1N60A

Crystal structure of the cu,mo-co dehydrogenase (codh); cyanide-inactivated form
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
161
structure length
161
Chain Sequence
KAHIELTINGHPVEALVEPRTLLIHFIREQQNLTGAHIGCDTSHCGACTVDLDGMSVKSCTMFAVQANGASITTIEGMAAPDGTLSALQEGFRMMHGLQCGYCTPGMIMRSHRLLQENPSPTEAEIRFGIGGNLCRCTGYQNIVKAIQYAAAKINGVPFEE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Carbon monoxide dehydrogenase small chain
publication title Catalysis at a dinuclear [CuSMo(=O)OH] cluster in a CO dehydrogenase resolved at 1.1-A resolution
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 49
structure length 161
sequence length 161
chains with identical sequence D
ec nomenclature ec 1.2.5.3: Aerobic carbon monoxide dehydrogenase.
pdb deposition date 2002-11-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00111 Fer2 2Fe-2S iron-sulfur cluster binding domain
A PF01799 Fer2_2 [2Fe-2S] binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.120 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 [2Fe-2S]-binding domain 1n60A02
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1n60A01
2M56B 3AEDB 1RFKA 1AYFA 1KFYB 1ROEA 1RWSA 1XO3A 3B2GA 2W3SA 3P4QB 1E0ZA 2BS4B 4KX6B 1JWAD 2WDVB 2CJOA 3P4PB 4FXCA 3AE9B 1F0ZA 1NI3A 3AE8B 3LXFA 3AEBB 3CWIA 2PIAA 3AEAB 4YSXB 1FO4A 4YSYB 1SB3C 1JQ4A 4USAA 1JW9D 1QOFA 2QJLA 1EWYC 1WXQA 5C2TB 5G5GA 3AE2B 3AN1A 1IUEA 1XLOA 2CJNA 2PVOD 2WLBA 3P1MA 3P63A 1CJEA 5EE9A 1DOYA 4N59A 2W54A 4US8A 1V97A 5G5HA 2JQRB 1TKYA 1OQRA 2BS3B 1N62A 1FMAD 2MJEA 1VDVA 4YTPB 3W9CB 5C3JB 2W3RA 2B76B 5AUIA 1FIQA 3AM9A 1JWBD 1VLBA 1NYQA 1CZPA 2OHFA 2QIEB 1TKGA 2Y5CA 3VR8B 1N5XA 2W55A 1N5WA 2N0SB 2EKIA 3AECB 3AE3B 2Q5WD 3NS1A 3NVZA 1FFUA 4WWMA 4ZHOA 1GAQB 3LB8C 1ZP0B 2WU5B 1PFDA 1E9MA 1OQQA 3VRBB 1WRIA 4C7YA 2E3TA 3NVVA 1J7CA 5EE3A 1VJKA 1NENB 1FFVA 4N6EB 2WDRB 1ZXIA 1T3QA 2H89B 3RPFC 3ETRA 2K5PA 4ZOHC 1JRPA 1FXAA 2DBYA 2K9XA 4YTNB 1FM0D 3SFEB 2WQYB 2DWQA 2PKOA 2WU2B 1WWTA 2WP9B 3CIRB 5GXGB 4C80A 1KRHA 2PVGC 2ACZB 1QOAA 2KAJA 3WCQA 1ZOYB 2L52A 2MJDA 1ZUD2 3DWMA 2JX5A 4YTMB 1PUTA 1KF6B 1JROA 4HRSA 1TJEA 1E10A 1TYGB 3P4SB 3ABVB 1FRRA 3AE7B 1WYGA 1L6VA 1J7AA 1L0VB 1E7PB 3B2FA 4HROA 4IDIA 1N60A 1L6UA 1XLPA 1DOIA 3AEFB 1J7BA 1QLBB 1RM6C 3AH7A 1SF0A 3L4PA 2WS3B 3BIID 5EE1A 4YSZB 1NEKB 4C7ZA 3VRAB 1YJIA 3AEEB 2AX5A 2K22A 3HRDD 1QOGA 1UWMA 4YT0B 1AWDA 1QOBA 1A70A 2CU3A 2M19A 2MH7A 4LTUA 4YXDB 4US9A 3AE1B 1L5PA 3W5UB 2L83A 5AUKA 3KWLA 4ITKA 1R7SA 2FBWB 3FAHA 1JALA 4A9AA 4JWSC 2BS2B 3HVZA 5H8YE 1PDXA 2KMMA 1V8CA 1XLNA 4ZHPA 1NYRA 1WGKA 3W5VB 1TKEA 3ZYYX 3AB5A 1YJJA 4N58A 5H92C 2G1EA 3NRZA 3HUIA 4P6VF 4WQMA 3EUB2 1DOXA 3AE4B 3AEGB 5EE0A 3AE6B 1YQ4B 3NVWA 3AE5B 1E6EB 1RYJA 3AMZA 3FC4A 2BT6A 2WDQB 3DWGC 1GPXA 3AV8A 5MPOA 1NVID 1FXIA 1OFFA 3PO0A 3VR9B 2LEKA 1XLQA 2MJ3A 1N61A 1I7HA 1YQ3B 1SIJA 2H88B 3P4RB 4JWUC 2HTME 1QT9A 3B9JA 3SFDB 3SR6A 1QF6A 1N63A 1B9RA 1FRDA 1DGJA 3NVYA 4JX1C
chains in the Genus database with same CATH superfamily
1GJZA 3HIZA 3ZUNA 2HHWA 4P0PB 2W8LA 3TBLD 2KJ9A 3AU2A 5ALEA 2V4RA 3KZIU 4QIWF 4JK1A 3JPQA 1JX4A 2HSZA 3BDPA 1SB3C 4NL9A 1BT0A 2ZJ5A 1WI0A 2MBEA 3PVLA 2W9CA 3L16A 1WXQA 1F0MA 3KHHA 5J0SA 2I5HA 1Y8RC 2KMDA 2DYMA 3HM3A 3SENA 3CYMA 5KG2A 5KFZA 2K4EA 3JPSA 5J2AA 1WCLA 4WURA 1Y88A 1NZBA 8ICGA 1ZQFA 4GIBA 5DG7A 1HZ5A 3PZ7A 2LKYA 3N7PD 5AUIA 4J6IA 5HI1A 4TKNA 4ZRKA 3PV8A 4LDTD 7ICIA 4RPYA 1UNSA 2KMAA 2YLMA 2YEPF 5BMHA 4G3IA 3KD3A 3SYZA 3OSPA 1V49A 3K9OB 3NZUA 2WF6A 4YMMA 4EZKA 2RDJA 5IIMA 2VH2A 5J2DA 9ICOA 1J2NA 3QC8B 3LWLA 1XSPA 3FILB 4F93B 3MDCA 4QZBA 2R18A 1U4AA 4K3BA 1Z3EB 3W2DA 2PEAA 2QB1A 2MHJA 5JHAA 2W04A 2WP9B 3TFRA 3TI0A 1FCCC 1GG3A 1QOAA 1C4AA 2IO1B 2BDUA 2ZJAA 2AQ3B 5J0OA 2L00B 1CRXA 4B9SA 4NNJB 5IIKA 5EOZA 3APDA 2QB0B 4X57B 2KX0A 4LNKA 2ZUCA 1WYGA 4Q8FA 4DOAA 2D5GA 4UB1A 1Q3UA 3AEFB 2BCSA 4I6PA 1DK3A 3CSFA 4TUQA 4RQ2A 4BKSD 1NEKB 2AQ1B 3TADA 2DPIA 4ZRPA 4JWMA 1SGHA 1ZD5A 1K1QA 3VH4B 3MC1A 2HHVA 3C21A 4LZGA 4C8NA 5EDSA 1AW7A 3B0YA 1OEYA 3C5FA 3AQFA 4CF3A 4C4TA 5BPCA 2BS2B 3THVA 1OUQA 3CSTA 7ICHA 1TY0A 2XY5A 2OCEA 5GTHU 4K81A 1M6YA 2KVCA 4M0AA 9ICQA 2K8CB 1YJJA 3PNCA 1ZQLA 2BPFA 2KD0A 2L0TA 4NQLB 5G55A 5EE0A 1KTQA 3R8BA 2KFNA 4S0RA 2VA8A 2KDBA 1GPXA 2KNJA 1ET9A 5KFIA 1YMHE 1COKA 2G4DB 3OWEB 4Q2JA 2EZZA 3ZTDA 4MSMB 2ALZA 4J9PA 2V3SA 2QC8A 3SFDB 3OJSA 4II2B 3ZGZA 4HAIA 1YQBA 2FE8A 3AEDB 1SZPA 3HT3A 3GIMA 2WXKA 9ICEA 1QKZA 1L3SA 4DL5A 2WXGA 4DBGA 4W9EA 2W9NA 3IRUA 1NJXA 2A19A 3HKZC 4PHEA 2DQNB 4KMOB 5J2BA 1J97A 4JPSA 1L3TA 2ZIXA 5DDYA 3K9PB 4QZAA 8ICQA 3H0MB 2BCUA 2AL3A 5KFAA 5D7GA 3RJFA 4ED2A 4J9LA 2ZXIA 4I29A 2C2RA 2LVPA 5KG5A 1KLUD 4GN1A 3ZNID 2LGDA 3UXOA 2R2QA 1K5OA 3AECB 2EKIA 2G09A 4UAZA 2D3GA 1D9DA 4EBDA 3ZVVA 4CRXA 3H1UA 2DKXA 2K39A 3BVMA 5ALJA 2WX1A 3MHZA 2HVIA 4NY8A 1U47A 1OTRB 1UBQA 2Y1JA 4P1CC 2YX8A 4OZCA 4UBCA 1HUOA 4YL8A 2ISPA 3KBBA 5KG7A 1FEHA 4QZHA 1KBUA 4GIVA 4MH8A 4O3PA 4F4YA 4RQNA 1FXTB 4FJVB 3A0HU 3M7DA 8ICTA 1WJ4A 3SV4A 5ALPA 3CF6E 1UUPA 1RAXA 3VUXA 4A3PA 3UMBA 3MR2A 1QSLA 4EEWA 5KFHA 1KF6B 4DHJD 5I4DA 2PI5A 3AULA 3IM1A 4F4ZA 3RJIA 4UAUA 1WE6A 3MFGA 4CF5A 4KTQA 2KX3A 4RFBA 1WIAA 1IGDA 2BGFA 2KN7A 4ED8A 1NZPA 2KTRA 1WWUA 3NY5A 2EKEC 4DFJA 2MH7A 1ZQZA 4US9A 2ZZPB 4F5OA 5HP4A 3EECA 2UVWA 1SGGA 5FR3A 2A1JB 1JALA 1ZKHA 3NUQA 4IQTA 1XLNA 1WFYA 1I4RA 5ALYA 4LZDA 2J4XA 2NRTA 2N1VA 2Y0SC 3O0FA 3D2NA 3FYHA 4N58A 4OZBA 2JYEA 4WQMA 3NRZA 5DB6A 2WAQF 2ZVNA 9ICUA 3WAMA 5J2HA 4QZCA 4MFFA 3RULA 4HYKA 3MR3A 4TURA 2JH1A 5KG0A 5KFRA 2PXIA 3QZ8A 3WAOA 1OFFA 4AJYB 2ZW0A 4RUAA 4EBCA 2BVCA 3TSSA 2ZTEA 5ALMA 1ZXHA 2F44A 3F2DA 3WALA 3GV8B 1ENFA 2LFIA 2NO5A 1KFYB 1U45A 2W43A 1L8OA 3JW0X 3T9LA 2DX5B 2XC9A 2EELA 4F92B 2HOFA 1Q3VA 9ICGA 2BGWA 4DXGA 3Q8RB 3WK8A 4LJXA 4B9NA 3BQ7A 2Y3AA 3AE2B 1A76A 3M6KA 4UAWA 3WKEA 4CGZA 1IM4A 3K1ZA 4RT3A 5HR7A 1WR1A 3QU5A 4RQMA 4NM2A 2K4HA 2G0AA 3PSFA 3V7KA 1P0RA 2JZZA 2QCZA 3ALBA 1X42A 2M9NA 2NMQA 4TUPA 3V6CB 1C77A 2BKEA 2ZPNA 3AE3B 3I1YA 2BHNA 2ODGA 3Q8AA 4NWIA 2O6KA 9ICAA 5D94A 2NRVA 4BOSC 1D5MC 3ORYA 1GAQB 1YZ7A 2KFJA 1NNLA 4RMAA 5EE3A 4Y2VA 3RB4A 3V72A 2N1WA 3JPRA 4CDGA 3ZDMC 2NR2A 4U7CA 1I4GA 1SXEA 5B5EU 1RXVA 3BYTB 3V6HA 2LGYA 4OVUA 5KFTA 2AQ4A 2RHFA 5AZFA 2KAJA 1R4NB 1BPYA 3DBHB 1Y56A 5JH5C 4HWIB 4YWGG 2ASQA 1PUTA 4LNNA 5BMGA 4EKUA 2KE7A 3VDZA 4RGOS 4QZIA 2V4IB 5JU5A 2K4IA 4IRCA 4C8KA 1L0VB 1JWMD 4DQSA 4MDKE 2H3QA 4TUUA 2IZVB 1A0PA 2YB4A 3F53A 2ZVOA 3L4PA 3I63C 4DSEA 3V05A 4KLHA 1YJIA 2XO7A 4ED6A 3HRDD 5KFVA 2ZXHA 3Q69A 2K6DB 2M19A 4J9NA 2K89A 3LWMA 5DQHA 4GXIA 1P7EA 3BZCA 3VQIA 9ICSA 2VZKB 2KHVA 1RXWA 2RRDA 1SL0A 1T0YA 2KWDA 4B9KA 2H3FA 2GBJA 4ZHPA 2M8SA 4ECVA 4ECTA 1WUDA 2FPLA 2RLTA 1TAQA 1RLFA 3PW7A 2IA6A 5DPSA 2BR0A 1F52A 2P35A 3I28A 3RAQA 4ANXA 3NVWA 1ZPSA 4B6WA 1KJTA 3RB6A 3C29A 5CB1A 2K8BA 3U7ZA 1IGCA 2KKCA 3Q8CA 5AM2A 5ALKA 4WJOA 5BO4B 4JIOU 1XC9A 2D07B 3ZXRA 3AE8B 2FDRA 1L6NA 4HK2A 5CRXA 3UMGA 3U2SC 4UDUC 4BKGA 1E0ZA 2V4QA 2NBVB 4ICVA 3U26A 1NK4A 3MJWA 5AI5A 4K4HA 5IIJA 5BOMA 2H3IA 2WYQA 5HMLA 2HHTA 2GLSA 4MEYA 3CWIA 5J17A 4MM3A 1C79A 3KYCD 1EWYC 3NHEB 5ALVA 4RZRA 3ZD8A 5BYSA 4R64A 1WJ6A 1WX9A 9ICBA 5HHDG 4P7IA 1RQLA 3ONNA 1TTNA 5HMMA 2V1YA 3LJ3A 4N9F4 5J0RA 2YMPA 1SZHA 3T8MA 2V3NA 5E6JA 5AKLA 9ICMA 5T8IA 1U48A 1R4NI 1KFSA 2HTHA 2JHDA 2JZBB 1JWBD 3BS5A 3UQ0A 2YMMA 2Y5PA 1N5XA 4O9MA 4R65A 3RZWC 3WAPA 4FHJA 3QU4A 2LI6A 3WK7A 1WM2A 2AQ2B 4DO9A 4KLFA 4AWJA 4ICAA 1FCLA 1E9MA 3ZRFA 4FS1A 3SD5A 3VRBB 2DFLA 2EH9A 4NJCA 4PYZA 3QX1A 2BCQA 2R8JA 3R3MA 1PYWD 2JEFA 4FA6A 4KDIC 2MEKA 5AKHA 2XN9C 4YMNA 2ZJ8A 4EUTA 1HIWA 1XNSA 3TMPB 1ZQ1C 3V61A 2Y1IA 1KOTA 4CHKA 4NJ8A 4E0DA 3UGBB 1IBXA 2ZIUA 2G08A 1MHXA 2JX5A 4M9JA 1KKXA 2ZG6A 4F50A 2JMGA 4Y2JA 3A9JB 1L6VA 3V6EB 3PTFC 4IR9A 4K1RB 2RDBC 1R4MB 1DOIA 1XO1A 3WIMA 1XCTL 3SAGA 1BXTA 1J7BA 8ICPA 1C4PA 2LHDA 3W1SC 1SF0A 1L7OA 1PUZA 2VJ5A 3IG5A 4FZMA 1PZNA 4DDGD 1UWXA 2YEPB 3VCBA 4CQNA 3DDCB 4YQWA 2W7OA 3NG0A 2IHNA 3GV5B 2ES6A 4FLHA 1PVRA 1NBFC 3JYUA 4XDCA 5AK6A 3PSEB 4M9GA 1V6EA 3DBSA 4MEMA 5KT3A 3FAHA 1OQYA 4HPLB 1E7UA 4QNLA 5C23A 2E5SA 2UWQA 1DGSA 4C8LA 2LGSA 2DGZA 4Z6FA 7ICGA 2IOHA 2N4FA 4FN2A 3W5VB 4NAWB 3L54A 3M95A 1C1YB 2N9XA 3H40A 7ICEA 2O6VD 1QH9A 2JZPA 1L0XB 4RF1A 2XIDA 3AE6B 2KG5A 5CHFA 4DQQA 4WWPA 2E6XA 4UATA 1V80A 2BKRB 3BZKA 1HXYD 4DQOC 1UHUA 4J9KA 1WGGA 4EZJA 1UH6A 4KKJA 1SIFA 3C1YA 2YVCA 4JX1C 1S0VA 2M56B 3LYYA 1AYFA 1Q10A 3B2GA 1EF5A 4ECZA 2BS4B 3BS7A 2FUHB 3WKAA 4MGKE 1IXRA 2REXA 3AU4A 2KKPA 3GZFA 4OHJA 1TAUA 1V9PA 3WK5A 5CHWA 4Y2YA 3QWZB 4RM9A 1LGRA 2PVOD 5KFOA 2JZ3B 4PH5A 3EC8A 4XQ8A 3WK4A 4NZLB 1GB1A 3RJHA 2WXRA 2ZPYA 2KQ7A 4URKA 2IO0B 4QWAA 4M47A 4IWOA 2OM6A 4UB6U 5J18A 4H2AA 3VR8B 2R8IA 3ZDBA 2M17A 2Z7JA 1K50A 3QUCA 3H0LB 4KSKC 5AKXA 4C00A 3UI3A 2KKVA 5E6PA 1URJA 2CN1A 5DQGA 4KGSA 1R4MI 3DCGA 3BK1A 2LUEA 3A4SC 1KL9A 4MH0E 1SE3A 3H7IA 1SSNA 1X9SA 1NENB 3M8SA 8ICAA 2IDYA 2AGPA 1SJHD 3RTVA 2FE9A 1BPXA 3RR8A 4QIWC 3G6XA 5ALWA 2WQYB 2FUG1 3FKYA 4G11A 3QYPA 2BBCA 2L7RA 1WWTA 4KV2A 2J0MA 4OZAA 2KP7A 2LI5A 2AQ0A 2YMLA 4QW8A 3ZI4A 1C78A 2MBOA 2L52A 3NZSA 1RDFA 8ICZA 1SE2A 3OJUA 4Y2PA 5AI9A 3WU2U 1VCBA 3UXPA 1B1ZA 2P66A 1HEZE 2KTFA 4IWPA 3U52E 4DL7A 3ZNHB 3PT2B 1JN3A 5DPTA 4BDPA 1RM6C 5JRTA 3OG5A 1BVSA 3TACB 2ZNVB 3NJTA 3T3OA 2BWES 2KLCA 4RGNA 5ALXA 2PI4A 2LD9A 2LHEA 7ICFA 3A1QB 1KLVA 3IT4B 4GMVA 3HJEA 4FBUA 2EZXA 4II3B 4PHAA 1X6IA 1OW5A 2BCRA 2WXNA 1E8XA 3KWVA 4UB5A 1F9JA 4BJQA 2MBBB 4DQPA 4J9OA 2WXFA 2QARB 2KMMA 1NKBA 3N28A 2C7NB 1WGKA 1LXDA 1Z00A 3EA6A 2K60A 2OJRA 1J0GA 2JXXA 2LXCA 4C4RA 2L76A 1SE4A 2GI9A 3AE4B 2OYYA 2HHXA 1EU3A 4M6WB 1RYSA 4UB3A 2K6QA 3EPGA 1RYJA 3R7RA 3AMZA 2PMZC 3IHQB 3CP8A 2I1KA 5ALSA 9ICJA 2G5IB 4KLQA 2HOQA 4LNIA 1I42A 3TEXA 4PS8A 3V3XA 3NRWA 2CHWA 2WXOA 3I76A 1ZRNA 2LMRA 2ZCBA 2HTME 3MABA 2YTUA 2KWUB 4RQ1A 4MF8A 4EYHB 1T3NA 3TL5A 3NVYA 3P4QB 5DQIA 4A8XC 2ZIWB 4BWJA 2VIXA 2RQ5A 2ZUBA 4DXAB 4JB3A 1VD2A 4UB2A 4EYIB 5ALQA 2CJOA 4O0IA 5BYRA 5J2JA 2KZ3A 4ICUA 2J52A 2NO4A 4AP9A 2QJLA 5AKZA 5DBAA 4HEA1 1F77A 3V7LA 3PLVA 5CP2A 1IPGA 4N59A 3T5HA 1D9FA 2GB1A 9ICIA 5IP4D 4F4WA 1K1SA 4YTPB 4XDDA 3OHAA 3KHGA 3A9KB 4PHDA 2XY6A 2KVRA 1VLBA 3N7SC 4O3RA 7ICVA 3GIKA 3AUOA 4CNQA 3PGEA 2DAJA 5KG1A 1D6EC 4ZHOA 1X6JA 5AKIA 2LYHA 5K4LA 3ZIMA 2BYEA 2RPQA 1JMLA 4I2EA 4GDLB 2QILA 7ICUA 5CHGA 1YT3A 2F1HA 5L1MA 4B9UA 4BXOB 2H89B 5DDMA 4TSSA 4B6JA 2PFPA 2DBYA 2K9XA 3RF9A 3ZQ4A 2N9LA 4PPXA 5KFKA 2KJRA 3OJ3A 5AKKA 5ALOA 3A0BU 4ELTA 2NBUA 3Q3NC 3D32A 4XRHA 5GXGB 1V1PB 3M9MB 2ACZB 3PO4A 1EU4A 2NS5A 1ZUD2 2HMXA 4B9TA 3GIIA 2NCNA 2LASA 5JHBA 1MPEA 5CX3A 1KLNA 4DLEA 4NAMA 2NRWA 3M6ZA 4B9MA 3AE7B 4GB9A 3N7RC 1IYFA 2CXYA 3BQ1A 3LVVA 2WHEA 1C20A 4HPMB 4OVZA 4RNAA 4UB8U 2KZRA 2IO3B 3VFKA 3S2AA 5KFCA 2FAZA 4WWOA 3PLUA 1P9DU 2LRWA 4WWNA 4BUGA 1ZQSA 2JR5A 9ICFA 1L4DB 1E5WA 2MU2A 3N1YC 4ITKA 2BTEA 1SEBD 1YNTE 4UAYA 1MG8A 4GU2A 3QU2A 4P0PA 1V8CA 1V5OA 4A6QA 3EYZA 1TS2A 2D10A 3H8SA 3FDSA 2RMMA 4EEYA 4DF8A 1ZQHA 3QEAZ 1BNPA 4RQ8A 3GZNI 4EZ6A 3KTQA 4IW0A 3PHXB 1LVHA 1VZ8A 4Q45A 5ALUA 2BCVA 3BZDB 2IBIB 2PFQA 3RD2A 3H8MA 8ICFA 4O3OA 4AYBC 1EXNA 2BQUA 2IMWP 3PO0A 2KDFB 1I7HA 3G6YA 4RQ7A 2G07A 1NK7A 4GLXA 2WF5A 4P4MA 2F1IA 4KLEA 2JH7A 1AN8A 2AH5A 3URYA 3ZNGC 4KLMA 1J8CA 3WK6A 4TV3A 5KT4A 1MC8A 1FNWA 2IO2B 3SD7A 2W9BB 2LGIA 2OXOA 2Y9UA 2LUMA 2X38A 4ZRIA 2DL0A 4USAA 2BF8B 2KWCA 1JQ4A 2IPKD 4ARIA 5G5GA 3FILA 5IIOA 3MR6A 3P63A 3I9V1 5KFWA 3SU8X 3M63B 4C0ZA 2NTSA 4DHZB 2R8HA 2M4NA 2ONQA 4G0NB 4F1SA 1Z1VA 2CHXA 2JRHA 4IM3A 3GDXA 2BS3B 3E56A 4HXDA 4RF0A 1BPEA 3QXGA 4DSKA 1NJYA 2OJWA 4W9IA 5ALFA 5KTQA 4QAYA 5DPRA 4KITB 1F2RI 1G6JA 4QW9A 1ZQOA 3UIPB 3MHSD 3ZRCA 5AKYA 4OJPA 2CPRA 2QB0A 2LHTA 1HEKA 4EX7A 2IGGA 2LMCA 4TQRA 4UB4A 3NOBA 4OD0A 4YCXA 2LYAA 1WRIA 1ZQAA 1SBBB 3PSPA 5ALZA 4F2SA 1AARA 1J7CA 5D4BA 3R2TA 1XT9B 2EANA 1ZQQA 3AV8A 1FXAA 2O2VB 4MFAA 1MJDA 1WXSA 3TEWA 1CI4A 2MUTB 4RQ0A 4KX3A 4C4SA 4ECRA 3RT3B 2DWQA 2CRXA 2N7EA 2LGXA 1V38A 3PMLA 2ASLA 2J6SA 2R61A 1YD8U 4IUMB 5J2IA 2KHQA 1EM7A 2FIDA 4HJGE 2MJDA 2WNMA 3ISCA 4M9HA 5LXIB 1PVQA 5F9NA 3A33B 3BYYB 2HJ8A 3SEIA 4XGAB 1ZW7A 5DLFA 2B21A 1TE2A 1WXMA 3HPOA 2GBNA 5ALNA 3IP4B 1WX7A 4HROA 4EX6A 1N60A 2F76X 4RQ3A 3T3FA 1N2XA 2KQ4X 3H6NA 3IHPC 4KLTA 3BIID 5EE1A 8ICWA 1UD7A 1ZD4A 5CEHA 3RJEA 3Q3MC 2GBMA 2ZUDA 3TAQA 4ANUA 2KSOB 1XD3B 7ICRA 4P1BC 4XE0A 1J2MA 5CJ7A 4M01A 3W5UB 4J9RA 3BVZA 5AUKA 1L0YB 3ONSA 3HP6A 1OGWA 1JI7A 1L7PA 4F8RA 3HVZA 5AHXA 3RJGA 2N7JA 3H4DA 4NJ6A 1UCVA 3OTQA 3VHTC 4RQ4A 1L2NA 1VZ6A 4MSQB 2WXMA 4LJPB 4MEXA 1NK0A 3CNHA 3C1ZA 3N97B 1DOQA 3RNGC 2KEYA 5AM5A 1PVPA 2PFOA 3FC4A 4M00A 4IL6U 3ML9A 5LNK1 5J8YC 1PK1B 1N61A 3NASA 1XLQA 1ZDVA 4O1NA 2A3VA 2KJHB 5AIBA 4YVZA 3G6VA 4I2BA 2GO7A 2WTFA 3T79A 2E8MA 4ZRQA 3TJPA 1KEJA 4HKQA 1GOZA 3MDAA 1QQRA 1X9WA 2D3BA 5A0LA 3OGUA 2DYBA 2LZ6A 3IG8A 2JXTA 4JV0A 3L5KA 4DQIA 3GOEA 2D3DA 3MR5A 4BAXA 4MHVA 3F2BA 5J2RA 2F1JA 1DRGA 1NJWA 3E2EA 1LKYB 4EZ9A 4HJKA 5KFXA 3VXWA 2OWOA 4DXFA 1D5XC 3ALRA 2KO3A 5F3XB 4YD1A 3PX4A 3S6JA 2DENB 4O3QA 4OJ5A 5KFUA 2MJEA 4X5VA 3KKAC 4QZ8A 1QCKA 5KFJA 3AM9A 2DZJA 3O65B 1LB2B 1CZPA 2QIEB 1F5SA 2C60A 2CS4A 3QJZA 1N5WA 5J0QA 1ZE3D 1Q1OA 3MC9A 2JEIA 3C8YA 4OCZA 4W9GA 4RQ5A 1GUAB 5L1JA 2K8HA 4C7YA 3NVVA 1RPLA 4JV1A 3PS6A 1ZXIA 1BPZA 3N3KB 4L2YA 4JE3B 3BQTA 2X8XX 2FMSA 2JEGA 4DOBA 5IKCM 2LBOA 4ACFA 3R7QA 3SFEB 2BB5A 1PGXA 1RZTA 3HKZF 4PGQA 4NLKA 5KG4A 2C28A 2PVGC 2A1JA 3Q8QB 1ZQJA 4ED3A 4ASWC 1EF1A 2JYTA 2YMQA 1D8BA 1TAMA 3E58A 1YN5A 8ICRA 1I4PA 5J0XA 8ICVA 1NJZA 3PY8A 2M0XA 3B1LX 4KGTA 2AHOB 8ICJA 1QQ7A 4MFCA 2PLPA 5KL8B 2ASJA 3IAS1 2VH1A 4XYCA 1RQNA 7ICJA 1E7VA 2KN4A 3X0WA 2INPE 3GE8C 1UWMA 5L1KA 2PTLA 1ZQNA 2WWZA 1ZQRA 1WWVA 2HBKA 4ANVA 1D5ZC 5KFSA 2DPJA 5ALDA 3B0AA 8ICYA 4M9NA 2BYVE 2G3QB 1RYUA 3QARA 3RNEC 3DQVA 4W9HA 4F3OA 2GLEA 2V9WA 4O5KA 3CMMB 3UXNA 1RFAA 3QE9Y 4RGMA 2P6UA 5KFPA 1F1HA 5TSSA 8ICMA 1UELA 4DSJA 2KTQA 2MP2B 1KFTA 1DOXA 1ESFA 1MQ2A 3VTVA 7ICSA 2FI1A 4BBNC 3HW8A 4KLOA 2QSDA 3N1XC 3JPOA 2KOBA 2WF9A 3ZDAA 4ELUA 2WDQB 3PX6A 5DGBA 1ZQGA 3DWGC 3U4EG 3ED5A 4B0EA 2MJ3A 4BX9C 2H88B 2QHOA 3P4RB 4RPXA 1B9RA 1QF6A 1ZQXA 1QQ5A 5DG9A 1FRDA 4YMOA 4F91B 4YD2A 3EHVA 4MJSB 3LYSA 1C76A 3OAWA 2RDGA 1S76D 3UMCA 2ZIVB 4DFDA 3IXSA 2FPMA 3F5AA 1E10A 1ZQEA 1I4HA 2C2EA 3KUDB 2JV3A 1Z4NA 4K7UA 2I38A 3Q3JA 5KFBA 7ICMA 1BPBA 2W54A 1V97A 2KC1A 4NLBA 2WHIA 1TKYA 3RUIB 3V6KA 5AM1A 5KFMA 3PRPB 4FULA 1RRBA 1NYQA 3HK0A 1JWUD 3JPPA 3PREA 1S3SG 1VR9A 2MX2A 2BYFA 2WXJA 2BQQA 2QLTA 2MLBA 4RQ6A 5AM4A 3PW4A 3N32A 5F9LA 4DL6A 4DWIA 2DZKA 4O3SA 1B43A 5AEKB 3LB8C 1ZP0B 3QNMA 1RYRA 5DB9A 2O6VB 1NKEA 2XGQA 3U7DA 3M1YA 2XICA 4F71A 1JXEA 1X2IA 2GH1A 1SKWA 4NLGA 1KH0A 2HHUA 1XF5L 4DEZA 1NI2A 4BFRA 2GRIA 1M4VA 2C7MB 5AM3A 3RBEA 2KT7A 4XZ4A 4DK5A 2DZIA 1FM0D 2W03A 2JF5A 4I2HA 2KLGA 2VANA 3JVZX 4RM8A 1SV4A 5KHOA 3W1SA 2M1MA 2XK5B 3M9OB 5HNKA 3RAXA 2WU2B 4XUSA 5AICA 1GNUA 4C80A 1WGDA 4FJYA 4PT5A 3RFAA 1S9FA 3WKDA 4UBBA 1ZOYB 3QUBA 2AGOA 4KZ0A 1X66A 1WY8A 4ECUA 3PZDA 5E79U 3ABVB 1S5LU 1ZD3A 1T94A 7ICTA 2KK0A 4R8UB 3OJ4B 4B0MA 4FE3A 4I28A 2LXAA 1T0RC 2H5XA 1L7YA 5D46A 2PPHA 1TFRA 2WB1C 1TS3A 9ICXA 1QOGA 1Z19A 2L1AA 4TQ1A 2KDEB 5KT5A 3PW2A 5JXVA 3ZO5B 4KGRA 5EWEA 4A55A 4YXJA 2KQSA 3BVGA 3FM9A 4OJLA 3V60A 4W9CA 2UU7A 5LXHA 3ZYYX 4PL1A 1K51A 2KXJA 2HBJA 3HUIA 4P6VF 1FPYA 4FZNA 3M8RA 3RH4A 1UA1A 3AEGB 3RJJA 1L3VA 3C5GA 5ALTA 1E6EB 2PW9A 1ISNA 5ALRA 2BW2A 4HCPB 3I5JC 3Q14C 2AXTU 2H3VA 1A77A 2FCMA 2NPTB 1NK8A 4F4XA 1JIHA 1X9XA 4BWMA 2KWVB 3PRZA 3VR9B 4DCCA 3BWUD 1XS9D 3RB3A 2JZBA 5J0WA 1ZOLA 4J9SA 1SKRA 4M8MA 1DGJA 3U30A 1WJNA 2VKQA 3DBRI 3ZD9A 2W3SA 2JU6X 4F4KA 5IIIA 4ZDVA 1T5XD 3P4PB 8ICLA 4AP4C 4MELA 8ICUA 4I2FA 3AE9B 1V81A 2J6TA 1SXDA 4P0QB 1Z5SB 1ZQPA 3UQ2A 5DLGA 2MBQA 1WXAA 1FD6A 4GXKA 2XGPA 2DHZA 3DVGX 1CJEA 3A4RA 3MP9A 4PS7A 1ZETA 3ECIA 5HHHA 3AEVA 1FMAD 4DFKA 3TARA 1Q8KA 5IO9A 1SL1A 3KUCB 1TBEA 2K8AA 1B4FA 1QILA 4M0WB 5KFGA 2LJ5A 4Y2UA 9ICNA 9ICCA 3A9JA 4ED7A 2HHSA 2GBRA 3KH0A 4E3CA 4OO1J 2W11A 1V5TA 2HDEA 2E3TA 5DGAA 2KHWB 1GB4A 3WKBA 3K75D 4N6EB 3TQ1A 4CYEA 3TEYA 1JRPA 4YTNB 4EEKA 2Z0EB 3TCAA 2DAFA 4P16A 2ZJDA 2KOXA 5AI4A 3P42A 2N9KA 3JSVB 4Q8EA 3KFUF 1C4CA 1S10A 1I4XA 1SJED 4W9JA 3IT6B 3WCQA 2JRIB 3DHGC 3QAQA 3QU7A 1EUVB 4FBTA 4XA5A 5J2KA 1K52A 1X1MA 2WDTB 4NAWA 5KAIU 3ZXVA 4GC6A 3ZLZA 2KJ6A 1C7YA 4KIKB 2YB1A 1MG4A 2F8LA 2BZFA 1CK1A 3Q3FA 2LPEA 4ECWA 3TFSA 4K4GA 1SKSA 3TIXA 8ICEA 4PGYA 5CHVC 2J53A 2CU3A 4I2IA 2W8KA 3H8JA 2JEJA 3ENEA 5T14A 3RZFA 9ICWA 4FO6A 2FBWB 4GDKB 7ICQA 4C4VB 2D3AA 3QIJA 1PDXA 3UIOB 4JWNA 2IY0B 2RD0A 2Q0ZX 3ZDTA 1JUDA 2UVUA 1WZ0A 4I2JA 5AIAA 3HVDA 2EAMA 2PJHA 1FEZA 1WR6E 5H92C 4FZLA 3ICXA 3Q8SB 2KJ8A 9ICHA 2G5HB 4XX5A 2L5YA 2BT6A 1NKCA 1WCNA 4C56C 1UA0A 3KVFB 3H7SA 4R63A 4Y2QA 5KT2A 2KFKB 3H7PB 3OLMD 3B9JA 2B76B 5DKWA 4Y2RA 7ICNA 4LDTB 3ETLA 2ZTCA 3PR4A 3C19A 3VUYA 2KMCA 4JL9A 4BZAA 5D3DA 1UGJA 1D3ZA 5AKJA 1DXSA 1KRPA 3RH6A 1DK2A 2QMTA 4MGIE 4MGZE 4I2AA 5ALLA 2Q4TA 5J2FA 4M02A 1WMHB 3MGIA 2KVZA 2XI9A 1GC7A 1IUEA 2CJNA 1WE7A 3P1MA 3PO5A 5DG8A 4HCNB 4IKGA 2WFAA 5ALIA 3KZXA 5KFEA 2GMIC 2GOWA 3SI8A 2JQRB 4M9LA 3KHLA 1BNOA 4AOFA 2F8KA 3W9CB 3QHTA 3LDAA 1KTKA 3SMVA 1FIQA 4P4OA 5EWFA 3K1RB 1MSWD 1TKGA 5JTIA 2B0CA 1LV5A 3PX0A 3DVGY 3RR7A 3SV3A 1TV9A 3F5EA 3JPTA 4LNFA 4JMUA 3P2BA 4AJWA 3IG3A 3R2IA 3AL0B 4LNOA 3W1YA 3ZJVA 2J6UA 1I35A 3GZNB 2W9CB 1VJKA 2AL6A 1B0XA 1IG6A 1QLNA 4RPZA 3N1ZC 3IN5A 3RPFC 2K5PA 4OW0A 4TQSA 2MA9B 3A1QA 5EWGA 3Q8MA 3RBDA 3U8ZA 4KN4A 5KG6A 4BGDA 1KRHA 4HDOA 4WJ3B 2A4ZA 2C5LC 1NK5A 4EELA 3HILA 2P6RA 5TZVA 2JWUA 1ZQBA 2QARA 3QUTA 3PMNA 1U49A 3L13A 4HRSA 4DFPA 5GTIU 4ZH4A 1WX8A 1TYGB 1YN4A 3DVNU 3O13A 1HQRD 3MGVA 1MQ3A 1YN3A 2OEDA 1WM3A 4XC2A 4IDIA 3B08A 2Y5BB 3V7JA 2HDOA 2M0AA 4M6WA 1XSNA 3T5LA 1XCQL 2WS3B 4Z6DA 1T4GA 1TGZB 5KFLA 3AEEB 2K22A 4YT0B 2RDHA 1ZJNA 1AWDA 2HBLA 3RNFC 4C8MA 4LTUA 4NLNA 3H4BA 4ANWA 2INDC 3IV6A 3ISBA 1UT8A 1OXJA 1CEZA 1L5PA 2XY7A 1TVAA 1GC6A 3NTUA 1STEA 5GMVA 3C2KA 4RT2A 2ZIWA 5KG3A 3E0FA 2W9AA 1TIFA 3QK0A 3WANA 2MSED 4NQKE 5BOLA 4DDID 3GS2A 3MBYA 2ZNVC 4I6LB 2L05A 2HVHA 4BKSA 3UQAA 3IVFA 4LVSA 2BWFA 1O08A 1HUZA 9ICRA 4B95A 2GOLA 4A8EA 1S97A 1S1QB 1JWSD 3BINA 3A9KA 3VUWA 4DQRA 4JWUC 1TKDA 4GLSC 2ASDA 1ZQKA 3Q3OC 3N30A 2K0PA 5DB7A 3QCAA 2LM1A 4OJOA 4WH4A 2LYBA 3H0RB 5L1IA 2WXHA 1PK3A 4HKZE 1JWAD 4DL3A 1XSLA 4YR2A 3ZDCA 2KYWA 3MFHA 2ZCCA 3LXFA 7ICLA 3B0XA 4UQGA 1QQ6A 4GDLA 3EW9A 1ZYQA 1MN8A 3CW2C 2R8GA 2K3UA 4KMUA 2BKFA 2INCC 3GP7A 2OH2A 1CQVA 4QJFB 4BXOA 1YX6B 2B3AA 3VC8A 4AQ7A 1Z1BA 3K4GA 5L95C 5D6JB 2B6GA 3UQBA 1BUIC 4KLSA 5BYQA 3RRHA 3Q2AC 4GFJA 1P98A 4K7SA 1E8YA 1V1PA 1KN5A 2W55A 4YP3A 4W9FA 4DHJB 4Q44A 4NL9C 3F2CA 2PMZF 3RNAC 1KLGD 5KFNA 3WKCA 4ECXA 5JUMA 3ZNZB 2UYZB 4IQWA 4DLGA 8ICXA 5J0PA 2ZIXB 5FKAC 1KQQA 2FLNA 4ZOHC 2C7HA 1KW4A 2FCSA 3RMKC 1ZQMA 3QEBZ 1COOA 2BPSA 2WAQC 3NZ3A 4ZYNA 2PKOA 2KICA 1VJ5A 2NV3A 3DV9A 2XCAA 3M9NB 1L5UA 2DYOA 5KT6A 4OVVA 4IM2A 4DWFA 2WXIA 3DWMA 3N20C 2OEHA 4ACOA 4PJ0U 5C0YA 5DCNA 4PL2A 3P4SB 3C2LA 5KAFU 1L3UA 4CCHA 2EAOA 4DSIA 1EO6A 4RNMA 2LRUA 2GBKA 1ZQVA 4O5EA 4A3OA 1C3TA 1SL2A 1L6UA 3AQEA 4UW9A 1UPHA 1QLBB 1WZ3A 1HZ6A 2I2YA 2EQYA 4YSZB 4F7ZA 2F2AB 2JVCA 3TANA 1YX5B 2FCNA 1IP9A 3QA8A 2XCPA 2I1QA 4YXDB 1M94A 2G9HD 4WQOB 4KKIA 9ICKA 5TR5A 2FPKA 4I2GA 3AE1B 4YG2A 2L83A 3IBEA 2HI0A 5J8YA 2D11A 4QZFA 1S77D 1F2RC 4L1BA 4G3XB 2LVQA 4Z6CA 1TKEA 2V4LA 3RI7C 3SHQA 3L17A 2W9BA 2HJ1A 2R2OA 4FJZA 4W9LA 4WJQA 5AK3A 3ML8A 4NLCA 2K8CA 3TADC 3HHMA 2BPGA 2FJ6A 4I2DA 3H9DA 3C28A 3BY4B 8ICBA 1YQ4B 1Q46A 3R66C 2KTRB 4GC7A 2DUYA 4PZNA 3SAHA 4IG7B 3DOWA 4J9MA 1NVID 5AI8A 4EBEA 1O03A 1V2YA 1YQ3B 1MA7A 4DOCA 1T0QC 5L9XA 3RRGA 4KLIA 4PK1A 4ECYA 1QSYA 1S0OA 1TT5B 1KM7A 4RGTA 5J2CA 1HA5A 4J9QA 2LVOA 2KIVA 1XO3A 5KNIA 3M62B 3KKAA 3APCA 4KX6B 3VTUA 2MSNA 3SQIA 1WGRA 2MAXA 2F77X 1VZ7A 3AEBB 1ZQWA 3TKAA 3APFA 4G9BA 4YSYB 4KVGB 4DL2A 4IWQA 4TQ0A 3QUQA 4PGXA 2WLBA 2BQRA 1L8LA 2AYOB 5EE9A 2MQJA 2O2VA 2V3PA 1V1OA 1HTQA 4US8A 3QZ7A 1I4QA 4K7WA 4DL4A 5FP0A 2LM4A 2MUTA 4R66A 1JXLA 1OQRA 4PZOA 1XU4A 2JWZA 3UF8A 3BQ0A 4NJ7A 1X9MA 3X23A 4ED1A 2SAKA 4QZDA 5J2GA 1PGAA 2XEWA 2RDIA 2NRZA 1L4ZB 2G45B 3C23A 1OEYJ 2JRZA 2J42A 3NVZA 4AYBF 1XWLA 1MI0A 2IGDA 3V62A 1QTMA 3IFWB 1VRAB 4QWBA 1OQQA 2EMSA 1ZJMA 4J3OD 3PHWB 1SV0A 2D6FC 4DSLA 2VJ4A 4YN4A 5ALGA 4PYUA 4DHZE 4IM0A 2L3ZA 1UBIA 1KDHA 1E90A 1D8LA 2KSOA 5KFQA 1N6ZA 4RH6A 3D2QA 1PQSA 4BOZB 3UINB 2AU0A 4PHPA 2MA1A 4IS7A 5DBCA 3GQCA 5J29A 2I9GA 4ECSA 4P4PA 4QWDA 1X40A 4LLGM 1T0SC 2QDFA 2N1RA 2CU1A 1Q0WB 1WYWB 1JROA 4EFOA 4A90A 1TS5A 5AI6A 3M3JA 4L23A 5HR6A 1E7PB 1WGYA 4B9VA 4XWWA 1XLPA 5CR0A 1E8ZA 3WA0A 1AQ6A 3KYDD 2ATLA 5ALHA 5KFDA 2C9WB 1QOBA 2XVTA 2ZTDA 2IBKA 1A70A 1PK1A 2LJIA 4JQWC 1T6BX 3PZ8A 2V9HA 3NGDA 3AXCA 2M0NA 2PFNA 5IINA 1IIPA 2FCQA 2VA3A 8ICKA 3KWLA 5HKHA 1WH3A 4E71A 5H8YE 3ZJUA 1ZGUB 2KV2A 3DHIC 2DLBA 2QKQA 1SV0C 4WAAA 2UVRA 3KQ4A 5JZEB 1TK5A 4U6PA 3ZDDA 1MHHE 3KOOA 3EUB2 4I6NB 3LK9A 3DBLB 4NXZA 5AM0A 2LWPA 3MC0B 5G2NA 2JUOA 1P3QU 1LKYA 2MCNB 2V0GA 2NVUI 2E8NA 2HBMA 5J2EA 5E6OA 3T5KA 4F5NA 3SR6A 2PE9A 3KUZA 2FMQA 2RGFA 1UZXB 1L7MA 2WXPA 2KANA 1YIWA 3GV7B 1H4RA 4WIPA 3RJKA 2WF7A 4I2CA 2KN5A 2WDVB 4EZLA 2EAPA 4M8NA 4AS1A 8ICNA 4M04A 1V86A 2OOBB 3MC8A 4NLZA 1P1AA 3PSIA 3D6JA 1ZQCA 1TY2A 1FO4A 1N48A 2PIAA 4AUQC 4YSXB 4WJNA 1JW9D 5TISU 3NUHB 5HFYA 7ICKA 4K4IA 2FIFA 5C2TB 3AN1A 1XLOA 4JLCA 2DF4B 2L0FA 2E1EA 2J0KA 1DOYA 1N56A 3E9SA 4BVUC 2K8BB 5HG2A 4EOYA 2QEJC 5D2MB 1EWCA 3HM6X 1N62A 2PMVA 2KDIA 4F2RA 4Y2TA 1ET6A 3OSNA 4Z6EA 4DSFA 8ICOA 2JY6A 3KLSX 4TUSA 4JUZA 2K1FA 4ED0A 1RG6A 2Q5WD 5C1ZA 4LCDE 2BYTA 1UF0A 2DNFA 1A6SA 5J0TA 4XWTA 5LLIA 1PFDA 1CUKA 4MM3B 3RNCC 4YR3A 4O3NA 5DB8A 2E1FA 4Q43A 4M2YA 8ICCA 4F5RA 2JT4B 2WDRB 4ELVA 2N9EB 1ZQIA 5B66U 5HHIA 4CE6A 1ACCA 3H8WA 2A1AA 3J81j 2G06A 4BKTA 1WXVA 3V6JA 5L1LA 4QZ9A 2Y0SF 4A20A 4F5PA 2BPCA 3BS5B 8ICIA 4F5QA 1WSPA 1YOVB 4FADA 1D8YA 1JCKB 2MRLA 2HCFA 1TZ1A 4KZCA 4YTMB 2ZEQA 2IYDB 3R9KA 2YQEA 3L08A 2NYVA 3DBRB 3ZTCA 5KHQA 2AEHA 2NBWB 1S0NA 3B2FA 3DBLI 2JXJA 2MP2A 4EENA 3EZ5A 4IRDA 4R3DA 3T3NA 3PZPA 3GILA 2IY1B 4MF2A 3VRAB 4QWCA 2AX5A 4J03A 3GIJA 2UVVA 4ZRJA 2JPHA 2MBHA 5KFYA 3AU5A 4E74A 4KSLC 2KNBA 3SEBA 4MJSA 4UAVA 2NTTA 2ZIUB 1IBXB 3BK2A 3DPDA 4B9LA 4G50A 2ZIVA 1SXTA 4IC9A 3EFCA 3PVXA 1ZD2P 1P7DA 3DHHC 4IR1A 1NOMA 2TSSA 5AKGA 4ECQA 2R8KA 4LJOB 2FMPA 5DPWA 2GWSA 1ZQUA 1QSSA 2AJQA 2KACA 1D4BA 4KDLB 2VA2A 2LEKA 5CWRA 3BJYA 1SIJA 1SWWA 2D8CA 4LK0M 1HTOA 3DBHI 1QT9A 1GO3F 2CR5A 3TAPA 1C9FA 5CA7A 3RFZB 4OJ6A 1BMLC 1RFKA 1ROEA 1RWSA 1K53A 3RB0A 1FNUA 3L10B 4FXCA 3C2MA 2JGAA 2C2DA 4JV2A 2O6VA 5CTRC 2KDMA 1TS4A 3PPAA 2W9MA 1PGBA 4YR0A 8ICHA 3LDZE 4F72A 5IAAC 5C5JA 1J19A 4K3CA 4UARA 5G5HA 3I57A 2KZZA 3OHBA 2HW3A 2Z59B 1TK0A 1DYQA 5C3JB 2XK5A 4GGQA 2E8PA 2W3RA 3ZDEA 2OHFA 2E8OA 1BPDA 5H2FU 5J0YA 1TZOA 2Y5CA 1TK8A 1LFDA 5KL1B 2G4SA 2VZKD 2ISOA 2WXLA 2KFZA 4BBNF 4MACA 3NS1A 1S0MA 3Q8EA 4WWMA 2WF8A 4GXJA 1K8RB 4MGYE 4KLUA 2Z0DB 2WU5B 3T5JA 4R8UA 4RNOA 4NM1A 2J7QB 3SZ2A 9ICVA 1Z4OA 1T3QA 3N9YC 2K4PA 5DBBA 1SE9A 2RR9A 4Y2XA 1WF9A 5E6NA 1Z2MA 2SEBD 3Q8PB 1KSPA 2W82A 2WGSA 3CIRB 3RN9C 3GB1A 2KC2A 3QU9A 3JPNA 4KLLA 3PV1A 2IGHA 3EWAA 2I1JA 1IV8A 3CRXA 5AKEA 1TJEA 9ICTA 4GOCA 2EZYA 4FHKA 2DZMA 4RCOA 1JMSA 1J7AA 3D2SA 2A5UA 2AGQA 2F3NA 4C8OA 2IJ0A 4DFMA 1ZQDA 4JGHB 5IN7A 2MRPA 4KLDA 1AROP 2RP5A 4GXBA 3IDWA 5AZHA 2NPTA 3KHRA 2D3CA 2KJ5A 5D49A 1YJ1A 3MTNB 5AI0A 3QQ8B 4KLJA 1FNVA 5AZGA 3DVNV 2FLLA 1R7SA 3L0WB 3SAFA 4IOIE 4A9AA 4JWSC 1P7FA 3ZJTA 1XEEA 1NYRA 4WJPA 3ZW3A 2JSVX 4I27A 3BQ2A 3AB5A 2BB6A 1XXGA 1B22A 3NS8A 1ECWA 4P0QA 2G1EA 5J0UA 3Q8BA 3VVWB 3GFKB 4EE2A 5IA7A 4NV0A 2WXQA 1LQBA 3AE5B 2Y9TA 1H38A 2IHMA 4FFDA 1QZEA 9ICPA 2YN4A 2MWSB 2VRRB 2ZW1A 2IOFA 2RPVA 1N63A 1ZDXA 2N7DA 2KD1A 2RSUA 4M0WA 5FK9C 4QZEA 2WB1F 2HHQA 3ISDA 1E8WA 1V9JA 2EMTA 2L32A 4ZYSA 2CHZA 7ICOA 1Z00B 2KVSA 1CMXB 4TMAB 1F0ZA 1NI3A 2KIWA 4YFKA 3PRMB 3VAWA 4W9KA 2KZMA 4IRKA 3AEAB 1S8OA 1NK9A 4KLGA 3UM9A 3AI5A 1V85A 1QOFA 1T7PA 4RU9A 3DDHA 1WJUA 1YZ6A 3MFIA 4O5CA 3MGHA 1Q5WB 2HE7A 3MJ5A 3EFUA 2AWTA 4CF4A 2FNJB 1WRDB 4MT5A 2PKEA 1VDVA 4NY0A 3JSVA 4HDQA 4HVBA 1UQVA 4HLEA 4REZA 4NPNA 2XBBC 1ZRMA 3Q6BA 3PR5B 3Q8LA 2N0SB 3N4MB 4QWEA 4FBJB 3HX0A 2PE6B 1FFUA 2J0JA 4PS3A 1ZQYA 4HPPA 2H3ZA 2YY6A 1NK6A 3SDLC 4KIKA 2INNE 5L83A 2CKHB 2DKZA 5AK4A 2D2QA 2XNAC 1FFVA 3HWTA 3PW5A 1NDDA 3ETRA 3J9CA 3Q8KA 4CO7A 2WX0A 1XQQA 4RUCA 1U9LA 1WG8A 1F44A 4D2KA 4RNNA 1XO0A 2FLPA 1L7NA 3WK9A 3IAM1 3QX7A 2MW5A 4DF4A 1ZQTA 2ESEA 1LM8B 3AU6A 4IQVA 4GDKA 4C4VA 3I3TB 4Y2SA 3UPQA 2W7PA 1LO5D 3DEEA 1UGMA 4W9DA 3RYTA 3EPIA 1FRRA 5IOIA 1SWVA 2C22A 5BMIA 4DS4A 3KW5B 3Q8FA 4GSWA 1H8CA 3VH3B 3RH5A 4QZGA 2L8JA 3AH7A 2ON8A 3OPXA 3C0RB 4C7ZA 2Z8LA 1MVKA 3L3FX 4UASA 3TEZA 4DS5A 1KFDA 1WGHA 7ICPA 3H7PA 2KFKA 3PW0A 4WAFA 3TUOA 3GE3C 3RNBC 5KT7A 3PSTA 4FS2A 3ZKJC 1BGXT 4YXMA 1UT5A 4O3MA 1MFWA 3GU3A 5FR6A 4IQUA 2EDUA 1JRUA 3EGRA 3LVWA 2K25A 2N9PC 5D3IB 2KK8A 2ICIA 2NRXA 1HE8A 3RCZA 4S17A 4P2HA 4KN7A 1ED1A 2I6XA 2IOFK 9ICLA 1WMHA 2HD5B 2HOIA 5KFFA 2BDPA 1U4BA 1HJPA 3H8HA 5MPOA 1T8EA 5IILA 8ICSA 4IC7B 4ARCA 1A5RA 4KX5A 2BQ3A 1FXIA 5AK5A 4F8CB 3VTWA
chains in the Genus database with same CATH topology
2M56B 1HA5A 3LYYA 1AYFA 1Q10A 3B2GA 1XO3A 1C76A 2RDGA 2BS4B 4KX6B 3IXSA 1VZ7A 1I4HA 3AEBB 4OHJA 4YSYB 1SB3C 1WXQA 2I38A 4TQ0A 2PVOD 2WLBA 1GB1A 4NZLB 2DYMA 2V3PA 5EE9A 1V1OA 2W54A 4US8A 1V97A 1I4QA 2WXRA 1TKYA 1OQRA 4WURA 3PZ7A 1HZ5A 5AUIA 4H2AA 5HI1A 1NYQA 3VR8B 1JWUD 2SAKA 1VR9A 1PGAA 1UNSA 1K50A 5BMHA 2WXJA 1L4ZB 2YEPF 3UI3A 2J42A 3NVZA 3LB8C 1ZP0B 1MI0A 2IGDA 4KGSA 3BK1A 1VRAB 1OQQA 1KH0A 4J3OD 1XF5L 1SE3A 1SSNA 1NENB 3FILB 2GRIA 1M4VA 2IDYA 1SJHD 1FM0D 3W2DA 4RH6A 3W1SA 2WQYB 2FUG1 2BBCA 2WU2B 1WWTA 2WP9B 4OZAA 4C80A 4PT5A 1FCCC 1QOAA 1C4AA 4LLGM 1C78A 1ZOYB 2AQ3B 2L52A 1SE2A 1JROA 4A90A 1TS5A 1B1ZA 1HEZE 3ABVB 4L23A 1WYGA 3U52E 1E7PB 2D5GA 4XWWA 1XLPA 3AEFB 4B0MA 1RM6C 1TS3A 1NEKB 2AQ1B 3T3OA 4ZRPA 1QOGA 2L1AA 4RGNA 1QOBA 2LHEA 4TQ1A 1A70A 2LJIA 3IT4B 5JXVA 1T6BX 3PZ8A 4KGRA 2WXNA 3KWVA 1AW7A 4A55A 3KWLA 3BVGA 2BS2B 5H8YE 2WXFA 2KMMA 1TY0A 3ZJUA 1WGKA 3EA6A 2DLBA 3ZYYX 1YJJA 1K51A 3KQ4A 1MHHE 3HUIA 4P6VF 3EUB2 1SE4A 2GI9A 3AE4B 3AEGB 5EE0A 3MC0B 1EU3A 1E6EB 1RYJA 3R8BA 2PW9A 3AMZA 2V0GA 2BW2A 1GPXA 3AV8A 1ET9A 3OWEB 1YMHE 4Q2JA 3TEXA 3VR9B 3V3XA 2WXOA 3BWUD 2HTME 3SFDB 3SR6A 2I2YA 1DGJA 3NVYA 3ZGZA 3AEDB 2FE8A 3P4QB 2WXKA 2WXPA 1QKZA 4A8XC 2W3SA 4WIPA 2WXGA 2JU6X 1T5XD 2WDVB 2CJOA 3P4PB 5BYRA 4AS1A 3AE9B 1TY2A 2PIAA 2J52A 4YSXB 1FO4A 1JW9D 2QJLA 1FD6A 4JPSA 3NUHB 4HEA1 5C2TB 5HFYA 1F77A 3AN1A 1XLOA 1CJEA 3MP9A 5D7GA 1DOYA 3E9SA 4N59A 2GB1A 5HG2A 2QEJC 1EWCA 1N62A 1FMAD 1KLUD 2PMVA 4XDDA 4YTPB 1VLBA 1ET6A 3KLSX 3AECB 2EKIA 1QILA 2Q5WD 1D6EC 4ZHOA 2BYTA 4XWTA 1PFDA 1JMLA 4MM3B 2HDEA 4GDLB 2QILA 3BVMA 2E3TA 3MHZA 1GB4A 4N6EB 2WDRB 2H89B 4TSSA 4OZCA 3TEYA 2DBYA 1JRPA 2K9XA 1ACCA 4YTNB 3ZQ4A 1FEHA 2N9LA 4P16A 4MH8A 3P42A 2N9KA 5GXGB 1C4CA 1V1PB 1SJED 1I4XA 1UUPA 2ACZB 1WSPA 3IT6B 3WCQA 1EU4A 1JCKB 1ZUD2 4YTMB 1KF6B 1K52A 1MPEA 5I4DA 4NAMA 3MFGA 3AE7B 4RFBA 3B2FA 1IGDA 4OVZA 4RNAA 4R3DA 1CK1A 3T3NA 3VRAB 2AX5A 2J53A 2CU3A 2MH7A 4US9A 1L4DB 5FR3A 4ITKA 2FBWB 4GDKB 1SEBD 1JALA 3SEBA 1YNTE 2BTEA 1PDXA 2NTTA 1IBXB 3BK2A 1V8CA 1XLNA 1SXTA 4A6QA 1TS2A 1I4RA 2RMMA 2J4XA 3HVDA 4N58A 4OZBA 5H92C 2JYEA 4WQMA 3NRZA 1VZ8A 2TSSA 3BZDB 2BT6A 2KACA 4C56C 1OFFA 3PO0A 2ZW0A 2LEKA 1D4BA 1I7HA 1SIJA 3TSSA 1ZXHA 4LK0M 1QT9A 3B9JA 2B76B 1C9FA 1ENFA 2LFIA 3RFZB 1RFKA 1BMLC 1KFYB 1ROEA 1RWSA 1K53A 1AN8A 5D3DA 3URYA 1UGJA 1FNUA 4FXCA 2QMTA 2EELA 1FNWA 2LGIA 2KDMA 1TS4A 2LUMA 2X38A 4DXGA 4USAA 1JQ4A 2IPKD 1PGBA 2Y3AA 4ARIA 5G5GA 3AE2B 3FILA 1IUEA 2CJNA 3P1MA 3P63A 3I9V1 4IKGA 2NTSA 2ONQA 5G5HA 2JQRB 3I57A 2BS3B 3E56A 1DYQA 4RF0A 3W9CB 5C3JB 2W3RA 1KTKA 1FIQA 2OHFA 1TZOA 2Y5CA 1TKGA 2NMQA 1C77A 2VZKD 2WXLA 1F2RI 3AE3B 4MACA 3NS1A 3Q8AA 2LMCA 3Q8EA 4WWMA 5E6JA 2IGGA 1D5MC 1GAQB 2WU5B 1WRIA 3R2IA 1SBBB 3ZJVA 1J7CA 5EE3A 1VJKA 3R2TA 3N9YC 1T3QA 3RPFC 2K5PA 1FXAA 4OW0A 1I4GA 3TEWA 3BYTB 2DWQA 2SEBD 2W82A 3CIRB 3GB1A 2R61A 1KRHA 2KAJA 1EM7A 2JWUA 2IGHA 2MJDA 2WNMA 4HJGE 1Y56A 3BYYB 4YWGG 1PUTA 4HRSA 5BMGA 1TJEA 1YN4A 1E10A 1TYGB 3O13A 4RGOS 1HQRD 1YN3A 2V4IB 4RCOA 4KKJA 1J7AA 2OEDA 1L0VB 4HROA 4IDIA 1JWMD 1N60A 2IJ0A 2KQ4X 2M0AA 3V05A 1XCQL 3L4PA 2WS3B 3BIID 5EE1A 1YJIA 3AEEB 2K22A 3HRDD 4YT0B 2RDHA 1AWDA 3Q69A 2M19A 4LTUA 4XE0A 1P7EA 1L5PA 3W5UB 3BVZA 1FNVA 1L0YB 5AUKA 1STEA 3VQIA 2VZKB 1R7SA 4IOIE 4A9AA 4JWSC 3HVZA 1P7FA 2KWDA 3ZJTA 2N7JA 4ZHPA 1XEEA 1NYRA 2JSVX 1VZ6A 3AB5A 2BB6A 1XXGA 3GS2A 2G1EA 2WXMA 3Q8BA 4EE2A 2WXQA 3NVWA 1ZPSA 3AE5B 3FC4A 3U7ZA 1IGCA 5LNK1 1XLQA 3Q8CA 1N61A 4O1NA 1ZDVA 1JWSD 2ZW1A 2RPVA 4JWUC 4GLSC 4ZRQA 1N63A 4HKQA 3AE8B 2K0PA 1ZDXA 1GOZA 3U2SC 4UDUC 4WH4A 1E0ZA 4M0WA 5FK9C 1QQRA 2WXHA 4HKZE 2L32A 1JWAD 4ZYSA 4TMAB 1F0ZA 1NI3A 3LXFA 3CWIA 2JXTA 3AEAB 2K3UA 1QOFA 1C79A 1EWYC 3GP7A 1CQVA 5BYSA 4AQ7A 5HHDG 3MJ5A 4DXFA 1D5XC 1BUIC 2V3NA 4MT5A 5BYQA 2MJEA 5T8IA 1VDVA 3AM9A 1JWBD 1V1PA 2Y5PA 1CZPA 2QIEB 4REZA 1N5XA 2W55A 1N5WA 2N0SB 1ZE3D 1FFUA 2AQ2B 1KLGD 3C8YA 1FCLA 1E9MA 2INNE 3VRBB 4NJCA 4C7YA 3NVVA 2XNAC 1FFVA 5FKAC 1ZXIA 1PYWD 3ETRA 3J9CA 4ZOHC 4JE3B 4L2YA 2MEKA 2XN9C 4D2KA 3SFEB 2BB5A 3IAM1 1PGXA 3NZ3A 2PKOA 2DYOA 2PVGC 2JYTA 1IBXA 2WXIA 1MHXA 3DWMA 2JX5A 1YN5A 3P4SB 1LO5D 1I4PA 1FRRA 1L6VA 5BMIA 4KGTA 3Q8FA 1L6UA 1DOIA 1XCTL 1BXTA 1J7BA 1QLBB 2LHDA 1C4PA 1HZ6A 2PLPA 3AH7A 2ON8A 1SF0A 3IAS1 4YSZB 4C7ZA 2Z8LA 2KN4A 1MVKA 2INPE 1UWXA 2YEPB 1UWMA 4CQNA 2PTLA 3TEZA 4YXDB 1D5ZC 2G9HD 4KKIA 4WAFA 3TUOA 3AE1B 4XDCA 2L83A 3FAHA 1F2RC 4L1BA 3EGRA 3W5VB 4RGMA 1TKEA 4NAWB 5TSSA 5D3IB 2ICIA 2JZPA 1L0XB 1DOXA 1ESFA 4RF1A 3AE6B 1YQ4B 2QSDA 2WDQB 3DWGC 3H8HA 3U4EG 2E6XA 1NVID 5MPOA 4B0EA 2MJ3A 1YQ3B 4ARCA 2H88B 1HXYD 4DQOC 3P4RB 1B9RA 4RGTA 1QF6A 1FXIA 1FRDA 4JX1C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2M56 B;  3AED B;  1RFK A;  1AYF A;  1KFY B;  1ROE A;  1RWS A;  1XO3 A;  3B2G A;  2W3S A;  3P4Q B;  1E0Z A;  2BS4 B;  4KX6 B;  1JWA D;  2WDV B;  2CJO A;  3P4P B;  4FXC A;  3AE9 B;  1F0Z A;  1NI3 A;  3AE8 B;  3LXF A;  3AEB B;  3CWI A;  2PIA A;  3AEA B;  4YSX B;  1FO4 A;  4YSY B;  1SB3 C;  1JQ4 A;  4USA A;  1JW9 D;  1QOF A;  2QJL A;  1EWY C;  1WXQ A;  5C2T B;  5G5G A;  3AE2 B;  3AN1 A;  1IUE A;  1XLO A;  2CJN A;  2PVO D;  2WLB A;  3P1M A;  3P63 A;  1CJE A;  5EE9 A;  1DOY A;  4N59 A;  2W54 A;  4US8 A;  1V97 A;  5G5H A;  2JQR B;  1TKY A;  1OQR A;  2BS3 B;  1N62 A;  1FMA D;  2MJE A;  1VDV A;  4YTP B;  3W9C B;  5C3J B;  2W3R A;  2B76 B;  5AUI A;  1FIQ A;  3AM9 A;  1JWB D;  1VLB A;  1NYQ A;  1CZP A;  2OHF A;  2QIE B;  1TKG A;  2Y5C A;  3VR8 B;  1N5X A;  2W55 A;  1N5W A;  2N0S B;  2EKI A;  3AEC B;  3AE3 B;  2Q5W D;  3NS1 A;  3NVZ A;  1FFU A;  4WWM A;  4ZHO A;  1GAQ B;  3LB8 C;  1ZP0 B;  2WU5 B;  1PFD A;  1E9M A;  1OQQ A;  3VRB B;  1WRI A;  4C7Y A;  2E3T A;  3NVV A;  1J7C A;  5EE3 A;  1VJK A;  1NEN B;  1FFV A;  4N6E B;  2WDR B;  1ZXI A;  1T3Q A;  2H89 B;  3RPF C;  3ETR A;  2K5P A;  4ZOH C;  1JRP A;  1FXA A;  2DBY A;  2K9X A;  4YTN B;  1FM0 D;  3SFE B;  2WQY B;  2DWQ A;  2PKO A;  2WU2 B;  1WWT A;  2WP9 B;  3CIR B;  5GXG B;  4C80 A;  1KRH A;  2PVG C;  2ACZ B;  1QOA A;  2KAJ A;  3WCQ A;  1ZOY B;  2L52 A;  2MJD A;  1ZUD 2;  3DWM A;  2JX5 A;  4YTM B;  1PUT A;  1KF6 B;  1JRO A;  4HRS A;  1TJE A;  1E10 A;  1TYG B;  3P4S B;  3ABV B;  1FRR A;  3AE7 B;  1WYG A;  1L6V A;  1J7A A;  1L0V B;  1E7P B;  3B2F A;  4HRO A;  4IDI A;  1N60 A;  1L6U A;  1XLP A;  1DOI A;  3AEF B;  1J7B A;  1QLB B;  1RM6 C;  3AH7 A;  1SF0 A;  3L4P A;  2WS3 B;  3BII D;  5EE1 A;  4YSZ B;  1NEK B;  4C7Z A;  3VRA B;  1YJI A;  3AEE B;  2AX5 A;  2K22 A;  3HRD D;  1QOG A;  1UWM A;  4YT0 B;  1AWD A;  1QOB A;  1A70 A;  2CU3 A;  2M19 A;  2MH7 A;  4LTU A;  4YXD B;  4US9 A;  3AE1 B;  1L5P A;  3W5U B;  2L83 A;  5AUK A;  3KWL A;  4ITK A;  1R7S A;  2FBW B;  3FAH A;  1JAL A;  4A9A A;  4JWS C;  2BS2 B;  3HVZ A;  5H8Y E;  1PDX A;  2KMM A;  1V8C A;  1XLN A;  4ZHP A;  1NYR A;  1WGK A;  3W5V B;  1TKE A;  3ZYY X;  3AB5 A;  1YJJ A;  4N58 A;  5H92 C;  2G1E A;  3NRZ A;  3HUI A;  4P6V F;  4WQM A;  3EUB 2;  1DOX A;  3AE4 B;  3AEG B;  5EE0 A;  3AE6 B;  1YQ4 B;  3NVW A;  3AE5 B;  1E6E B;  1RYJ A;  3AMZ A;  3FC4 A;  2BT6 A;  2WDQ B;  3DWG C;  1GPX A;  3AV8 A;  5MPO A;  1NVI D;  1FXI A;  1OFF A;  3PO0 A;  3VR9 B;  2LEK A;  1XLQ A;  2MJ3 A;  1N61 A;  1I7H A;  1YQ3 B;  1SIJ A;  2H88 B;  3P4R B;  4JWU C;  2HTM E;  1QT9 A;  3B9J A;  3SFD B;  3SR6 A;  1QF6 A;  1N63 A;  1B9R A;  1FRD A;  1DGJ A;  3NVY A;  4JX1 C; 
#chains in the Genus database with same CATH topology
 1GJZ A;  3HIZ A;  3ZUN A;  2HHW A;  4P0P B;  2W8L A;  3TBL D;  2KJ9 A;  3AU2 A;  5ALE A;  2V4R A;  3KZI U;  4QIW F;  4JK1 A;  3JPQ A;  1JX4 A;  2HSZ A;  3BDP A;  1SB3 C;  4NL9 A;  1BT0 A;  2ZJ5 A;  1WI0 A;  2MBE A;  3PVL A;  2W9C A;  3L16 A;  1WXQ A;  1F0M A;  3KHH A;  5J0S A;  2I5H A;  1Y8R C;  2KMD A;  2DYM A;  3HM3 A;  3SEN A;  3CYM A;  5KG2 A;  5KFZ A;  2K4E A;  3JPS A;  5J2A A;  1WCL A;  4WUR A;  1Y88 A;  1NZB A;  8ICG A;  1ZQF A;  4GIB A;  5DG7 A;  1HZ5 A;  3PZ7 A;  2LKY A;  3N7P D;  5AUI A;  4J6I A;  5HI1 A;  4TKN A;  4ZRK A;  3PV8 A;  4LDT D;  7ICI A;  4RPY A;  1UNS A;  2KMA A;  2YLM A;  2YEP F;  5BMH A;  4G3I A;  3KD3 A;  3SYZ A;  3OSP A;  1V49 A;  3K9O B;  3NZU A;  2WF6 A;  4YMM A;  4EZK A;  2RDJ A;  5IIM A;  2VH2 A;  5J2D A;  9ICO A;  1J2N A;  3QC8 B;  3LWL A;  1XSP A;  3FIL B;  4F93 B;  3MDC A;  4QZB A;  2R18 A;  1U4A A;  4K3B A;  1Z3E B;  3W2D A;  2PEA A;  2QB1 A;  2MHJ A;  5JHA A;  2W04 A;  2WP9 B;  3TFR A;  3TI0 A;  1FCC C;  1GG3 A;  1QOA A;  1C4A A;  2IO1 B;  2BDU A;  2ZJA A;  2AQ3 B;  5J0O A;  2L00 B;  1CRX A;  4B9S A;  4NNJ B;  5IIK A;  5EOZ A;  3APD A;  2QB0 B;  4X57 B;  2KX0 A;  4LNK A;  2ZUC A;  1WYG A;  4Q8F A;  4DOA A;  2D5G A;  4UB1 A;  1Q3U A;  3AEF B;  2BCS A;  4I6P A;  1DK3 A;  3CSF A;  4TUQ A;  4RQ2 A;  4BKS D;  1NEK B;  2AQ1 B;  3TAD A;  2DPI A;  4ZRP A;  4JWM A;  1SGH A;  1ZD5 A;  1K1Q A;  3VH4 B;  3MC1 A;  2HHV A;  3C21 A;  4LZG A;  4C8N A;  5EDS A;  1AW7 A;  3B0Y A;  1OEY A;  3C5F A;  3AQF A;  4CF3 A;  4C4T A;  5BPC A;  2BS2 B;  3THV A;  1OUQ A;  3CST A;  7ICH A;  1TY0 A;  2XY5 A;  2OCE A;  5GTH U;  4K81 A;  1M6Y A;  2KVC A;  4M0A A;  9ICQ A;  2K8C B;  1YJJ A;  3PNC A;  1ZQL A;  2BPF A;  2KD0 A;  2L0T A;  4NQL B;  5G55 A;  5EE0 A;  1KTQ A;  3R8B A;  2KFN A;  4S0R A;  2VA8 A;  2KDB A;  1GPX A;  2KNJ A;  1ET9 A;  5KFI A;  1YMH E;  1COK A;  2G4D B;  3OWE B;  4Q2J A;  2EZZ A;  3ZTD A;  4MSM B;  2ALZ A;  4J9P A;  2V3S A;  2QC8 A;  3SFD B;  3OJS A;  4II2 B;  3ZGZ A;  4HAI A;  1YQB A;  2FE8 A;  3AED B;  1SZP A;  3HT3 A;  3GIM A;  2WXK A;  9ICE A;  1QKZ A;  1L3S A;  4DL5 A;  2WXG A;  4DBG A;  4W9E A;  2W9N A;  3IRU A;  1NJX A;  2A19 A;  3HKZ C;  4PHE A;  2DQN B;  4KMO B;  5J2B A;  1J97 A;  4JPS A;  1L3T A;  2ZIX A;  5DDY A;  3K9P B;  4QZA A;  8ICQ A;  3H0M B;  2BCU A;  2AL3 A;  5KFA A;  5D7G A;  3RJF A;  4ED2 A;  4J9L A;  2ZXI A;  4I29 A;  2C2R A;  2LVP A;  5KG5 A;  1KLU D;  4GN1 A;  3ZNI D;  2LGD A;  3UXO A;  2R2Q A;  1K5O A;  3AEC B;  2EKI A;  2G09 A;  4UAZ A;  2D3G A;  1D9D A;  4EBD A;  3ZVV A;  4CRX A;  3H1U A;  2DKX A;  2K39 A;  3BVM A;  5ALJ A;  2WX1 A;  3MHZ A;  2HVI A;  4NY8 A;  1U47 A;  1OTR B;  1UBQ A;  2Y1J A;  4P1C C;  2YX8 A;  4OZC A;  4UBC A;  1HUO A;  4YL8 A;  2ISP A;  3KBB A;  5KG7 A;  1FEH A;  4QZH A;  1KBU A;  4GIV A;  4MH8 A;  4O3P A;  4F4Y A;  4RQN A;  1FXT B;  4FJV B;  3A0H U;  3M7D A;  8ICT A;  1WJ4 A;  3SV4 A;  5ALP A;  3CF6 E;  1UUP A;  1RAX A;  3VUX A;  4A3P A;  3UMB A;  3MR2 A;  1QSL A;  4EEW A;  5KFH A;  1KF6 B;  4DHJ D;  5I4D A;  2PI5 A;  3AUL A;  3IM1 A;  4F4Z A;  3RJI A;  4UAU A;  1WE6 A;  3MFG A;  4CF5 A;  4KTQ A;  2KX3 A;  4RFB A;  1WIA A;  1IGD A;  2BGF A;  2KN7 A;  4ED8 A;  1NZP A;  2KTR A;  1WWU A;  3NY5 A;  2EKE C;  4DFJ A;  2MH7 A;  1ZQZ A;  4US9 A;  2ZZP B;  4F5O A;  5HP4 A;  3EEC A;  2UVW A;  1SGG A;  5FR3 A;  2A1J B;  1JAL A;  1ZKH A;  3NUQ A;  4IQT A;  1XLN A;  1WFY A;  1I4R A;  5ALY A;  4LZD A;  2J4X A;  2NRT A;  2N1V A;  2Y0S C;  3O0F A;  3D2N A;  3FYH A;  4N58 A;  4OZB A;  2JYE A;  4WQM A;  3NRZ A;  5DB6 A;  2WAQ F;  2ZVN A;  9ICU A;  3WAM A;  5J2H A;  4QZC A;  4MFF A;  3RUL A;  4HYK A;  3MR3 A;  4TUR A;  2JH1 A;  5KG0 A;  5KFR A;  2PXI A;  3QZ8 A;  3WAO A;  1OFF A;  4AJY B;  2ZW0 A;  4RUA A;  4EBC A;  2BVC A;  3TSS A;  2ZTE A;  5ALM A;  1ZXH A;  2F44 A;  3F2D A;  3WAL A;  3GV8 B;  1ENF A;  2LFI A;  2NO5 A;  1KFY B;  1U45 A;  2W43 A;  1L8O A;  3JW0 X;  3T9L A;  2DX5 B;  2XC9 A;  2EEL A;  4F92 B;  2HOF A;  1Q3V A;  9ICG A;  2BGW A;  4DXG A;  3Q8R B;  3WK8 A;  4LJX A;  4B9N A;  3BQ7 A;  2Y3A A;  3AE2 B;  1A76 A;  3M6K A;  4UAW A;  3WKE A;  4CGZ A;  1IM4 A;  3K1Z A;  4RT3 A;  5HR7 A;  1WR1 A;  3QU5 A;  4RQM A;  4NM2 A;  2K4H A;  2G0A A;  3PSF A;  3V7K A;  1P0R A;  2JZZ A;  2QCZ A;  3ALB A;  1X42 A;  2M9N A;  2NMQ A;  4TUP A;  3V6C B;  1C77 A;  2BKE A;  2ZPN A;  3AE3 B;  3I1Y A;  2BHN A;  2ODG A;  3Q8A A;  4NWI A;  2O6K A;  9ICA A;  5D94 A;  2NRV A;  4BOS C;  1D5M C;  3ORY A;  1GAQ B;  1YZ7 A;  2KFJ A;  1NNL A;  4RMA A;  5EE3 A;  4Y2V A;  3RB4 A;  3V72 A;  2N1W A;  3JPR A;  4CDG A;  3ZDM C;  2NR2 A;  4U7C A;  1I4G A;  1SXE A;  5B5E U;  1RXV A;  3BYT B;  3V6H A;  2LGY A;  4OVU A;  5KFT A;  2AQ4 A;  2RHF A;  5AZF A;  2KAJ A;  1R4N B;  1BPY A;  3DBH B;  1Y56 A;  5JH5 C;  4HWI B;  4YWG G;  2ASQ A;  1PUT A;  4LNN A;  5BMG A;  4EKU A;  2KE7 A;  3VDZ A;  4RGO S;  4QZI A;  2V4I B;  5JU5 A;  2K4I A;  4IRC A;  4C8K A;  1L0V B;  1JWM D;  4DQS A;  4MDK E;  2H3Q A;  4TUU A;  2IZV B;  1A0P A;  2YB4 A;  3F53 A;  2ZVO A;  3L4P A;  3I63 C;  4DSE A;  3V05 A;  4KLH A;  1YJI A;  2XO7 A;  4ED6 A;  3HRD D;  5KFV A;  2ZXH A;  3Q69 A;  2K6D B;  2M19 A;  4J9N A;  2K89 A;  3LWM A;  5DQH A;  4GXI A;  1P7E A;  3BZC A;  3VQI A;  9ICS A;  2VZK B;  2KHV A;  1RXW A;  2RRD A;  1SL0 A;  1T0Y A;  2KWD A;  4B9K A;  2H3F A;  2GBJ A;  4ZHP A;  2M8S A;  4ECV A;  4ECT A;  1WUD A;  2FPL A;  2RLT A;  1TAQ A;  1RLF A;  3PW7 A;  2IA6 A;  5DPS A;  2BR0 A;  1F52 A;  2P35 A;  3I28 A;  3RAQ A;  4ANX A;  3NVW A;  1ZPS A;  4B6W A;  1KJT A;  3RB6 A;  3C29 A;  5CB1 A;  2K8B A;  3U7Z A;  1IGC A;  2KKC A;  3Q8C A;  5AM2 A;  5ALK A;  4WJO A;  5BO4 B;  4JIO U;  1XC9 A;  2D07 B;  3ZXR A;  3AE8 B;  2FDR A;  1L6N A;  4HK2 A;  5CRX A;  3UMG A;  3U2S C;  4UDU C;  4BKG A;  1E0Z A;  2V4Q A;  2NBV B;  4ICV A;  3U26 A;  1NK4 A;  3MJW A;  5AI5 A;  4K4H A;  5IIJ A;  5BOM A;  2H3I A;  2WYQ A;  5HML A;  2HHT A;  2GLS A;  4MEY A;  3CWI A;  5J17 A;  4MM3 A;  1C79 A;  3KYC D;  1EWY C;  3NHE B;  5ALV A;  4RZR A;  3ZD8 A;  5BYS A;  4R64 A;  1WJ6 A;  1WX9 A;  9ICB A;  5HHD G;  4P7I A;  1RQL A;  3ONN A;  1TTN A;  5HMM A;  2V1Y A;  3LJ3 A;  4N9F 4;  5J0R A;  2YMP A;  1SZH A;  3T8M A;  2V3N A;  5E6J A;  5AKL A;  9ICM A;  5T8I A;  1U48 A;  1R4N I;  1KFS A;  2HTH A;  2JHD A;  2JZB B;  1JWB D;  3BS5 A;  3UQ0 A;  2YMM A;  2Y5P A;  1N5X A;  4O9M A;  4R65 A;  3RZW C;  3WAP A;  4FHJ A;  3QU4 A;  2LI6 A;  3WK7 A;  1WM2 A;  2AQ2 B;  4DO9 A;  4KLF A;  4AWJ A;  4ICA A;  1FCL A;  1E9M A;  3ZRF A;  4FS1 A;  3SD5 A;  3VRB B;  2DFL A;  2EH9 A;  4NJC A;  4PYZ A;  3QX1 A;  2BCQ A;  2R8J A;  3R3M A;  1PYW D;  2JEF A;  4FA6 A;  4KDI C;  2MEK A;  5AKH A;  2XN9 C;  4YMN A;  2ZJ8 A;  4EUT A;  1HIW A;  1XNS A;  3TMP B;  1ZQ1 C;  3V61 A;  2Y1I A;  1KOT A;  4CHK A;  4NJ8 A;  4E0D A;  3UGB B;  1IBX A;  2ZIU A;  2G08 A;  1MHX A;  2JX5 A;  4M9J A;  1KKX A;  2ZG6 A;  4F50 A;  2JMG A;  4Y2J A;  3A9J B;  1L6V A;  3V6E B;  3PTF C;  4IR9 A;  4K1R B;  2RDB C;  1R4M B;  1DOI A;  1XO1 A;  3WIM A;  1XCT L;  3SAG A;  1BXT A;  1J7B A;  8ICP A;  1C4P A;  2LHD A;  3W1S C;  1SF0 A;  1L7O A;  1PUZ A;  2VJ5 A;  3IG5 A;  4FZM A;  1PZN A;  4DDG D;  1UWX A;  2YEP B;  3VCB A;  4CQN A;  3DDC B;  4YQW A;  2W7O A;  3NG0 A;  2IHN A;  3GV5 B;  2ES6 A;  4FLH A;  1PVR A;  1NBF C;  3JYU A;  4XDC A;  5AK6 A;  3PSE B;  4M9G A;  1V6E A;  3DBS A;  4MEM A;  5KT3 A;  3FAH A;  1OQY A;  4HPL B;  1E7U A;  4QNL A;  5C23 A;  2E5S A;  2UWQ A;  1DGS A;  4C8L A;  2LGS A;  2DGZ A;  4Z6F A;  7ICG A;  2IOH A;  2N4F A;  4FN2 A;  3W5V B;  4NAW B;  3L54 A;  3M95 A;  1C1Y B;  2N9X A;  3H40 A;  7ICE A;  2O6V D;  1QH9 A;  2JZP A;  1L0X B;  4RF1 A;  2XID A;  3AE6 B;  2KG5 A;  5CHF A;  4DQQ A;  4WWP A;  2E6X A;  4UAT A;  1V80 A;  2BKR B;  3BZK A;  1HXY D;  4DQO C;  1UHU A;  4J9K A;  1WGG A;  4EZJ A;  1UH6 A;  4KKJ A;  1SIF A;  3C1Y A;  2YVC A;  4JX1 C;  1S0V A;  2M56 B;  3LYY A;  1AYF A;  1Q10 A;  3B2G A;  1EF5 A;  4ECZ A;  2BS4 B;  3BS7 A;  2FUH B;  3WKA A;  4MGK E;  1IXR A;  2REX A;  3AU4 A;  2KKP A;  3GZF A;  4OHJ A;  1TAU A;  1V9P A;  3WK5 A;  5CHW A;  4Y2Y A;  3QWZ B;  4RM9 A;  1LGR A;  2PVO D;  5KFO A;  2JZ3 B;  4PH5 A;  3EC8 A;  4XQ8 A;  3WK4 A;  4NZL B;  1GB1 A;  3RJH A;  2WXR A;  2ZPY A;  2KQ7 A;  4URK A;  2IO0 B;  4QWA A;  4M47 A;  4IWO A;  2OM6 A;  4UB6 U;  5J18 A;  4H2A A;  3VR8 B;  2R8I A;  3ZDB A;  2M17 A;  2Z7J A;  1K50 A;  3QUC A;  3H0L B;  4KSK C;  5AKX A;  4C00 A;  3UI3 A;  2KKV A;  5E6P A;  1URJ A;  2CN1 A;  5DQG A;  4KGS A;  1R4M I;  3DCG A;  3BK1 A;  2LUE A;  3A4S C;  1KL9 A;  4MH0 E;  1SE3 A;  3H7I A;  1SSN A;  1X9S A;  1NEN B;  3M8S A;  8ICA A;  2IDY A;  2AGP A;  1SJH D;  3RTV A;  2FE9 A;  1BPX A;  3RR8 A;  4QIW C;  3G6X A;  5ALW A;  2WQY B;  2FUG 1;  3FKY A;  4G11 A;  3QYP A;  2BBC A;  2L7R A;  1WWT A;  4KV2 A;  2J0M A;  4OZA A;  2KP7 A;  2LI5 A;  2AQ0 A;  2YML A;  4QW8 A;  3ZI4 A;  1C78 A;  2MBO A;  2L52 A;  3NZS A;  1RDF A;  8ICZ A;  1SE2 A;  3OJU A;  4Y2P A;  5AI9 A;  3WU2 U;  1VCB A;  3UXP A;  1B1Z A;  2P66 A;  1HEZ E;  2KTF A;  4IWP A;  3U52 E;  4DL7 A;  3ZNH B;  3PT2 B;  1JN3 A;  5DPT A;  4BDP A;  1RM6 C;  5JRT A;  3OG5 A;  1BVS A;  3TAC B;  2ZNV B;  3NJT A;  3T3O A;  2BWE S;  2KLC A;  4RGN A;  5ALX A;  2PI4 A;  2LD9 A;  2LHE A;  7ICF A;  3A1Q B;  1KLV A;  3IT4 B;  4GMV A;  3HJE A;  4FBU A;  2EZX A;  4II3 B;  4PHA A;  1X6I A;  1OW5 A;  2BCR A;  2WXN A;  1E8X A;  3KWV A;  4UB5 A;  1F9J A;  4BJQ A;  2MBB B;  4DQP A;  4J9O A;  2WXF A;  2QAR B;  2KMM A;  1NKB A;  3N28 A;  2C7N B;  1WGK A;  1LXD A;  1Z00 A;  3EA6 A;  2K60 A;  2OJR A;  1J0G A;  2JXX A;  2LXC A;  4C4R A;  2L76 A;  1SE4 A;  2GI9 A;  3AE4 B;  2OYY A;  2HHX A;  1EU3 A;  4M6W B;  1RYS A;  4UB3 A;  2K6Q A;  3EPG A;  1RYJ A;  3R7R A;  3AMZ A;  2PMZ C;  3IHQ B;  3CP8 A;  2I1K A;  5ALS A;  9ICJ A;  2G5I B;  4KLQ A;  2HOQ A;  4LNI A;  1I42 A;  3TEX A;  4PS8 A;  3V3X A;  3NRW A;  2CHW A;  2WXO A;  3I76 A;  1ZRN A;  2LMR A;  2ZCB A;  2HTM E;  3MAB A;  2YTU A;  2KWU B;  4RQ1 A;  4MF8 A;  4EYH B;  1T3N A;  3TL5 A;  3NVY A;  3P4Q B;  5DQI A;  4A8X C;  2ZIW B;  4BWJ A;  2VIX A;  2RQ5 A;  2ZUB A;  4DXA B;  4JB3 A;  1VD2 A;  4UB2 A;  4EYI B;  5ALQ A;  2CJO A;  4O0I A;  5BYR A;  5J2J A;  2KZ3 A;  4ICU A;  2J52 A;  2NO4 A;  4AP9 A;  2QJL A;  5AKZ A;  5DBA A;  4HEA 1;  1F77 A;  3V7L A;  3PLV A;  5CP2 A;  1IPG A;  4N59 A;  3T5H A;  1D9F A;  2GB1 A;  9ICI A;  5IP4 D;  4F4W A;  1K1S A;  4YTP B;  4XDD A;  3OHA A;  3KHG A;  3A9K B;  4PHD A;  2XY6 A;  2KVR A;  1VLB A;  3N7S C;  4O3R A;  7ICV A;  3GIK A;  3AUO A;  4CNQ A;  3PGE A;  2DAJ A;  5KG1 A;  1D6E C;  4ZHO A;  1X6J A;  5AKI A;  2LYH A;  5K4L A;  3ZIM A;  2BYE A;  2RPQ A;  1JML A;  4I2E A;  4GDL B;  2QIL A;  7ICU A;  5CHG A;  1YT3 A;  2F1H A;  5L1M A;  4B9U A;  4BXO B;  2H89 B;  5DDM A;  4TSS A;  4B6J A;  2PFP A;  2DBY A;  2K9X A;  3RF9 A;  3ZQ4 A;  2N9L A;  4PPX A;  5KFK A;  2KJR A;  3OJ3 A;  5AKK A;  5ALO A;  3A0B U;  4ELT A;  2NBU A;  3Q3N C;  3D32 A;  4XRH A;  5GXG B;  1V1P B;  3M9M B;  2ACZ B;  3PO4 A;  1EU4 A;  2NS5 A;  1ZUD 2;  2HMX A;  4B9T A;  3GII A;  2NCN A;  2LAS A;  5JHB A;  1MPE A;  5CX3 A;  1KLN A;  4DLE A;  4NAM A;  2NRW A;  3M6Z A;  4B9M A;  3AE7 B;  4GB9 A;  3N7R C;  1IYF A;  2CXY A;  3BQ1 A;  3LVV A;  2WHE A;  1C20 A;  4HPM B;  4OVZ A;  4RNA A;  4UB8 U;  2KZR A;  2IO3 B;  3VFK A;  3S2A A;  5KFC A;  2FAZ A;  4WWO A;  3PLU A;  1P9D U;  2LRW A;  4WWN A;  4BUG A;  1ZQS A;  2JR5 A;  9ICF A;  1L4D B;  1E5W A;  2MU2 A;  3N1Y C;  4ITK A;  2BTE A;  1SEB D;  1YNT E;  4UAY A;  1MG8 A;  4GU2 A;  3QU2 A;  4P0P A;  1V8C A;  1V5O A;  4A6Q A;  3EYZ A;  1TS2 A;  2D10 A;  3H8S A;  3FDS A;  2RMM A;  4EEY A;  4DF8 A;  1ZQH A;  3QEA Z;  1BNP A;  4RQ8 A;  3GZN I;  4EZ6 A;  3KTQ A;  4IW0 A;  3PHX B;  1LVH A;  1VZ8 A;  4Q45 A;  5ALU A;  2BCV A;  3BZD B;  2IBI B;  2PFQ A;  3RD2 A;  3H8M A;  8ICF A;  4O3O A;  4AYB C;  1EXN A;  2BQU A;  2IMW P;  3PO0 A;  2KDF B;  1I7H A;  3G6Y A;  4RQ7 A;  2G07 A;  1NK7 A;  4GLX A;  2WF5 A;  4P4M A;  2F1I A;  4KLE A;  2JH7 A;  1AN8 A;  2AH5 A;  3URY A;  3ZNG C;  4KLM A;  1J8C A;  3WK6 A;  4TV3 A;  5KT4 A;  1MC8 A;  1FNW A;  2IO2 B;  3SD7 A;  2W9B B;  2LGI A;  2OXO A;  2Y9U A;  2LUM A;  2X38 A;  4ZRI A;  2DL0 A;  4USA A;  2BF8 B;  2KWC A;  1JQ4 A;  2IPK D;  4ARI A;  5G5G A;  3FIL A;  5IIO A;  3MR6 A;  3P63 A;  3I9V 1;  5KFW A;  3SU8 X;  3M63 B;  4C0Z A;  2NTS A;  4DHZ B;  2R8H A;  2M4N A;  2ONQ A;  4G0N B;  4F1S A;  1Z1V A;  2CHX A;  2JRH A;  4IM3 A;  3GDX A;  2BS3 B;  3E56 A;  4HXD A;  4RF0 A;  1BPE A;  3QXG A;  4DSK A;  1NJY A;  2OJW A;  4W9I A;  5ALF A;  5KTQ A;  4QAY A;  5DPR A;  4KIT B;  1F2R I;  1G6J A;  4QW9 A;  1ZQO A;  3UIP B;  3MHS D;  3ZRC A;  5AKY A;  4OJP A;  2CPR A;  2QB0 A;  2LHT A;  1HEK A;  4EX7 A;  2IGG A;  2LMC A;  4TQR A;  4UB4 A;  3NOB A;  4OD0 A;  4YCX A;  2LYA A;  1WRI A;  1ZQA A;  1SBB B;  3PSP A;  5ALZ A;  4F2S A;  1AAR A;  1J7C A;  5D4B A;  3R2T A;  1XT9 B;  2EAN A;  1ZQQ A;  3AV8 A;  1FXA A;  2O2V B;  4MFA A;  1MJD A;  1WXS A;  3TEW A;  1CI4 A;  2MUT B;  4RQ0 A;  4KX3 A;  4C4S A;  4ECR A;  3RT3 B;  2DWQ A;  2CRX A;  2N7E A;  2LGX A;  1V38 A;  3PML A;  2ASL A;  2J6S A;  2R61 A;  1YD8 U;  4IUM B;  5J2I A;  2KHQ A;  1EM7 A;  2FID A;  4HJG E;  2MJD A;  2WNM A;  3ISC A;  4M9H A;  5LXI B;  1PVQ A;  5F9N A;  3A33 B;  3BYY B;  2HJ8 A;  3SEI A;  4XGA B;  1ZW7 A;  5DLF A;  2B21 A;  1TE2 A;  1WXM A;  3HPO A;  2GBN A;  5ALN A;  3IP4 B;  1WX7 A;  4HRO A;  4EX6 A;  1N60 A;  2F76 X;  4RQ3 A;  3T3F A;  1N2X A;  2KQ4 X;  3H6N A;  3IHP C;  4KLT A;  3BII D;  5EE1 A;  8ICW A;  1UD7 A;  1ZD4 A;  5CEH A;  3RJE A;  3Q3M C;  2GBM A;  2ZUD A;  3TAQ A;  4ANU A;  2KSO B;  1XD3 B;  7ICR A;  4P1B C;  4XE0 A;  1J2M A;  5CJ7 A;  4M01 A;  3W5U B;  4J9R A;  3BVZ A;  5AUK A;  1L0Y B;  3ONS A;  3HP6 A;  1OGW A;  1JI7 A;  1L7P A;  4F8R A;  3HVZ A;  5AHX A;  3RJG A;  2N7J A;  3H4D A;  4NJ6 A;  1UCV A;  3OTQ A;  3VHT C;  4RQ4 A;  1L2N A;  1VZ6 A;  4MSQ B;  2WXM A;  4LJP B;  4MEX A;  1NK0 A;  3CNH A;  3C1Z A;  3N97 B;  1DOQ A;  3RNG C;  2KEY A;  5AM5 A;  1PVP A;  2PFO A;  3FC4 A;  4M00 A;  4IL6 U;  3ML9 A;  5LNK 1;  5J8Y C;  1PK1 B;  1N61 A;  3NAS A;  1XLQ A;  1ZDV A;  4O1N A;  2A3V A;  2KJH B;  5AIB A;  4YVZ A;  3G6V A;  4I2B A;  2GO7 A;  2WTF A;  3T79 A;  2E8M A;  4ZRQ A;  3TJP A;  1KEJ A;  4HKQ A;  1GOZ A;  3MDA A;  1QQR A;  1X9W A;  2D3B A;  5A0L A;  3OGU A;  2DYB A;  2LZ6 A;  3IG8 A;  2JXT A;  4JV0 A;  3L5K A;  4DQI A;  3GOE A;  2D3D A;  3MR5 A;  4BAX A;  4MHV A;  3F2B A;  5J2R A;  2F1J A;  1DRG A;  1NJW A;  3E2E A;  1LKY B;  4EZ9 A;  4HJK A;  5KFX A;  3VXW A;  2OWO A;  4DXF A;  1D5X C;  3ALR A;  2KO3 A;  5F3X B;  4YD1 A;  3PX4 A;  3S6J A;  2DEN B;  4O3Q A;  4OJ5 A;  5KFU A;  2MJE A;  4X5V A;  3KKA C;  4QZ8 A;  1QCK A;  5KFJ A;  3AM9 A;  2DZJ A;  3O65 B;  1LB2 B;  1CZP A;  2QIE B;  1F5S A;  2C60 A;  2CS4 A;  3QJZ A;  1N5W A;  5J0Q A;  1ZE3 D;  1Q1O A;  3MC9 A;  2JEI A;  3C8Y A;  4OCZ A;  4W9G A;  4RQ5 A;  1GUA B;  5L1J A;  2K8H A;  4C7Y A;  3NVV A;  1RPL A;  4JV1 A;  3PS6 A;  1ZXI A;  1BPZ A;  3N3K B;  4L2Y A;  4JE3 B;  3BQT A;  2X8X X;  2FMS A;  2JEG A;  4DOB A;  5IKC M;  2LBO A;  4ACF A;  3R7Q A;  3SFE B;  2BB5 A;  1PGX A;  1RZT A;  3HKZ F;  4PGQ A;  4NLK A;  5KG4 A;  2C28 A;  2PVG C;  2A1J A;  3Q8Q B;  1ZQJ A;  4ED3 A;  4ASW C;  1EF1 A;  2JYT A;  2YMQ A;  1D8B A;  1TAM A;  3E58 A;  1YN5 A;  8ICR A;  1I4P A;  5J0X A;  8ICV A;  1NJZ A;  3PY8 A;  2M0X A;  3B1L X;  4KGT A;  2AHO B;  8ICJ A;  1QQ7 A;  4MFC A;  2PLP A;  5KL8 B;  2ASJ A;  3IAS 1;  2VH1 A;  4XYC A;  1RQN A;  7ICJ A;  1E7V A;  2KN4 A;  3X0W A;  2INP E;  3GE8 C;  1UWM A;  5L1K A;  2PTL A;  1ZQN A;  2WWZ A;  1ZQR A;  1WWV A;  2HBK A;  4ANV A;  1D5Z C;  5KFS A;  2DPJ A;  5ALD A;  3B0A A;  8ICY A;  4M9N A;  2BYV E;  2G3Q B;  1RYU A;  3QAR A;  3RNE C;  3DQV A;  4W9H A;  4F3O A;  2GLE A;  2V9W A;  4O5K A;  3CMM B;  3UXN A;  1RFA A;  3QE9 Y;  4RGM A;  2P6U A;  5KFP A;  1F1H A;  5TSS A;  8ICM A;  1UEL A;  4DSJ A;  2KTQ A;  2MP2 B;  1KFT A;  1DOX A;  1ESF A;  1MQ2 A;  3VTV A;  7ICS A;  2FI1 A;  4BBN C;  3HW8 A;  4KLO A;  2QSD A;  3N1X C;  3JPO A;  2KOB A;  2WF9 A;  3ZDA A;  4ELU A;  2WDQ B;  3PX6 A;  5DGB A;  1ZQG A;  3DWG C;  3U4E G;  3ED5 A;  4B0E A;  2MJ3 A;  4BX9 C;  2H88 B;  2QHO A;  3P4R B;  4RPX A;  1B9R A;  1QF6 A;  1ZQX A;  1QQ5 A;  5DG9 A;  1FRD A;  4YMO A;  4F91 B;  4YD2 A;  3EHV A;  4MJS B;  3LYS A;  1C76 A;  3OAW A;  2RDG A;  1S76 D;  3UMC A;  2ZIV B;  4DFD A;  3IXS A;  2FPM A;  3F5A A;  1E10 A;  1ZQE A;  1I4H A;  2C2E A;  3KUD B;  2JV3 A;  1Z4N A;  4K7U A;  2I38 A;  3Q3J A;  5KFB A;  7ICM A;  1BPB A;  2W54 A;  1V97 A;  2KC1 A;  4NLB A;  2WHI A;  1TKY A;  3RUI B;  3V6K A;  5AM1 A;  5KFM A;  3PRP B;  4FUL A;  1RRB A;  1NYQ A;  3HK0 A;  1JWU D;  3JPP A;  3PRE A;  1S3S G;  1VR9 A;  2MX2 A;  2BYF A;  2WXJ A;  2BQQ A;  2QLT A;  2MLB A;  4RQ6 A;  5AM4 A;  3PW4 A;  3N32 A;  5F9L A;  4DL6 A;  4DWI A;  2DZK A;  4O3S A;  1B43 A;  5AEK B;  3LB8 C;  1ZP0 B;  3QNM A;  1RYR A;  5DB9 A;  2O6V B;  1NKE A;  2XGQ A;  3U7D A;  3M1Y A;  2XIC A;  4F71 A;  1JXE A;  1X2I A;  2GH1 A;  1SKW A;  4NLG A;  1KH0 A;  2HHU A;  1XF5 L;  4DEZ A;  1NI2 A;  4BFR A;  2GRI A;  1M4V A;  2C7M B;  5AM3 A;  3RBE A;  2KT7 A;  4XZ4 A;  4DK5 A;  2DZI A;  1FM0 D;  2W03 A;  2JF5 A;  4I2H A;  2KLG A;  2VAN A;  3JVZ X;  4RM8 A;  1SV4 A;  5KHO A;  3W1S A;  2M1M A;  2XK5 B;  3M9O B;  5HNK A;  3RAX A;  2WU2 B;  4XUS A;  5AIC A;  1GNU A;  4C80 A;  1WGD A;  4FJY A;  4PT5 A;  3RFA A;  1S9F A;  3WKD A;  4UBB A;  1ZOY B;  3QUB A;  2AGO A;  4KZ0 A;  1X66 A;  1WY8 A;  4ECU A;  3PZD A;  5E79 U;  3ABV B;  1S5L U;  1ZD3 A;  1T94 A;  7ICT A;  2KK0 A;  4R8U B;  3OJ4 B;  4B0M A;  4FE3 A;  4I28 A;  2LXA A;  1T0R C;  2H5X A;  1L7Y A;  5D46 A;  2PPH A;  1TFR A;  2WB1 C;  1TS3 A;  9ICX A;  1QOG A;  1Z19 A;  2L1A A;  4TQ1 A;  2KDE B;  5KT5 A;  3PW2 A;  5JXV A;  3ZO5 B;  4KGR A;  5EWE A;  4A55 A;  4YXJ A;  2KQS A;  3BVG A;  3FM9 A;  4OJL A;  3V60 A;  4W9C A;  2UU7 A;  5LXH A;  3ZYY X;  4PL1 A;  1K51 A;  2KXJ A;  2HBJ A;  3HUI A;  4P6V F;  1FPY A;  4FZN A;  3M8R A;  3RH4 A;  1UA1 A;  3AEG B;  3RJJ A;  1L3V A;  3C5G A;  5ALT A;  1E6E B;  2PW9 A;  1ISN A;  5ALR A;  2BW2 A;  4HCP B;  3I5J C;  3Q14 C;  2AXT U;  2H3V A;  1A77 A;  2FCM A;  2NPT B;  1NK8 A;  4F4X A;  1JIH A;  1X9X A;  4BWM A;  2KWV B;  3PRZ A;  3VR9 B;  4DCC A;  3BWU D;  1XS9 D;  3RB3 A;  2JZB A;  5J0W A;  1ZOL A;  4J9S A;  1SKR A;  4M8M A;  1DGJ A;  3U30 A;  1WJN A;  2VKQ A;  3DBR I;  3ZD9 A;  2W3S A;  2JU6 X;  4F4K A;  5III A;  4ZDV A;  1T5X D;  3P4P B;  8ICL A;  4AP4 C;  4MEL A;  8ICU A;  4I2F A;  3AE9 B;  1V81 A;  2J6T A;  1SXD A;  4P0Q B;  1Z5S B;  1ZQP A;  3UQ2 A;  5DLG A;  2MBQ A;  1WXA A;  1FD6 A;  4GXK A;  2XGP A;  2DHZ A;  3DVG X;  1CJE A;  3A4R A;  3MP9 A;  4PS7 A;  1ZET A;  3ECI A;  5HHH A;  3AEV A;  1FMA D;  4DFK A;  3TAR A;  1Q8K A;  5IO9 A;  1SL1 A;  3KUC B;  1TBE A;  2K8A A;  1B4F A;  1QIL A;  4M0W B;  5KFG A;  2LJ5 A;  4Y2U A;  9ICN A;  9ICC A;  3A9J A;  4ED7 A;  2HHS A;  2GBR A;  3KH0 A;  4E3C A;  4OO1 J;  2W11 A;  1V5T A;  2HDE A;  2E3T A;  5DGA A;  2KHW B;  1GB4 A;  3WKB A;  3K75 D;  4N6E B;  3TQ1 A;  4CYE A;  3TEY A;  1JRP A;  4YTN B;  4EEK A;  2Z0E B;  3TCA A;  2DAF A;  4P16 A;  2ZJD A;  2KOX A;  5AI4 A;  3P42 A;  2N9K A;  3JSV B;  4Q8E A;  3KFU F;  1C4C A;  1S10 A;  1I4X A;  1SJE D;  4W9J A;  3IT6 B;  3WCQ A;  2JRI B;  3DHG C;  3QAQ A;  3QU7 A;  1EUV B;  4FBT A;  4XA5 A;  5J2K A;  1K52 A;  1X1M A;  2WDT B;  4NAW A;  5KAI U;  3ZXV A;  4GC6 A;  3ZLZ A;  2KJ6 A;  1C7Y A;  4KIK B;  2YB1 A;  1MG4 A;  2F8L A;  2BZF A;  1CK1 A;  3Q3F A;  2LPE A;  4ECW A;  3TFS A;  4K4G A;  1SKS A;  3TIX A;  8ICE A;  4PGY A;  5CHV C;  2J53 A;  2CU3 A;  4I2I A;  2W8K A;  3H8J A;  2JEJ A;  3ENE A;  5T14 A;  3RZF A;  9ICW A;  4FO6 A;  2FBW B;  4GDK B;  7ICQ A;  4C4V B;  2D3A A;  3QIJ A;  1PDX A;  3UIO B;  4JWN A;  2IY0 B;  2RD0 A;  2Q0Z X;  3ZDT A;  1JUD A;  2UVU A;  1WZ0 A;  4I2J A;  5AIA A;  3HVD A;  2EAM A;  2PJH A;  1FEZ A;  1WR6 E;  5H92 C;  4FZL A;  3ICX A;  3Q8S B;  2KJ8 A;  9ICH A;  2G5H B;  4XX5 A;  2L5Y A;  2BT6 A;  1NKC A;  1WCN A;  4C56 C;  1UA0 A;  3KVF B;  3H7S A;  4R63 A;  4Y2Q A;  5KT2 A;  2KFK B;  3H7P B;  3OLM D;  3B9J A;  2B76 B;  5DKW A;  4Y2R A;  7ICN A;  4LDT B;  3ETL A;  2ZTC A;  3PR4 A;  3C19 A;  3VUY A;  2KMC A;  4JL9 A;  4BZA A;  5D3D A;  1UGJ A;  1D3Z A;  5AKJ A;  1DXS A;  1KRP A;  3RH6 A;  1DK2 A;  2QMT A;  4MGI E;  4MGZ E;  4I2A A;  5ALL A;  2Q4T A;  5J2F A;  4M02 A;  1WMH B;  3MGI A;  2KVZ A;  2XI9 A;  1GC7 A;  1IUE A;  2CJN A;  1WE7 A;  3P1M A;  3PO5 A;  5DG8 A;  4HCN B;  4IKG A;  2WFA A;  5ALI A;  3KZX A;  5KFE A;  2GMI C;  2GOW A;  3SI8 A;  2JQR B;  4M9L A;  3KHL A;  1BNO A;  4AOF A;  2F8K A;  3W9C B;  3QHT A;  3LDA A;  1KTK A;  3SMV A;  1FIQ A;  4P4O A;  5EWF A;  3K1R B;  1MSW D;  1TKG A;  5JTI A;  2B0C A;  1LV5 A;  3PX0 A;  3DVG Y;  3RR7 A;  3SV3 A;  1TV9 A;  3F5E A;  3JPT A;  4LNF A;  4JMU A;  3P2B A;  4AJW A;  3IG3 A;  3R2I A;  3AL0 B;  4LNO A;  3W1Y A;  3ZJV A;  2J6U A;  1I35 A;  3GZN B;  2W9C B;  1VJK A;  2AL6 A;  1B0X A;  1IG6 A;  1QLN A;  4RPZ A;  3N1Z C;  3IN5 A;  3RPF C;  2K5P A;  4OW0 A;  4TQS A;  2MA9 B;  3A1Q A;  5EWG A;  3Q8M A;  3RBD A;  3U8Z A;  4KN4 A;  5KG6 A;  4BGD A;  1KRH A;  4HDO A;  4WJ3 B;  2A4Z A;  2C5L C;  1NK5 A;  4EEL A;  3HIL A;  2P6R A;  5TZV A;  2JWU A;  1ZQB A;  2QAR A;  3QUT A;  3PMN A;  1U49 A;  3L13 A;  4HRS A;  4DFP A;  5GTI U;  4ZH4 A;  1WX8 A;  1TYG B;  1YN4 A;  3DVN U;  3O13 A;  1HQR D;  3MGV A;  1MQ3 A;  1YN3 A;  2OED A;  1WM3 A;  4XC2 A;  4IDI A;  3B08 A;  2Y5B B;  3V7J A;  2HDO A;  2M0A A;  4M6W A;  1XSN A;  3T5L A;  1XCQ L;  2WS3 B;  4Z6D A;  1T4G A;  1TGZ B;  5KFL A;  3AEE B;  2K22 A;  4YT0 B;  2RDH A;  1ZJN A;  1AWD A;  2HBL A;  3RNF C;  4C8M A;  4LTU A;  4NLN A;  3H4B A;  4ANW A;  2IND C;  3IV6 A;  3ISB A;  1UT8 A;  1OXJ A;  1CEZ A;  1L5P A;  2XY7 A;  1TVA A;  1GC6 A;  3NTU A;  1STE A;  5GMV A;  3C2K A;  4RT2 A;  2ZIW A;  5KG3 A;  3E0F A;  2W9A A;  1TIF A;  3QK0 A;  3WAN A;  2MSE D;  4NQK E;  5BOL A;  4DDI D;  3GS2 A;  3MBY A;  2ZNV C;  4I6L B;  2L05 A;  2HVH A;  4BKS A;  3UQA A;  3IVF A;  4LVS A;  2BWF A;  1O08 A;  1HUZ A;  9ICR A;  4B95 A;  2GOL A;  4A8E A;  1S97 A;  1S1Q B;  1JWS D;  3BIN A;  3A9K A;  3VUW A;  4DQR A;  4JWU C;  1TKD A;  4GLS C;  2ASD A;  1ZQK A;  3Q3O C;  3N30 A;  2K0P A;  5DB7 A;  3QCA A;  2LM1 A;  4OJO A;  4WH4 A;  2LYB A;  3H0R B;  5L1I A;  2WXH A;  1PK3 A;  4HKZ E;  1JWA D;  4DL3 A;  1XSL A;  4YR2 A;  3ZDC A;  2KYW A;  3MFH A;  2ZCC A;  3LXF A;  7ICL A;  3B0X A;  4UQG A;  1QQ6 A;  4GDL A;  3EW9 A;  1ZYQ A;  1MN8 A;  3CW2 C;  2R8G A;  2K3U A;  4KMU A;  2BKF A;  2INC C;  3GP7 A;  2OH2 A;  1CQV A;  4QJF B;  4BXO A;  1YX6 B;  2B3A A;  3VC8 A;  4AQ7 A;  1Z1B A;  3K4G A;  5L95 C;  5D6J B;  2B6G A;  3UQB A;  1BUI C;  4KLS A;  5BYQ A;  3RRH A;  3Q2A C;  4GFJ A;  1P98 A;  4K7S A;  1E8Y A;  1V1P A;  1KN5 A;  2W55 A;  4YP3 A;  4W9F A;  4DHJ B;  4Q44 A;  4NL9 C;  3F2C A;  2PMZ F;  3RNA C;  1KLG D;  5KFN A;  3WKC A;  4ECX A;  5JUM A;  3ZNZ B;  2UYZ B;  4IQW A;  4DLG A;  8ICX A;  5J0P A;  2ZIX B;  5FKA C;  1KQQ A;  2FLN A;  4ZOH C;  2C7H A;  1KW4 A;  2FCS A;  3RMK C;  1ZQM A;  3QEB Z;  1COO A;  2BPS A;  2WAQ C;  3NZ3 A;  4ZYN A;  2PKO A;  2KIC A;  1VJ5 A;  2NV3 A;  3DV9 A;  2XCA A;  3M9N B;  1L5U A;  2DYO A;  5KT6 A;  4OVV A;  4IM2 A;  4DWF A;  2WXI A;  3DWM A;  3N20 C;  2OEH A;  4ACO A;  4PJ0 U;  5C0Y A;  5DCN A;  4PL2 A;  3P4S B;  3C2L A;  5KAF U;  1L3U A;  4CCH A;  2EAO A;  4DSI A;  1EO6 A;  4RNM A;  2LRU A;  2GBK A;  1ZQV A;  4O5E A;  4A3O A;  1C3T A;  1SL2 A;  1L6U A;  3AQE A;  4UW9 A;  1UPH A;  1QLB B;  1WZ3 A;  1HZ6 A;  2I2Y A;  2EQY A;  4YSZ B;  4F7Z A;  2F2A B;  2JVC A;  3TAN A;  1YX5 B;  2FCN A;  1IP9 A;  3QA8 A;  2XCP A;  2I1Q A;  4YXD B;  1M94 A;  2G9H D;  4WQO B;  4KKI A;  9ICK A;  5TR5 A;  2FPK A;  4I2G A;  3AE1 B;  4YG2 A;  2L83 A;  3IBE A;  2HI0 A;  5J8Y A;  2D11 A;  4QZF A;  1S77 D;  1F2R C;  4L1B A;  4G3X B;  2LVQ A;  4Z6C A;  1TKE A;  2V4L A;  3RI7 C;  3SHQ A;  3L17 A;  2W9B A;  2HJ1 A;  2R2O A;  4FJZ A;  4W9L A;  4WJQ A;  5AK3 A;  3ML8 A;  4NLC A;  2K8C A;  3TAD C;  3HHM A;  2BPG A;  2FJ6 A;  4I2D A;  3H9D A;  3C28 A;  3BY4 B;  8ICB A;  1YQ4 B;  1Q46 A;  3R66 C;  2KTR B;  4GC7 A;  2DUY A;  4PZN A;  3SAH A;  4IG7 B;  3DOW A;  4J9M A;  1NVI D;  5AI8 A;  4EBE A;  1O03 A;  1V2Y A;  1YQ3 B;  1MA7 A;  4DOC A;  1T0Q C;  5L9X A;  3RRG A;  4KLI A;  4PK1 A;  4ECY A;  1QSY A;  1S0O A;  1TT5 B;  1KM7 A;  4RGT A;  5J2C A;  1HA5 A;  4J9Q A;  2LVO A;  2KIV A;  1XO3 A;  5KNI A;  3M62 B;  3KKA A;  3APC A;  4KX6 B;  3VTU A;  2MSN A;  3SQI A;  1WGR A;  2MAX A;  2F77 X;  1VZ7 A;  3AEB B;  1ZQW A;  3TKA A;  3APF A;  4G9B A;  4YSY B;  4KVG B;  4DL2 A;  4IWQ A;  4TQ0 A;  3QUQ A;  4PGX A;  2WLB A;  2BQR A;  1L8L A;  2AYO B;  5EE9 A;  2MQJ A;  2O2V A;  2V3P A;  1V1O A;  1HTQ A;  4US8 A;  3QZ7 A;  1I4Q A;  4K7W A;  4DL4 A;  5FP0 A;  2LM4 A;  2MUT A;  4R66 A;  1JXL A;  1OQR A;  4PZO A;  1XU4 A;  2JWZ A;  3UF8 A;  3BQ0 A;  4NJ7 A;  1X9M A;  3X23 A;  4ED1 A;  2SAK A;  4QZD A;  5J2G A;  1PGA A;  2XEW A;  2RDI A;  2NRZ A;  1L4Z B;  2G45 B;  3C23 A;  1OEY J;  2JRZ A;  2J42 A;  3NVZ A;  4AYB F;  1XWL A;  1MI0 A;  2IGD A;  3V62 A;  1QTM A;  3IFW B;  1VRA B;  4QWB A;  1OQQ A;  2EMS A;  1ZJM A;  4J3O D;  3PHW B;  1SV0 A;  2D6F C;  4DSL A;  2VJ4 A;  4YN4 A;  5ALG A;  4PYU A;  4DHZ E;  4IM0 A;  2L3Z A;  1UBI A;  1KDH A;  1E90 A;  1D8L A;  2KSO A;  5KFQ A;  1N6Z A;  4RH6 A;  3D2Q A;  1PQS A;  4BOZ B;  3UIN B;  2AU0 A;  4PHP A;  2MA1 A;  4IS7 A;  5DBC A;  3GQC A;  5J29 A;  2I9G A;  4ECS A;  4P4P A;  4QWD A;  1X40 A;  4LLG M;  1T0S C;  2QDF A;  2N1R A;  2CU1 A;  1Q0W B;  1WYW B;  1JRO A;  4EFO A;  4A90 A;  1TS5 A;  5AI6 A;  3M3J A;  4L23 A;  5HR6 A;  1E7P B;  1WGY A;  4B9V A;  4XWW A;  1XLP A;  5CR0 A;  1E8Z A;  3WA0 A;  1AQ6 A;  3KYD D;  2ATL A;  5ALH A;  5KFD A;  2C9W B;  1QOB A;  2XVT A;  2ZTD A;  2IBK A;  1A70 A;  1PK1 A;  2LJI A;  4JQW C;  1T6B X;  3PZ8 A;  2V9H A;  3NGD A;  3AXC A;  2M0N A;  2PFN A;  5IIN A;  1IIP A;  2FCQ A;  2VA3 A;  8ICK A;  3KWL A;  5HKH A;  1WH3 A;  4E71 A;  5H8Y E;  3ZJU A;  1ZGU B;  2KV2 A;  3DHI C;  2DLB A;  2QKQ A;  1SV0 C;  4WAA A;  2UVR A;  3KQ4 A;  5JZE B;  1TK5 A;  4U6P A;  3ZDD A;  1MHH E;  3KOO A;  3EUB 2;  4I6N B;  3LK9 A;  3DBL B;  4NXZ A;  5AM0 A;  2LWP A;  3MC0 B;  5G2N A;  2JUO A;  1P3Q U;  1LKY A;  2MCN B;  2V0G A;  2NVU I;  2E8N A;  2HBM A;  5J2E A;  5E6O A;  3T5K A;  4F5N A;  3SR6 A;  2PE9 A;  3KUZ A;  2FMQ A;  2RGF A;  1UZX B;  1L7M A;  2WXP A;  2KAN A;  1YIW A;  3GV7 B;  1H4R A;  4WIP A;  3RJK A;  2WF7 A;  4I2C A;  2KN5 A;  2WDV B;  4EZL A;  2EAP A;  4M8N A;  4AS1 A;  8ICN A;  4M04 A;  1V86 A;  2OOB B;  3MC8 A;  4NLZ A;  1P1A A;  3PSI A;  3D6J A;  1ZQC A;  1TY2 A;  1FO4 A;  1N48 A;  2PIA A;  4AUQ C;  4YSX B;  4WJN A;  1JW9 D;  5TIS U;  3NUH B;  5HFY A;  7ICK A;  4K4I A;  2FIF A;  5C2T B;  3AN1 A;  1XLO A;  4JLC A;  2DF4 B;  2L0F A;  2E1E A;  2J0K A;  1DOY A;  1N56 A;  3E9S A;  4BVU C;  2K8B B;  5HG2 A;  4EOY A;  2QEJ C;  5D2M B;  1EWC A;  3HM6 X;  1N62 A;  2PMV A;  2KDI A;  4F2R A;  4Y2T A;  1ET6 A;  3OSN A;  4Z6E A;  4DSF A;  8ICO A;  2JY6 A;  3KLS X;  4TUS A;  4JUZ A;  2K1F A;  4ED0 A;  1RG6 A;  2Q5W D;  5C1Z A;  4LCD E;  2BYT A;  1UF0 A;  2DNF A;  1A6S A;  5J0T A;  4XWT A;  5LLI A;  1PFD A;  1CUK A;  4MM3 B;  3RNC C;  4YR3 A;  4O3N A;  5DB8 A;  2E1F A;  4Q43 A;  4M2Y A;  8ICC A;  4F5R A;  2JT4 B;  2WDR B;  4ELV A;  2N9E B;  1ZQI A;  5B66 U;  5HHI A;  4CE6 A;  1ACC A;  3H8W A;  2A1A A;  3J81 j;  2G06 A;  4BKT A;  1WXV A;  3V6J A;  5L1L A;  4QZ9 A;  2Y0S F;  4A20 A;  4F5P A;  2BPC A;  3BS5 B;  8ICI A;  4F5Q A;  1WSP A;  1YOV B;  4FAD A;  1D8Y A;  1JCK B;  2MRL A;  2HCF A;  1TZ1 A;  4KZC A;  4YTM B;  2ZEQ A;  2IYD B;  3R9K A;  2YQE A;  3L08 A;  2NYV A;  3DBR B;  3ZTC A;  5KHQ A;  2AEH A;  2NBW B;  1S0N A;  3B2F A;  3DBL I;  2JXJ A;  2MP2 A;  4EEN A;  3EZ5 A;  4IRD A;  4R3D A;  3T3N A;  3PZP A;  3GIL A;  2IY1 B;  4MF2 A;  3VRA B;  4QWC A;  2AX5 A;  4J03 A;  3GIJ A;  2UVV A;  4ZRJ A;  2JPH A;  2MBH A;  5KFY A;  3AU5 A;  4E74 A;  4KSL C;  2KNB A;  3SEB A;  4MJS A;  4UAV A;  2NTT A;  2ZIU B;  1IBX B;  3BK2 A;  3DPD A;  4B9L A;  4G50 A;  2ZIV A;  1SXT A;  4IC9 A;  3EFC A;  3PVX A;  1ZD2 P;  1P7D A;  3DHH C;  4IR1 A;  1NOM A;  2TSS A;  5AKG A;  4ECQ A;  2R8K A;  4LJO B;  2FMP A;  5DPW A;  2GWS A;  1ZQU A;  1QSS A;  2AJQ A;  2KAC A;  1D4B A;  4KDL B;  2VA2 A;  2LEK A;  5CWR A;  3BJY A;  1SIJ A;  1SWW A;  2D8C A;  4LK0 M;  1HTO A;  3DBH I;  1QT9 A;  1GO3 F;  2CR5 A;  3TAP A;  1C9F A;  5CA7 A;  3RFZ B;  4OJ6 A;  1BML C;  1RFK A;  1ROE A;  1RWS A;  1K53 A;  3RB0 A;  1FNU A;  3L10 B;  4FXC A;  3C2M A;  2JGA A;  2C2D A;  4JV2 A;  2O6V A;  5CTR C;  2KDM A;  1TS4 A;  3PPA A;  2W9M A;  1PGB A;  4YR0 A;  8ICH A;  3LDZ E;  4F72 A;  5IAA C;  5C5J A;  1J19 A;  4K3C A;  4UAR A;  5G5H A;  3I57 A;  2KZZ A;  3OHB A;  2HW3 A;  2Z59 B;  1TK0 A;  1DYQ A;  5C3J B;  2XK5 A;  4GGQ A;  2E8P A;  2W3R A;  3ZDE A;  2OHF A;  2E8O A;  1BPD A;  5H2F U;  5J0Y A;  1TZO A;  2Y5C A;  1TK8 A;  1LFD A;  5KL1 B;  2G4S A;  2VZK D;  2ISO A;  2WXL A;  2KFZ A;  4BBN F;  4MAC A;  3NS1 A;  1S0M A;  3Q8E A;  4WWM A;  2WF8 A;  4GXJ A;  1K8R B;  4MGY E;  4KLU A;  2Z0D B;  2WU5 B;  3T5J A;  4R8U A;  4RNO A;  4NM1 A;  2J7Q B;  3SZ2 A;  9ICV A;  1Z4O A;  1T3Q A;  3N9Y C;  2K4P A;  5DBB A;  1SE9 A;  2RR9 A;  4Y2X A;  1WF9 A;  5E6N A;  1Z2M A;  2SEB D;  3Q8P B;  1KSP A;  2W82 A;  2WGS A;  3CIR B;  3RN9 C;  3GB1 A;  2KC2 A;  3QU9 A;  3JPN A;  4KLL A;  3PV1 A;  2IGH A;  3EWA A;  2I1J A;  1IV8 A;  3CRX A;  5AKE A;  1TJE A;  9ICT A;  4GOC A;  2EZY A;  4FHK A;  2DZM A;  4RCO A;  1JMS A;  1J7A A;  3D2S A;  2A5U A;  2AGQ A;  2F3N A;  4C8O A;  2IJ0 A;  4DFM A;  1ZQD A;  4JGH B;  5IN7 A;  2MRP A;  4KLD A;  1ARO P;  2RP5 A;  4GXB A;  3IDW A;  5AZH A;  2NPT A;  3KHR A;  2D3C A;  2KJ5 A;  5D49 A;  1YJ1 A;  3MTN B;  5AI0 A;  3QQ8 B;  4KLJ A;  1FNV A;  5AZG A;  3DVN V;  2FLL A;  1R7S A;  3L0W B;  3SAF A;  4IOI E;  4A9A A;  4JWS C;  1P7F A;  3ZJT A;  1XEE A;  1NYR A;  4WJP A;  3ZW3 A;  2JSV X;  4I27 A;  3BQ2 A;  3AB5 A;  2BB6 A;  1XXG A;  1B22 A;  3NS8 A;  1ECW A;  4P0Q A;  2G1E A;  5J0U A;  3Q8B A;  3VVW B;  3GFK B;  4EE2 A;  5IA7 A;  4NV0 A;  2WXQ A;  1LQB A;  3AE5 B;  2Y9T A;  1H38 A;  2IHM A;  4FFD A;  1QZE A;  9ICP A;  2YN4 A;  2MWS B;  2VRR B;  2ZW1 A;  2IOF A;  2RPV A;  1N63 A;  1ZDX A;  2N7D A;  2KD1 A;  2RSU A;  4M0W A;  5FK9 C;  4QZE A;  2WB1 F;  2HHQ A;  3ISD A;  1E8W A;  1V9J A;  2EMT A;  2L32 A;  4ZYS A;  2CHZ A;  7ICO A;  1Z00 B;  2KVS A;  1CMX B;  4TMA B;  1F0Z A;  1NI3 A;  2KIW A;  4YFK A;  3PRM B;  3VAW A;  4W9K A;  2KZM A;  4IRK A;  3AEA B;  1S8O A;  1NK9 A;  4KLG A;  3UM9 A;  3AI5 A;  1V85 A;  1QOF A;  1T7P A;  4RU9 A;  3DDH A;  1WJU A;  1YZ6 A;  3MFI A;  4O5C A;  3MGH A;  1Q5W B;  2HE7 A;  3MJ5 A;  3EFU A;  2AWT A;  4CF4 A;  2FNJ B;  1WRD B;  4MT5 A;  2PKE A;  1VDV A;  4NY0 A;  3JSV A;  4HDQ A;  4HVB A;  1UQV A;  4HLE A;  4REZ A;  4NPN A;  2XBB C;  1ZRM A;  3Q6B A;  3PR5 B;  3Q8L A;  2N0S B;  3N4M B;  4QWE A;  4FBJ B;  3HX0 A;  2PE6 B;  1FFU A;  2J0J A;  4PS3 A;  1ZQY A;  4HPP A;  2H3Z A;  2YY6 A;  1NK6 A;  3SDL C;  4KIK A;  2INN E;  5L83 A;  2CKH B;  2DKZ A;  5AK4 A;  2D2Q A;  2XNA C;  1FFV A;  3HWT A;  3PW5 A;  1NDD A;  3ETR A;  3J9C A;  3Q8K A;  4CO7 A;  2WX0 A;  1XQQ A;  4RUC A;  1U9L A;  1WG8 A;  1F44 A;  4D2K A;  4RNN A;  1XO0 A;  2FLP A;  1L7N A;  3WK9 A;  3IAM 1;  3QX7 A;  2MW5 A;  4DF4 A;  1ZQT A;  2ESE A;  1LM8 B;  3AU6 A;  4IQV A;  4GDK A;  4C4V A;  3I3T B;  4Y2S A;  3UPQ A;  2W7P A;  1LO5 D;  3DEE A;  1UGM A;  4W9D A;  3RYT A;  3EPI A;  1FRR A;  5IOI A;  1SWV A;  2C22 A;  5BMI A;  4DS4 A;  3KW5 B;  3Q8F A;  4GSW A;  1H8C A;  3VH3 B;  3RH5 A;  4QZG A;  2L8J A;  3AH7 A;  2ON8 A;  3OPX A;  3C0R B;  4C7Z A;  2Z8L A;  1MVK A;  3L3F X;  4UAS A;  3TEZ A;  4DS5 A;  1KFD A;  1WGH A;  7ICP A;  3H7P A;  2KFK A;  3PW0 A;  4WAF A;  3TUO A;  3GE3 C;  3RNB C;  5KT7 A;  3PST A;  4FS2 A;  3ZKJ C;  1BGX T;  4YXM A;  1UT5 A;  4O3M A;  1MFW A;  3GU3 A;  5FR6 A;  4IQU A;  2EDU A;  1JRU A;  3EGR A;  3LVW A;  2K25 A;  2N9P C;  5D3I B;  2KK8 A;  2ICI A;  2NRX A;  1HE8 A;  3RCZ A;  4S17 A;  4P2H A;  4KN7 A;  1ED1 A;  2I6X A;  2IOF K;  9ICL A;  1WMH A;  2HD5 B;  2HOI A;  5KFF A;  2BDP A;  1U4B A;  1HJP A;  3H8H A;  5MPO A;  1T8E A;  5IIL A;  8ICS A;  4IC7 B;  4ARC A;  1A5R A;  4KX5 A;  2BQ3 A;  1FXI A;  5AK5 A;  4F8C B;  3VTW A; 
#chains in the Genus database with same CATH homology
 2M56 B;  1HA5 A;  3LYY A;  1AYF A;  1Q10 A;  3B2G A;  1XO3 A;  1C76 A;  2RDG A;  2BS4 B;  4KX6 B;  3IXS A;  1VZ7 A;  1I4H A;  3AEB B;  4OHJ A;  4YSY B;  1SB3 C;  1WXQ A;  2I38 A;  4TQ0 A;  2PVO D;  2WLB A;  1GB1 A;  4NZL B;  2DYM A;  2V3P A;  5EE9 A;  1V1O A;  2W54 A;  4US8 A;  1V97 A;  1I4Q A;  2WXR A;  1TKY A;  1OQR A;  4WUR A;  3PZ7 A;  1HZ5 A;  5AUI A;  4H2A A;  5HI1 A;  1NYQ A;  3VR8 B;  1JWU D;  2SAK A;  1VR9 A;  1PGA A;  1UNS A;  1K50 A;  5BMH A;  2WXJ A;  1L4Z B;  2YEP F;  3UI3 A;  2J42 A;  3NVZ A;  3LB8 C;  1ZP0 B;  1MI0 A;  2IGD A;  4KGS A;  3BK1 A;  1VRA B;  1OQQ A;  1KH0 A;  4J3O D;  1XF5 L;  1SE3 A;  1SSN A;  1NEN B;  3FIL B;  2GRI A;  1M4V A;  2IDY A;  1SJH D;  1FM0 D;  3W2D A;  4RH6 A;  3W1S A;  2WQY B;  2FUG 1;  2BBC A;  2WU2 B;  1WWT A;  2WP9 B;  4OZA A;  4C80 A;  4PT5 A;  1FCC C;  1QOA A;  1C4A A;  4LLG M;  1C78 A;  1ZOY B;  2AQ3 B;  2L52 A;  1SE2 A;  1JRO A;  4A90 A;  1TS5 A;  1B1Z A;  1HEZ E;  3ABV B;  4L23 A;  1WYG A;  3U52 E;  1E7P B;  2D5G A;  4XWW A;  1XLP A;  3AEF B;  4B0M A;  1RM6 C;  1TS3 A;  1NEK B;  2AQ1 B;  3T3O A;  4ZRP A;  1QOG A;  2L1A A;  4RGN A;  1QOB A;  2LHE A;  4TQ1 A;  1A70 A;  2LJI A;  3IT4 B;  5JXV A;  1T6B X;  3PZ8 A;  4KGR A;  2WXN A;  3KWV A;  1AW7 A;  4A55 A;  3KWL A;  3BVG A;  2BS2 B;  5H8Y E;  2WXF A;  2KMM A;  1TY0 A;  3ZJU A;  1WGK A;  3EA6 A;  2DLB A;  3ZYY X;  1YJJ A;  1K51 A;  3KQ4 A;  1MHH E;  3HUI A;  4P6V F;  3EUB 2;  1SE4 A;  2GI9 A;  3AE4 B;  3AEG B;  5EE0 A;  3MC0 B;  1EU3 A;  1E6E B;  1RYJ A;  3R8B A;  2PW9 A;  3AMZ A;  2V0G A;  2BW2 A;  1GPX A;  3AV8 A;  1ET9 A;  3OWE B;  1YMH E;  4Q2J A;  3TEX A;  3VR9 B;  3V3X A;  2WXO A;  3BWU D;  2HTM E;  3SFD B;  3SR6 A;  2I2Y A;  1DGJ A;  3NVY A;  3ZGZ A;  3AED B;  2FE8 A;  3P4Q B;  2WXK A;  2WXP A;  1QKZ A;  4A8X C;  2W3S A;  4WIP A;  2WXG A;  2JU6 X;  1T5X D;  2WDV B;  2CJO A;  3P4P B;  5BYR A;  4AS1 A;  3AE9 B;  1TY2 A;  2PIA A;  2J52 A;  4YSX B;  1FO4 A;  1JW9 D;  2QJL A;  1FD6 A;  4JPS A;  3NUH B;  4HEA 1;  5C2T B;  5HFY A;  1F77 A;  3AN1 A;  1XLO A;  1CJE A;  3MP9 A;  5D7G A;  1DOY A;  3E9S A;  4N59 A;  2GB1 A;  5HG2 A;  2QEJ C;  1EWC A;  1N62 A;  1FMA D;  1KLU D;  2PMV A;  4XDD A;  4YTP B;  1VLB A;  1ET6 A;  3KLS X;  3AEC B;  2EKI A;  1QIL A;  2Q5W D;  1D6E C;  4ZHO A;  2BYT A;  4XWT A;  1PFD A;  1JML A;  4MM3 B;  2HDE A;  4GDL B;  2QIL A;  3BVM A;  2E3T A;  3MHZ A;  1GB4 A;  4N6E B;  2WDR B;  2H89 B;  4TSS A;  4OZC A;  3TEY A;  2DBY A;  1JRP A;  2K9X A;  1ACC A;  4YTN B;  3ZQ4 A;  1FEH A;  2N9L A;  4P16 A;  4MH8 A;  3P42 A;  2N9K A;  5GXG B;  1C4C A;  1V1P B;  1SJE D;  1I4X A;  1UUP A;  2ACZ B;  1WSP A;  3IT6 B;  3WCQ A;  1EU4 A;  1JCK B;  1ZUD 2;  4YTM B;  1KF6 B;  1K52 A;  1MPE A;  5I4D A;  4NAM A;  3MFG A;  3AE7 B;  4RFB A;  3B2F A;  1IGD A;  4OVZ A;  4RNA A;  4R3D A;  1CK1 A;  3T3N A;  3VRA B;  2AX5 A;  2J53 A;  2CU3 A;  2MH7 A;  4US9 A;  1L4D B;  5FR3 A;  4ITK A;  2FBW B;  4GDK B;  1SEB D;  1JAL A;  3SEB A;  1YNT E;  2BTE A;  1PDX A;  2NTT A;  1IBX B;  3BK2 A;  1V8C A;  1XLN A;  1SXT A;  4A6Q A;  1TS2 A;  1I4R A;  2RMM A;  2J4X A;  3HVD A;  4N58 A;  4OZB A;  5H92 C;  2JYE A;  4WQM A;  3NRZ A;  1VZ8 A;  2TSS A;  3BZD B;  2BT6 A;  2KAC A;  4C56 C;  1OFF A;  3PO0 A;  2ZW0 A;  2LEK A;  1D4B A;  1I7H A;  1SIJ A;  3TSS A;  1ZXH A;  4LK0 M;  1QT9 A;  3B9J A;  2B76 B;  1C9F A;  1ENF A;  2LFI A;  3RFZ B;  1RFK A;  1BML C;  1KFY B;  1ROE A;  1RWS A;  1K53 A;  1AN8 A;  5D3D A;  3URY A;  1UGJ A;  1FNU A;  4FXC A;  2QMT A;  2EEL A;  1FNW A;  2LGI A;  2KDM A;  1TS4 A;  2LUM A;  2X38 A;  4DXG A;  4USA A;  1JQ4 A;  2IPK D;  1PGB A;  2Y3A A;  4ARI A;  5G5G A;  3AE2 B;  3FIL A;  1IUE A;  2CJN A;  3P1M A;  3P63 A;  3I9V 1;  4IKG A;  2NTS A;  2ONQ A;  5G5H A;  2JQR B;  3I57 A;  2BS3 B;  3E56 A;  1DYQ A;  4RF0 A;  3W9C B;  5C3J B;  2W3R A;  1KTK A;  1FIQ A;  2OHF A;  1TZO A;  2Y5C A;  1TKG A;  2NMQ A;  1C77 A;  2VZK D;  2WXL A;  1F2R I;  3AE3 B;  4MAC A;  3NS1 A;  3Q8A A;  2LMC A;  3Q8E A;  4WWM A;  5E6J A;  2IGG A;  1D5M C;  1GAQ B;  2WU5 B;  1WRI A;  3R2I A;  1SBB B;  3ZJV A;  1J7C A;  5EE3 A;  1VJK A;  3R2T A;  3N9Y C;  1T3Q A;  3RPF C;  2K5P A;  1FXA A;  4OW0 A;  1I4G A;  3TEW A;  3BYT B;  2DWQ A;  2SEB D;  2W82 A;  3CIR B;  3GB1 A;  2R61 A;  1KRH A;  2KAJ A;  1EM7 A;  2JWU A;  2IGH A;  2MJD A;  2WNM A;  4HJG E;  1Y56 A;  3BYY B;  4YWG G;  1PUT A;  4HRS A;  5BMG A;  1TJE A;  1YN4 A;  1E10 A;  1TYG B;  3O13 A;  4RGO S;  1HQR D;  1YN3 A;  2V4I B;  4RCO A;  4KKJ A;  1J7A A;  2OED A;  1L0V B;  4HRO A;  4IDI A;  1JWM D;  1N60 A;  2IJ0 A;  2KQ4 X;  2M0A A;  3V05 A;  1XCQ L;  3L4P A;  2WS3 B;  3BII D;  5EE1 A;  1YJI A;  3AEE B;  2K22 A;  3HRD D;  4YT0 B;  2RDH A;  1AWD A;  3Q69 A;  2M19 A;  4LTU A;  4XE0 A;  1P7E A;  1L5P A;  3W5U B;  3BVZ A;  1FNV A;  1L0Y B;  5AUK A;  1STE A;  3VQI A;  2VZK B;  1R7S A;  4IOI E;  4A9A A;  4JWS C;  3HVZ A;  1P7F A;  2KWD A;  3ZJT A;  2N7J A;  4ZHP A;  1XEE A;  1NYR A;  2JSV X;  1VZ6 A;  3AB5 A;  2BB6 A;  1XXG A;  3GS2 A;  2G1E A;  2WXM A;  3Q8B A;  4EE2 A;  2WXQ A;  3NVW A;  1ZPS A;  3AE5 B;  3FC4 A;  3U7Z A;  1IGC A;  5LNK 1;  1XLQ A;  3Q8C A;  1N61 A;  4O1N A;  1ZDV A;  1JWS D;  2ZW1 A;  2RPV A;  4JWU C;  4GLS C;  4ZRQ A;  1N63 A;  4HKQ A;  3AE8 B;  2K0P A;  1ZDX A;  1GOZ A;  3U2S C;  4UDU C;  4WH4 A;  1E0Z A;  4M0W A;  5FK9 C;  1QQR A;  2WXH A;  4HKZ E;  2L32 A;  1JWA D;  4ZYS A;  4TMA B;  1F0Z A;  1NI3 A;  3LXF A;  3CWI A;  2JXT A;  3AEA B;  2K3U A;  1QOF A;  1C79 A;  1EWY C;  3GP7 A;  1CQV A;  5BYS A;  4AQ7 A;  5HHD G;  3MJ5 A;  4DXF A;  1D5X C;  1BUI C;  2V3N A;  4MT5 A;  5BYQ A;  2MJE A;  5T8I A;  1VDV A;  3AM9 A;  1JWB D;  1V1P A;  2Y5P A;  1CZP A;  2QIE B;  4REZ A;  1N5X A;  2W55 A;  1N5W A;  2N0S B;  1ZE3 D;  1FFU A;  2AQ2 B;  1KLG D;  3C8Y A;  1FCL A;  1E9M A;  2INN E;  3VRB B;  4NJC A;  4C7Y A;  3NVV A;  2XNA C;  1FFV A;  5FKA C;  1ZXI A;  1PYW D;  3ETR A;  3J9C A;  4ZOH C;  4JE3 B;  4L2Y A;  2MEK A;  2XN9 C;  4D2K A;  3SFE B;  2BB5 A;  3IAM 1;  1PGX A;  3NZ3 A;  2PKO A;  2DYO A;  2PVG C;  2JYT A;  1IBX A;  2WXI A;  1MHX A;  3DWM A;  2JX5 A;  1YN5 A;  3P4S B;  1LO5 D;  1I4P A;  1FRR A;  1L6V A;  5BMI A;  4KGT A;  3Q8F A;  1L6U A;  1DOI A;  1XCT L;  1BXT A;  1J7B A;  1QLB B;  2LHD A;  1C4P A;  1HZ6 A;  2PLP A;  3AH7 A;  2ON8 A;  1SF0 A;  3IAS 1;  4YSZ B;  4C7Z A;  2Z8L A;  2KN4 A;  1MVK A;  2INP E;  1UWX A;  2YEP B;  1UWM A;  4CQN A;  2PTL A;  3TEZ A;  4YXD B;  1D5Z C;  2G9H D;  4KKI A;  4WAF A;  3TUO A;  3AE1 B;  4XDC A;  2L83 A;  3FAH A;  1F2R C;  4L1B A;  3EGR A;  3W5V B;  4RGM A;  1TKE A;  4NAW B;  5TSS A;  5D3I B;  2ICI A;  2JZP A;  1L0X B;  1DOX A;  1ESF A;  4RF1 A;  3AE6 B;  1YQ4 B;  2QSD A;  2WDQ B;  3DWG C;  3H8H A;  3U4E G;  2E6X A;  1NVI D;  5MPO A;  4B0E A;  2MJ3 A;  1YQ3 B;  4ARC A;  2H88 B;  1HXY D;  4DQO C;  3P4R B;  1B9R A;  4RGT A;  1QF6 A;  1FXI A;  1FRD A;  4JX1 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...