1N60A

Crystal structure of the cu,mo-co dehydrogenase (codh); cyanide-inactivated form
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
161
structure length
161
Chain Sequence
KAHIELTINGHPVEALVEPRTLLIHFIREQQNLTGAHIGCDTSHCGACTVDLDGMSVKSCTMFAVQANGASITTIEGMAAPDGTLSALQEGFRMMHGLQCGYCTPGMIMRSHRLLQENPSPTEAEIRFGIGGNLCRCTGYQNIVKAIQYAAAKINGVPFEE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Catalysis at a dinuclear [CuSMo(=O)OH] cluster in a CO dehydrogenase resolved at 1.1-A resolution
pubmed doi rcsb
molecule tags Oxidoreductase
molecule keywords Carbon monoxide dehydrogenase small chain
total genus 49
structure length 161
sequence length 161
chains with identical sequence D
ec nomenclature ec 1.2.5.3: Aerobic carbon monoxide dehydrogenase.
pdb deposition date 2002-11-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00111 Fer2 2Fe-2S iron-sulfur cluster binding domain
A PF01799 Fer2_2 [2Fe-2S] binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.120 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 [2Fe-2S]-binding domain 1n60A02
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1n60A01
2W3RA 3NS1A 1CJEA 2K5PA 1TKGA 5AUKA 1PDXA 1B9RA 1ZXIA 1DGJA 4YSZB 1IUEA 1XLQA 1N5WA 1AYFA 1A70A 2MH7A 1J7AA 1KF6B 2WDVB 2KMMA 4C7YA 3P63A 4ZHOA 1QLBB 3AECB 2BT6A 2DWQA 1E10A 2N0SB 1N60A 2L83A 3AE7B 1E9MA 2CJOA 1TYGB 4LTUA 1DOXA 2QIEB 3AB5A 1TJEA 4YSYB 4YT0B 5MPOA 2K9XA 5EE3A 3HRDD 1L0VB 1GPXA 1FO4A 1L5PA 3AMZA 1N63A 2W3SA 3PO0A 1QOBA 3VR8B 2QJLA 1R7SA 2PKOA 3AE1B 1RM6C 3NRZA 1OFFA 1NVID 3LB8C 1FFUA 1VLBA 4US9A 1N5XA 1NENB 4YTNB 1XLNA 1FIQA 5AUIA 3P4SB 3WCQA 2W55A 4HROA 1XLOA 3CIRB 4YXDB 1FXAA 1JRPA 4C7ZA 1RYJA 4N6EB 4YTMB 2HTME 1N61A 3NVYA 1JWAD 4P6VF 2G1EA 1SB3C 2CU3A 3VRAB 1EWYC 3P4RB 3ABVB 3NVVA 1WRIA 1J7BA 3LXFA 2EKIA 1JALA 2WQYB 3AE3B 2ACZB 2DBYA 1F0ZA 1N62A 1L6VA 1TKYA 2H89B 1KFYB 1NEKB 2AX5A 3AE6B 3FC4A 3ETRA 3NVZA 1GAQB 1ROEA 3B9JA 2WU5B 5G5GA 2PIAA 1CZPA 4N58A 1L6UA 3W9CB 4FXCA 1VJKA 2MJ3A 2WS3B 5EE0A 4US8A 1E6EB 2B76B 3ZYYX 1QF6A 3AM9A 2OHFA 5C3JB 2WDQB 1J7CA 1NYRA 1YJIA 3CWIA 1YJJA 2Q5WD 2BS2B 4C80A 1QOGA 2CJNA 2WU2B 2MJDA 5C2TB 1T3QA 3DWMA 3AEFB 1JWBD 3AEBB 4A9AA 1XLPA 3RPFC 3AE2B 1V8CA 4N59A 3AE4B 3SR6A 1AWDA 3AEDB 2FBWB 1XO3A 1ZP0B 1ZOYB 1JROA 3AV8A 4JX1C 1FFVA 1FRDA 5H8YE 3AEGB 2W54A 1OQQA 1DOIA 1DOYA 3AE5B 1VDVA 1E7PB 1FXIA 4JWUC 1JQ4A 1E0ZA 3FAHA 1NI3A 4YSXB 1FRRA 2PVGC 2PVOD 2Y5CA 4HRSA 2E3TA 3BIID 1KRHA 1ZUD2 2H88B 3AH7A 1YQ3B 5EE1A 2L52A 2BS3B 1PUTA 2WP9B 1SF0A 3AN1A 1FM0D 1WWTA 3B2GA 3AE9B 1JW9D 4WWMA 1OQRA 4ZOHC 5G5HA 1YQ4B 5EE9A 5GXGB 2WDRB 3EUB2 3HUIA 3W5VB 4ITKA 4USAA 2JQRB 1QOAA 1WXQA 3AE8B 4WQMA 3VR9B 3AEEB 1QT9A 3P1MA 3P4PB 2KAJA 4KX6B 1WYGA 2MJEA 1FMAD 3SFDB 3W5UB 4ZHPA 2M56B 1NYQA 1RFKA 3VRBB 1SIJA 2BS4B 3AEAB 3B2FA 4JWSC 1RWSA 3HVZA 3KWLA 3P4QB 2K22A 5H92C 4YTPB 3SFEB 1QOFA 4IDIA 3L4PA 3DWGC 1V97A 1TKEA 2LEKA 1WGKA 1I7HA 1PFDA 1UWMA 2WLBA 2M19A 3NVWA 2JX5A
chains in the Genus database with same CATH superfamily
2KQ4X 3IG3A 4XZ4A 1KTKA 1ZDXA 4KX3A 1JMLA 3PZ8A 2HBMA 4J6IA 4ED2A 2M1MA 5KFFA 1F1HA 1S76D 2K8CB 2LBOA 4KIKB 4WH4A 2HJ8A 5KFJA 4W9EA 4EKUA 4QNLA 3AECB 1E10A 3HM3A 2YMPA 1QSLA 2HVHA 3GILA 2CS4A 4RNOA 4DXGA 2MQJA 4UB3A 3PRPB 1X2IA 5J2DA 4ECWA 3Q14C 5G55A 2KE7A 1L5PA 4RZRA 1L7NA 1N63A 3BS5A 2K8BB 1EO6A 1B43A 2ASLA 3DBRB 2W8LA 1NJWA 3RI7C 3SU8X 4FA6A 1HEZE 3L13A 3OG5A 4CHKA 4CF3A 3IDWA 3CRXA 3PSIA 1LV5A 4KGTA 2WHIA 1OEYJ 4FBTA 2KLGA 2LGYA 2W04A 1NZBA 1WWVA 2PTLA 5JXVA 2R2QA 1HIWA 2RP5A 1J19A 2IZVB 4AWJA 3CIRB 3BZKA 3GU3A 4DEZA 4Y2TA 4C7ZA 3PMLA 2PFPA 2WXIA 1S5LU 4IC9A 2DAJA 5DB8A 3BINA 2KKPA 2XK5B 4ECUA 2MEKA 1TKDA 2JYTA 1JALA 3NUHB 1WR1A 4BKSD 1DGSA 2DL0A 1LGRA 5DKWA 3DCGA 1BPDA 4HAIA 2KDMA 2WB1F 1ROEA 2MBHA 1BT0A 1Q5WB 5KG4A 2NVUI 3CMMB 3APCA 5IN7A 2WHEA 4F50A 2KTFA 4O9MA 1AQ6A 1VJKA 1C20A 2PPHA 2MJ3A 4I6NB 1K8RB 2VJ4A 2G09A 3G6XA 3KQ4A 3AM9A 2I5HA 1N56A 1V1PA 3VR9B 4C80A 1HA5A 3LJ3A 2E1EA 7ICNA 3C0RB 5BMGA 4KV2A 4A3PA 5AM0A 4MEMA 4A9AA 4BZAA 3ZNZB 3T3OA 2XY7A 2HHXA 2GLSA 2L1AA 9ICVA 3AEDB 2W11A 2EELA 4HLEA 4JX1C 5DBAA 3Q3OC 3MGVA 4E74A 4NJ8A 2W54A 4AQ7A 2YB1A 2C2EA 1DOIA 1E0ZA 3Q2AC 3NJTA 2Y5PA 2QDFA 7ICJA 4Y2SA 3M9OB 3GIMA 2H88B 1ET9A 4OCZA 4M0WA 1KKXA 1GC7A 1AROP 4UASA 2BGFA 3AN1A 2ZCCA 3B2GA 2FUG1 5DG9A 5GXGB 4ITKA 3ZTCA 4BWJA 4G3IA 2V3PA 3GS2A 3KHGA 1R4NI 2KAJA 1CMXB 1YQBA 4DFPA 1IV8A 5KAFU 3AEVA 2GBRA 4OZAA 1FNWA 5ALTA 3OJSA 3F2DA 4J9QA 2KFKA 1HXYD 2E5SA 3QK0A 5KFBA 5D46A 1T94A 4QW8A 3M6KA 3MBYA 4ARCA 1PFDA 4M0AA 3WAPA 5ALRA 2QILA 4DO9A 4GLXA 1STEA 1J7AA 1GB4A 4RFBA 4K4IA 4C00A 3QWZB 3SI8A 2Y1JA 3BVMA 1V49A 2N9EB 2KIVA 3M7DA 1PVRA 3AE7B 2WXQA 2RQ5A 5J2FA 2BPFA 2DNFA 2N7JA 5KFMA 1ZQQA 4F8RA 5TSSA 3RNEC 3IAS1 5KT2A 2XY5A 2C7NB 3ZVVA 5HMLA 1V9JA 1YN4A 4QJFB 5F3XB 3CYMA 4RT3A 5KFAA 2RDJA 1D6EC 1ISNA 3GOEA 2KWUB 2HTHA 1WWUA 2KTQA 1WGHA 3ZO5B 1KN5A 1N2XA 3H8WA 3C19A 2LZ6A 3IXSA 2KFJA 2JEGA 3OPXA 4F4ZA 2OEDA 1LFDA 3GE3C 1XU4A 9ICSA 5L1IA 4KVGB 5AICA 1A0PA 1HUZA 2Y9UA 3ED5A 3MHZA 2KYWA 1IGDA 2LKYA 3QU5A 3AXCA 2KMCA 2IGGA 1XCQL 3NVVA 1WRIA 3L3FX 2IO0B 2IY1B 4XC2A 1AARA 4LJPB 3N4MB 2ZIXA 3VDZA 3AE3B 8ICZA 4FHKA 1F0ZA 4QZCA 1P3QU 1NEKB 4JE3B 3PO4A 4LNFA 2A5UA 2AYOB 4W9CA 1GG3A 4O3QA 4DWIA 1I42A 2V9WA 2AXTU 4YN4A 1SGGA 2MHJA 4DL4A 1J0GA 3DV9A 1OW5A 4I28A 5JHBA 4KKJA 2Y1IA 4F5PA 4RF1A 3PRZA 1J7CA 5KFHA 1T4GA 7ICOA 2E1FA 1YN3A 3SZ2A 2L00B 3BJYA 2J7QB 2FMPA 3NZUA 2BCQA 5BOMA 3DVNV 1GJZA 1BMLC 3T5LA 4II2B 3DDCB 1JROA 1XNSA 5LLIA 2NRWA 4KX5A 4CNQA 1IYFA 4RQ0A 1ZGUB 4H2AA 3WKEA 4RQ5A 3QUBA 3OTQA 1KLGD 9ICAA 3P2BA 4MH8A 3V6JA 1F2RC 4IQTA 1ZQTA 2YVCA 1WM3A 3PR4A 3ZW3A 1ZKHA 1B0XA 5KG6A 2GBMA 5EE9A 4REZA 1JW9D 2DYBA 1XCTL 3ETLA 4XDCA 2E8PA 3KLSX 1JI7A 1IM4A 2AQ0A 3C1ZA 4QZEA 4F8CB 3N97B 1XEEA 1NKEA 3SFDB 1UHUA 5KFXA 3IT6B 3E58A 3EECA 1WGDA 4NPNA 1D8BA 2FIFA 1RWSA 2JU6X 5AI6A 2RDBC 5D49A 4WJ3B 5EWGA 4Y2VA 2K8AA 2J42A 3C1YA 4RGTA 4FJYA 2K6DB 3ZNHB 3NVWA 1X6IA 3T3FA 4JB3A 3C2LA 2LVQA 2YLMA 1D5ZC 4QW9A 1MG4A 4L23A 1NK7A 1PK1B 2F44A 4C8KA 3Q3NC 9ICUA 5CEHA 1E5WA 1YMHE 3TADA 2QLTA 1WE7A 4F71A 1ESFA 4Y2PA 3MFHA 2CHXA 4B9MA 4OJOA 1JX4A 2R8GA 4URKA 5DDMA 4P0PB 1ZETA 1XSNA 2N9PC 3F5AA 4W9LA 1D4BA 3PW0A 1VD2A 3N28A 2XGPA 4YSYB 1XS9D 8ICUA 1UCVA 2F1HA 3H8MA 2BBCA 3AU2A 2FJ6A 1P7FA 2JGAA 1KFDA 5DQGA 4QIWF 2GBKA 3Q69A 4FFDA 5J29A 4DSFA 2OYYA 1GNUA 2JEIA 3BYTB 3BYYB 5AKZA 2MSED 4Y2RA 5FP0A 1SIFA 4JLCA 3SEBA 2LGXA 5KFVA 5CHFA 4ZRKA 1LVHA 2FUHB 3EPGA 2KZZA 4S17A 5JRTA 3MR3A 3NTUA 2XGQA 4F4KA 4N6EB 5D7GA 3PY8A 5G2NA 4IW0A 1X9MA 4RGMA 4PGXA 3PSFA 3ZJUA 5KFYA 3HHMA 3D32A 3L10B 2XIDA 5AKJA 8ICGA 4J03A 4EBEA 1KFYB 3NZ3A 4DHJD 3Q3FA 3NVZA 2WU5B 3PLVA 1TY0A 1WXVA 3H7PB 4N58A 3GP7A 3WK7A 5DG7A 2JZ3B 2AH5A 2PFNA 2V4IB 3W9CB 4XRHA 5EE0A 4HPLB 1SXEA 3DVGY 2NPTA 1S0NA 2UVRA 2D3CA 2KDFB 3PZPA 4R8UB 2F8LA 3B0XA 1P7DA 3LWLA 1F44A 5IOIA 2R8IA 3C23A 2WF9A 2E6XA 2BCRA 2V0GA 3S6JA 3JPTA 4KDLB 2DYOA 1NDDA 5ALZA 4I29A 2AU0A 2LPEA 3IG5A 3CW2C 2ON8A 2K4IA 4ECVA 4Q45A 5AIBA 3C5GA 4YMMA 4RQ4A 3O13A 1SF0A 1ZQZA 1WWTA 3NASA 4BBNF 1RLFA 2LJ5A 1WXQA 2W8KA 2L8JA 4I2GA 2LRUA 4IG7B 2YMLA 2ZXIA 4PH5A 4B9VA 3EHVA 3TL5A 4F5RA 1JXLA 4ANVA 8ICOA 4ZRIA 1SV0C 4QZ8A 4DOCA 7ICTA 3AEAB 3SD5A 3P4QB 3IFWB 3LDAA 3C2KA 4RM9A 3I9V1 3K1RB 7ICGA 3RD2A 4EEWA 3N1XC 2KMAA 4UQGA 3VFKA 1DK2A 5AUKA 1D8YA 3CWIA 2UYZB 2W7OA 1D9DA 2O6VB 3RH5A 1XLQA 3QU4A 1J97A 4R8UA 5KFQA 2WNMA 4ZHOA 4J9LA 4HPMB 5FR6A 4RUCA 1MI0A 3OHAA 5KFKA 4JGHB 2QB0A 4M0WB 2DWQA 2DFLA 5BOLA 1WGRA 4PZNA 5C0YA 2KIWA 1Q0WB 1B4FA 2L76A 1TYGB 1ZDVA 1JIHA 2BB5A 2D5GA 3NG0A 2INDC 4MJSA 2RPVA 1OQYA 3SD7A 4CQNA 3H7PA 1ZQVA 3TADC 1KQQA 4K4GA 2W03A 2CR5A 3PO0A 2KEYA 2VKQA 3UIPB 4PYUA 5D2MB 4LZDA 3KWVA 2MSNA 4DF8A 1OUQA 4K3CA 2K4EA 4PT5A 2LYHA 4QWCA 1RG6A 4AYBF 3R7QA 3ZTDA 2LI6A 2MW5A 1M6YA 5ALKA 1U4AA 1WMHB 2LVOA 3PPAA 4R64A 1ZQFA 2LASA 2D11A 2ZEQA 3VH3B 4RGOS 5KT4A 1L0YB 2G1EA 1ZQHA 2KJRA 1U45A 5AK3A 2JYEA 2X38A 2KZ3A 3M1YA 2KICA 3H8JA 2BYEA 2NYVA 3TFSA 1F77A 2ZCBA 3M9NB 3R3MA 2KNJA 4DDGD 3AULA 1XXGA 2AGQA 2BDUA 4NL9C 3AE6B 3KHRA 2KKVA 4ECSA 4KITB 4IWOA 4OJ5A 2N1WA 4RQ3A 2JWZA 1C9FA 1ZQOA 5ALFA 5KL1B 4WURA 2RD0A 1IG6A 1E6EB 1UELA 2B76B 4PYZA 1QF6A 1L3UA 3AU4A 2XBBC 1YJIA 2WAQF 2JEFA 2K89A 4I2DA 5J2KA 4GFJA 2CKHB 4F5NA 2JXJA 5CTRC 4F4YA 1SWVA 1SGHA 1T6BX 2QHOA 3AE2B 1YZ6A 3EWAA 2G5IB 2FBWB 2KVZA 7ICQA 1T3NA 2WXMA 1WX8A 1OTRB 2D3AA 3QUQA 5KFRA 3FAHA 2DENB 3I3TB 5HR7A 1HZ6A 3PNCA 3Q8RB 1SJHD 2D3GA 3OJ3A 4M8MA 3QX1A 2DZKA 3UINB 3WK6A 2L52A 3UMGA 4IKGA 2XCPA 3SENA 5DB7A 2VJ5A 3QUCA 3H40A 4GXJA 1C1YB 4OJLA 3HUIA 4LNOA 3ZDCA 2I38A 2ZPNA 4DK5A 5DGAA 1UT8A 2Z0DB 4JMUA 4FS2A 4TUUA 2D8CA 3H8SA 2FMQA 4JWSC 4EYHB 3KWLA 5ALPA 4F72A 2KNBA 5H92C 1Y56A 1ZRNA 1VRAB 4TUSA 3HIZA 4L1BA 4O5KA 2ZW0A 1C76A 4OHJA 2PE9A 3IRUA 2FE8A 2I6XA 3KKAC 5DG8A 2KK8A 1NKBA 5KG1A 9ICIA 3A9KA 1DK3A 5AK6A 5KT6A 4QZHA 1QLBB 3B1LX 2MCNB 1JWSD 4UB2A 2H3VA 3LDZE 2CJOA 2HVIA 4IRCA 3MTNB 1QH9A 5HHIA 4PHDA 2FMSA 3IV6A 5L83A 5AI8A 9ICMA 1NOMA 4GB9A 5EE3A 4MGKE 3F53A 2HHUA 3Q8MA 2W43A 2FLLA 2KFZA 4HDOA 5ALLA 4RF0A 5L1JA 1EM7A 4GDKA 1TS4A 4JV0A 3LB8C 4Y2JA 2Y9TA 3E0FA 3KYCD 4YTNB 4JUZA 3ISBA 2FCNA 2YB4A 1Q8KA 5DBCA 3TANA 1IBXB 2HHVA 1R4MB 3ZJVA 4ACOA 5CHWA 5HNKA 3JPOA 4YTMB 3APFA 1RAXA 4Z6DA 2REXA 5IIJA 3UQAA 4A90A 1J2NA 5K4LA 4IQWA 3MJ5A 1VR9A 1Q46A 3S2AA 1KLUD 3QJZA 2M0XA 2DBYA 5D6JB 2H3ZA 1WJ4A 2FNJB 3B9JA 1JUDA 3HVDA 2F8KA 4E0DA 2FDRA 3KHLA 3BY4B 3H7SA 3HK0A 4C8LA 1MVKA 3TEZA 2D6FC 3L16A 2G06A 5KG7A 2GRIA 4L2YA 3KH0A 2B21A 4C0ZA 8ICIA 3DBHI 1L8LA 4B9KA 3M6ZA 5HI1A 4O3NA 4BWMA 4HCNB 3RPFC 5KFSA 2PMZF 4B95A 7ICPA 4DQIA 4MM3A 1FFVA 4EYIB 1WXAA 3QHTA 4MGZE 3AEGB 3PX4A 2IOHA 4CF4A 3OHBA 2LMRA 1FXIA 3MFGA 5JTIA 4PGYA 2V4LA 4NQLB 2JWUA 1RYSA 2BVCA 1I4HA 2LJIA 2DZMA 4M8NA 3QIJA 2X8XX 2FPLA 2L3ZA 1BNOA 1M94A 5AI9A 4EX7A 1QT9A 3P4PB 4ECRA 3RT3B 4AS1A 3QNMA 3TFRA 1HTQA 2KHQA 4RCOA 8ICLA 2KX3A 2ESEA 2EZYA 3AU5A 3DWGC 2P66A 2W9NA 2KOBA 1I7HA 1UWMA 2KMDA 1RPLA 2ISOA 1QILA 1RXVA 1TBEA 2VA2A 3PT2B 4YCXA 2QMTA 1CJEA 4ECZA 2J4XA 4F93B 2Q0ZX 1NJZA 2IGHA 3PW5A 5CR0A 2VIXA 4K1RB 3ZNID 4NQKE 2PW9A 5HG2A 4QWDA 4D2KA 4X5VA 2N9LA 3R7RA 4RQ7A 8ICEA 4OVUA 1N60A 5KFDA 5CWRA 2KQSA 1L7MA 2M8SA 5TISU 4W9KA 1V85A 4C4TA 8ICBA 2KP7A 3CF6E 3RJJA 4PS7A 2FI1A 5ALWA 2FCMA 3A33B 1SXDA 3VR8B 1KW4A 3IM1A 4J9PA 3QEBZ 2R8JA 1KM7A 1ZQRA 3ECIA 4GGQA 3EC8A 4CF5A 2K4PA 4JIOU 2ZTDA 5AM1A 1TK5A 2G3QB 4P2HA 2DYMA 1L7OA 4YWGG 1NNLA 3PLUA 2LUEA 2W55A 1KLVA 4NLKA 4OJ6A 4IQVA 1ZE3D 4WWPA 1F2RI 3CP8A 5E6JA 5L1LA 1N61A 2P35A 2KSOA 3G6VA 2HHQA 3PVLA 4WJQA 2PFOA 9ICGA 1SZHA 4EBCA 1PQSA 4LNIA 3WANA 1R4MI 4QWBA 1VZ7A 4TQ0A 3D6JA 1BXTA 2WXRA 3U2SC 2HDOA 4TURA 4BGDA 3C28A 5CX3A 3TEWA 5G5GA 2JRZA 4KZCA 2WXLA 3MR2A 4R65A 2EZZA 4NNJB 1L4DB 4YD1A 3E9SA 3RAXA 2NRZA 3KOOA 1T3QA 5C23A 1UNSA 1NJXA 5KFLA 2K8CA 2IPKD 1HUOA 4AOFA 4ED8A 3JPSA 3W1SC 3RCZA 2AL3A 2BQUA 2XN9C 4YL8A 2ZTCA 4YSXB 1S8OA 2PVOD 5AM5A 2WF5A 4KLSA 2K0PA 1ZD2P 1KRHA 4KN4A 2ZNVC 2O2VB 3RNAC 1CQVA 5J0WA 4RNNA 3HWTA 3IG8A 1WX9A 3ORYA 4IS7A 7ICVA 2CRXA 1UGMA 2DX5B 2MRPA 2WX1A 5EWEA 1ZQPA 2K3UA 3WKDA 1MPEA 5T8IA 1QOAA 2B3AA 4ECXA 3P1MA 3ZIMA 4PHPA 2MJEA 3SAHA 3F2CA 1V81A 2BWFA 2M56B 1NYQA 2JXTA 4Q8EA 2N1VA 5KFTA 4KLTA 4F7ZA 4F91B 3GV8B 3NZSA 4ELUA 4E3CA 3IP4B 2RRDA 2HD5B 4YTPB 4UAWA 2C60A 4G9BA 3QX7A 3OAWA 1WSPA 3BS7A 8ICXA 3UF8A 2JX5A 2E8OA 1ZQJA 4ICAA 1ENFA 9ICWA 4K3BA 1FCLA 4BAXA 2DGZA 4B9UA 2MH7A 3P63A 4DHZB 1ZD4A 4YR2A 3UXNA 2NS5A 2EMSA 5JHAA 1UPHA 1TZ1A 4QZGA 1E9MA 8ICMA 1NBFC 5IIMA 3RZWC 4GU2A 1HTOA 2IOFA 2ZUDA 2WTFA 7ICSA 1TJEA 4WAAA 4I2JA 4DSKA 5LNK1 2D3BA 3AMZA 4KMUA 3IAM1 3U8ZA 4KLQA 2NO4A 2KG5A 5BYRA 4RU9A 4TQSA 4NJCA 3AE1B 4A6QA 5I4DA 4ED1A 5TZVA 3A4SC 4AP4C 1XWLA 4RNMA 4F2SA 3VAWA 4C8NA 4BXOB 1T0SC 3NHEB 2GLEA 4TV3A 3V3XA 3WAOA 3WCQA 1XLOA 3PV8A 4DCCA 1C3TA 5B66U 1I4GA 1EWCA 1WM2A 2RR9A 9ICPA 2WX0A 3QUTA 2AEHA 3AU6A 3ICXA 1V5TA 5L1MA 1J7BA 5DDYA 1X9WA 1KJTA 1T0QC 1WJUA 3ZXRA 5FR3A 5DPWA 4Z6CA 2BF8B 1HE8A 5J8YC 2BYTA 4KDIC 2IBKA 4PJ0U 2KLCA 4O1NA 3BS5B 2WS3B 3VCBA 3N20C 4BKGA 4F5QA 2WDQB 2XVTA 4M00A 1QQ5A 2WDTB 3PO5A 3A0HU 1WGGA 2H3QA 3AEBB 1K50A 2UVWA 1V8CA 3R9KA 4B6JA 3CNHA 2KN5A 5JH5C 1XO3A 2ONQA 2ZG6A 4RGNA 3W2DA 2HBJA 4Q43A 1FRDA 2BB6A 4O3MA 1OQQA 2B0CA 8ICKA 1XD3B 3U7DA 2GB1A 4NL9A 4M04A 1HZ5A 1SKRA 1FCCC 3MC0B 3VH4B 4B9NA 2OOBB 1Q3VA 5AKYA 1E90A 1I4QA 4M6WA 2NRVA 4Z6EA 2EAPA 4ED3A 2ZJAA 4DQQA 1TS5A 1S0VA 3KD3A 1Z2MA 2KJ6A 4WIPA 3SV4A 2ASDA 4LJOB 5G5HA 5HMMA 3N1ZC 4RQ8A 3EUB2 2QCZA 4MF8A 3UQ0A 2N4FA 3X23A 1BNPA 3AEEB 5E6PA 3U30A 3DOWA 3L17A 4GDLA 1KFSA 3SAFA 3WKCA 4RUAA 5J2IA 2KJ5A 3VRBB 1EU3A 3LVVA 5BO4B 4TKNA 3KFUF 2D2QA 1JN3A 4DSLA 5AK5A 5HHHA 2WLBA 2PLPA 2MP2A 3V6KA 2QARA 3LYSA 4MEXA 4OVZA 2EKEC 1OXJA 2Z7JA 1D5XC 1A70A 3TARA 2WDVB 2YQEA 2KKCA 3DBLB 5EWFA 2L0TA 2BCSA 4RPZA 2WXPA 3RFAA 2WXFA 2N0SB 4KLHA 3ZDBA 3KBBA 3Q3MC 3PV1A 5B5EU 2VANA 4DOAA 3RB0A 3SAGA 5MPOA 3GFKB 2Y0SC 1L0VB 3LWMA 2Y3AA 2IY0B 1WCNA 5IINA 1PVQA 2ZJDA 4NLCA 4JK1A 3JVZX 4UARA 3SMVA 5KFCA 1R7SA 2K8BA 3H6NA 4KSLC 3NY5A 2K8HA 1FFUA 1AW7A 3DQVA 3UGBB 5FKAC 2HI0A 5KFUA 5AI5A 5IAAC 4Y2UA 2XCAA 4DLGA 4BOZB 1L3VA 2PFQA 4A20A 1BGXT 1MFWA 3CSTA 3J9CA 5TR5A 2CPRA 4N9F4 5J0OA 1RFAA 2DZIA 2F1JA 2G45B 1TK0A 3FM9A 4G11A 2RDIA 2KDEB 2A19A 4HJGE 3FC4A 5J2JA 2A1JB 1YZ7A 2GWSA 3UXPA 4DFMA 1BPBA 2K60A 2KTRA 4R63A 2JH7A 4FLHA 1TE2A 3PHWB 4XWTA 2MBBB 2VH2A 5AEKB 1Z1VA 3CSFA 1I4XA 1NKCA 4BFRA 4FHJA 1YJJA 1YX6B 2MJDA 1KH0A 2AJQA 4R3DA 2PMVA 1L3TA 4IOIE 1O03A 3RAQA 1WIAA 3AV8A 4OZBA 1VJ5A 4UBCA 3KZXA 3DBSA 4FULA 1ACCA 2WWZA 1S3SG 4BX9C 3O0FA 2XY6A 4DL7A 8ICWA 1H4RA 4TQ1A 2EAMA 2IO1B 3KZIU 2C2RA 2G0AA 2Y5CA 4G3XB 2B6GA 1L6NA 4TMAB 4P4OA 3A1QB 4BDPA 4M9NA 4MHVA 3BQ2A 5ALOA 1TAUA 2VZKD 4LVSA 5KT7A 1Q10A 2DPIA 5HKHA 4GDKB 2KVSA 3HKZF 1B1ZA 2LWPA 2MBEA 4II3B 3QXGA 2W9CB 2QEJC 2WXNA 3PZ7A 2D07B 4F5OA 3WKBA 3WAMA 3HW8A 4CE6A 4ZYSA 3RMKC 2CHZA 4CDGA 4QZAA 1BPXA 4FJVB 4IDIA 4GN1A 4WJOA 1OEYA 4MGYE 1WE6A 4YMNA 4DFJA 1PK1A 4M01A 1LKYA 4ZDVA 2EDUA 2A1AA 4NLZA 4ICVA 3H8HA 1P7EA 3Q8BA 3JPQA 3F2BA 1AYFA 5J2GA 1GC6A 2OEHA 2INPE 3EFCA 2BKEA 4LDTD 3ZGZA 1WZ3A 5ALMA 3BK2A 1S0MA 3RJHA 1NK4A 1FNVA 3M63B 1MC8A 8ICAA 1V6EA 2KN4A 3OGUA 4IWPA 2WXJA 2NBUA 3N30A 3RYTA 1UUPA 1UD7A 1FO4A 1ZXHA 5J2RA 2W3SA 4C4RA 1LB2B 4AYBC 1ZPSA 4PL1A 3PS6A 3PX6A 2QKQA 3RRHA 3PW7A 3OJUA 5D3IB 2HHTA 4UB1A 9ICXA 3I28A 3BQ0A 5HFYA 5L1KA 1WXMA 1SV0A 9ICEA 3RNBC 3V6EB 4B0EA 2ZW1A 1S0OA 2JY6A 2Z59B 2ZXHA 5BPCA 3AQEA 4ED0A 4J9NA 1VZ8A 2FCSA 1EF5A 2GBNA 3UMBA 2NRXA 3EYZA 2VH1A 3DBHB 3V6CB 4ELVA 4ARIA 4GC7A 1Z00A 1SE9A 4NAWB 2BTEA 2ICIA 4GXBA 1TKYA 4MGIE 5ALNA 2AX5A 2KXJA 4MDKE 1MA7A 3MC9A 4HEA1 3ZDMC 4O0IA 1GAQB 3R66C 3ALRA 1LM8B 3N32A 2YTUA 4PK1A 2OWOA 2C28A 5F9NA 3D2NA 2NBVB 3U26A 3EW9A 1ZRMA 4UW9A 1ZOLA 3W1SA 2GOLA 4NLBA 3AQFA 4K4HA 2WXGA 3TEYA 5KFZA 4ECYA 5C2TB 2RLTA 4NLNA 3DWMA 3ML8A 3TACB 1XSPA 3T79A 2QSDA 2BHNA 3SR6A 4KLMA 4UAYA 5ALQA 2G5HB 4LZGA 2KZMA 3DBRI 4AJYB 1EF1A 1COKA 1VDVA 2O6KA 1E7PB 3RTVA 9ICTA 4KZ0A 1QQ6A 2GOWA 2LM1A 2D3DA 2VZKB 1FRRA 4C8OA 2CU1A 3G6YA 3KUDB 4I2HA 2Y0SF 4HKZE 4NZLB 2JV3A 2LVPA 3V05A 2HOFA 4GIVA 1GUAB 5IA7A 2EMTA 1NK0A 1CK1A 3MR5A 3UMCA 2A3VA 3RNCC 4GSWA 2F2AB 4IUMB 1PGBA 3N7SC 2NRTA 2ZIXB 4WQMA 4J3OD 4KX6B 5IIOA 3MC1A 1KTQA 1RFKA 2UU7A 3TBLD 3HM6X 2LGDA 2TSSA 2ZIVB 1D5MC 3SFEB 4P4MA 4YP3A 2JZBB 3PVXA 2G08A 2KV2A 4YXMA 4DQPA 4M9HA 1F9JA 2M19A 2QB0B 1KBUA 3C5FA 4KLJA 1X66A 4TUPA 1Z19A 2KWVB 2LHDA 3KHHA 4F2RA 5IO9A 2DQNB 2LXAA 2KQ7A 2HDEA 3JPPA 3RR8A 2WFAA 3VTVA 1ZQ1C 1ZQLA 3RNFC 4NJ6A 2GBJA 3GIIA 1WFYA 1WG8A 2XI9A 4DXAB 1SWWA 2GO7A 4MFAA 4XE0A 5E79U 4BVUC 2RSUA 2K6QA 3PHXB 1FPYA 2L0FA 3KTQA 7ICUA 3O65B 1GPXA 3M3JA 4DS5A 3MGIA 2ASQA 2L05A 3Q6BA 1N48A 1T0RC 4MACA 3AI5A 1TFRA 4BJQA 2PKOA 8ICYA 1N6ZA 3MC8A 4WJPA 5CRXA 3KUZA 1R4NB 1RQNA 5KT5A 1Z4OA 2JXXA 1RYRA 2HOQA 3A9JB 5KG5A 2FLNA 4FN2A 4RPXA 4DLEA 2RPQA 5AM4A 3RJIA 4ZH4A 5KTQA 3APDA 4LCDE 2HTME 4JPSA 1FD6A 3K9PB 3JPNA 1SB3C 5DB6A 3JPRA 2KD1A 4DL5A 4BXOA 1K1QA 4DDID 2EKIA 3URYA 5J2HA 1FXTB 3MGHA 3VVWB 1BVSA 5J17A 3RRGA 3RJGA 8ICCA 3JSVA 3RBEA 1QQRA 1L6UA 1X1MA 4Y2XA 5IIKA 3H9DA 1WYWB 3H4DA 4US8A 5ALGA 2PEAA 3QE9Y 2FIDA 4HXDA 3VUXA 4ZRJA 4JWNA 3BZCA 1U4BA 3KVFB 2AQ4A 4NY8A 3AEFB 3FKYA 4GLSC 5AKHA 3V72A 4I6LB 1Z00B 4N59A 1JXEA 1AWDA 2YY6A 1HJPA 5ALSA 1J8CA 1UA0A 5FK9C 7ICRA 8ICTA 1C7YA 4ACFA 4O3PA 3T9LA 4EZLA 2R61A 3M95A 1MHXA 4TUQA 4C56C 4CYEA 4CRXA 1KFTA 1NI3A 1EUVB 3I5JC 1P98A 1S97A 3BIID 2G4SA 4NXZA 2BQRA 1YD8U 2LUMA 1PUTA 4MJSB 3BWUD 1FM0D 3ONSA 2E8NA 1BPZA 1OQRA 4LK0M 2HSZA 4IM3A 3W5VB 3ZUNA 2W9BB 3N9YC 4K7SA 1WRDB 1V9PA 2YX8A 2DKZA 4NAWA 2KJ9A 2G07A 1KLNA 2F76X 3TMPB 2D10A 4TSSA 2BGWA 5AKIA 3QYPA 2G4DB 5KFGA 2M4NA 3HP6A 2BS4B 1E7UA 4FJZA 2IYDB 1PVPA 1E8ZA 2HW3A 1C4PA 1S77D 4P0QA 4KIKA 4M9LA 1WGKA 2QJLA 3VUYA 1QTMA 3FILB 4HCPB 2K5PA 1PDXA 1ZXIA 4DL6A 3E2EA 1IUEA 1IIPA 4OW0A 3BDPA 4ASWC 1ED1A 1FNUA 2DPJA 1XO0A 3LVWA 3RZFA 4DHZE 4Q44A 4M02A 4J9KA 5HHDG 3T5KA 4HKQA 3PRMB 2ATLA 2V9HA 3ZJTA 3B08A 3GB1A 4LTUA 1TS2A 3ZDDA 3PREA 3IHPC 4A3OA 5C5JA 4FBUA 3HRDD 2JVCA 4KSKC 1TIFA 3T3NA 1IXRA 4ANUA 1U49A 2G9HD 2GI9A 4KGRA 5J2EA 4RH6A 2XNAC 1E8XA 2P6UA 2I9GA 1ZQUA 5J0SA 1Z5SB 2W9MA 1MG8A 2NV3A 1H38A 4XGAB 4QIWC 3PMNA 1NENB 9ICQA 4GIBA 2EH9A 2KDBA 3IHQB 4UATA 1V86A 1L3SA 1RYJA 1JRPA 2RDGA 4FE3A 3MP9A 2IOFK 3GV7B 1E8YA 1Y8RC 4CGZA 2MBQA 3U4EG 2CU3A 4KLFA 1ZQEA 4G50A 2ZPYA 3ABVB 2QC8A 3P4RB 3LXFA 4OD0A 4KN7A 1ZYQA 4ANWA 1X9SA 4U7CA 2JH1A 3QA8A 1L5UA 2H89B 3D2SA 4JQWC 4IM2A 1SBBB 3JW0X 1K52A 4FXCA 2NTSA 4P1CC 1WR6E 3Q8CA 1NK6A 1C4CA 1U48A 2JHDA 2R8KA 4KLIA 3NS8A 4YQWA 2H3FA 5CHGA 2WU2B 4I6PA 2OM6A 3A9KB 4Y2YA 4J9RA 4XUSA 3SEIA 1D8LA 3ENEA 2INNE 3V7LA 3RULA 2ZZPB 2WXKA 3V7JA 3K9OB 2ALZA 3EA6A 1ZD3A 3WALA 5AM2A 3TKAA 1TGZB 2MU2A 2KVRA 4B9LA 5DLFA 5BMHA 1E8WA 4JV2A 1UA1A 1PUZA 1ZUD2 3VUWA 3ZQ4A 2BS3B 4W9GA 5AKEA 4DBGA 4OZCA 4PS8A 4FZMA 3EGRA 4PS3A 2AHOB 3K1ZA 3HJEA 1LQBA 3OJ4B 3Q8SB 3MABA 9ICJA 2KT7A 3RB3A 1FMAD 3K75D 1MHHE 4DOBA 2LM4A 5L95C 3L5KA 2K1FA 2FPKA 4MFFA 2ZIVA 4Q8FA 4FBJB 2JEJA 4AP9A 3RJKA 2R18A 2MBOA 3ZDTA 1QOFA 2PXIA 2PJHA 1X40A 2KWDA 3UQ2A 2JPHA 2HBLA 1PZNA 3NS1A 3UM9A 3L08A 1B9RA 3HX0A 3GV5B 3N1YC 1ZW7A 4IC7B 4QZBA 1N5WA 3QU7A 2MX2A 5AK4A 5CJ7A 3OSPA 1P1AA 5D3DA 2OCEA 4UB4A 3Q3JA 1DRGA 1LKYB 2BT6A 3L54A 3UI3A 1WJ6A 1KEJA 1ZQNA 3B0AA 4AUQC 2ZJ5A 2BDPA 2QIEB 2KC1A 3ZDAA 4YT0B 1LO5D 2J0MA 3K4GA 1MJDA 4B0MA 3FYHA 5KNIA 4J9OA 3RR7A 1HQRD 1Q1OA 1QOBA 2LGIA 4F4XA 4BOSC 3NRWA 4HDQA 4NWIA 3V6HA 2JZPA 4PZOA 2KOXA 2FPMA 4DXFA 1OFFA 5AIAA 5JU5A 3R2IA 1SXTA 1WMHA 1CUKA 1XLNA 4XX5A 1FIQA 2IMWP 2ZIUB 3F5EA 2YMQA 4EE2A 4RNAA 4HROA 2SEBD 4YXDB 2K39A 2KX0A 4P6VF 2XEWA 3X0WA 4HWIB 2I2YA 3RN9C 9ICBA 4A55A 2HBKA 2R2OA 4PHAA 1M4VA 4I2EA 3I63C 4ZRQA 4RMAA 4GXIA 1N62A 3V7KA 2DLBA 4QWAA 3RH6A 3R8BA 3RBDA 2F3NA 4BBNC 3HILA 3BQ1A 1NI2A 5KT3A 1K1SA 7ICLA 4UDUC 1T7PA 2LI5A 2IJ0A 4YMOA 3THVA 1V1PB 3KYDD 4TQRA 4WWNA 4IR9A 3H4BA 3KW5B 2ASJA 1ZQKA 1NYRA 1SZPA 5AZGA 4UB6U 8ICHA 2NTTA 3JYUA 3DDHA 4RQ6A 4DSJA 3BVZA 2V1YA 4ZRPA 1ZP0B 4I2IA 5LXHA 1SE4A 4W9IA 4BUGA 2AQ1B 4MELA 3HT3A 1TVAA 3AE5B 4Z6FA 4IWQA 3GZNI 1V5OA 3VTWA 3GZFA 4LDTB 1QCKA 4HRSA 4YG2A 2KHVA 3WU2U 2E8MA 1YQ3B 2KN7A 3LK9A 5J8YA 4UB8U 5CP2A 4NM1A 8ICSA 2JZZA 2SAKA 2LYAA 4WQOB 8ICJA 1T0YA 4JV1A 2KJ8A 2WDRB 2CXYA 1UZXB 4K7WA 2ISPA 1BPEA 4QWEA 4IRKA 1WXSA 3C8YA 4NM2A 1WI0A 5ALXA 1EU4A 3RB4A 3VHTC 2W82A 1MN8A 1MSWD 3R2TA 3QQ8B 4WJNA 1K53A 4M47A 1XQQA 2NR2A 3ONNA 3SDLC 2W9CA 2C2DA 4NV0A 3RF9A 2L32A 2M0AA 2CN1A 4JL9A 5HR6A 5DPRA 2IHNA 2MA9B 1QSYA 1VCBA 5KFEA 1QLNA 3UIOB 2N9XA 3QCAA 3GQCA 4M2YA 3MR6A 8ICPA 3WK8A 5D94A 2LYBA 1ZQAA 5J2AA 2LHTA 2KMMA 3I1YA 2IDYA 2J53A 1SL2A 2NPTB 5T14A 7ICHA 1I4PA 3VC8A 1DOXA 4RQ2A 5CB1A 2RMMA 1X9XA 4I2CA 8ICRA 2MAXA 4DL3A 3JSVB 3DBLI 1V80A 1SEBD 9ICNA 1D9FA 3NOBA 1G6JA 5E6NA 3Q8FA 2P6RA 1Z1BA 4RPYA 2YEPF 4W9DA 4YD2A 5J0YA 2J0KA 2LD9A 3NRZA 2HHWA 5J0RA 2GH1A 5LXIB 1K5OA 4R66A 3QAQA 3TIXA 4F92B 4A8EA 3KKAA 4W9HA 1SKSA 2IA6A 1FXAA 9ICLA 4C8MA 2J6UA 1P9DU 2ZIWA 4ZYNA 5DCNA 2IBIB 2AGOA 1EWYC 2QB1A 2Y5BB 4YVZA 4DQSA 4J9SA 2PE6B 1KOTA 5KAIU 1L6VA 1B22A 4DQOC 2RHFA 1SL1A 4GDLB 3ETRA 8ICQA 2MUTA 2WF6A 3E56A 5ALYA 2K4HA 2PIAA 4MH0E 2AL6A 1S1QB 2NCNA 3OWEB 3WK5A 1RDFA 4P0PA 4KLGA 4I2AA 2ZNVB 3WKAA 3ZXVA 4O5CA 4B6WA 2WF8A 5J2BA 1JWBD 5DQHA 5CHVC 4CCHA 2A1JA 5BYSA 3LYYA 3IBEA 5DLGA 1WF9A 2BW2A 4EZJA 1ZQSA 2JUOA 3DHGC 1ZQMA 1RXWA 4JWUC 4MT5A 2O6VA 2J0JA 3H0LB 4GC6A 5C1ZA 2WYQA 5DGBA 5J0UA 1KL9A 5A0LA 2V4RA 3TEXA 2ZJ8A 4EFOA 1I35A 3PSPA 4O5EA 4K7UA 1C79A 3HKZC 2V3SA 4P7IA 5EDSA 2VRRB 5CA7A 2J6TA 2K25A 3RNGC 4USAA 1UWXA 1XO1A 2BPCA 4EENA 1T5XD 1PK3A 3W5UB 3RH4A 2KFNA 3WK9A 1A76A 2OXOA 3GIKA 2W9BA 4NLGA 1CEZA 1ZQYA 1JRUA 1VZ6A 3HVZA 1E7VA 2HE7A 2IHMA 4O3OA 3C2MA 2RGFA 3SQIA 1L7YA 1WJNA 5J2CA 1V97A 1RRBA 1TKEA 2INCC 5KFOA 1ZQXA 3SV3A 1L8OA 2DUYA 3NUQA 7ICIA 3TCAA 4G0NB 5ALJA 1YJ1A 2PI4A 3ALBA 1QZEA 4Y2QA 1C78A 4C7YA 2A4ZA 4FZLA 5ALDA 2WXHA 4PGQA 2H5XA 4GMVA 5AKXA 1U9LA 1TT5B 5AM3A 2BR0A 2L83A 3MHSD 4MSQB 4MF2A 1ET6A 3QZ8A 1WUDA 2WAQC 4HVBA 2EZXA 2FLPA 3ZRFA 3BVGA 2K9XA 4YR3A 5DB9A 2MRLA 2KK0A 1COOA 1JMSA 4M9JA 3Q8AA 5DPTA 4EBDA 1ECWA 2NO5A 3ISCA 4NY0A 1SE2A 2OJWA 8ICVA 1Z4NA 3PSTA 3SHQA 2XK5A 1RM6C 3H0MB 1NVID 4CO7A 1TV9A 2IO2B 1ZJNA 3H7IA 1UF0A 4HYKA 2KO3A 2AGPA 1ZQIA 1GOZA 4ELTA 2JRHA 4ED6A 1L2NA 4EZKA 3RB6A 5GTHU 2YMMA 1JWAD 4YXJA 3DHIC 4RQNA 1WZ0A 5J0TA 4F1SA 4P1BC 4OJPA 2WGSA 1GO3F 2FAZA 3EFUA 3U7ZA 2ACZB 2JT4B 1WGYA 4RM8A 5KG0A 1PGAA 4IM0A 3P42A 4F4WA 4RT2A 2KHWB 2J6SA 4DF4A 3QU9A 5KFPA 2JSVX 2LGSA 5DPSA 4B9SA 1CZPA 4IR1A 4I2BA 2BQQA 2C9WB 1ZQCA 3ZD8A 4OO1J 5AKGA 1A77A 2C5LC 2F77X 4BKSA 4KLEA 4QZFA 2OHFA 3U52E 2HMXA 4UBBA 3UPQA 2CJNA 4E71A 3BZDB 3M8SA 1XLPA 3H1UA 2NMQA 2W7PA 4HPPA 3BQ7A 4Q2JA 3QEAZ 7ICEA 1TS3A 3TAQA 5IKCM 2C22A 4OVVA 1V1OA 1SL0A 3B0YA 1IBXA 1A6SA 3N3KB 2IO3B 1JWMD 4DQRA 2PVGC 1Y88A 2E3TA 2DKXA 3PW2A 4UB5A 3L0WB 4HK2A 2ODGA 3ISDA 5ALVA 8ICNA 2WP9B 3OSNA 2KC2A 3T5JA 2O6VD 3AE9B 1V38A 4ZOHC 2BZFA 1XC9A 4K81A 4WWMA 5J0QA 1PGXA 3AUOA 4PL2A 2ZTEA 9ICOA 4KLOA 2FCQA 2LMCA 3AE8B 4EELA 4EZ6A 1WYGA 4EZ9A 4ECTA 4I2FA 1F0MA 2C7MB 3A1QA 1TAMA 3MDCA 2DZJA 2QARB 2CHWA 5AKLA 1JWUD 2FE9A 1T8EA 5KG2A 3I76A 4UAVA 5AI4A 1FEZA 3IVFA 3SYZA 1MQ3A 2OJRA 3TJPA 3MFIA 2KSOB 4EOYA 2L5YA 2UVUA 3VQIA 1Q3UA 4MSMB 3ZLZA 5ALUA 3BQTA 2JF5A 1X42A 4RQ1A 3M8RA 2BPSA 1IGCA 4ANXA 2LXCA 1NJYA 4YSZB 7ICFA 3ZI4A 1BUIC 3V61A 4PHEA 3QU2A 5DBBA 2C7HA 3DVGX 3KUCB 4EX6A 4ED7A 3TI0A 2M0NA 2XICA 3ML9A 5KFWA 3N7PD 2Q4TA 4LNKA 1EXNA 2KVCA 2YN4A 4M6WB 2XO7A 4KLLA 4IRDA 1I4RA 4RQMA 2DHZA 2KZRA 1HEKA 1L7PA 4KTQA 3MJWA 2WF7A 4AJWA 2N7DA 3RJFA 3A0BU 3ZD9A 1UBQA 3Q8LA 4KLUA 4UAUA 3PX0A 1JCKB 2I1KA 2KACA 3QARA 1DOQA 1VLBA 2UVVA 2BQ3A 1N5XA 1PYWD 5HP4A 8ICFA 2O2VA 4WWOA 3P4SB 2HCFA 4DS4A 2EQYA 4P4PA 1L0XB 1WX7A 1WH3A 2BCUA 2MWSB 3ZNGC 3NVYA 2F1IA 1ZQBA 3A9JA 2ES6A 2KTRB 1RYUA 3WK4A 3PR5B 2PI5A 3Q8QB 2BKFA 2ZVOA 4W9FA 3VRAB 1L4ZB 3WA0A 2MA1A 2WQYB 4ECQA 5AHXA 3GE8C 1KDHA 4DL2A 2M9NA 3FILA 5JZEB 5GMVA 4U6PA 2LRWA 2HOIA 2KWCA 2JZBA 2BPGA 3W1YA 4HJKA 3Q8EA 4A8XC 2Z8LA 2EANA 3OLMD 4GOCA 4O3RA 4QAYA 1DYQA 4DWFA 2BS2B 2BCVA 1QOGA 1XSLA 3Q8KA 2OH2A 3AE4B 5KL8B 1H8CA 1ZOYB 3ZRCA 1TAQA 9ICHA 2MP2B 1UQVA 4FZNA 5H8YE 4WAFA 2ZUCA 1X6JA 1NK9A 1LXDA 4MM3B 1DOYA 1ZD5A 2BWES 4IL6U 4XQ8A 1YOVB 2LFIA 1UGJA 3PSEB 3GDXA 2DAFA 3AH7A 1S9FA 1BPYA 4S0RA 3RFZB 2VA8A 2WB1C 2RDHA 2VA3A 4B9TA 1YQ4B 4KKIA 1TY2A 1Z3EB 3IT4B 4KMOB 4GXKA 2MUTB 1AN8A 4DFKA 1URJA 3C29A 2M17A 1WY8A 4J9MA 1P0RA 3B2FA 1F52A 3N7RC 3UQBA 1GB1A 3H0RB 5KHQA 1ZJMA 2V4QA 4QZIA 3HPOA 5AKKA 2ZIWB 3VXWA 3L4PA 3TAPA 1S10A 2PKEA 2BYVE 2LEKA 3PW4A 2I1JA 2ZVNA 3PZDA 2GMIC 4YFKA 5KG3A 2W3RA 1TKGA 1KRPA 4C4VB 1IPGA 9ICCA 1DGJA 4EEYA 1DXSA 2HJ1A 2KD0A 2PMZC 4EEKA 3DEEA 1KF6B 1A5RA 1ZQDA 1K51A 3T8MA 3QZ7A 2UWQA 1CRXA 5KHOA 4DHJB 2R8HA 3DPDA 1SSNA 1CI4A 2N1RA 5EOZA 3RUIB 9ICKA 4FO6A 1D3ZA 3AB5A 3M62B 2IGDA 1QKZA 4KGSA 5BMIA 4EUTA 4KLDA 1UBIA 4X57B 5DQIA 4DSEA 5AZFA 1UH6A 5KFNA 2WXOA 4JWMA 4US9A 1TTNA 3RJEA 3T5HA 1YNTE 2I1QA 4UAZA 3NGDA 3FDSA 3UXOA 4DSIA 4IQUA 4P0QB 5AUIA 2H3IA 2N7EA 3TQ1A 4M9GA 3I57A 2XC9A 2KANA 7ICMA 2JRIB 3DHHC 4NAMA 5BYQA 5ALIA 5IIIA 4W9JA 1ZQWA 5KFIA 7ICKA 5J0PA 1ZQGA 5ALEA 1NK8A 2LHEA 1C77A 1NK5A 1RQLA 1XF5L 3C21A 4QZ9A 3VTUA 3WIMA 1U47A 1RZTA 1SE3A 1UT5A 5JUMA 2W9AA 2KFKB 3GZNB 3TSSA 3ZYYX 3A4RA 5C3JB 2L7RA 4P16A 3M9MB 4FS1A 2Q5WD 2ZUBA 1SKWA 1QSSA 2DF4B 3D2QA 5L9XA 2V3NA 3EZ5A 2J52A 3V62A 4ICUA 3V60A 2BYFA 4BKTA 4XA5A 5IILA 1J2MA 1YX5B 4DFDA 2MLBA 9ICRA 5AI0A 1O08A 1C4AA 1NZPA 1TK8A 1KSPA 2AQ2B 3ZDEA 4FADA 1IP9A 3PTFC 2KDIA 3J81j 5D4BA 1MQ2A 1JQ4A 4C4VA 3TUOA 4LNNA 4LJXA 5ALHA 1XT9B 3ZKJC 3MDAA 2N9KA 1SV4A 4MEYA 4O3SA 4PPXA 9ICFA 4F3OA 2JMGA 3BK1A 2AWTA 1YT3A 5EE1A 4C4SA 3Q8PB 1WCLA 1SJED 1QQ7A 2ZIUA 5AZHA 5J18A 1YIWA 3QC8B 2BKRB 4I27A 4NJ7A 2JQRB 2HHSA 2NBWB 5IP4D 1TZOA 4YR0A 1V2YA 3IN5A 3AL0B 5J0XA 5GTIU 1YN5A 3GIJA 3DVNU 4ZHPA 4QZDA 2YEPB 2AQ3B 5H2FU 4XDDA 1SIJA 2Z0EB 1OGWA 2K22A 4MFCA 2EAOA 3EPIA 3PGEA 4LLGM 4XYCA 1FEHA 2KJHB 5E6OA 1F5SA 4XWWA 5F9LA 2JR5A
chains in the Genus database with same CATH topology
2KQ4X 4OHJA 1KTKA 1ZDXA 2FE8A 3H8HA 1JMLA 1P7EA 3PZ8A 3Q8BA 1AYFA 4WH4A 2KMMA 2INPE 1QLBB 2IDYA 2J53A 3ZGZA 1JWSD 3AECB 3BK2A 1E10A 1FNVA 1I4PA 2KN4A 4DXGA 2CJOA 1DOXA 2WXJA 2RMMA 5EE3A 1UUPA 1FO4A 1SEBD 1L5PA 1ZXHA 4RF0A 1N63A 2W3SA 1EM7A 1ZPSA 3Q8FA 2YEPF 1HEZE 5D3IB 3NRZA 1TS4A 3LB8C 4KGTA 5HFYA 4YTNB 4B0EA 2ZW1A 2PTLA 5JXVA 1IBXB 3ZJVA 3CIRB 1FXAA 4C7ZA 4YTMB 2WXIA 1VZ8A 4A90A 3MJ5A 1EWYC 2MEKA 1VR9A 4ARIA 2JYTA 1KLUD 1JALA 3NUHB 4NAWB 2BTEA 2DBYA 2ICIA 1L6VA 1TKYA 2AX5A 2KDMA 4DQOC 4GDLB 4HEA1 1ROEA 3ETRA 1GAQB 3B9JA 3HVDA 3E56A 2PIAA 1MVKA 1VJKA 3TEZA 3OWEB 2MJ3A 3KQ4A 3AM9A 2GRIA 4L2YA 3W1SA 1V1PA 3VR9B 2WXGA 4C80A 1HA5A 5BMGA 3TEYA 5C2TB 5HI1A 3DWMA 1JWBD 4A9AA 3RPFC 5BYSA 3T3OA 2QSDA 2L1AA 3LYYA 3SR6A 3AEDB 2EELA 2BW2A 4JX1C 1FFVA 3AEGB 2W54A 4AQ7A 1DOIA 4JWUC 1VDVA 1E7PB 1FXIA 4MT5A 1E0ZA 3MFGA 2Y5PA 2VZKB 1FRRA 3TEXA 2H88B 2JWUA 4HKZE 1ET9A 4NZLB 1I4HA 2LJIA 4M0WA 3V05A 3AN1A 1C79A 3B2GA 2FUG1 5GXGB 1CK1A 4ITKA 4USAA 1PGBA 1UWXA 2V3PA 3GS2A 4J3OD 4WQMA 1QT9A 4KX6B 3P4PB 2KAJA 4AS1A 1T5XD 3W5UB 4OZAA 1FNWA 1RFKA 1VZ6A 4RCOA 3HVZA 2TSSA 1HXYD 1D5MC 3SFEB 3DWGC 1V97A 1TKEA 4ARCA 1I7HA 1PFDA 1UWMA 2M19A 1QILA 2LHDA 1CJEA 2QMTA 2QILA 2J4XA 2IGHA 1STEA 1J7AA 2HDEA 1C78A 2PW9A 4C7YA 1GB4A 5HG2A 4D2KA 2WXHA 2N9LA 4RFBA 3BVMA 1N60A 2L83A 3AE7B 2WXQA 4XE0A 1ET6A 2N7JA 3BVGA 2K9XA 3IAS1 1GPXA 3Q8AA 1YN4A 3VR8B 4MACA 1SE2A 1D6EC 2PKOA 1RM6C 1NVID 2DYMA 3IXSA 4YWGG 1GOZA 2W55A 2OEDA 1ZE3D 4JPSA 1F2RI 1FD6A 2HTME 1N61A 1JWAD 5E6JA 3MHZA 1SB3C 1IGDA 2IGGA 1XCQL 3NVVA 1WRIA 4TQ0A 1VZ7A 2EKIA 3URYA 3AE3B 1BXTA 2ACZB 3U7ZA 1F0ZA 1NEKB 2WXRA 4JE3B 3U2SC 1PGAA 3P42A 3TEWA 5G5GA 2JSVX 1QQRA 2WXLA 1CZPA 1L6UA 4KKJA 4US8A 1L4DB 3E9SA 4RF1A 2OHFA 3U52E 1J7CA 2CJNA 3BZDB 1T3QA 1UNSA 1YN3A 3AEFB 4GLSC 1XLPA 4N59A 1AWDA 2IPKD 1BMLC 2NMQA 1JROA 5FK9C 4Q2JA 1TS3A 2R61A 1MHXA 1V1OA 4H2AA 1IBXA 1KLGD 2XN9C 4C56C 4MH8A 1JWMD 1NI3A 4YSXB 1F2RC 2PVGC 2PVOD 2K0PA 2E3TA 3BIID 1KRHA 2LUMA 1PUTA 3BWUD 2WP9B 1FM0D 1CQVA 4REZA 5EE9A 3AE9B 1JW9D 4LK0M 1OQRA 4ZOHC 1XCTL 4WWMA 4XDCA 3W5VB 3KLSX 1PGXA 3N9YC 2K3UA 1MPEA 5T8IA 1QOAA 2LMCA 3AE8B 3P1MA 1WYGA 2MJEA 1XEEA 4TSSA 3SFDB 2M56B 3IT6B 1JWUD 1NYQA 2JXTA 2BS4B 1RWSA 2JU6X 4YTPB 1C4PA 2J42A 1WGKA 4RGTA 1WSPA 3VQIA 2QJLA 3NVWA 3FILB 2JX5A 1ENFA 2K5PA 1FCLA 1D5ZC 1PDXA 1ZXIA 1IGCA 4L23A 1IUEA 4OW0A 4YSZB 1YMHE 2MH7A 3P63A 1FNUA 1BUIC 1ESFA 5HHDG 4HKQA 3ZJTA 1E9MA 1D4BA 3GB1A 4LTUA 1TS2A 1TJEA 4YSYB 2BBCA 3HRDD 5LNK1 3T3NA 3AMZA 1I4RA 1P7FA 3IAM1 3Q69A 2G9HD 2GI9A 4KGRA 5BYRA 4RH6A 4NJCA 2XNAC 3BYTB 3BYYB 3AE1B 3SEBA 1JCKB 4A6QA 2KACA 5I4DA 1VLBA 1N5XA 1NENB 1PYWD 3P4SB 3V3XA 3WCQA 1L0XB 1XLOA 1RYJA 1JRPA 2RDGA 4N6EB 1I4GA 5D7GA 3NVYA 3MP9A 1EWCA 4RGMA 3U4EG 3ZJUA 2CU3A 3VRAB 3P4RB 3ABVB 1L4ZB 1J7BA 3LXFA 2WQYB 2H89B 1KFYB 3NZ3A 5FR3A 3FILA 3NVZA 2WU5B 1TY0A 2BYTA 1SBBB 3GP7A 2V4IB 4N58A 1K52A 4FXCA 2NTSA 3W9CB 4O1NA 3Q8CA 2WS3B 5EE0A 3Q8EA 4A8XC 2Z8LA 1C4CA 2WDQB 1DYQA 2BS2B 1QOGA 2WU2B 3AEBB 1K50A 1V8CA 3AE4B 2INNE 1XO3A 2ONQA 1ZOYB 4RGNA 2WXKA 3W2DA 2E6XA 1FRDA 2BB6A 3EA6A 5H8YE 2V0GA 1OQQA 2DYOA 4WAFA 2GB1A 4MM3B 1DOYA 1HZ5A 2LFIA 1FCCC 3MC0B 5BMHA 1UGJA 2ON8A 1I4QA 1ZUD2 3AH7A 1TS5A 3ZQ4A 2BS3B 3O13A 4OZCA 1SF0A 3RFZB 1WWTA 2RDHA 3EGRA 4WIPA 5G5HA 1YQ4B 4KKIA 3EUB2 1TY2A 3IT4B 1WXQA 3AEEB 1AN8A 1FMAD 1MHHE 3VRBB 1EU3A 3AEAB 3B2FA 3P4QB 1GB1A 3I9V1 1QOFA 3L4PA 2KWDA 2LEKA 2WLBA 5AUKA 3CWIA 2PLPA 2W3RA 3NS1A 1TKGA 4OVZA 1B9RA 1DGJA 1XLQA 1N5WA 1D5XC 1A70A 1KF6B 2WDVB 2WNMA 4ZHOA 5D3DA 1MI0A 1K51A 2BT6A 2DWQA 2WXPA 3UI3A 2WXFA 1SSNA 2N0SB 1TYGB 1ZDVA 2BB5A 2D5GA 2QIEB 3AB5A 5MPOA 2RPVA 4YT0B 1LO5D 4CQNA 2IGDA 1QKZA 4KGSA 4B0MA 5BMIA 1L0VB 2Y3AA 3PO0A 1HQRD 1QOBA 2LGIA 3KWVA 2JZPA 1R7SA 4PT5A 4DXFA 2WXOA 1OFFA 1FFUA 4US9A 1AW7A 1SXTA 3R2IA 1XLNA 1YNTE 5FKAC 1FIQA 5AUIA 4EE2A 4RNAA 4HROA 2SEBD 4YXDB 3I57A 4P6VF 4RGOS 1L0YB 2G1EA 4NAMA 5BYQA 2JYEA 2X38A 3J9CA 4A55A 2I2YA 1F77A 1M4VA 4ZRQA 2LHEA 1C77A 1N62A 2DLBA 1XXGA 4HJGE 3AE6B 3R8BA 3FC4A 1XF5L 1SE3A 4UDUC 1C9FA 2IJ0A 1V1PB 4WURA 3TSSA 1E6EB 2B76B 4XWTA 3ZYYX 1QF6A 1I4XA 5C3JB 4P16A 1NYRA 1YJIA 1YJJA 2Q5WD 2V3NA 2MJDA 1KH0A 2J52A 2NTTA 4R3DA 1T6BX 2PMVA 3AE2B 4IOIE 3BVZA 2FBWB 4ZRPA 1C4AA 1ZP0B 2AQ2B 3AV8A 4OZBA 1SE4A 2AQ1B 2WXMA 1ACCA 3AE5B 1JQ4A 3TUOA 3FAHA 4TQ1A 1HZ6A 2N9KA 1SJHD 3BK1A 2Y5CA 4HRSA 1YQ3B 5EE1A 2SAKA 2L52A 5TSSA 4IKGA 4TMAB 1SJED 2WDRB 3HUIA 2I38A 2JQRB 2VZKD 1Q10A 3C8YA 1TZOA 4GDKB 1B1ZA 1EU4A 2W82A 1YN5A 4ZHPA 3R2TA 2YEPB 2AQ3B 2QEJC 2WXNA 3PZ7A 1K53A 1SIJA 4XDDA 4JWSC 3KWLA 2K22A 5H92C 4ZYSA 4LLGM 2L32A 1FEHA 2M0AA 1Y56A 1VRAB 4IDIA 4XWWA 4L1BA 2ZW0A 1C76A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2W3R A;  3NS1 A;  1CJE A;  2K5P A;  1TKG A;  5AUK A;  1PDX A;  1B9R A;  1ZXI A;  1DGJ A;  4YSZ B;  1IUE A;  1XLQ A;  1N5W A;  1AYF A;  1A70 A;  2MH7 A;  1J7A A;  1KF6 B;  2WDV B;  2KMM A;  4C7Y A;  3P63 A;  4ZHO A;  1QLB B;  3AEC B;  2BT6 A;  2DWQ A;  1E10 A;  2N0S B;  1N60 A;  2L83 A;  3AE7 B;  1E9M A;  2CJO A;  1TYG B;  4LTU A;  1DOX A;  2QIE B;  3AB5 A;  1TJE A;  4YSY B;  4YT0 B;  5MPO A;  2K9X A;  5EE3 A;  3HRD D;  1L0V B;  1GPX A;  1FO4 A;  1L5P A;  3AMZ A;  1N63 A;  2W3S A;  3PO0 A;  1QOB A;  3VR8 B;  2QJL A;  1R7S A;  2PKO A;  3AE1 B;  1RM6 C;  3NRZ A;  1OFF A;  1NVI D;  3LB8 C;  1FFU A;  1VLB A;  4US9 A;  1N5X A;  1NEN B;  4YTN B;  1XLN A;  1FIQ A;  5AUI A;  3P4S B;  3WCQ A;  2W55 A;  4HRO A;  1XLO A;  3CIR B;  4YXD B;  1FXA A;  1JRP A;  4C7Z A;  1RYJ A;  4N6E B;  4YTM B;  2HTM E;  1N61 A;  3NVY A;  1JWA D;  4P6V F;  2G1E A;  1SB3 C;  2CU3 A;  3VRA B;  1EWY C;  3P4R B;  3ABV B;  3NVV A;  1WRI A;  1J7B A;  3LXF A;  2EKI A;  1JAL A;  2WQY B;  3AE3 B;  2ACZ B;  2DBY A;  1F0Z A;  1N62 A;  1L6V A;  1TKY A;  2H89 B;  1KFY B;  1NEK B;  2AX5 A;  3AE6 B;  3FC4 A;  3ETR A;  3NVZ A;  1GAQ B;  1ROE A;  3B9J A;  2WU5 B;  5G5G A;  2PIA A;  1CZP A;  4N58 A;  1L6U A;  3W9C B;  4FXC A;  1VJK A;  2MJ3 A;  2WS3 B;  5EE0 A;  4US8 A;  1E6E B;  2B76 B;  3ZYY X;  1QF6 A;  3AM9 A;  2OHF A;  5C3J B;  2WDQ B;  1J7C A;  1NYR A;  1YJI A;  3CWI A;  1YJJ A;  2Q5W D;  2BS2 B;  4C80 A;  1QOG A;  2CJN A;  2WU2 B;  2MJD A;  5C2T B;  1T3Q A;  3DWM A;  3AEF B;  1JWB D;  3AEB B;  4A9A A;  1XLP A;  3RPF C;  3AE2 B;  1V8C A;  4N59 A;  3AE4 B;  3SR6 A;  1AWD A;  3AED B;  2FBW B;  1XO3 A;  1ZP0 B;  1ZOY B;  1JRO A;  3AV8 A;  4JX1 C;  1FFV A;  1FRD A;  5H8Y E;  3AEG B;  2W54 A;  1OQQ A;  1DOI A;  1DOY A;  3AE5 B;  1VDV A;  1E7P B;  1FXI A;  4JWU C;  1JQ4 A;  1E0Z A;  3FAH A;  1NI3 A;  4YSX B;  1FRR A;  2PVG C;  2PVO D;  2Y5C A;  4HRS A;  2E3T A;  3BII D;  1KRH A;  1ZUD 2;  2H88 B;  3AH7 A;  1YQ3 B;  5EE1 A;  2L52 A;  2BS3 B;  1PUT A;  2WP9 B;  1SF0 A;  3AN1 A;  1FM0 D;  1WWT A;  3B2G A;  3AE9 B;  1JW9 D;  4WWM A;  1OQR A;  4ZOH C;  5G5H A;  1YQ4 B;  5EE9 A;  5GXG B;  2WDR B;  3EUB 2;  3HUI A;  3W5V B;  4ITK A;  4USA A;  2JQR B;  1QOA A;  1WXQ A;  3AE8 B;  4WQM A;  3VR9 B;  3AEE B;  1QT9 A;  3P1M A;  3P4P B;  2KAJ A;  4KX6 B;  1WYG A;  2MJE A;  1FMA D;  3SFD B;  3W5U B;  4ZHP A;  2M56 B;  1NYQ A;  1RFK A;  3VRB B;  1SIJ A;  2BS4 B;  3AEA B;  3B2F A;  4JWS C;  1RWS A;  3HVZ A;  3KWL A;  3P4Q B;  2K22 A;  5H92 C;  4YTP B;  3SFE B;  1QOF A;  4IDI A;  3L4P A;  3DWG C;  1V97 A;  1TKE A;  2LEK A;  1WGK A;  1I7H A;  1PFD A;  1UWM A;  2WLB A;  2M19 A;  3NVW A;  2JX5 A; 
#chains in the Genus database with same CATH topology
 2KQ4 X;  3IG3 A;  4XZ4 A;  1KTK A;  1ZDX A;  4KX3 A;  1JML A;  3PZ8 A;  2HBM A;  4J6I A;  4ED2 A;  2M1M A;  5KFF A;  1F1H A;  1S76 D;  2K8C B;  2LBO A;  4KIK B;  4WH4 A;  2HJ8 A;  5KFJ A;  4W9E A;  4EKU A;  4QNL A;  3AEC B;  1E10 A;  3HM3 A;  2YMP A;  1QSL A;  2HVH A;  3GIL A;  2CS4 A;  4RNO A;  4DXG A;  2MQJ A;  4UB3 A;  3PRP B;  1X2I A;  5J2D A;  4ECW A;  3Q14 C;  5G55 A;  2KE7 A;  1L5P A;  4RZR A;  1L7N A;  1N63 A;  3BS5 A;  2K8B B;  1EO6 A;  1B43 A;  2ASL A;  3DBR B;  2W8L A;  1NJW A;  3RI7 C;  3SU8 X;  4FA6 A;  1HEZ E;  3L13 A;  3OG5 A;  4CHK A;  4CF3 A;  3IDW A;  3CRX A;  3PSI A;  1LV5 A;  4KGT A;  2WHI A;  1OEY J;  4FBT A;  2KLG A;  2LGY A;  2W04 A;  1NZB A;  1WWV A;  2PTL A;  5JXV A;  2R2Q A;  1HIW A;  2RP5 A;  1J19 A;  2IZV B;  4AWJ A;  3CIR B;  3BZK A;  3GU3 A;  4DEZ A;  4Y2T A;  4C7Z A;  3PML A;  2PFP A;  2WXI A;  1S5L U;  4IC9 A;  2DAJ A;  5DB8 A;  3BIN A;  2KKP A;  2XK5 B;  4ECU A;  2MEK A;  1TKD A;  2JYT A;  1JAL A;  3NUH B;  1WR1 A;  4BKS D;  1DGS A;  2DL0 A;  1LGR A;  5DKW A;  3DCG A;  1BPD A;  4HAI A;  2KDM A;  2WB1 F;  1ROE A;  2MBH A;  1BT0 A;  1Q5W B;  5KG4 A;  2NVU I;  3CMM B;  3APC A;  5IN7 A;  2WHE A;  4F50 A;  2KTF A;  4O9M A;  1AQ6 A;  1VJK A;  1C20 A;  2PPH A;  2MJ3 A;  4I6N B;  1K8R B;  2VJ4 A;  2G09 A;  3G6X A;  3KQ4 A;  3AM9 A;  2I5H A;  1N56 A;  1V1P A;  3VR9 B;  4C80 A;  1HA5 A;  3LJ3 A;  2E1E A;  7ICN A;  3C0R B;  5BMG A;  4KV2 A;  4A3P A;  5AM0 A;  4MEM A;  4A9A A;  4BZA A;  3ZNZ B;  3T3O A;  2XY7 A;  2HHX A;  2GLS A;  2L1A A;  9ICV A;  3AED B;  2W11 A;  2EEL A;  4HLE A;  4JX1 C;  5DBA A;  3Q3O C;  3MGV A;  4E74 A;  4NJ8 A;  2W54 A;  4AQ7 A;  2YB1 A;  2C2E A;  1DOI A;  1E0Z A;  3Q2A C;  3NJT A;  2Y5P A;  2QDF A;  7ICJ A;  4Y2S A;  3M9O B;  3GIM A;  2H88 B;  1ET9 A;  4OCZ A;  4M0W A;  1KKX A;  1GC7 A;  1ARO P;  4UAS A;  2BGF A;  3AN1 A;  2ZCC A;  3B2G A;  2FUG 1;  5DG9 A;  5GXG B;  4ITK A;  3ZTC A;  4BWJ A;  4G3I A;  2V3P A;  3GS2 A;  3KHG A;  1R4N I;  2KAJ A;  1CMX B;  1YQB A;  4DFP A;  1IV8 A;  5KAF U;  3AEV A;  2GBR A;  4OZA A;  1FNW A;  5ALT A;  3OJS A;  3F2D A;  4J9Q A;  2KFK A;  1HXY D;  2E5S A;  3QK0 A;  5KFB A;  5D46 A;  1T94 A;  4QW8 A;  3M6K A;  3MBY A;  4ARC A;  1PFD A;  4M0A A;  3WAP A;  5ALR A;  2QIL A;  4DO9 A;  4GLX A;  1STE A;  1J7A A;  1GB4 A;  4RFB A;  4K4I A;  4C00 A;  3QWZ B;  3SI8 A;  2Y1J A;  3BVM A;  1V49 A;  2N9E B;  2KIV A;  3M7D A;  1PVR A;  3AE7 B;  2WXQ A;  2RQ5 A;  5J2F A;  2BPF A;  2DNF A;  2N7J A;  5KFM A;  1ZQQ A;  4F8R A;  5TSS A;  3RNE C;  3IAS 1;  5KT2 A;  2XY5 A;  2C7N B;  3ZVV A;  5HML A;  1V9J A;  1YN4 A;  4QJF B;  5F3X B;  3CYM A;  4RT3 A;  5KFA A;  2RDJ A;  1D6E C;  1ISN A;  3GOE A;  2KWU B;  2HTH A;  1WWU A;  2KTQ A;  1WGH A;  3ZO5 B;  1KN5 A;  1N2X A;  3H8W A;  3C19 A;  2LZ6 A;  3IXS A;  2KFJ A;  2JEG A;  3OPX A;  4F4Z A;  2OED A;  1LFD A;  3GE3 C;  1XU4 A;  9ICS A;  5L1I A;  4KVG B;  5AIC A;  1A0P A;  1HUZ A;  2Y9U A;  3ED5 A;  3MHZ A;  2KYW A;  1IGD A;  2LKY A;  3QU5 A;  3AXC A;  2KMC A;  2IGG A;  1XCQ L;  3NVV A;  1WRI A;  3L3F X;  2IO0 B;  2IY1 B;  4XC2 A;  1AAR A;  4LJP B;  3N4M B;  2ZIX A;  3VDZ A;  3AE3 B;  8ICZ A;  4FHK A;  1F0Z A;  4QZC A;  1P3Q U;  1NEK B;  4JE3 B;  3PO4 A;  4LNF A;  2A5U A;  2AYO B;  4W9C A;  1GG3 A;  4O3Q A;  4DWI A;  1I42 A;  2V9W A;  2AXT U;  4YN4 A;  1SGG A;  2MHJ A;  4DL4 A;  1J0G A;  3DV9 A;  1OW5 A;  4I28 A;  5JHB A;  4KKJ A;  2Y1I A;  4F5P A;  4RF1 A;  3PRZ A;  1J7C A;  5KFH A;  1T4G A;  7ICO A;  2E1F A;  1YN3 A;  3SZ2 A;  2L00 B;  3BJY A;  2J7Q B;  2FMP A;  3NZU A;  2BCQ A;  5BOM A;  3DVN V;  1GJZ A;  1BML C;  3T5L A;  4II2 B;  3DDC B;  1JRO A;  1XNS A;  5LLI A;  2NRW A;  4KX5 A;  4CNQ A;  1IYF A;  4RQ0 A;  1ZGU B;  4H2A A;  3WKE A;  4RQ5 A;  3QUB A;  3OTQ A;  1KLG D;  9ICA A;  3P2B A;  4MH8 A;  3V6J A;  1F2R C;  4IQT A;  1ZQT A;  2YVC A;  1WM3 A;  3PR4 A;  3ZW3 A;  1ZKH A;  1B0X A;  5KG6 A;  2GBM A;  5EE9 A;  4REZ A;  1JW9 D;  2DYB A;  1XCT L;  3ETL A;  4XDC A;  2E8P A;  3KLS X;  1JI7 A;  1IM4 A;  2AQ0 A;  3C1Z A;  4QZE A;  4F8C B;  3N97 B;  1XEE A;  1NKE A;  3SFD B;  1UHU A;  5KFX A;  3IT6 B;  3E58 A;  3EEC A;  1WGD A;  4NPN A;  1D8B A;  2FIF A;  1RWS A;  2JU6 X;  5AI6 A;  2RDB C;  5D49 A;  4WJ3 B;  5EWG A;  4Y2V A;  2K8A A;  2J42 A;  3C1Y A;  4RGT A;  4FJY A;  2K6D B;  3ZNH B;  3NVW A;  1X6I A;  3T3F A;  4JB3 A;  3C2L A;  2LVQ A;  2YLM A;  1D5Z C;  4QW9 A;  1MG4 A;  4L23 A;  1NK7 A;  1PK1 B;  2F44 A;  4C8K A;  3Q3N C;  9ICU A;  5CEH A;  1E5W A;  1YMH E;  3TAD A;  2QLT A;  1WE7 A;  4F71 A;  1ESF A;  4Y2P A;  3MFH A;  2CHX A;  4B9M A;  4OJO A;  1JX4 A;  2R8G A;  4URK A;  5DDM A;  4P0P B;  1ZET A;  1XSN A;  2N9P C;  3F5A A;  4W9L A;  1D4B A;  3PW0 A;  1VD2 A;  3N28 A;  2XGP A;  4YSY B;  1XS9 D;  8ICU A;  1UCV A;  2F1H A;  3H8M A;  2BBC A;  3AU2 A;  2FJ6 A;  1P7F A;  2JGA A;  1KFD A;  5DQG A;  4QIW F;  2GBK A;  3Q69 A;  4FFD A;  5J29 A;  4DSF A;  2OYY A;  1GNU A;  2JEI A;  3BYT B;  3BYY B;  5AKZ A;  2MSE D;  4Y2R A;  5FP0 A;  1SIF A;  4JLC A;  3SEB A;  2LGX A;  5KFV A;  5CHF A;  4ZRK A;  1LVH A;  2FUH B;  3EPG A;  2KZZ A;  4S17 A;  5JRT A;  3MR3 A;  3NTU A;  2XGQ A;  4F4K A;  4N6E B;  5D7G A;  3PY8 A;  5G2N A;  4IW0 A;  1X9M A;  4RGM A;  4PGX A;  3PSF A;  3ZJU A;  5KFY A;  3HHM A;  3D32 A;  3L10 B;  2XID A;  5AKJ A;  8ICG A;  4J03 A;  4EBE A;  1KFY B;  3NZ3 A;  4DHJ D;  3Q3F A;  3NVZ A;  2WU5 B;  3PLV A;  1TY0 A;  1WXV A;  3H7P B;  4N58 A;  3GP7 A;  3WK7 A;  5DG7 A;  2JZ3 B;  2AH5 A;  2PFN A;  2V4I B;  3W9C B;  4XRH A;  5EE0 A;  4HPL B;  1SXE A;  3DVG Y;  2NPT A;  1S0N A;  2UVR A;  2D3C A;  2KDF B;  3PZP A;  4R8U B;  2F8L A;  3B0X A;  1P7D A;  3LWL A;  1F44 A;  5IOI A;  2R8I A;  3C23 A;  2WF9 A;  2E6X A;  2BCR A;  2V0G A;  3S6J A;  3JPT A;  4KDL B;  2DYO A;  1NDD A;  5ALZ A;  4I29 A;  2AU0 A;  2LPE A;  3IG5 A;  3CW2 C;  2ON8 A;  2K4I A;  4ECV A;  4Q45 A;  5AIB A;  3C5G A;  4YMM A;  4RQ4 A;  3O13 A;  1SF0 A;  1ZQZ A;  1WWT A;  3NAS A;  4BBN F;  1RLF A;  2LJ5 A;  1WXQ A;  2W8K A;  2L8J A;  4I2G A;  2LRU A;  4IG7 B;  2YML A;  2ZXI A;  4PH5 A;  4B9V A;  3EHV A;  3TL5 A;  4F5R A;  1JXL A;  4ANV A;  8ICO A;  4ZRI A;  1SV0 C;  4QZ8 A;  4DOC A;  7ICT A;  3AEA B;  3SD5 A;  3P4Q B;  3IFW B;  3LDA A;  3C2K A;  4RM9 A;  3I9V 1;  3K1R B;  7ICG A;  3RD2 A;  4EEW A;  3N1X C;  2KMA A;  4UQG A;  3VFK A;  1DK2 A;  5AUK A;  1D8Y A;  3CWI A;  2UYZ B;  2W7O A;  1D9D A;  2O6V B;  3RH5 A;  1XLQ A;  3QU4 A;  1J97 A;  4R8U A;  5KFQ A;  2WNM A;  4ZHO A;  4J9L A;  4HPM B;  5FR6 A;  4RUC A;  1MI0 A;  3OHA A;  5KFK A;  4JGH B;  2QB0 A;  4M0W B;  2DWQ A;  2DFL A;  5BOL A;  1WGR A;  4PZN A;  5C0Y A;  2KIW A;  1Q0W B;  1B4F A;  2L76 A;  1TYG B;  1ZDV A;  1JIH A;  2BB5 A;  2D5G A;  3NG0 A;  2IND C;  4MJS A;  2RPV A;  1OQY A;  3SD7 A;  4CQN A;  3H7P A;  1ZQV A;  3TAD C;  1KQQ A;  4K4G A;  2W03 A;  2CR5 A;  3PO0 A;  2KEY A;  2VKQ A;  3UIP B;  4PYU A;  5D2M B;  4LZD A;  3KWV A;  2MSN A;  4DF8 A;  1OUQ A;  4K3C A;  2K4E A;  4PT5 A;  2LYH A;  4QWC A;  1RG6 A;  4AYB F;  3R7Q A;  3ZTD A;  2LI6 A;  2MW5 A;  1M6Y A;  5ALK A;  1U4A A;  1WMH B;  2LVO A;  3PPA A;  4R64 A;  1ZQF A;  2LAS A;  2D11 A;  2ZEQ A;  3VH3 B;  4RGO S;  5KT4 A;  1L0Y B;  2G1E A;  1ZQH A;  2KJR A;  1U45 A;  5AK3 A;  2JYE A;  2X38 A;  2KZ3 A;  3M1Y A;  2KIC A;  3H8J A;  2BYE A;  2NYV A;  3TFS A;  1F77 A;  2ZCB A;  3M9N B;  3R3M A;  2KNJ A;  4DDG D;  3AUL A;  1XXG A;  2AGQ A;  2BDU A;  4NL9 C;  3AE6 B;  3KHR A;  2KKV A;  4ECS A;  4KIT B;  4IWO A;  4OJ5 A;  2N1W A;  4RQ3 A;  2JWZ A;  1C9F A;  1ZQO A;  5ALF A;  5KL1 B;  4WUR A;  2RD0 A;  1IG6 A;  1E6E B;  1UEL A;  2B76 B;  4PYZ A;  1QF6 A;  1L3U A;  3AU4 A;  2XBB C;  1YJI A;  2WAQ F;  2JEF A;  2K89 A;  4I2D A;  5J2K A;  4GFJ A;  2CKH B;  4F5N A;  2JXJ A;  5CTR C;  4F4Y A;  1SWV A;  1SGH A;  1T6B X;  2QHO A;  3AE2 B;  1YZ6 A;  3EWA A;  2G5I B;  2FBW B;  2KVZ A;  7ICQ A;  1T3N A;  2WXM A;  1WX8 A;  1OTR B;  2D3A A;  3QUQ A;  5KFR A;  3FAH A;  2DEN B;  3I3T B;  5HR7 A;  1HZ6 A;  3PNC A;  3Q8R B;  1SJH D;  2D3G A;  3OJ3 A;  4M8M A;  3QX1 A;  2DZK A;  3UIN B;  3WK6 A;  2L52 A;  3UMG A;  4IKG A;  2XCP A;  3SEN A;  5DB7 A;  2VJ5 A;  3QUC A;  3H40 A;  4GXJ A;  1C1Y B;  4OJL A;  3HUI A;  4LNO A;  3ZDC A;  2I38 A;  2ZPN A;  4DK5 A;  5DGA A;  1UT8 A;  2Z0D B;  4JMU A;  4FS2 A;  4TUU A;  2D8C A;  3H8S A;  2FMQ A;  4JWS C;  4EYH B;  3KWL A;  5ALP A;  4F72 A;  2KNB A;  5H92 C;  1Y56 A;  1ZRN A;  1VRA B;  4TUS A;  3HIZ A;  4L1B A;  4O5K A;  2ZW0 A;  1C76 A;  4OHJ A;  2PE9 A;  3IRU A;  2FE8 A;  2I6X A;  3KKA C;  5DG8 A;  2KK8 A;  1NKB A;  5KG1 A;  9ICI A;  3A9K A;  1DK3 A;  5AK6 A;  5KT6 A;  4QZH A;  1QLB B;  3B1L X;  2MCN B;  1JWS D;  4UB2 A;  2H3V A;  3LDZ E;  2CJO A;  2HVI A;  4IRC A;  3MTN B;  1QH9 A;  5HHI A;  4PHD A;  2FMS A;  3IV6 A;  5L83 A;  5AI8 A;  9ICM A;  1NOM A;  4GB9 A;  5EE3 A;  4MGK E;  3F53 A;  2HHU A;  3Q8M A;  2W43 A;  2FLL A;  2KFZ A;  4HDO A;  5ALL A;  4RF0 A;  5L1J A;  1EM7 A;  4GDK A;  1TS4 A;  4JV0 A;  3LB8 C;  4Y2J A;  2Y9T A;  3E0F A;  3KYC D;  4YTN B;  4JUZ A;  3ISB A;  2FCN A;  2YB4 A;  1Q8K A;  5DBC A;  3TAN A;  1IBX B;  2HHV A;  1R4M B;  3ZJV A;  4ACO A;  5CHW A;  5HNK A;  3JPO A;  4YTM B;  3APF A;  1RAX A;  4Z6D A;  2REX A;  5IIJ A;  3UQA A;  4A90 A;  1J2N A;  5K4L A;  4IQW A;  3MJ5 A;  1VR9 A;  1Q46 A;  3S2A A;  1KLU D;  3QJZ A;  2M0X A;  2DBY A;  5D6J B;  2H3Z A;  1WJ4 A;  2FNJ B;  3B9J A;  1JUD A;  3HVD A;  2F8K A;  4E0D A;  2FDR A;  3KHL A;  3BY4 B;  3H7S A;  3HK0 A;  4C8L A;  1MVK A;  3TEZ A;  2D6F C;  3L16 A;  2G06 A;  5KG7 A;  2GRI A;  4L2Y A;  3KH0 A;  2B21 A;  4C0Z A;  8ICI A;  3DBH I;  1L8L A;  4B9K A;  3M6Z A;  5HI1 A;  4O3N A;  4BWM A;  4HCN B;  3RPF C;  5KFS A;  2PMZ F;  4B95 A;  7ICP A;  4DQI A;  4MM3 A;  1FFV A;  4EYI B;  1WXA A;  3QHT A;  4MGZ E;  3AEG B;  3PX4 A;  2IOH A;  4CF4 A;  3OHB A;  2LMR A;  1FXI A;  3MFG A;  5JTI A;  4PGY A;  2V4L A;  4NQL B;  2JWU A;  1RYS A;  2BVC A;  1I4H A;  2LJI A;  2DZM A;  4M8N A;  3QIJ A;  2X8X X;  2FPL A;  2L3Z A;  1BNO A;  1M94 A;  5AI9 A;  4EX7 A;  1QT9 A;  3P4P B;  4ECR A;  3RT3 B;  4AS1 A;  3QNM A;  3TFR A;  1HTQ A;  2KHQ A;  4RCO A;  8ICL A;  2KX3 A;  2ESE A;  2EZY A;  3AU5 A;  3DWG C;  2P66 A;  2W9N A;  2KOB A;  1I7H A;  1UWM A;  2KMD A;  1RPL A;  2ISO A;  1QIL A;  1RXV A;  1TBE A;  2VA2 A;  3PT2 B;  4YCX A;  2QMT A;  1CJE A;  4ECZ A;  2J4X A;  4F93 B;  2Q0Z X;  1NJZ A;  2IGH A;  3PW5 A;  5CR0 A;  2VIX A;  4K1R B;  3ZNI D;  4NQK E;  2PW9 A;  5HG2 A;  4QWD A;  4D2K A;  4X5V A;  2N9L A;  3R7R A;  4RQ7 A;  8ICE A;  4OVU A;  1N60 A;  5KFD A;  5CWR A;  2KQS A;  1L7M A;  2M8S A;  5TIS U;  4W9K A;  1V85 A;  4C4T A;  8ICB A;  2KP7 A;  3CF6 E;  3RJJ A;  4PS7 A;  2FI1 A;  5ALW A;  2FCM A;  3A33 B;  1SXD A;  3VR8 B;  1KW4 A;  3IM1 A;  4J9P A;  3QEB Z;  2R8J A;  1KM7 A;  1ZQR A;  3ECI A;  4GGQ A;  3EC8 A;  4CF5 A;  2K4P A;  4JIO U;  2ZTD A;  5AM1 A;  1TK5 A;  2G3Q B;  4P2H A;  2DYM A;  1L7O A;  4YWG G;  1NNL A;  3PLU A;  2LUE A;  2W55 A;  1KLV A;  4NLK A;  4OJ6 A;  4IQV A;  1ZE3 D;  4WWP A;  1F2R I;  3CP8 A;  5E6J A;  5L1L A;  1N61 A;  2P35 A;  2KSO A;  3G6V A;  2HHQ A;  3PVL A;  4WJQ A;  2PFO A;  9ICG A;  1SZH A;  4EBC A;  1PQS A;  4LNI A;  3WAN A;  1R4M I;  4QWB A;  1VZ7 A;  4TQ0 A;  3D6J A;  1BXT A;  2WXR A;  3U2S C;  2HDO A;  4TUR A;  4BGD A;  3C28 A;  5CX3 A;  3TEW A;  5G5G A;  2JRZ A;  4KZC A;  2WXL A;  3MR2 A;  4R65 A;  2EZZ A;  4NNJ B;  1L4D B;  4YD1 A;  3E9S A;  3RAX A;  2NRZ A;  3KOO A;  1T3Q A;  5C23 A;  1UNS A;  1NJX A;  5KFL A;  2K8C A;  2IPK D;  1HUO A;  4AOF A;  4ED8 A;  3JPS A;  3W1S C;  3RCZ A;  2AL3 A;  2BQU A;  2XN9 C;  4YL8 A;  2ZTC A;  4YSX B;  1S8O A;  2PVO D;  5AM5 A;  2WF5 A;  4KLS A;  2K0P A;  1ZD2 P;  1KRH A;  4KN4 A;  2ZNV C;  2O2V B;  3RNA C;  1CQV A;  5J0W A;  4RNN A;  3HWT A;  3IG8 A;  1WX9 A;  3ORY A;  4IS7 A;  7ICV A;  2CRX A;  1UGM A;  2DX5 B;  2MRP A;  2WX1 A;  5EWE A;  1ZQP A;  2K3U A;  3WKD A;  1MPE A;  5T8I A;  1QOA A;  2B3A A;  4ECX A;  3P1M A;  3ZIM A;  4PHP A;  2MJE A;  3SAH A;  3F2C A;  1V81 A;  2BWF A;  2M56 B;  1NYQ A;  2JXT A;  4Q8E A;  2N1V A;  5KFT A;  4KLT A;  4F7Z A;  4F91 B;  3GV8 B;  3NZS A;  4ELU A;  4E3C A;  3IP4 B;  2RRD A;  2HD5 B;  4YTP B;  4UAW A;  2C60 A;  4G9B A;  3QX7 A;  3OAW A;  1WSP A;  3BS7 A;  8ICX A;  3UF8 A;  2JX5 A;  2E8O A;  1ZQJ A;  4ICA A;  1ENF A;  9ICW A;  4K3B A;  1FCL A;  4BAX A;  2DGZ A;  4B9U A;  2MH7 A;  3P63 A;  4DHZ B;  1ZD4 A;  4YR2 A;  3UXN A;  2NS5 A;  2EMS A;  5JHA A;  1UPH A;  1TZ1 A;  4QZG A;  1E9M A;  8ICM A;  1NBF C;  5IIM A;  3RZW C;  4GU2 A;  1HTO A;  2IOF A;  2ZUD A;  2WTF A;  7ICS A;  1TJE A;  4WAA A;  4I2J A;  4DSK A;  5LNK 1;  2D3B A;  3AMZ A;  4KMU A;  3IAM 1;  3U8Z A;  4KLQ A;  2NO4 A;  2KG5 A;  5BYR A;  4RU9 A;  4TQS A;  4NJC A;  3AE1 B;  4A6Q A;  5I4D A;  4ED1 A;  5TZV A;  3A4S C;  4AP4 C;  1XWL A;  4RNM A;  4F2S A;  3VAW A;  4C8N A;  4BXO B;  1T0S C;  3NHE B;  2GLE A;  4TV3 A;  3V3X A;  3WAO A;  3WCQ A;  1XLO A;  3PV8 A;  4DCC A;  1C3T A;  5B66 U;  1I4G A;  1EWC A;  1WM2 A;  2RR9 A;  9ICP A;  2WX0 A;  3QUT A;  2AEH A;  3AU6 A;  3ICX A;  1V5T A;  5L1M A;  1J7B A;  5DDY A;  1X9W A;  1KJT A;  1T0Q C;  1WJU A;  3ZXR A;  5FR3 A;  5DPW A;  4Z6C A;  2BF8 B;  1HE8 A;  5J8Y C;  2BYT A;  4KDI C;  2IBK A;  4PJ0 U;  2KLC A;  4O1N A;  3BS5 B;  2WS3 B;  3VCB A;  3N20 C;  4BKG A;  4F5Q A;  2WDQ B;  2XVT A;  4M00 A;  1QQ5 A;  2WDT B;  3PO5 A;  3A0H U;  1WGG A;  2H3Q A;  3AEB B;  1K50 A;  2UVW A;  1V8C A;  3R9K A;  4B6J A;  3CNH A;  2KN5 A;  5JH5 C;  1XO3 A;  2ONQ A;  2ZG6 A;  4RGN A;  3W2D A;  2HBJ A;  4Q43 A;  1FRD A;  2BB6 A;  4O3M A;  1OQQ A;  2B0C A;  8ICK A;  1XD3 B;  3U7D A;  2GB1 A;  4NL9 A;  4M04 A;  1HZ5 A;  1SKR A;  1FCC C;  3MC0 B;  3VH4 B;  4B9N A;  2OOB B;  1Q3V A;  5AKY A;  1E90 A;  1I4Q A;  4M6W A;  2NRV A;  4Z6E A;  2EAP A;  4ED3 A;  2ZJA A;  4DQQ A;  1TS5 A;  1S0V A;  3KD3 A;  1Z2M A;  2KJ6 A;  4WIP A;  3SV4 A;  2ASD A;  4LJO B;  5G5H A;  5HMM A;  3N1Z C;  4RQ8 A;  3EUB 2;  2QCZ A;  4MF8 A;  3UQ0 A;  2N4F A;  3X23 A;  1BNP A;  3AEE B;  5E6P A;  3U30 A;  3DOW A;  3L17 A;  4GDL A;  1KFS A;  3SAF A;  3WKC A;  4RUA A;  5J2I A;  2KJ5 A;  3VRB B;  1EU3 A;  3LVV A;  5BO4 B;  4TKN A;  3KFU F;  2D2Q A;  1JN3 A;  4DSL A;  5AK5 A;  5HHH A;  2WLB A;  2PLP A;  2MP2 A;  3V6K A;  2QAR A;  3LYS A;  4MEX A;  4OVZ A;  2EKE C;  1OXJ A;  2Z7J A;  1D5X C;  1A70 A;  3TAR A;  2WDV B;  2YQE A;  2KKC A;  3DBL B;  5EWF A;  2L0T A;  2BCS A;  4RPZ A;  2WXP A;  3RFA A;  2WXF A;  2N0S B;  4KLH A;  3ZDB A;  3KBB A;  3Q3M C;  3PV1 A;  5B5E U;  2VAN A;  4DOA A;  3RB0 A;  3SAG A;  5MPO A;  3GFK B;  2Y0S C;  1L0V B;  3LWM A;  2Y3A A;  2IY0 B;  1WCN A;  5IIN A;  1PVQ A;  2ZJD A;  4NLC A;  4JK1 A;  3JVZ X;  4UAR A;  3SMV A;  5KFC A;  1R7S A;  2K8B A;  3H6N A;  4KSL C;  3NY5 A;  2K8H A;  1FFU A;  1AW7 A;  3DQV A;  3UGB B;  5FKA C;  2HI0 A;  5KFU A;  5AI5 A;  5IAA C;  4Y2U A;  2XCA A;  4DLG A;  4BOZ B;  1L3V A;  2PFQ A;  4A20 A;  1BGX T;  1MFW A;  3CST A;  3J9C A;  5TR5 A;  2CPR A;  4N9F 4;  5J0O A;  1RFA A;  2DZI A;  2F1J A;  2G45 B;  1TK0 A;  3FM9 A;  4G11 A;  2RDI A;  2KDE B;  2A19 A;  4HJG E;  3FC4 A;  5J2J A;  2A1J B;  1YZ7 A;  2GWS A;  3UXP A;  4DFM A;  1BPB A;  2K60 A;  2KTR A;  4R63 A;  2JH7 A;  4FLH A;  1TE2 A;  3PHW B;  4XWT A;  2MBB B;  2VH2 A;  5AEK B;  1Z1V A;  3CSF A;  1I4X A;  1NKC A;  4BFR A;  4FHJ A;  1YJJ A;  1YX6 B;  2MJD A;  1KH0 A;  2AJQ A;  4R3D A;  2PMV A;  1L3T A;  4IOI E;  1O03 A;  3RAQ A;  1WIA A;  3AV8 A;  4OZB A;  1VJ5 A;  4UBC A;  3KZX A;  3DBS A;  4FUL A;  1ACC A;  2WWZ A;  1S3S G;  4BX9 C;  3O0F A;  2XY6 A;  4DL7 A;  8ICW A;  1H4R A;  4TQ1 A;  2EAM A;  2IO1 B;  3KZI U;  2C2R A;  2G0A A;  2Y5C A;  4G3X B;  2B6G A;  1L6N A;  4TMA B;  4P4O A;  3A1Q B;  4BDP A;  4M9N A;  4MHV A;  3BQ2 A;  5ALO A;  1TAU A;  2VZK D;  4LVS A;  5KT7 A;  1Q10 A;  2DPI A;  5HKH A;  4GDK B;  2KVS A;  3HKZ F;  1B1Z A;  2LWP A;  2MBE A;  4II3 B;  3QXG A;  2W9C B;  2QEJ C;  2WXN A;  3PZ7 A;  2D07 B;  4F5O A;  3WKB A;  3WAM A;  3HW8 A;  4CE6 A;  4ZYS A;  3RMK C;  2CHZ A;  4CDG A;  4QZA A;  1BPX A;  4FJV B;  4IDI A;  4GN1 A;  4WJO A;  1OEY A;  4MGY E;  1WE6 A;  4YMN A;  4DFJ A;  1PK1 A;  4M01 A;  1LKY A;  4ZDV A;  2EDU A;  2A1A A;  4NLZ A;  4ICV A;  3H8H A;  1P7E A;  3Q8B A;  3JPQ A;  3F2B A;  1AYF A;  5J2G A;  1GC6 A;  2OEH A;  2INP E;  3EFC A;  2BKE A;  4LDT D;  3ZGZ A;  1WZ3 A;  5ALM A;  3BK2 A;  1S0M A;  3RJH A;  1NK4 A;  1FNV A;  3M63 B;  1MC8 A;  8ICA A;  1V6E A;  2KN4 A;  3OGU A;  4IWP A;  2WXJ A;  2NBU A;  3N30 A;  3RYT A;  1UUP A;  1UD7 A;  1FO4 A;  1ZXH A;  5J2R A;  2W3S A;  4C4R A;  1LB2 B;  4AYB C;  1ZPS A;  4PL1 A;  3PS6 A;  3PX6 A;  2QKQ A;  3RRH A;  3PW7 A;  3OJU A;  5D3I B;  2HHT A;  4UB1 A;  9ICX A;  3I28 A;  3BQ0 A;  5HFY A;  5L1K A;  1WXM A;  1SV0 A;  9ICE A;  3RNB C;  3V6E B;  4B0E A;  2ZW1 A;  1S0O A;  2JY6 A;  2Z59 B;  2ZXH A;  5BPC A;  3AQE A;  4ED0 A;  4J9N A;  1VZ8 A;  2FCS A;  1EF5 A;  2GBN A;  3UMB A;  2NRX A;  3EYZ A;  2VH1 A;  3DBH B;  3V6C B;  4ELV A;  4ARI A;  4GC7 A;  1Z00 A;  1SE9 A;  4NAW B;  2BTE A;  2ICI A;  4GXB A;  1TKY A;  4MGI E;  5ALN A;  2AX5 A;  2KXJ A;  4MDK E;  1MA7 A;  3MC9 A;  4HEA 1;  3ZDM C;  4O0I A;  1GAQ B;  3R66 C;  3ALR A;  1LM8 B;  3N32 A;  2YTU A;  4PK1 A;  2OWO A;  2C28 A;  5F9N A;  3D2N A;  2NBV B;  3U26 A;  3EW9 A;  1ZRM A;  4UW9 A;  1ZOL A;  3W1S A;  2GOL A;  4NLB A;  3AQF A;  4K4H A;  2WXG A;  3TEY A;  5KFZ A;  4ECY A;  5C2T B;  2RLT A;  4NLN A;  3DWM A;  3ML8 A;  3TAC B;  1XSP A;  3T79 A;  2QSD A;  2BHN A;  3SR6 A;  4KLM A;  4UAY A;  5ALQ A;  2G5H B;  4LZG A;  2KZM A;  3DBR I;  4AJY B;  1EF1 A;  1COK A;  1VDV A;  2O6K A;  1E7P B;  3RTV A;  9ICT A;  4KZ0 A;  1QQ6 A;  2GOW A;  2LM1 A;  2D3D A;  2VZK B;  1FRR A;  4C8O A;  2CU1 A;  3G6Y A;  3KUD B;  4I2H A;  2Y0S F;  4HKZ E;  4NZL B;  2JV3 A;  2LVP A;  3V05 A;  2HOF A;  4GIV A;  1GUA B;  5IA7 A;  2EMT A;  1NK0 A;  1CK1 A;  3MR5 A;  3UMC A;  2A3V A;  3RNC C;  4GSW A;  2F2A B;  4IUM B;  1PGB A;  3N7S C;  2NRT A;  2ZIX B;  4WQM A;  4J3O D;  4KX6 B;  5IIO A;  3MC1 A;  1KTQ A;  1RFK A;  2UU7 A;  3TBL D;  3HM6 X;  2LGD A;  2TSS A;  2ZIV B;  1D5M C;  3SFE B;  4P4M A;  4YP3 A;  2JZB B;  3PVX A;  2G08 A;  2KV2 A;  4YXM A;  4DQP A;  4M9H A;  1F9J A;  2M19 A;  2QB0 B;  1KBU A;  3C5F A;  4KLJ A;  1X66 A;  4TUP A;  1Z19 A;  2KWV B;  2LHD A;  3KHH A;  4F2R A;  5IO9 A;  2DQN B;  2LXA A;  2KQ7 A;  2HDE A;  3JPP A;  3RR8 A;  2WFA A;  3VTV A;  1ZQ1 C;  1ZQL A;  3RNF C;  4NJ6 A;  2GBJ A;  3GII A;  1WFY A;  1WG8 A;  2XI9 A;  4DXA B;  1SWW A;  2GO7 A;  4MFA A;  4XE0 A;  5E79 U;  4BVU C;  2RSU A;  2K6Q A;  3PHX B;  1FPY A;  2L0F A;  3KTQ A;  7ICU A;  3O65 B;  1GPX A;  3M3J A;  4DS5 A;  3MGI A;  2ASQ A;  2L05 A;  3Q6B A;  1N48 A;  1T0R C;  4MAC A;  3AI5 A;  1TFR A;  4BJQ A;  2PKO A;  8ICY A;  1N6Z A;  3MC8 A;  4WJP A;  5CRX A;  3KUZ A;  1R4N B;  1RQN A;  5KT5 A;  1Z4O A;  2JXX A;  1RYR A;  2HOQ A;  3A9J B;  5KG5 A;  2FLN A;  4FN2 A;  4RPX A;  4DLE A;  2RPQ A;  5AM4 A;  3RJI A;  4ZH4 A;  5KTQ A;  3APD A;  4LCD E;  2HTM E;  4JPS A;  1FD6 A;  3K9P B;  3JPN A;  1SB3 C;  5DB6 A;  3JPR A;  2KD1 A;  4DL5 A;  4BXO A;  1K1Q A;  4DDI D;  2EKI A;  3URY A;  5J2H A;  1FXT B;  3MGH A;  3VVW B;  1BVS A;  5J17 A;  3RRG A;  3RJG A;  8ICC A;  3JSV A;  3RBE A;  1QQR A;  1L6U A;  1X1M A;  4Y2X A;  5IIK A;  3H9D A;  1WYW B;  3H4D A;  4US8 A;  5ALG A;  2PEA A;  3QE9 Y;  2FID A;  4HXD A;  3VUX A;  4ZRJ A;  4JWN A;  3BZC A;  1U4B A;  3KVF B;  2AQ4 A;  4NY8 A;  3AEF B;  3FKY A;  4GLS C;  5AKH A;  3V72 A;  4I6L B;  1Z00 B;  4N59 A;  1JXE A;  1AWD A;  2YY6 A;  1HJP A;  5ALS A;  1J8C A;  1UA0 A;  5FK9 C;  7ICR A;  8ICT A;  1C7Y A;  4ACF A;  4O3P A;  3T9L A;  4EZL A;  2R61 A;  3M95 A;  1MHX A;  4TUQ A;  4C56 C;  4CYE A;  4CRX A;  1KFT A;  1NI3 A;  1EUV B;  3I5J C;  1P98 A;  1S97 A;  3BII D;  2G4S A;  4NXZ A;  2BQR A;  1YD8 U;  2LUM A;  1PUT A;  4MJS B;  3BWU D;  1FM0 D;  3ONS A;  2E8N A;  1BPZ A;  1OQR A;  4LK0 M;  2HSZ A;  4IM3 A;  3W5V B;  3ZUN A;  2W9B B;  3N9Y C;  4K7S A;  1WRD B;  1V9P A;  2YX8 A;  2DKZ A;  4NAW A;  2KJ9 A;  2G07 A;  1KLN A;  2F76 X;  3TMP B;  2D10 A;  4TSS A;  2BGW A;  5AKI A;  3QYP A;  2G4D B;  5KFG A;  2M4N A;  3HP6 A;  2BS4 B;  1E7U A;  4FJZ A;  2IYD B;  1PVP A;  1E8Z A;  2HW3 A;  1C4P A;  1S77 D;  4P0Q A;  4KIK A;  4M9L A;  1WGK A;  2QJL A;  3VUY A;  1QTM A;  3FIL B;  4HCP B;  2K5P A;  1PDX A;  1ZXI A;  4DL6 A;  3E2E A;  1IUE A;  1IIP A;  4OW0 A;  3BDP A;  4ASW C;  1ED1 A;  1FNU A;  2DPJ A;  1XO0 A;  3LVW A;  3RZF A;  4DHZ E;  4Q44 A;  4M02 A;  4J9K A;  5HHD G;  3T5K A;  4HKQ A;  3PRM B;  2ATL A;  2V9H A;  3ZJT A;  3B08 A;  3GB1 A;  4LTU A;  1TS2 A;  3ZDD A;  3PRE A;  3IHP C;  4A3O A;  5C5J A;  4FBU A;  3HRD D;  2JVC A;  4KSK C;  1TIF A;  3T3N A;  1IXR A;  4ANU A;  1U49 A;  2G9H D;  2GI9 A;  4KGR A;  5J2E A;  4RH6 A;  2XNA C;  1E8X A;  2P6U A;  2I9G A;  1ZQU A;  5J0S A;  1Z5S B;  2W9M A;  1MG8 A;  2NV3 A;  1H38 A;  4XGA B;  4QIW C;  3PMN A;  1NEN B;  9ICQ A;  4GIB A;  2EH9 A;  2KDB A;  3IHQ B;  4UAT A;  1V86 A;  1L3S A;  1RYJ A;  1JRP A;  2RDG A;  4FE3 A;  3MP9 A;  2IOF K;  3GV7 B;  1E8Y A;  1Y8R C;  4CGZ A;  2MBQ A;  3U4E G;  2CU3 A;  4KLF A;  1ZQE A;  4G50 A;  2ZPY A;  3ABV B;  2QC8 A;  3P4R B;  3LXF A;  4OD0 A;  4KN7 A;  1ZYQ A;  4ANW A;  1X9S A;  4U7C A;  2JH1 A;  3QA8 A;  1L5U A;  2H89 B;  3D2S A;  4JQW C;  4IM2 A;  1SBB B;  3JW0 X;  1K52 A;  4FXC A;  2NTS A;  4P1C C;  1WR6 E;  3Q8C A;  1NK6 A;  1C4C A;  1U48 A;  2JHD A;  2R8K A;  4KLI A;  3NS8 A;  4YQW A;  2H3F A;  5CHG A;  2WU2 B;  4I6P A;  2OM6 A;  3A9K B;  4Y2Y A;  4J9R A;  4XUS A;  3SEI A;  1D8L A;  3ENE A;  2INN E;  3V7L A;  3RUL A;  2ZZP B;  2WXK A;  3V7J A;  3K9O B;  2ALZ A;  3EA6 A;  1ZD3 A;  3WAL A;  5AM2 A;  3TKA A;  1TGZ B;  2MU2 A;  2KVR A;  4B9L A;  5DLF A;  5BMH A;  1E8W A;  4JV2 A;  1UA1 A;  1PUZ A;  1ZUD 2;  3VUW A;  3ZQ4 A;  2BS3 B;  4W9G A;  5AKE A;  4DBG A;  4OZC A;  4PS8 A;  4FZM A;  3EGR A;  4PS3 A;  2AHO B;  3K1Z A;  3HJE A;  1LQB A;  3OJ4 B;  3Q8S B;  3MAB A;  9ICJ A;  2KT7 A;  3RB3 A;  1FMA D;  3K75 D;  1MHH E;  4DOB A;  2LM4 A;  5L95 C;  3L5K A;  2K1F A;  2FPK A;  4MFF A;  2ZIV A;  4Q8F A;  4FBJ B;  2JEJ A;  4AP9 A;  3RJK A;  2R18 A;  2MBO A;  3ZDT A;  1QOF A;  2PXI A;  2PJH A;  1X40 A;  2KWD A;  3UQ2 A;  2JPH A;  2HBL A;  1PZN A;  3NS1 A;  3UM9 A;  3L08 A;  1B9R A;  3HX0 A;  3GV5 B;  3N1Y C;  1ZW7 A;  4IC7 B;  4QZB A;  1N5W A;  3QU7 A;  2MX2 A;  5AK4 A;  5CJ7 A;  3OSP A;  1P1A A;  5D3D A;  2OCE A;  4UB4 A;  3Q3J A;  1DRG A;  1LKY B;  2BT6 A;  3L54 A;  3UI3 A;  1WJ6 A;  1KEJ A;  1ZQN A;  3B0A A;  4AUQ C;  2ZJ5 A;  2BDP A;  2QIE B;  2KC1 A;  3ZDA A;  4YT0 B;  1LO5 D;  2J0M A;  3K4G A;  1MJD A;  4B0M A;  3FYH A;  5KNI A;  4J9O A;  3RR7 A;  1HQR D;  1Q1O A;  1QOB A;  2LGI A;  4F4X A;  4BOS C;  3NRW A;  4HDQ A;  4NWI A;  3V6H A;  2JZP A;  4PZO A;  2KOX A;  2FPM A;  4DXF A;  1OFF A;  5AIA A;  5JU5 A;  3R2I A;  1SXT A;  1WMH A;  1CUK A;  1XLN A;  4XX5 A;  1FIQ A;  2IMW P;  2ZIU B;  3F5E A;  2YMQ A;  4EE2 A;  4RNA A;  4HRO A;  2SEB D;  4YXD B;  2K39 A;  2KX0 A;  4P6V F;  2XEW A;  3X0W A;  4HWI B;  2I2Y A;  3RN9 C;  9ICB A;  4A55 A;  2HBK A;  2R2O A;  4PHA A;  1M4V A;  4I2E A;  3I63 C;  4ZRQ A;  4RMA A;  4GXI A;  1N62 A;  3V7K A;  2DLB A;  4QWA A;  3RH6 A;  3R8B A;  3RBD A;  2F3N A;  4BBN C;  3HIL A;  3BQ1 A;  1NI2 A;  5KT3 A;  1K1S A;  7ICL A;  4UDU C;  1T7P A;  2LI5 A;  2IJ0 A;  4YMO A;  3THV A;  1V1P B;  3KYD D;  4TQR A;  4WWN A;  4IR9 A;  3H4B A;  3KW5 B;  2ASJ A;  1ZQK A;  1NYR A;  1SZP A;  5AZG A;  4UB6 U;  8ICH A;  2NTT A;  3JYU A;  3DDH A;  4RQ6 A;  4DSJ A;  3BVZ A;  2V1Y A;  4ZRP A;  1ZP0 B;  4I2I A;  5LXH A;  1SE4 A;  4W9I A;  4BUG A;  2AQ1 B;  4MEL A;  3HT3 A;  1TVA A;  3AE5 B;  4Z6F A;  4IWQ A;  3GZN I;  1V5O A;  3VTW A;  3GZF A;  4LDT B;  1QCK A;  4HRS A;  4YG2 A;  2KHV A;  3WU2 U;  2E8M A;  1YQ3 B;  2KN7 A;  3LK9 A;  5J8Y A;  4UB8 U;  5CP2 A;  4NM1 A;  8ICS A;  2JZZ A;  2SAK A;  2LYA A;  4WQO B;  8ICJ A;  1T0Y A;  4JV1 A;  2KJ8 A;  2WDR B;  2CXY A;  1UZX B;  4K7W A;  2ISP A;  1BPE A;  4QWE A;  4IRK A;  1WXS A;  3C8Y A;  4NM2 A;  1WI0 A;  5ALX A;  1EU4 A;  3RB4 A;  3VHT C;  2W82 A;  1MN8 A;  1MSW D;  3R2T A;  3QQ8 B;  4WJN A;  1K53 A;  4M47 A;  1XQQ A;  2NR2 A;  3ONN A;  3SDL C;  2W9C A;  2C2D A;  4NV0 A;  3RF9 A;  2L32 A;  2M0A A;  2CN1 A;  4JL9 A;  5HR6 A;  5DPR A;  2IHN A;  2MA9 B;  1QSY A;  1VCB A;  5KFE A;  1QLN A;  3UIO B;  2N9X A;  3QCA A;  3GQC A;  4M2Y A;  3MR6 A;  8ICP A;  3WK8 A;  5D94 A;  2LYB A;  1ZQA A;  5J2A A;  2LHT A;  2KMM A;  3I1Y A;  2IDY A;  2J53 A;  1SL2 A;  2NPT B;  5T14 A;  7ICH A;  1I4P A;  3VC8 A;  1DOX A;  4RQ2 A;  5CB1 A;  2RMM A;  1X9X A;  4I2C A;  8ICR A;  2MAX A;  4DL3 A;  3JSV B;  3DBL I;  1V80 A;  1SEB D;  9ICN A;  1D9F A;  3NOB A;  1G6J A;  5E6N A;  3Q8F A;  2P6R A;  1Z1B A;  4RPY A;  2YEP F;  4W9D A;  4YD2 A;  5J0Y A;  2J0K A;  2LD9 A;  3NRZ A;  2HHW A;  5J0R A;  2GH1 A;  5LXI B;  1K5O A;  4R66 A;  3QAQ A;  3TIX A;  4F92 B;  4A8E A;  3KKA A;  4W9H A;  1SKS A;  2IA6 A;  1FXA A;  9ICL A;  4C8M A;  2J6U A;  1P9D U;  2ZIW A;  4ZYN A;  5DCN A;  2IBI B;  2AGO A;  1EWY C;  2QB1 A;  2Y5B B;  4YVZ A;  4DQS A;  4J9S A;  2PE6 B;  1KOT A;  5KAI U;  1L6V A;  1B22 A;  4DQO C;  2RHF A;  1SL1 A;  4GDL B;  3ETR A;  8ICQ A;  2MUT A;  2WF6 A;  3E56 A;  5ALY A;  2K4H A;  2PIA A;  4MH0 E;  2AL6 A;  1S1Q B;  2NCN A;  3OWE B;  3WK5 A;  1RDF A;  4P0P A;  4KLG A;  4I2A A;  2ZNV B;  3WKA A;  3ZXV A;  4O5C A;  4B6W A;  2WF8 A;  5J2B A;  1JWB D;  5DQH A;  5CHV C;  4CCH A;  2A1J A;  5BYS A;  3LYY A;  3IBE A;  5DLG A;  1WF9 A;  2BW2 A;  4EZJ A;  1ZQS A;  2JUO A;  3DHG C;  1ZQM A;  1RXW A;  4JWU C;  4MT5 A;  2O6V A;  2J0J A;  3H0L B;  4GC6 A;  5C1Z A;  2WYQ A;  5DGB A;  5J0U A;  1KL9 A;  5A0L A;  2V4R A;  3TEX A;  2ZJ8 A;  4EFO A;  1I35 A;  3PSP A;  4O5E A;  4K7U A;  1C79 A;  3HKZ C;  2V3S A;  4P7I A;  5EDS A;  2VRR B;  5CA7 A;  2J6T A;  2K25 A;  3RNG C;  4USA A;  1UWX A;  1XO1 A;  2BPC A;  4EEN A;  1T5X D;  1PK3 A;  3W5U B;  3RH4 A;  2KFN A;  3WK9 A;  1A76 A;  2OXO A;  3GIK A;  2W9B A;  4NLG A;  1CEZ A;  1ZQY A;  1JRU A;  1VZ6 A;  3HVZ A;  1E7V A;  2HE7 A;  2IHM A;  4O3O A;  3C2M A;  2RGF A;  3SQI A;  1L7Y A;  1WJN A;  5J2C A;  1V97 A;  1RRB A;  1TKE A;  2INC C;  5KFO A;  1ZQX A;  3SV3 A;  1L8O A;  2DUY A;  3NUQ A;  7ICI A;  3TCA A;  4G0N B;  5ALJ A;  1YJ1 A;  2PI4 A;  3ALB A;  1QZE A;  4Y2Q A;  1C78 A;  4C7Y A;  2A4Z A;  4FZL A;  5ALD A;  2WXH A;  4PGQ A;  2H5X A;  4GMV A;  5AKX A;  1U9L A;  1TT5 B;  5AM3 A;  2BR0 A;  2L83 A;  3MHS D;  4MSQ B;  4MF2 A;  1ET6 A;  3QZ8 A;  1WUD A;  2WAQ C;  4HVB A;  2EZX A;  2FLP A;  3ZRF A;  3BVG A;  2K9X A;  4YR3 A;  5DB9 A;  2MRL A;  2KK0 A;  1COO A;  1JMS A;  4M9J A;  3Q8A A;  5DPT A;  4EBD A;  1ECW A;  2NO5 A;  3ISC A;  4NY0 A;  1SE2 A;  2OJW A;  8ICV A;  1Z4N A;  3PST A;  3SHQ A;  2XK5 A;  1RM6 C;  3H0M B;  1NVI D;  4CO7 A;  1TV9 A;  2IO2 B;  1ZJN A;  3H7I A;  1UF0 A;  4HYK A;  2KO3 A;  2AGP A;  1ZQI A;  1GOZ A;  4ELT A;  2JRH A;  4ED6 A;  1L2N A;  4EZK A;  3RB6 A;  5GTH U;  2YMM A;  1JWA D;  4YXJ A;  3DHI C;  4RQN A;  1WZ0 A;  5J0T A;  4F1S A;  4P1B C;  4OJP A;  2WGS A;  1GO3 F;  2FAZ A;  3EFU A;  3U7Z A;  2ACZ B;  2JT4 B;  1WGY A;  4RM8 A;  5KG0 A;  1PGA A;  4IM0 A;  3P42 A;  4F4W A;  4RT2 A;  2KHW B;  2J6S A;  4DF4 A;  3QU9 A;  5KFP A;  2JSV X;  2LGS A;  5DPS A;  4B9S A;  1CZP A;  4IR1 A;  4I2B A;  2BQQ A;  2C9W B;  1ZQC A;  3ZD8 A;  4OO1 J;  5AKG A;  1A77 A;  2C5L C;  2F77 X;  4BKS A;  4KLE A;  4QZF A;  2OHF A;  3U52 E;  2HMX A;  4UBB A;  3UPQ A;  2CJN A;  4E71 A;  3BZD B;  3M8S A;  1XLP A;  3H1U A;  2NMQ A;  2W7P A;  4HPP A;  3BQ7 A;  4Q2J A;  3QEA Z;  7ICE A;  1TS3 A;  3TAQ A;  5IKC M;  2C22 A;  4OVV A;  1V1O A;  1SL0 A;  3B0Y A;  1IBX A;  1A6S A;  3N3K B;  2IO3 B;  1JWM D;  4DQR A;  2PVG C;  1Y88 A;  2E3T A;  2DKX A;  3PW2 A;  4UB5 A;  3L0W B;  4HK2 A;  2ODG A;  3ISD A;  5ALV A;  8ICN A;  2WP9 B;  3OSN A;  2KC2 A;  3T5J A;  2O6V D;  3AE9 B;  1V38 A;  4ZOH C;  2BZF A;  1XC9 A;  4K81 A;  4WWM A;  5J0Q A;  1PGX A;  3AUO A;  4PL2 A;  2ZTE A;  9ICO A;  4KLO A;  2FCQ A;  2LMC A;  3AE8 B;  4EEL A;  4EZ6 A;  1WYG A;  4EZ9 A;  4ECT A;  4I2F A;  1F0M A;  2C7M B;  3A1Q A;  1TAM A;  3MDC A;  2DZJ A;  2QAR B;  2CHW A;  5AKL A;  1JWU D;  2FE9 A;  1T8E A;  5KG2 A;  3I76 A;  4UAV A;  5AI4 A;  1FEZ A;  3IVF A;  3SYZ A;  1MQ3 A;  2OJR A;  3TJP A;  3MFI A;  2KSO B;  4EOY A;  2L5Y A;  2UVU A;  3VQI A;  1Q3U A;  4MSM B;  3ZLZ A;  5ALU A;  3BQT A;  2JF5 A;  1X42 A;  4RQ1 A;  3M8R A;  2BPS A;  1IGC A;  4ANX A;  2LXC A;  1NJY A;  4YSZ B;  7ICF A;  3ZI4 A;  1BUI C;  3V61 A;  4PHE A;  3QU2 A;  5DBB A;  2C7H A;  3DVG X;  3KUC B;  4EX6 A;  4ED7 A;  3TI0 A;  2M0N A;  2XIC A;  3ML9 A;  5KFW A;  3N7P D;  2Q4T A;  4LNK A;  1EXN A;  2KVC A;  2YN4 A;  4M6W B;  2XO7 A;  4KLL A;  4IRD A;  1I4R A;  4RQM A;  2DHZ A;  2KZR A;  1HEK A;  1L7P A;  4KTQ A;  3MJW A;  2WF7 A;  4AJW A;  2N7D A;  3RJF A;  3A0B U;  3ZD9 A;  1UBQ A;  3Q8L A;  4KLU A;  4UAU A;  3PX0 A;  1JCK B;  2I1K A;  2KAC A;  3QAR A;  1DOQ A;  1VLB A;  2UVV A;  2BQ3 A;  1N5X A;  1PYW D;  5HP4 A;  8ICF A;  2O2V A;  4WWO A;  3P4S B;  2HCF A;  4DS4 A;  2EQY A;  4P4P A;  1L0X B;  1WX7 A;  1WH3 A;  2BCU A;  2MWS B;  3ZNG C;  3NVY A;  2F1I A;  1ZQB A;  3A9J A;  2ES6 A;  2KTR B;  1RYU A;  3WK4 A;  3PR5 B;  2PI5 A;  3Q8Q B;  2BKF A;  2ZVO A;  4W9F A;  3VRA B;  1L4Z B;  3WA0 A;  2MA1 A;  2WQY B;  4ECQ A;  5AHX A;  3GE8 C;  1KDH A;  4DL2 A;  2M9N A;  3FIL A;  5JZE B;  5GMV A;  4U6P A;  2LRW A;  2HOI A;  2KWC A;  2JZB A;  2BPG A;  3W1Y A;  4HJK A;  3Q8E A;  4A8X C;  2Z8L A;  2EAN A;  3OLM D;  4GOC A;  4O3R A;  4QAY A;  1DYQ A;  4DWF A;  2BS2 B;  2BCV A;  1QOG A;  1XSL A;  3Q8K A;  2OH2 A;  3AE4 B;  5KL8 B;  1H8C A;  1ZOY B;  3ZRC A;  1TAQ A;  9ICH A;  2MP2 B;  1UQV A;  4FZN A;  5H8Y E;  4WAF A;  2ZUC A;  1X6J A;  1NK9 A;  1LXD A;  4MM3 B;  1DOY A;  1ZD5 A;  2BWE S;  4IL6 U;  4XQ8 A;  1YOV B;  2LFI A;  1UGJ A;  3PSE B;  3GDX A;  2DAF A;  3AH7 A;  1S9F A;  1BPY A;  4S0R A;  3RFZ B;  2VA8 A;  2WB1 C;  2RDH A;  2VA3 A;  4B9T A;  1YQ4 B;  4KKI A;  1TY2 A;  1Z3E B;  3IT4 B;  4KMO B;  4GXK A;  2MUT B;  1AN8 A;  4DFK A;  1URJ A;  3C29 A;  2M17 A;  1WY8 A;  4J9M A;  1P0R A;  3B2F A;  1F52 A;  3N7R C;  3UQB A;  1GB1 A;  3H0R B;  5KHQ A;  1ZJM A;  2V4Q A;  4QZI A;  3HPO A;  5AKK A;  2ZIW B;  3VXW A;  3L4P A;  3TAP A;  1S10 A;  2PKE A;  2BYV E;  2LEK A;  3PW4 A;  2I1J A;  2ZVN A;  3PZD A;  2GMI C;  4YFK A;  5KG3 A;  2W3R A;  1TKG A;  1KRP A;  4C4V B;  1IPG A;  9ICC A;  1DGJ A;  4EEY A;  1DXS A;  2HJ1 A;  2KD0 A;  2PMZ C;  4EEK A;  3DEE A;  1KF6 B;  1A5R A;  1ZQD A;  1K51 A;  3T8M A;  3QZ7 A;  2UWQ A;  1CRX A;  5KHO A;  4DHJ B;  2R8H A;  3DPD A;  1SSN A;  1CI4 A;  2N1R A;  5EOZ A;  3RUI B;  9ICK A;  4FO6 A;  1D3Z A;  3AB5 A;  3M62 B;  2IGD A;  1QKZ A;  4KGS A;  5BMI A;  4EUT A;  4KLD A;  1UBI A;  4X57 B;  5DQI A;  4DSE A;  5AZF A;  1UH6 A;  5KFN A;  2WXO A;  4JWM A;  4US9 A;  1TTN A;  3RJE A;  3T5H A;  1YNT E;  2I1Q A;  4UAZ A;  3NGD A;  3FDS A;  3UXO A;  4DSI A;  4IQU A;  4P0Q B;  5AUI A;  2H3I A;  2N7E A;  3TQ1 A;  4M9G A;  3I57 A;  2XC9 A;  2KAN A;  7ICM A;  2JRI B;  3DHH C;  4NAM A;  5BYQ A;  5ALI A;  5III A;  4W9J A;  1ZQW A;  5KFI A;  7ICK A;  5J0P A;  1ZQG A;  5ALE A;  1NK8 A;  2LHE A;  1C77 A;  1NK5 A;  1RQL A;  1XF5 L;  3C21 A;  4QZ9 A;  3VTU A;  3WIM A;  1U47 A;  1RZT A;  1SE3 A;  1UT5 A;  5JUM A;  2W9A A;  2KFK B;  3GZN B;  3TSS A;  3ZYY X;  3A4R A;  5C3J B;  2L7R A;  4P16 A;  3M9M B;  4FS1 A;  2Q5W D;  2ZUB A;  1SKW A;  1QSS A;  2DF4 B;  3D2Q A;  5L9X A;  2V3N A;  3EZ5 A;  2J52 A;  3V62 A;  4ICU A;  3V60 A;  2BYF A;  4BKT A;  4XA5 A;  5IIL A;  1J2M A;  1YX5 B;  4DFD A;  2MLB A;  9ICR A;  5AI0 A;  1O08 A;  1C4A A;  1NZP A;  1TK8 A;  1KSP A;  2AQ2 B;  3ZDE A;  4FAD A;  1IP9 A;  3PTF C;  2KDI A;  3J81 j;  5D4B A;  1MQ2 A;  1JQ4 A;  4C4V A;  3TUO A;  4LNN A;  4LJX A;  5ALH A;  1XT9 B;  3ZKJ C;  3MDA A;  2N9K A;  1SV4 A;  4MEY A;  4O3S A;  4PPX A;  9ICF A;  4F3O A;  2JMG A;  3BK1 A;  2AWT A;  1YT3 A;  5EE1 A;  4C4S A;  3Q8P B;  1WCL A;  1SJE D;  1QQ7 A;  2ZIU A;  5AZH A;  5J18 A;  1YIW A;  3QC8 B;  2BKR B;  4I27 A;  4NJ7 A;  2JQR B;  2HHS A;  2NBW B;  5IP4 D;  1TZO A;  4YR0 A;  1V2Y A;  3IN5 A;  3AL0 B;  5J0X A;  5GTI U;  1YN5 A;  3GIJ A;  3DVN U;  4ZHP A;  4QZD A;  2YEP B;  2AQ3 B;  5H2F U;  4XDD A;  1SIJ A;  2Z0E B;  1OGW A;  2K22 A;  4MFC A;  2EAO A;  3EPI A;  3PGE A;  4LLG M;  4XYC A;  1FEH A;  2KJH B;  5E6O A;  1F5S A;  4XWW A;  5F9L A;  2JR5 A; 
#chains in the Genus database with same CATH homology
 2KQ4 X;  4OHJ A;  1KTK A;  1ZDX A;  2FE8 A;  3H8H A;  1JML A;  1P7E A;  3PZ8 A;  3Q8B A;  1AYF A;  4WH4 A;  2KMM A;  2INP E;  1QLB B;  2IDY A;  2J53 A;  3ZGZ A;  1JWS D;  3AEC B;  3BK2 A;  1E10 A;  1FNV A;  1I4P A;  2KN4 A;  4DXG A;  2CJO A;  1DOX A;  2WXJ A;  2RMM A;  5EE3 A;  1UUP A;  1FO4 A;  1SEB D;  1L5P A;  1ZXH A;  4RF0 A;  1N63 A;  2W3S A;  1EM7 A;  1ZPS A;  3Q8F A;  2YEP F;  1HEZ E;  5D3I B;  3NRZ A;  1TS4 A;  3LB8 C;  4KGT A;  5HFY A;  4YTN B;  4B0E A;  2ZW1 A;  2PTL A;  5JXV A;  1IBX B;  3ZJV A;  3CIR B;  1FXA A;  4C7Z A;  4YTM B;  2WXI A;  1VZ8 A;  4A90 A;  3MJ5 A;  1EWY C;  2MEK A;  1VR9 A;  4ARI A;  2JYT A;  1KLU D;  1JAL A;  3NUH B;  4NAW B;  2BTE A;  2DBY A;  2ICI A;  1L6V A;  1TKY A;  2AX5 A;  2KDM A;  4DQO C;  4GDL B;  4HEA 1;  1ROE A;  3ETR A;  1GAQ B;  3B9J A;  3HVD A;  3E56 A;  2PIA A;  1MVK A;  1VJK A;  3TEZ A;  3OWE B;  2MJ3 A;  3KQ4 A;  3AM9 A;  2GRI A;  4L2Y A;  3W1S A;  1V1P A;  3VR9 B;  2WXG A;  4C80 A;  1HA5 A;  5BMG A;  3TEY A;  5C2T B;  5HI1 A;  3DWM A;  1JWB D;  4A9A A;  3RPF C;  5BYS A;  3T3O A;  2QSD A;  2L1A A;  3LYY A;  3SR6 A;  3AED B;  2EEL A;  2BW2 A;  4JX1 C;  1FFV A;  3AEG B;  2W54 A;  4AQ7 A;  1DOI A;  4JWU C;  1VDV A;  1E7P B;  1FXI A;  4MT5 A;  1E0Z A;  3MFG A;  2Y5P A;  2VZK B;  1FRR A;  3TEX A;  2H88 B;  2JWU A;  4HKZ E;  1ET9 A;  4NZL B;  1I4H A;  2LJI A;  4M0W A;  3V05 A;  3AN1 A;  1C79 A;  3B2G A;  2FUG 1;  5GXG B;  1CK1 A;  4ITK A;  4USA A;  1PGB A;  1UWX A;  2V3P A;  3GS2 A;  4J3O D;  4WQM A;  1QT9 A;  4KX6 B;  3P4P B;  2KAJ A;  4AS1 A;  1T5X D;  3W5U B;  4OZA A;  1FNW A;  1RFK A;  1VZ6 A;  4RCO A;  3HVZ A;  2TSS A;  1HXY D;  1D5M C;  3SFE B;  3DWG C;  1V97 A;  1TKE A;  4ARC A;  1I7H A;  1PFD A;  1UWM A;  2M19 A;  1QIL A;  2LHD A;  1CJE A;  2QMT A;  2QIL A;  2J4X A;  2IGH A;  1STE A;  1J7A A;  2HDE A;  1C78 A;  2PW9 A;  4C7Y A;  1GB4 A;  5HG2 A;  4D2K A;  2WXH A;  2N9L A;  4RFB A;  3BVM A;  1N60 A;  2L83 A;  3AE7 B;  2WXQ A;  4XE0 A;  1ET6 A;  2N7J A;  3BVG A;  2K9X A;  3IAS 1;  1GPX A;  3Q8A A;  1YN4 A;  3VR8 B;  4MAC A;  1SE2 A;  1D6E C;  2PKO A;  1RM6 C;  1NVI D;  2DYM A;  3IXS A;  4YWG G;  1GOZ A;  2W55 A;  2OED A;  1ZE3 D;  4JPS A;  1F2R I;  1FD6 A;  2HTM E;  1N61 A;  1JWA D;  5E6J A;  3MHZ A;  1SB3 C;  1IGD A;  2IGG A;  1XCQ L;  3NVV A;  1WRI A;  4TQ0 A;  1VZ7 A;  2EKI A;  3URY A;  3AE3 B;  1BXT A;  2ACZ B;  3U7Z A;  1F0Z A;  1NEK B;  2WXR A;  4JE3 B;  3U2S C;  1PGA A;  3P42 A;  3TEW A;  5G5G A;  2JSV X;  1QQR A;  2WXL A;  1CZP A;  1L6U A;  4KKJ A;  4US8 A;  1L4D B;  3E9S A;  4RF1 A;  2OHF A;  3U52 E;  1J7C A;  2CJN A;  3BZD B;  1T3Q A;  1UNS A;  1YN3 A;  3AEF B;  4GLS C;  1XLP A;  4N59 A;  1AWD A;  2IPK D;  1BML C;  2NMQ A;  1JRO A;  5FK9 C;  4Q2J A;  1TS3 A;  2R61 A;  1MHX A;  1V1O A;  4H2A A;  1IBX A;  1KLG D;  2XN9 C;  4C56 C;  4MH8 A;  1JWM D;  1NI3 A;  4YSX B;  1F2R C;  2PVG C;  2PVO D;  2K0P A;  2E3T A;  3BII D;  1KRH A;  2LUM A;  1PUT A;  3BWU D;  2WP9 B;  1FM0 D;  1CQV A;  4REZ A;  5EE9 A;  3AE9 B;  1JW9 D;  4LK0 M;  1OQR A;  4ZOH C;  1XCT L;  4WWM A;  4XDC A;  3W5V B;  3KLS X;  1PGX A;  3N9Y C;  2K3U A;  1MPE A;  5T8I A;  1QOA A;  2LMC A;  3AE8 B;  3P1M A;  1WYG A;  2MJE A;  1XEE A;  4TSS A;  3SFD B;  2M56 B;  3IT6 B;  1JWU D;  1NYQ A;  2JXT A;  2BS4 B;  1RWS A;  2JU6 X;  4YTP B;  1C4P A;  2J42 A;  1WGK A;  4RGT A;  1WSP A;  3VQI A;  2QJL A;  3NVW A;  3FIL B;  2JX5 A;  1ENF A;  2K5P A;  1FCL A;  1D5Z C;  1PDX A;  1ZXI A;  1IGC A;  4L23 A;  1IUE A;  4OW0 A;  4YSZ B;  1YMH E;  2MH7 A;  3P63 A;  1FNU A;  1BUI C;  1ESF A;  5HHD G;  4HKQ A;  3ZJT A;  1E9M A;  1D4B A;  3GB1 A;  4LTU A;  1TS2 A;  1TJE A;  4YSY B;  2BBC A;  3HRD D;  5LNK 1;  3T3N A;  3AMZ A;  1I4R A;  1P7F A;  3IAM 1;  3Q69 A;  2G9H D;  2GI9 A;  4KGR A;  5BYR A;  4RH6 A;  4NJC A;  2XNA C;  3BYT B;  3BYY B;  3AE1 B;  3SEB A;  1JCK B;  4A6Q A;  2KAC A;  5I4D A;  1VLB A;  1N5X A;  1NEN B;  1PYW D;  3P4S B;  3V3X A;  3WCQ A;  1L0X B;  1XLO A;  1RYJ A;  1JRP A;  2RDG A;  4N6E B;  1I4G A;  5D7G A;  3NVY A;  3MP9 A;  1EWC A;  4RGM A;  3U4E G;  3ZJU A;  2CU3 A;  3VRA B;  3P4R B;  3ABV B;  1L4Z B;  1J7B A;  3LXF A;  2WQY B;  2H89 B;  1KFY B;  3NZ3 A;  5FR3 A;  3FIL A;  3NVZ A;  2WU5 B;  1TY0 A;  2BYT A;  1SBB B;  3GP7 A;  2V4I B;  4N58 A;  1K52 A;  4FXC A;  2NTS A;  3W9C B;  4O1N A;  3Q8C A;  2WS3 B;  5EE0 A;  3Q8E A;  4A8X C;  2Z8L A;  1C4C A;  2WDQ B;  1DYQ A;  2BS2 B;  1QOG A;  2WU2 B;  3AEB B;  1K50 A;  1V8C A;  3AE4 B;  2INN E;  1XO3 A;  2ONQ A;  1ZOY B;  4RGN A;  2WXK A;  3W2D A;  2E6X A;  1FRD A;  2BB6 A;  3EA6 A;  5H8Y E;  2V0G A;  1OQQ A;  2DYO A;  4WAF A;  2GB1 A;  4MM3 B;  1DOY A;  1HZ5 A;  2LFI A;  1FCC C;  3MC0 B;  5BMH A;  1UGJ A;  2ON8 A;  1I4Q A;  1ZUD 2;  3AH7 A;  1TS5 A;  3ZQ4 A;  2BS3 B;  3O13 A;  4OZC A;  1SF0 A;  3RFZ B;  1WWT A;  2RDH A;  3EGR A;  4WIP A;  5G5H A;  1YQ4 B;  4KKI A;  3EUB 2;  1TY2 A;  3IT4 B;  1WXQ A;  3AEE B;  1AN8 A;  1FMA D;  1MHH E;  3VRB B;  1EU3 A;  3AEA B;  3B2F A;  3P4Q B;  1GB1 A;  3I9V 1;  1QOF A;  3L4P A;  2KWD A;  2LEK A;  2WLB A;  5AUK A;  3CWI A;  2PLP A;  2W3R A;  3NS1 A;  1TKG A;  4OVZ A;  1B9R A;  1DGJ A;  1XLQ A;  1N5W A;  1D5X C;  1A70 A;  1KF6 B;  2WDV B;  2WNM A;  4ZHO A;  5D3D A;  1MI0 A;  1K51 A;  2BT6 A;  2DWQ A;  2WXP A;  3UI3 A;  2WXF A;  1SSN A;  2N0S B;  1TYG B;  1ZDV A;  2BB5 A;  2D5G A;  2QIE B;  3AB5 A;  5MPO A;  2RPV A;  4YT0 B;  1LO5 D;  4CQN A;  2IGD A;  1QKZ A;  4KGS A;  4B0M A;  5BMI A;  1L0V B;  2Y3A A;  3PO0 A;  1HQR D;  1QOB A;  2LGI A;  3KWV A;  2JZP A;  1R7S A;  4PT5 A;  4DXF A;  2WXO A;  1OFF A;  1FFU A;  4US9 A;  1AW7 A;  1SXT A;  3R2I A;  1XLN A;  1YNT E;  5FKA C;  1FIQ A;  5AUI A;  4EE2 A;  4RNA A;  4HRO A;  2SEB D;  4YXD B;  3I57 A;  4P6V F;  4RGO S;  1L0Y B;  2G1E A;  4NAM A;  5BYQ A;  2JYE A;  2X38 A;  3J9C A;  4A55 A;  2I2Y A;  1F77 A;  1M4V A;  4ZRQ A;  2LHE A;  1C77 A;  1N62 A;  2DLB A;  1XXG A;  4HJG E;  3AE6 B;  3R8B A;  3FC4 A;  1XF5 L;  1SE3 A;  4UDU C;  1C9F A;  2IJ0 A;  1V1P B;  4WUR A;  3TSS A;  1E6E B;  2B76 B;  4XWT A;  3ZYY X;  1QF6 A;  1I4X A;  5C3J B;  4P16 A;  1NYR A;  1YJI A;  1YJJ A;  2Q5W D;  2V3N A;  2MJD A;  1KH0 A;  2J52 A;  2NTT A;  4R3D A;  1T6B X;  2PMV A;  3AE2 B;  4IOI E;  3BVZ A;  2FBW B;  4ZRP A;  1C4A A;  1ZP0 B;  2AQ2 B;  3AV8 A;  4OZB A;  1SE4 A;  2AQ1 B;  2WXM A;  1ACC A;  3AE5 B;  1JQ4 A;  3TUO A;  3FAH A;  4TQ1 A;  1HZ6 A;  2N9K A;  1SJH D;  3BK1 A;  2Y5C A;  4HRS A;  1YQ3 B;  5EE1 A;  2SAK A;  2L52 A;  5TSS A;  4IKG A;  4TMA B;  1SJE D;  2WDR B;  3HUI A;  2I38 A;  2JQR B;  2VZK D;  1Q10 A;  3C8Y A;  1TZO A;  4GDK B;  1B1Z A;  1EU4 A;  2W82 A;  1YN5 A;  4ZHP A;  3R2T A;  2YEP B;  2AQ3 B;  2QEJ C;  2WXN A;  3PZ7 A;  1K53 A;  1SIJ A;  4XDD A;  4JWS C;  3KWL A;  2K22 A;  5H92 C;  4ZYS A;  4LLG M;  2L32 A;  1FEH A;  2M0A A;  1Y56 A;  1VRA B;  4IDI A;  4XWW A;  4L1B A;  2ZW0 A;  1C76 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...