C;  2D8H A;  3H0F A;  3VS7 A;  2F2V A;  3REA B;  4DEY A;  2J6K A;  3EHR A;  1PWT A;  2AZV A;  2XMF A;  2RQV A;  1YWP A;  1H3H A;  1FMK A;  1WDX A;  2HDA A;  2L2P A;  1LCK A;  4OMP A;  1RUW A;  4Z8A A;  1K0S A;  1JXM A;  4CC3 A;  2C0I A;  2FRY A;  4M4Z A;  1JU5 C;  2BZX A;  2VKN A;  4Z89 A;  1SRM A;  2PTK A;  2DA9 A;  2KXD A;  1UJY A;  3JV3 A;  2ED1 A;  2KT8 A;  1YN8 A;  1WFW A;  3M0R A;  1WXB A;  2GTJ A;  1K0X A;  4RTV A;  3IQL A;  2GGR A;  2YUO A;  1MV3 A;  2LJ1 A;  1PRL C;  1HD3 A;  2M51 A;  2DL5 A;  2NUZ A;  2CSI A;  1E7O A;  2EW3 A;  2J6F A;  2YDL A;  2KNB B;  1K1Z A;  4A63 B;  2CT3 A;  1E6G A;  4WCI A;  4RTZ A;  2E5K A;  2L3P A;  2K6D A;  1Y0M A;  3EHQ A;  2HCK A;  4IIM A;  1T3L A;  2D0N A;  2DIL A;  2GQI A;  2LCS A;  2JMA A;  2OJ2 A;  1SRL A;  1AVZ C;  1W1F A;  1AWJ A;  2EQI A;  5IHK A;  2AK5 A;  3VS4 A;  1QWE A;  2EGE A;  3LH5 A;  2KR3 A;  4J9F A;  3QWY A;  5IXF A;  2AZS A;  1WXU A;  2OI3 A;  1AD5 A;  1GFD A;  2DL3 A;  4X1V A;  1RLQ C;  1AOJ A;  2W10 A;  2EYW A;  2ROL A;  4D8D A;  1OOT A;  2RF0 A;  3RBB B;  3FJ5 A;  2DL4 A;  1X6B A;  1X43 A;  4LN2 A;  2KYM A;  2D8J A;  1ZLM A;  1TUC A;  2RQR A;  2LMJ A;  1K9A A;  2KYB A;  3ULR B;  2EYX A;  3M0Q A;  1WX6 A;  5GJV B;  2LP5 A;  1UTI A;  4JJB A;  3O5Z A;  1H8K A;  3TVT A;  5IXB A;  1KFZ A;  1RLP C;  2CRE A;  2ENM A;  1K76 A;  2JM8 A;  4GLM A;  1B3Q A;  1UHC A;  1BBZ A;  2EGA A;  2HEQ A;  2A08 A;  1U06 A;  1ZX6 A;  1CKA A;  5IHN A;  2RQU A;  4ZNX A;  4HVU A;  3EG1 A;  4FSS A;  1AEY A;  2CH4 W;  1H92 A;  2KEA A;  1SHF A;  1ZBJ A;  1AZE A;  1BB9 A;  2H8H A;  2CT4 A;  1NG2 A;  2FPE A;  1YP5 A;  4Z88 A;  1I07 A;  2KE9 A;  4J9E A;  4E6R A;  1ARK A;  2GBQ A;  5L23 A;  2CSQ A;  5I11 A;  1VYV A;  2O2O A;  2B86 A;  2LQN A;  3EG3 A;  4OMQ A;  4RTU A;  2M0Y A;  2C0T A;  1X2K A;  4AFZ C;  3M0S A;  1PHT A;  4D8K A;  1X2Q A;  1T0J A;  1IO6 A;  4CC7 A;  2AKL A;  1MUZ A;  2SRC A;  2JW4 A;  1OPL A;  2EBP A;  1MV0 B;  2JM9 A;  2SEM A;  1TG0 A;  2DRK A;  3SHW A;  1WYX A;  2YT6 A;  4LE9 A;  4R0K A;  4RTX A;  2DYB A;  1UEC A;  3EG0 A;  2CUD A;  4ESR A;  1EFN A;  1ZUU A;  2ESW A;  2BZ8 A;  1NLO C;  2KT1 A;  4J9B A;  3VRY A;  4HVV A;  1GCQ A;  1QKW A;  1NM7 A;  4F16 A;  1M8M A;  3NMZ C;  2BZY A;  2LJ3 A;  4JJC A;  4LUE A;  1V1C A;  1W6X A;  2ED0 A;  2K9G A;  2VVK A;  2JXB A;  3NHN A;  5HCK A;  2MCN A;  1HJD A;  1GFC A;  2DBK A;  1G83 A;  2C0O A;  3M0P A;  4LNP A;  3UA6 A;  4AG2 C;  1NYG A;  4J9I A;  2L0A A;  2L3S A;  4GBQ A;  4OML A;  1T0H A;  1PRM C;  1VA7 A;  1PNJ A;  1X6G A;  1U5S A;  4J9H A;  1WA7 A;  2EKH A;  1BK2 A;  2KRO A;  2DNU A;  2I0N A;  1ABO A;  2MIO A;  3UAT A;  1UJ0 A;  2DM1 A;  2W0Z A;  2FRW A;  3H0I A;  3THK A;  3GBQ A;  4OMM A;  1WIE A;  3UA7 A;  2O88 A;  3NGP A;  2RNA A;  1AWW A;  2V1Q A;  1QCF A;  2LQW A;  4KRT A;  4RTT A;  1BU1 A;  1X27 A;  2DE0 X;  2QDL A;  4J9G A;  1AWX A;  1OEB A;  3PVL A;  2KRS A;  4JZ4 A;  3ZL7 C;  1OV3 A;  1UHF A;  2X3X D;  3UF4 A;  2ECZ A;  1M3C A;  3M0T A;  4AG1 C;  2AKK A;  2A37 A;  2BTT A;  4LUD A;  2DF6 A;  1FYN A;  2KGT A;  1KJW A;  1SPK A;  1SEM A;  2K2M A;  2LJ0 A;  2RPN A;  4Y92 A;  4AFU C;  1M3A A;  2MOX A;  1GCP A;  2YUN A;  2G6F X;  1YCS B;  1JQQ A;  1JXO A;  3I5R A;  4EIK A;  3VS6 A;  3EG2 A;  1M27 C;  2DVJ A;  1UFF A;  2GTO A;  2LNH B;  1GBQ A;  3KFV A;  5I22 A;  2J06 A;  2JS2 A;  1ZSG A;  2X3W D;  3QWX X;  4DEX A;  1S1N A;  1GRI A;  2EVR A;  2YUQ A;  2A36 A;  1T3S A;  4CC2 A; 
#chains in the Genus database with same CATH topology
 5GJW B;  1G2B A;  1GL5 A;  2FG0 A;  5KYY A;  3H8Z A;  4KH1 B;  1RAB B;  1C1A A;  4KH0 B;  4XK8 E;  1MNE A;  1SHG A;  4IUU A;  3SDZ A;  2DL7 A;  2EGC A;  1Q81 R;  3CC7 T;  3BFM A;  5IT9 E;  2LDM A;  4N0A A;  1PG5 B;  3CC4 Q;  1Y57 A;  3BW1 A;  2EWN A;  1VQN T;  3U23 A;  5I2M A;  1SSH A;  2AIR B;  1HSQ A;  3GLX A;  2PNI A;  5LJ5 d;  3SD4 A;  1VQK T;  1RAG B;  1KD1 U;  4FYY B;  3VS0 A;  3HRS A;  4KUD K;  2NUT B;  3PVQ A;  3H0H A;  5EC7 A;  3CC2 A;  3A98 A;  3M0U A;  4BDY A;  5GAN f;  2KBT A;  2X4Y A;  4OMO A;  1YI2 A;  1GBR A;  2QI2 A;  3JRZ A;  1AHJ B;  1D1B A;  3G71 Q;  3CCL Q;  2ZPH B;  2O4X A;  5A2Q E;  4DQ2 A;  2EJ9 A;  3TU4 K;  1JJ2 S;  3TEE A;  4J6X A;  5GAN g;  4F14 A;  1UB4 A;  2BE7 D;  1WHL A;  1RAA B;  2J05 A;  2M9U A;  4J9C A;  3H41 A;  2LQK A;  5LJ3 f;  2O31 A;  4JJN K;  1M30 A;  1NYF A;  1B07 A;  2LZ6 B;  3SFM A;  3L2R A;  2DEQ A;  2FZG B;  4XAX B;  1I0C A;  4JPB W;  5GAM f;  2DXU A;  4NOY A;  2FO0 A;  2NYS A;  4C8Q B;  2RJD A;  5A0D A;  2XU8 A;  2CKK A;  3MEA A;  2CS7 A;  1WI7 A;  4QT7 A;  5LJ3 g;  1KIK A;  3RNJ A;  4C92 C;  3VJP A;  1UUE A;  4AFQ C;  1C0M A;  4PLI A;  3OS1 A;  4JS5 A;  1M90 R;  3CQT A;  5A0L A;  5GAM g;  4M7D F;  3CEY A;  4RG2 A;  2DL8 A;  3I9Q A;  4EMH A;  4Z02 A;  2LQ8 A;  2KRN A;  4QVZ A;  3R6O A;  2QDY B;  1QWF A;  2FVU A;  2COY A;  2E41 A;  2QAS A;  1JRI A;  2MPX C;  3OA6 A;  1YWP A;  5DM7 R;  4C5I A;  1QP3 A;  1FMK A;  2E10 A;  3C4S A;  4M75 B;  2MK5 A;  3CCU T;  2Y4X A;  4OMP A;  3LGF A;  5GMK e;  1K0S A;  1JXM A;  1M4Z A;  2F1L A;  2FRY A;  1WPY A;  3RER A;  2KXD A;  4X9C A;  1UJY A;  2M0O A;  3GPL A;  2EAY A;  4PJJ A;  2H3E B;  2MF2 A;  4XTX A;  1Q86 U;  3ZFJ A;  4RG8 A;  5GAN j;  3IQL A;  1RAE B;  1Q7Y R;  3MPU B;  2YUO A;  4JRQ A;  3LX7 A;  3DLL A;  2M51 A;  2RA2 A;  4DBF A;  1Q95 G;  2NUZ A;  2CSI A;  1VQ6 Q;  3OYF A;  1Y07 A;  1QVF S;  3OMC A;  1O75 A;  2O4X B;  2E5K A;  2K5I A;  3RES A;  2L3P A;  3CCU Q;  2K6D A;  3V7S A;  1T3L A;  4MMK A;  2DIL A;  2GQI A;  1YJ9 A;  2PUO B;  2OJ2 A;  1OYX A;  1SRL A;  4BAC A;  2DIG A;  3CCE A;  1IHV A;  3EG9 A;  3VS4 A;  2KR3 A;  5LJ3 j;  2FZK B;  2DL3 A;  1YJN A;  2KK4 A;  1EX4 A;  1RLQ C;  3CME Q;  4M7D G;  3CCE T;  1OU8 A;  2RF0 A;  2EQK A;  3RBB B;  2PVG B;  1KC8 U;  2XKO C;  2D8J A;  3JCM W;  3ER0 A;  1K9M R;  4LDV A;  4CI0 C;  2LMJ A;  3M0Q A;  4BE1 A;  3ZEH A;  1PCX A;  2ZZD A;  3RKW A;  4QQG A;  3CPW P;  4ANJ A;  1VQO T;  1RL2 A;  3EGD B;  2HL5 C;  2OX7 A;  2E3I A;  3NFC A;  4WF2 A;  5FU6 B;  1BBZ A;  2EGA A;  2HEQ A;  3LW5 E;  1LVK A;  4C92 B;  4A4F A;  4RMO A;  2KEA A;  2NUP A;  1W2B S;  4M7D D;  2E6Z A;  4Q5W A;  3FRN A;  3OYL A;  2E70 A;  4Z88 A;  4QVC A;  5D6W A;  1VQ8 A;  4E6R A;  2GQV A;  3QJY A;  3JCM e;  4MDX A;  1VUB A;  5I11 A;  2E12 A;  4J5Y A;  3EG3 A;  3OYM A;  2LQN A;  1KQS S;  3CCV Q;  1X2K A;  4D8K A;  4XTV A;  1T0J A;  4PLL A;  1IO6 A;  2OTJ T;  1QP2 A;  2AKL A;  3CXC A;  2JW4 A;  4AMC A;  5KYX B;  5CKD A;  1MV0 B;  2DK3 A;  2ATC B;  1RAI B;  3L2U A;  3AHU A;  3OYC A;  5A0G A;  2EYQ A;  1LJO A;  4FL6 A;  4XQ3 A;  2JNG A;  3EG0 A;  4ESR A;  1EFN A;  3S6W A;  2QYZ A;  4FT4 A;  3CBP A;  4HVV A;  5GMK m;  3GF5 A;  3FEO A;  1NM7 A;  3NMZ C;  2LJ3 A;  2CYZ B;  3X28 B;  4M78 E;  1V1C A;  5CO7 A;  2K5L A;  1VQ4 Q;  2K9G A;  1D3B B;  2IG0 A;  1UGP B;  1Q81 U;  4OB0 B;  1HJD A;  2VB6 A;  5KYU A;  1QCN A;  4GBQ A;  1NE8 A;  4PFP A;  4EMK C;  2HL3 A;  3EAE A;  1P92 A;  4J9H A;  1OQK A;  1BK2 A;  4C5H A;  2KRO A;  2DZ9 A;  1TH7 A;  4J7I A;  2DM1 A;  3P8B B;  2M1H A;  3OMG A;  3CMA T;  4E7K A;  2DD5 A;  3H0I A;  5CKB A;  4PJN A;  2XI9 A;  3RR6 A;  3FB9 A;  5IN1 A;  2V1Q A;  2LQW A;  4KRT A;  4XTY A;  2EKO A;  1OUL A;  2QDL A;  3G4S A;  4PK4 A;  2KRS A;  2D6F A;  4PFO A;  3JCM d;  2CZ1 B;  3BDU A;  3MEV A;  5C6S A;  3A1P A;  3TCJ A;  4AG1 C;  2V26 A;  5CCA A;  5CAI A;  4LUD A;  1G8X A;  1FYN A;  3QPH A;  1SEM A;  3EH2 A;  2RPN A;  1WZO A;  4IKF A;  1YBY A;  1WNL A;  3KUF A;  5FRO A;  3M5A A;  1YCS B;  1KQ1 A;  3G4S T;  2QQB A;  1IGU A;  1JXO A;  3I5R A;  3VS6 A;  1NBE B;  3EG2 A;  1M27 C;  1UFF A;  2LNH B;  2XID A;  3QZ9 B;  3JCM Q;  2EQJ A;  3OYB A;  2RJE A;  1S1N A;  3HL8 A;  5GAM h;  3JCM X;  3BDL A;  4WTO B;  3HSB A;  2YUQ A;  2V8I A;  3BY7 A;  1T3S A;  3URG A;  4M77 F;  4F7U A;  1X6O A;  1MGQ A;  4C8Q E;  2QQA A;  3VS1 A;  4E7I A;  1ABQ A;  2KY9 A;  2YXY A;  3J81 E;  1K73 U;  1KK7 A;  2IIM A;  1RI9 A;  2AHJ B;  1N9R A;  1GCQ C;  3OYN A;  2I2L A;  5FRM A;  1ZSZ C;  4RTW A;  2V1R A;  1M90 U;  2AT1 B;  2EYZ A;  3R6N A;  3G6E Q;  2EPD A;  3A8H B;  4FYW B;  1PKT A;  4PJO E;  1Z9Q A;  1G3W A;  2P4R A;  3M59 A;  3CCM A;  3VYH B;  3I55 Q;  1KC8 R;  2DFU A;  1ZSZ A;  2O9V A;  4XU0 A;  1M2O A;  1HK9 A;  1PD1 A;  2DO3 A;  2KI7 A;  3V7C A;  2YWW A;  3X26 B;  1YIJ A;  1UGV A;  3GNF B;  2QGG A;  4MML A;  1VQP Q;  3CCM T;  1E6H A;  2L5Q A;  3S3M A;  1M2V B;  1VQM Q;  4J9D A;  2D9T A;  2O01 E;  4F17 A;  2CP2 A;  2P0Q A;  3A5Z B;  2XK0 A;  3EFO A;  3OYI A;  2DMO A;  3CBO A;  4OMN A;  1YIJ T;  1YIT A;  2LX7 A;  3V8L A;  1O9S A;  5IAY A;  1KSW A;  1W70 A;  2F2W A;  2L89 A;  2RMO A;  4LDW A;  4EMK B;  2DVE A;  3CCS Q;  2F69 A;  1S72 T;  1VQ7 T;  5L8R E;  3CCQ A;  4KGV B;  2DYI A;  4RTY A;  2JVV A;  2D1X A;  4JZ3 A;  3I35 A;  3OY9 A;  5D7U A;  2NWM A;  4LD6 A;  1NEB A;  4ZN1 A;  8AT1 B;  1YIT T;  1JEG A;  2CZ6 B;  3LLR A;  4M77 G;  4IUQ A;  2VXE A;  1ZUK A;  1I5O B;  3MEW A;  4M7D A;  3CCQ T;  4PJO C;  2YUP A;  5FWC A;  1G3T A;  2LVM A;  2RD1 A;  4FYX B;  1VYU A;  2E65 A;  3L2Q A;  1N5Z A;  1IRE B;  4RUG A;  3PE0 A;  1S72 Q;  5KE3 A;  2K79 A;  3CC4 A;  5KE2 A;  4HVW A;  2CH4 A;  1OX8 A;  4X9D A;  4LDY A;  3H6Z A;  2DLP A;  3CCR A;  1YFN A;  3RUX A;  4PL6 A;  3GNG A;  5HK3 A;  2V8J A;  5LJ5 f;  2JT4 A;  4M78 B;  2P0P A;  1TUD A;  4F7U B;  4N0A C;  4N4I A;  1QW1 A;  2K3Y A;  5GAN e;  2HKQ B;  2ZPI B;  3VS7 A;  4LXC A;  4M7A G;  2F2V A;  4DEY A;  4NL3 A;  3RMQ A;  3JCM c;  1RAD B;  1ZQ1 A;  5GAO n;  2J6K A;  3A8G B;  3EHR A;  4L6V 5;  1WDX A;  2HDA A;  3CCR T;  1RUW A;  4B9X A;  2QEX A;  1MMG A;  4Z8A A;  1VQL A;  4M4Z A;  5CVI A;  4Z89 A;  1SRM A;  2XDB A;  3OBW A;  1TXQ A;  3OB9 A;  2KT8 A;  2CGH A;  3RDV A;  3MP8 A;  4HCZ A;  1WXB A;  2GTJ A;  1X75 C;  2PQW A;  4RTV A;  2LX9 A;  4C92 E;  2QEX T;  1FWZ A;  2R5A A;  2OTL Q;  5LJ3 e;  1VQL T;  3C94 A;  2DZC A;  4M78 F;  5D6Y A;  3NTK A;  2J6F A;  2YDL A;  3VUZ A;  5GMK l;  1QVG A;  1D09 B;  7AT1 B;  3CC7 Q;  2X4X A;  4M7A D;  3CC2 T;  2A0F B;  1UEB A;  3CPW A;  1VQN Q;  3V8J A;  1AVZ C;  4MZT A;  1W1F A;  4A4E A;  2ZPE B;  5IHK A;  5KH6 A;  4OB3 B;  3MET A;  1YI2 T;  2EGE A;  3LH5 A;  1VQK Q;  1M8V A;  3CCJ A;  4HT9 A;  2DD4 A;  4C0F A;  3QWY A;  1NJI C;  3UPU A;  1WXU A;  1AD5 A;  2BKD N;  5FLX E;  2LT1 A;  2EYW A;  2FYK A;  2ROL A;  3OW2 A;  3FLG A;  4D8D A;  5CKF A;  4FT2 A;  2G3R A;  3FJ5 A;  2E1H A;  3CCJ T;  4ZGD B;  3E19 A;  4OMF B;  3TQ7 P;  1ZLM A;  5GAN d;  3SB2 A;  3HKS A;  5GMK i;  3SWN C;  1TUC A;  2RQR A;  3I56 A;  1K9A A;  5CK9 A;  3ULR B;  1WX6 A;  2LT4 A;  4CRI A;  3M58 A;  4JJB A;  3TVT A;  5IXB A;  1K73 R;  1RLP C;  1VQ9 A;  1FMV A;  2ENM A;  4PJO B;  4UC4 A;  3OYH A;  1B3Q A;  3SWN A;  1C6V X;  2LRQ A;  4X34 A;  3I56 T;  1ZBX A;  4IUR A;  4P5N A;  3EG1 A;  1TTH B;  4FSS A;  4BB7 A;  1AEY A;  3PFS A;  2QA4 A;  1H92 A;  3HHT B;  1SHF A;  5KYY B;  3H9N A;  1AZE A;  2H8H A;  1VQ9 T;  4BD3 A;  3JB9 J;  3N5B B;  5LJ3 d;  4A53 A;  2K5F A;  3CPF A;  4C8Q F;  3PGG A;  4J9E A;  2GBQ A;  1U1S A;  2DER A;  4E7J A;  2QA4 T;  5DY9 A;  2X51 A;  2DET A;  4BI8 B;  2RHI A;  2C0T A;  1JBM A;  1PHT A;  4N4G A;  1I81 A;  1QVP A;  1UGS B;  2SRC A;  4OB1 B;  2YLC A;  3OQ5 A;  2JM9 A;  1MMN A;  1WYX A;  2YT6 A;  5GAN 5;  4R0K A;  4F04 B;  3EGX A;  2YLB A;  4A4K A;  2ESW A;  2BZ8 A;  2Y4Y A;  2KT1 A;  4J9B A;  4ZTJ A;  2R5M A;  2HMA A;  2XD0 A;  1SSF A;  1BKB A;  1QKW A;  1D0Y A;  4HA8 A;  2LCC A;  4M75 F;  2BZY A;  4LUE A;  5I21 A;  1OU9 A;  2ED0 A;  1PM3 A;  2VVK A;  1XJW B;  3PTA A;  1R77 A;  5HCK A;  2ZCF B;  2FL7 A;  1G83 A;  3FIF A;  3M0P A;  3UA6 A;  4DA4 A;  4J9I A;  2L3S A;  3CD6 A;  4OML A;  1T0H A;  5CKE A;  1PRM C;  4IUP A;  1VA7 A;  2XG8 D;  1PNJ A;  1YJ9 T;  4DOV A;  1JB0 E;  5GAM j;  1WA7 A;  4BY6 C;  2DXB A;  4B6M A;  5GAN 4;  3CXC S;  1M5Q 1;  4HT8 A;  2W0Z A;  2PVD B;  2WSC E;  2RO0 A;  4IUV A;  1YJN T;  3CD6 T;  1HXD A;  2O88 A;  1QVG P;  4ZN3 A;  1N8R C;  2HQE A;  4C8Q G;  4JLG A;  2RNA A;  2VAS A;  3HP9 A;  1AWW A;  1QCF A;  2DTO A;  1BU1 A;  3PIO A;  3PMI A;  4J9G A;  1PSE A;  3PVL A;  2BUD A;  3ZL7 C;  3SWN B;  1UHF A;  3UF4 A;  1M3C A;  3QSU A;  3CCV A;  1EIF A;  1FMW A;  2A37 A;  1WQ7 A;  3WVE B;  3CCE Q;  4HCC A;  1FX7 A;  1D1A A;  2RJC A;  2LJ0 A;  1BCO A;  1BIA A;  1M1K C;  3D7S B;  4C5G A;  4B9W A;  2FB7 A;  3C95 A;  3OW2 P;  4BDZ A;  1YJN Q;  2GCX A;  4M77 A;  3FDR A;  1BYM A;  1GBQ A;  3P8H A;  1KHC A;  1QVF A;  1K8A C;  3QUI A;  3JB9 F;  3JB9 I;  1KHI A;  2XIC A;  4RKU E;  4DEX A;  1M9S A;  2DPP B;  2LTO A;  1VQO Q;  1NJI R;  1GRI A;  2EVR A;  1B34 A;  5KYN A;  1R0C B;  4M75 G;  2A36 A;  4JS4 A;  4CC2 A;  4M7A C;  4E47 A;  2K3B A;  2CP3 A;  3GP8 A;  4HCK A;  3AT1 B;  1CSK A;  1VQ8 T;  1PKS A;  1TU0 B;  3X24 B;  5GAO r;  3A8M B;  2COZ A;  5FW9 A;  1Y71 A;  3EGX B;  2KRM A;  3OYE A;  4C92 F;  1VYT A;  4ORZ A;  3RMS A;  4M7A A;  1PSF A;  2CP5 A;  1UE9 A;  2D0Q B;  3LH0 A;  2ZGW A;  2HD0 A;  2HSP A;  2K4Y A;  5LJ5 h;  3NPF A;  2XDP A;  4D6W A;  3M57 A;  4K11 A;  4OVA A;  1LNX A;  3EG9 B;  2DKG A;  2EQU A;  2WSE E;  1QQJ A;  3QYH B;  2DBM A;  4F7U E;  3QG1 A;  2OTJ Q;  5DLQ E;  1XNI A;  4E7L A;  3LYI A;  4CC4 B;  3TSW A;  3V7R A;  1JJ2 P;  6AT1 B;  4M75 D;  3JCM f;  2DX1 A;  1ZUY A;  5FWB A;  1I1J A;  3A8L B;  3DLM A;  2JUF A;  2RQW A;  3L42 A;  1AT1 B;  2CUB A;  3MP1 A;  5ECA A;  1QKX A;  1VQ5 A;  1W2B A;  1X69 A;  2MI6 A;  2HBW A;  1YHQ A;  4MDW A;  1MMD A;  3OYG A;  2HBP A;  3JCM g;  2E3H A;  2JTM A;  3JB9 G;  1WQW A;  2JTF A;  2RN8 A;  2J7I A;  2J6O A;  1YWO A;  4OGE A;  1SG5 A;  1VQ5 T;  1A0N B;  2QTX A;  2ZPB B;  2GFA A;  2F5K A;  2E6N A;  3JCM J;  1KG1 A;  1RAC B;  1KQS A;  4E2F B;  5FU7 C;  1TWB A;  4HXJ A;  1RI0 A;  3EFR A;  1YHQ T;  2NUP B;  3BE3 A;  1YJW A;  3L1A A;  3REB B;  4ZGE B;  1WJR A;  4KBM B;  2CP0 A;  3CMA Q;  4C92 G;  3TSZ A;  4A4G A;  2GNC A;  2K7A A;  3A8O B;  3G6E A;  2ROT A;  3E1S A;  1PD0 A;  3QDF A;  5AT1 B;  3GOX A;  1AZG B;  1IXD A;  2O9S A;  1IHW A;  2KAF A;  2DRM A;  5KCO A;  1Z9Z A;  1NEG A;  1YJW T;  5IH2 A;  3CBM A;  8ATC B;  3FC3 A;  2JTE A;  2CDT A;  3LWH A;  2D8H A;  1QMC A;  2E4H A;  5FRN A;  4M7D E;  3MKD A;  1PWT A;  2AZV A;  1H3H A;  4C0Z A;  2L2P A;  1LCK A;  5HY6 A;  1VQP A;  4HCB A;  3G4S Q;  1TS9 A;  1Y96 A;  1Q82 C;  2M16 A;  3LGL A;  3HFN A;  2PTK A;  2DA9 A;  2RK1 A;  9ATC B;  3JV3 A;  1BI3 A;  1N8R R;  2ED1 A;  3QZ5 B;  4J7F A;  1YN8 A;  4DBR A;  1WFW A;  2QGF B;  1K0X A;  2GGR A;  3CCS A;  1QVF P;  1HD3 A;  2QQ9 A;  3X20 B;  2DL5 A;  4XTZ A;  1D0Z A;  1E7O A;  2EW3 A;  5M9O A;  1F1B B;  3ZBD A;  2YRC A;  1M1G A;  2IVW A;  3P8D A;  2KNB B;  5KYU B;  1IZ6 A;  4A63 B;  2CT3 A;  5GAN 6;  4WCI A;  2R58 A;  4RTZ A;  2EJG A;  1M1K R;  4ELY C;  1Y0M A;  4MZM A;  3EHQ A;  2HCK A;  4IIM A;  3T9N A;  1I8F A;  2LCS A;  2JMA A;  1N27 A;  4ATO A;  4O6J A;  3OS0 A;  2AK5 A;  3OYD A;  1K8A R;  4JUV A;  4PKC C;  3KBG A;  2F5T X;  1Y7X A;  4J9F A;  5IXF A;  2AZS A;  2OI3 A;  3MHX A;  2OAU A;  4X1V A;  5HKC A;  5EG2 A;  4M7D C;  2HSE B;  2B8A A;  1NPP A;  2BIV A;  3G7Z A;  2W10 A;  1WGS A;  1B7T A;  4C5E A;  3Q1J A;  2CZ7 B;  4QVD A;  1X43 A;  3UDC A;  3CCM Q;  4KGZ B;  3WXM B;  1FXX A;  1LPL A;  2P0K A;  4NL2 A;  1OZ2 A;  4QW2 A;  1VOM A;  4VUB A;  3MJX A;  1YIJ Q;  1G5V A;  1KFZ A;  1Q7Y C;  1ZA1 B;  1X01 A;  5KYW A;  1VQ7 Q;  5FU7 B;  1R0B G;  3OYJ A;  5LL6 S;  1UHC A;  4NS5 A;  5GMK h;  1W2B P;  4C8Q A;  2A08 A;  1U06 A;  2JOY A;  2HZY A;  3WVD B;  3X25 B;  1ACM B;  4ZNX A;  5J39 A;  1YCY A;  1H64 1;  1MND A;  1YIT Q;  3HFO A;  3MP6 A;  4EPC A;  1RAH B;  3JCM P;  1BB9 A;  4BI4 A;  2LCL A;  3HRT A;  2CT4 A;  2K2V A;  2WAC A;  1NG2 A;  1G3S A;  3CC4 T;  4J6W A;  3CCQ Q;  4JRK A;  1ARK A;  2RHX A;  1KQS P;  3G71 A;  3CCL A;  3KXT A;  3MEU A;  4M77 D;  5LJ5 g;  1VYV A;  2O2O A;  2B86 A;  2VXF A;  4FU6 A;  2K3X A;  4RTU A;  2ZAE A;  4AFZ C;  1G3Y A;  1R8O B;  2R57 A;  1ZSZ B;  1VQK A;  5CR2 A;  4QQ6 A;  1OPL A;  2EBP A;  3M56 A;  2VUB A;  3OYA A;  1BI2 A;  2CZ0 B;  2DRK A;  2QQS A;  3G71 T;  3CCL T;  2MAM A;  2M02 A;  2LNV A;  4M75 A;  4LE9 A;  1K9M C;  3JCM V;  4F7U F;  2OTL T;  1UEC A;  2PVO B;  2CUD A;  4ELZ C;  5GAM e;  3CCR Q;  1NJI U;  2HQH A;  4LD9 K;  1EZZ B;  5GAO m;  2COW A;  4R56 A;  3EFO B;  2RK2 A;  1PC0 A;  1VIF A;  4ZTF A;  1W6X A;  2LC4 A;  3VUB A;  3L2Z A;  3OBY A;  4E7S A;  2Z0W A;  1GFC A;  2DBK A;  2C0O A;  1BI0 A;  3FJP A;  1KD1 C;  1ZA2 B;  4AG2 C;  2QEX Q;  3M55 A;  2QTV A;  4HKE A;  1VQL Q;  1X6G A;  3M53 A;  3PMT A;  2X4J A;  2EKH A;  1OX9 A;  1U1T A;  2VC8 A;  1ABO A;  2MIO A;  2P4T A;  3EFS A;  4M7D B;  3ASK A;  2FRW A;  3GIB A;  3CC2 Q;  3THK A;  2YRD A;  3GBQ A;  5C0M A;  4OMM A;  1Q82 R;  2XHC A;  1WIE A;  1GXI E;  4XU3 A;  4JRI A;  4A54 A;  1YI2 Q;  5KYW B;  4LDX A;  4YTL A;  2E5Q A;  5DLO A;  2FHD A;  1AWX A;  4JZ4 A;  2HNI A;  1KQ2 A;  2RJF A;  3JCM h;  2X3X D;  4FSX A;  4RCB A;  5LJ5 j;  2X4W A;  5CQY A;  2BTT A;  3PT9 A;  4KUL A;  2KGT A;  1SKU B;  3DKM A;  5FU6 C;  1SPK A;  2K2M A;  2KQW A;  4Y92 A;  1GCP A;  2G6F X;  3CCJ Q;  1H3Z A;  5I2S A;  2VYT A;  1VQ6 A;  1JQQ A;  4M78 G;  3J80 E;  4F7U G;  3EGD A;  1MMA A;  2GTO A;  4ZGJ B;  5I22 A;  4FW2 A;  5GAO q;  3CCU A;  1ZSG A;  2X3W D;  5GAM d;  1XTD A;  2YHT A;  1LOJ A;  4PFZ A;  4MZP A;  4A4H A;  4C92 A;  3OS2 A;  2C06 A;  1VQ6 T;  1JJ2 A;  3I56 Q;  3UWN A;  4PJO F;  4J8O A;  3SEM A;  3C0C A;  2MMP A;  1VQ9 Q;  1M3B A;  2L3Q A;  2RQT A;  2VWF A;  4Y28 E;  3CME A;  3QYG B;  4M77 E;  1K4U S;  1J3T A;  3EGU A;  1CKB A;  2JMC A;  2PU9 B;  4C0G A;  4TVR A;  1JO8 A;  2ZPF B;  3PIP A;  4OF1 A;  3UT1 A;  5GAN 7;  1BI1 A;  4OB2 B;  3J7A F;  2QA4 Q;  2GFU A;  3DB3 A;  1YNZ A;  4M78 D;  1AWO A;  5KYX A;  2PZ1 A;  3CME T;  2FPF A;  2FPD A;  2ABL A;  2FEI A;  2QQR A;  1QLY A;  2IPO B;  3I5S A;  1Q86 C;  4R55 A;  2RB6 A;  2GF7 A;  1UDL A;  2EYY A;  1WXT A;  4M7A E;  1N8R U;  4IUT A;  4FCY A;  4BUG A;  2EJF A;  4JLI A;  2MYS A;  2DXT A;  1OI1 A;  3HPW A;  4JDS A;  4O5V A;  3VS5 A;  4AFS C;  2YSQ A;  2H3J A;  1D3B A;  4XU1 A;  4JJD A;  2V8K A;  3NTH A;  2DJQ A;  4PNO A;  1HYO A;  1M1K U;  1TUG B;  2L8D A;  1WLP B;  1VQO A;  2X35 A;  2RM4 A;  1OPK A;  2RHZ A;  4M77 C;  1XOV A;  5CIU A;  3QBY A;  4FW1 A;  5IHI A;  1YJ9 Q;  1N9S A;  2EFI A;  1WHM A;  1UGR B;  1K8A U;  5AYF A;  2JS0 A;  1UG1 A;  4PJO G;  2HQX A;  3PNW C;  2DJZ A;  4E7Z A;  4OP0 A;  4II1 A;  2OAW A;  4AT1 B;  1W4S A;  1KC8 C;  2F2X A;  2JJ9 A;  1NZ9 A;  4IIO A;  3E9F A;  1D1C A;  3CD6 Q;  4OGC A;  1DJ7 B;  2KXC A;  3CCV T;  3VS3 A;  2A28 A;  3OYY A;  2VGN A;  3VS2 A;  4DBH A;  3VRZ A;  1U3O A;  4ME7 A;  3M4Y A;  1KD1 R;  1NLP C;  5GAN 2;  3H0F A;  3OSV A;  3REA B;  2QK0 A;  4C8Q D;  1UGQ B;  3M54 A;  4C0D C;  1VQ4 A;  4KT0 E;  2XMF A;  2RQV A;  2OTJ A;  4PJL A;  3MCA B;  2JN0 A;  2YRV A;  1WHG A;  2BE9 B;  2DTI A;  4CC3 A;  2EIF A;  3JSC A;  4RCC A;  2C0I A;  1JU5 C;  2BZX A;  2VKN A;  2KSS A;  4PJO D;  4XTU A;  1VQ4 T;  2DTH A;  1WJS A;  3M0R A;  3C12 A;  3S3O A;  2CP7 A;  4L59 A;  1MV3 A;  2LJ1 A;  1PRL C;  1N6A A;  1MHN A;  1D0X A;  2P84 A;  1I4K 1;  3QKJ A;  1K1Z A;  4QQD A;  5KCH A;  1VQ8 Q;  2RI2 A;  1E6G A;  2RI3 A;  2VGM A;  4Y91 A;  4DOW A;  5GAO l;  2DEU A;  5J26 A;  5GMK j;  1IGQ A;  3QHS A;  2RH2 A;  2E64 A;  4QKU A;  2D0N A;  2RHU A;  1IRX A;  1AWJ A;  2EQI A;  4PJM A;  1QWE A;  5GAN 3;  4BE0 A;  3HTR A;  1TSF A;  3CMA A;  1GFD A;  1BCM A;  1AOJ A;  4BY6 B;  2DXC A;  3S3N A;  1M2V A;  1OOT A;  3NTI A;  2DL4 A;  1X6B A;  1Q81 C;  4DBQ A;  4LN2 A;  2KYM A;  2L3R A;  5CQX A;  3ME9 A;  5GAN h;  4V2S A;  4EMK A;  2KYB A;  4EDU A;  2EYX A;  5GJV B;  4J6Y A;  2LP5 A;  2A3L A;  4FM4 B;  1UTI A;  3O5Z A;  1H8K A;  4M77 B;  4LDU A;  2Y90 A;  5HK0 A;  1ZHI A;  5CKH A;  2CRE A;  3E9G A;  2KMT A;  1K76 A;  2JM8 A;  4GLM A;  5D6X A;  1WHK A;  1RAF B;  1OZ3 A;  1ZX6 A;  1M1F A;  1CKA A;  1B34 B;  5IHN A;  2RQU A;  4HVU A;  4JRP A;  2CH4 W;  1VQ5 Q;  3INZ A;  3I55 A;  1Q86 R;  3HRU A;  1ZBJ A;  1Q82 U;  4L5G A;  4M78 C;  2FPE A;  3G6E T;  1YP5 A;  3O8V A;  4KUI A;  1YHQ Q;  3OYK A;  3JB9 D;  2HKN A;  5LJ3 h;  1I07 A;  2KE9 A;  5GAO p;  2FZC B;  5L23 A;  2KVQ G;  1TOV A;  4M7A B;  1WHJ A;  2CSQ A;  1V29 B;  1VQM A;  3I55 T;  3QJ6 A;  3E2U A;  4C0D B;  4OMQ A;  5J3B A;  4M78 A;  2M0Y A;  2RI5 A;  3JCM b;  3M0S A;  3VU3 C;  1X2Q A;  1YJW Q;  4CC7 A;  1SF9 A;  1MUZ A;  4C92 D;  2SEM A;  1VQP T;  1TG0 A;  4E7H A;  2QXF A;  3SHW A;  1VQM T;  3JB9 H;  1U8R A;  4RTX A;  1IB8 A;  2DYB A;  2MWO A;  2VV5 A;  3QDR B;  4FIB A;  1ZUU A;  1K73 C;  4XU2 A;  1NLO C;  3VRY A;  2PUK B;  1GCQ A;  3CCS T;  3L2V A;  1M90 C;  4F16 A;  1M8M A;  4JJC A;  2HAX A;  2NUT A;  1NPR A;  4M7A F;  2DIQ A;  2JXB A;  3NHN A;  4FYV B;  2KDS A;  2EQM A;  2MCN A;  3QII A;  4LNP A;  1VQ7 A;  1S72 A;  1NYG A;  2L0A A;  3VYG A;  2QG9 B;  4M75 E;  2RHY A;  3CXC P;  4XTW A;  1U5S A;  2A7Y A;  4J83 A;  5LJ5 e;  3OSS C;  1I5L A;  3JAM E;  2DNU A;  2I0N A;  3VV0 A;  3UAT A;  4GY5 A;  1Q7Y U;  1UJ0 A;  3RKY A;  2X9H A;  3G1J A;  1BIB A;  3L2W A;  3F70 A;  4N4H A;  3UA7 A;  1WJQ A;  4C8Q C;  4BE2 A;  3NGP A;  2ZPG B;  3VKI A;  4RTT A;  1X27 A;  2DE0 X;  2NLU A;  1QVG S;  1OEB A;  2DAQ A;  1OV3 A;  3V8K A;  2ECZ A;  4EMG A;  1WHH A;  3M0T A;  3CPW S;  2AKK A;  3LWI A;  2XDD A;  2DF6 A;  1KJW A;  2WSF E;  3M4G A;  2K57 A;  1VIE A;  1V76 A;  4AFU C;  2QAZ A;  1M3A A;  2MOX A;  3TRE A;  2YUN A;  5GAN 8;  3EH1 A;  2MWP A;  2OTL A;  2CP6 A;  4EIK A;  3MO8 A;  3RIR A;  2DVJ A;  3KFV A;  2J06 A;  3M9Q A;  4PJO A;  3OW2 S;  1Y96 B;  3RKX A;  1QCO A;  2JS2 A;  3DB4 A;  3QO3 A;  3QWX X;  3QXE B;  4KGX B;  3CC7 A;  1XQH A;  4GLK A;  4M75 C;  2JZ2 A;  1K9M U;  3OS5 A;  1VQN A;  4BI3 A; 
#chains in the Genus database with same CATH homology
 5GJW B;  1G2B A;  2K3B A;  1GL5 A;  2FG0 A;  4HCK A;  1CSK A;  3VS1 A;  1ABQ A;  3SEM A;  1SHG A;  1PKS A;  2DL7 A;  2EGC A;  2IIM A;  1RI9 A;  3C0C A;  5FW9 A;  1GCQ C;  4RTW A;  2KRM A;  2V1R A;  1VYT A;  1M3B A;  2EYZ A;  2L3Q A;  2RQT A;  3R6N A;  2VWF A;  4ORZ A;  1Y57 A;  2EPD A;  1K4U S;  1J3T A;  3EGU A;  1CKB A;  2JMC A;  3U23 A;  1UE9 A;  1SSH A;  1PKT A;  2HSP A;  1HSQ A;  1JO8 A;  1Z9Q A;  2PNI A;  2P4R A;  3VS0 A;  3NPF A;  4K11 A;  3PVQ A;  3H0H A;  5EC7 A;  1YNZ A;  3A98 A;  2O9V A;  1AWO A;  3M0U A;  2PZ1 A;  2DBM A;  2FPF A;  2FPD A;  2KBT A;  4OMO A;  2ABL A;  1GBR A;  2FEI A;  1UGV A;  4CC4 B;  1QLY A;  3I5S A;  3TSW A;  1E6H A;  1UDL A;  2EYY A;  1WXT A;  2DX1 A;  1ZUY A;  4J9D A;  5FWB A;  4F17 A;  1I1J A;  2RQW A;  2DMO A;  4F14 A;  2CUB A;  5ECA A;  1QKX A;  4OMN A;  3VS5 A;  2LX7 A;  1KSW A;  1W70 A;  1X69 A;  2F2W A;  2RMO A;  2YSQ A;  4AFS C;  2J05 A;  4J9C A;  4JJD A;  2HBW A;  3H41 A;  2DJQ A;  4RTY A;  2O31 A;  1M30 A;  1NYF A;  2D1X A;  4JZ3 A;  1B07 A;  2LZ6 B;  3I35 A;  2RN8 A;  2J7I A;  2J6O A;  2NWM A;  1I0C A;  1WLP B;  1YWO A;  4JPB W;  1NEB A;  1A0N B;  1JEG A;  2FO0 A;  1OPK A;  1XOV A;  5IHI A;  1ZUK A;  4HXJ A;  2YUP A;  5FWC A;  2JS0 A;  1UG1 A;  3REB B;  1WI7 A;  1VYU A;  4QT7 A;  1N5Z A;  1KIK A;  3RNJ A;  2OAW A;  3TSZ A;  4RUG A;  3PE0 A;  1UUE A;  2F2X A;  2GNC A;  2K7A A;  4AFQ C;  4IIO A;  2K79 A;  2ROT A;  3CQT A;  4HVW A;  2CH4 A;  2KXC A;  3VS3 A;  1AZG B;  2A28 A;  2O9S A;  2DL8 A;  2DLP A;  2DRM A;  3I9Q A;  3VS2 A;  1Z9Z A;  1NEG A;  3VRZ A;  5IH2 A;  1U3O A;  2JT4 A;  2KRN A;  1TUD A;  2JTE A;  2CDT A;  1QWF A;  1NLP C;  2D8H A;  3H0F A;  3VS7 A;  2F2V A;  3REA B;  4DEY A;  2J6K A;  3EHR A;  1PWT A;  2AZV A;  2XMF A;  2RQV A;  1YWP A;  1H3H A;  1FMK A;  1WDX A;  2HDA A;  2L2P A;  1LCK A;  4OMP A;  1RUW A;  4Z8A A;  1K0S A;  1JXM A;  4CC3 A;  2C0I A;  2FRY A;  4M4Z A;  1JU5 C;  2BZX A;  2VKN A;  4Z89 A;  1SRM A;  2PTK A;  2DA9 A;  2KXD A;  1UJY A;  3JV3 A;  2ED1 A;  2KT8 A;  1YN8 A;  1WFW A;  3M0R A;  1WXB A;  2GTJ A;  1K0X A;  4RTV A;  3IQL A;  2GGR A;  2YUO A;  1MV3 A;  2LJ1 A;  1PRL C;  1HD3 A;  2M51 A;  2DL5 A;  2NUZ A;  2CSI A;  1E7O A;  2EW3 A;  2J6F A;  2YDL A;  2KNB B;  1K1Z A;  4A63 B;  2CT3 A;  1E6G A;  4WCI A;  4RTZ A;  2E5K A;  2L3P A;  2K6D A;  1Y0M A;  3EHQ A;  2HCK A;  4IIM A;  1T3L A;  2D0N A;  2DIL A;  2GQI A;  2LCS A;  2JMA A;  2OJ2 A;  1SRL A;  1AVZ C;  1W1F A;  1AWJ A;  2EQI A;  5IHK A;  2AK5 A;  3VS4 A;  1QWE A;  2EGE A;  3LH5 A;  2KR3 A;  4J9F A;  3QWY A;  5IXF A;  2AZS A;  1WXU A;  2OI3 A;  1AD5 A;  1GFD A;  2DL3 A;  4X1V A;  1RLQ C;  1AOJ A;  2W10 A;  2EYW A;  2ROL A;  4D8D A;  1OOT A;  2RF0 A;  3RBB B;  3FJ5 A;  2DL4 A;  1X6B A;  1X43 A;  4LN2 A;  2KYM A;  2D8J A;  1ZLM A;  1TUC A;  2RQR A;  2LMJ A;  1K9A A;  2KYB A;  3ULR B;  2EYX A;  3M0Q A;  1WX6 A;  5GJV B;  2LP5 A;  1UTI A;  4JJB A;  3O5Z A;  1H8K A;  3TVT A;  5IXB A;  1KFZ A;  1RLP C;  2CRE A;  2ENM A;  1K76 A;  2JM8 A;  4GLM A;  1B3Q A;  1UHC A;  1BBZ A;  2EGA A;  2HEQ A;  2A08 A;  1U06 A;  1ZX6 A;  1CKA A;  5IHN A;  2RQU A;  4ZNX A;  4HVU A;  3EG1 A;  4FSS A;  1AEY A;  2CH4 W;  1H92 A;  2KEA A;  1SHF A;  1ZBJ A;  1AZE A;  1BB9 A;  2H8H A;  2CT4 A;  1NG2 A;  2FPE A;  1YP5 A;  4Z88 A;  1I07 A;  2KE9 A;  4J9E A;  4E6R A;  1ARK A;  2GBQ A;  5L23 A;  2CSQ A;  5I11 A;  1VYV A;  2O2O A;  2B86 A;  2LQN A;  3EG3 A;  4OMQ A;  4RTU A;  2M0Y A;  2C0T A;  1X2K A;  4AFZ C;  3M0S A;  1PHT A;  4D8K A;  1X2Q A;  1T0J A;  1IO6 A;  4CC7 A;  2AKL A;  1MUZ A;  2SRC A;  2JW4 A;  1OPL A;  2EBP A;  1MV0 B;  2JM9 A;  2SEM A;  1TG0 A;  2DRK A;  3SHW A;  1WYX A;  2YT6 A;  4LE9 A;  4R0K A;  4RTX A;  2DYB A;  1UEC A;  3EG0 A;  2CUD A;  4ESR A;  1EFN A;  1ZUU A;  2ESW A;  2BZ8 A;  1NLO C;  2KT1 A;  4J9B A;  3VRY A;  4HVV A;  1GCQ A;  1QKW A;  1NM7 A;  4F16 A;  1M8M A;  3NMZ C;  2BZY A;  2LJ3 A;  4JJC A;  4LUE A;  1V1C A;  1W6X A;  2ED0 A;  2K9G A;  2VVK A;  2JXB A;  3NHN A;  5HCK A;  2MCN A;  1HJD A;  1GFC A;  2DBK A;  1G83 A;  2C0O A;  3M0P A;  4LNP A;  3UA6 A;  4AG2 C;  1NYG A;  4J9I A;  2L0A A;  2L3S A;  4GBQ A;  4OML A;  1T0H A;  1PRM C;  1VA7 A;  1PNJ A;  1X6G A;  1U5S A;  4J9H A;  1WA7 A;  2EKH A;  1BK2 A;  2KRO A;  2DNU A;  2I0N A;  1ABO A;  2MIO A;  3UAT A;  1UJ0 A;  2DM1 A;  2W0Z A;  2FRW A;  3H0I A;  3THK A;  3GBQ A;  4OMM A;  1WIE A;  3UA7 A;  2O88 A;  3NGP A;  2RNA A;  1AWW A;  2V1Q A;  1QCF A;  2LQW A;  4KRT A;  4RTT A;  1BU1 A;  1X27 A;  2DE0 X;  2QDL A;  4J9G A;  1AWX A;  1OEB A;  3PVL A;  2KRS A;  4JZ4 A;  3ZL7 C;  1OV3 A;  1UHF A;  2X3X D;  3UF4 A;  2ECZ A;  1M3C A;  3M0T A;  4AG1 C;  2AKK A;  2A37 A;  2BTT A;  4LUD A;  2DF6 A;  1FYN A;  2KGT A;  1KJW A;  1SPK A;  1SEM A;  2K2M A;  2LJ0 A;  2RPN A;  4Y92 A;  4AFU C;  1M3A A;  2MOX A;  1GCP A;  2YUN A;  2G6F X;  1YCS B;  1JQQ A;  1JXO A;  3I5R A;  4EIK A;  3VS6 A;  3EG2 A;  1M27 C;  2DVJ A;  1UFF A;  2GTO A;  2LNH B;  1GBQ A;  3KFV A;  5I22 A;  2J06 A;  2JS2 A;  1ZSG A;  2X3W D;  3QWX X;  4DEX A;  1S1N A;  1GRI A;  2EVR A;  2YUQ A;  2A36 A;  1T3S A;  4CC2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...