1N60A

Crystal structure of the cu,mo-co dehydrogenase (codh); cyanide-inactivated form
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
161
structure length
161
Chain Sequence
KAHIELTINGHPVEALVEPRTLLIHFIREQQNLTGAHIGCDTSHCGACTVDLDGMSVKSCTMFAVQANGASITTIEGMAAPDGTLSALQEGFRMMHGLQCGYCTPGMIMRSHRLLQENPSPTEAEIRFGIGGNLCRCTGYQNIVKAIQYAAAKINGVPFEE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Catalysis at a dinuclear [CuSMo(=O)OH] cluster in a CO dehydrogenase resolved at 1.1-A resolution
pubmed doi rcsb
molecule tags Oxidoreductase
molecule keywords Carbon monoxide dehydrogenase small chain
total genus 49
structure length 161
sequence length 161
chains with identical sequence D
ec nomenclature ec 1.2.5.3: Aerobic carbon monoxide dehydrogenase.
pdb deposition date 2002-11-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00111 Fer2 2Fe-2S iron-sulfur cluster binding domain
A PF01799 Fer2_2 [2Fe-2S] binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.120 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 [2Fe-2S]-binding domain 1n60A02
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1n60A01
1RM6C 1JROA 2B76B 1DOIA 2QIEB 2WU5B 4JWUC 3VRAB 5G5HA 1QOFA 1GAQB 3FAHA 2K9XA 1JRPA 1JWBD 2L52A 2OHFA 4ZOHC 1QOGA 2WDQB 2WS3B 3B2FA 1CJEA 1YQ4B 2EKIA 2WLBA 2WU2B 2JX5A 1OQQA 1R7SA 2PIAA 1PUTA 3W9CB 1AYFA 1L6UA 2DBYA 2MH7A 3AEEB 3AECB 3HRDD 1JWAD 1TKYA 2WQYB 4P6VF 1J7AA 3CIRB 1V8CA 3P1MA 2W3RA 1PFDA 1QOBA 1PDXA 2E3TA 3VR8B 5EE3A 1ZOYB 1A70A 3HUIA 4ITKA 1CZPA 2Q5WD 1FM0D 4IDIA 2FBWB 1ZP0B 3EUB2 1FXIA 2ACZB 3AEGB 1WXQA 2Y5CA 4LTUA 5H8YE 1JQ4A 3AEBB 1DGJA 3AEDB 4KX6B 5H92C 1E7PB 1RYJA 2MJEA 1FMAD 1XLQA 3SFDB 2LEKA 2K5PA 3LB8C 2WDVB 4JWSC 2H88B 2BS3B 4YT0B 3ZYYX 1VDVA 1TJEA 1F0ZA 1JW9D 2PKOA 2G1EA 1UWMA 2M19A 1NEKB 1FFUA 1J7CA 2BT6A 5MPOA 3LXFA 2JQRB 3AM9A 1TKEA 2WDRB 3AE6B 2PVOD 1ZXIA 4YTNB 3W5UB 4YTMB 4C7YA 2DWQA 3HVZA 3W5VB 3VRBB 1EWYC 3AEFB 3SR6A 1NYRA 1E0ZA 3VR9B 1T3QA 1FO4A 1NI3A 3AE8B 3AE9B 1RFKA 3AE1B 3AN1A 3PO0A 5EE0A 4US9A 3P63A 5EE9A 1XO3A 5AUKA 1KFYB 2N0SB 1YJJA 4A9AA 1DOYA 1WWTA 2HTME 3AE7B 1L0VB 1VJKA 2W55A 3AE2B 3L4PA 4YSZB 4YXDB 3FC4A 1J7BA 1NVID 1OFFA 2CJOA 1SB3C 4FXCA 1B9RA 1WYGA 2M56B 3B9JA 1TYGB 2L83A 1QOAA 4N58A 4YTPB 1NENB 1SIJA 2MJDA 3B2GA 3NRZA 1QF6A 2AX5A 1N5XA 4YSYB 2W54A 4YSXB 3NVVA 2MJ3A 4WQMA 1QLBB 1GPXA 3NVZA 5EE1A 3ETRA 3P4QB 1KF6B 1N63A 3AE5B 1N5WA 3AEAB 1E10A 2BS2B 1E9MA 2W3SA 4ZHOA 3NS1A 1FRRA 3AB5A 3DWMA 3WCQA 1WRIA 1ROEA 1TKGA 4ZHPA 4HROA 1ZUD2 4WWMA 2QJLA 1L6VA 3CWIA 2K22A 5AUIA 2WP9B 5C2TB 4C7ZA 1OQRA 1E6EB 3AV8A 1FIQA 4US8A 2H89B 1FFVA 3SFEB 2BS4B 1NYQA 2KAJA 3AE3B 3P4PB 1FXAA 4JX1C 1V97A 1SF0A 2KMMA 1XLOA 1N61A 1RWSA 1XLPA 2CU3A 4C80A 1FRDA 3BIID 1N62A 1XLNA 3AE4B 1YQ3B 3NVWA 1IUEA 3NVYA 2PVGC 1DOXA 1WGKA 4N6EB 3AMZA 1KRHA 4USAA 1VLBA 1I7HA 3AH7A 2CJNA 3P4RB 5GXGB 3DWGC 5C3JB 3KWLA 1QT9A 3P4SB 1JALA 1YJIA 1L5PA 3ABVB 4N59A 1AWDA 3RPFC 5G5GA 4HRSA 1N60A
chains in the Genus database with same CATH superfamily
5KG2A 1N6ZA 2WU5B 2GLEA 5D6JB 1ZD3A 1SXEA 2LZ6A 1MVKA 3U30A 9ICTA 4NJ6A 1OQQA 2KNBA 3WK9A 1RXVA 3AECB 2L00B 2I1QA 1LGRA 2XCAA 4DWFA 3PX6A 4B6WA 4FFDA 5KNIA 3KHLA 2V3NA 4MJSB 1UWXA 3RNAC 2Y0SC 2E3TA 1I4QA 4ED7A 2LJ5A 1F5SA 4C0ZA 2KOBA 1NK8A 4QZCA 1RLFA 1JQ4A 3KZIU 4LNIA 1WXQA 2ZTDA 2B21A 2GWSA 2WAQC 2PE9A 2E8MA 2PW9A 4AS1A 2NR2A 4TV3A 3AXCA 3ZDAA 4QZFA 1JMLA 2GBMA 3IG3A 4F8CB 2DAJA 3RCZA 1NDDA 1YD8U 2KTRA 3A9JA 1A0PA 4CHKA 5BYSA 1HXYD 4CYEA 2YEPB 4GMVA 2VJ5A 2P6UA 5JHAA 5LXHA 8ICHA 2W9MA 4FA6A 4NLCA 2LM1A 8ICSA 3W5VB 4OZBA 1EWYC 1D3ZA 1WRDB 3CSTA 1KEJA 1NI3A 1J0GA 5KAFU 4F4KA 3C1ZA 4NY0A 3SENA 3LYYA 3QNMA 3TADC 3V6JA 3Q8MA 3QEBZ 4EZJA 1TV9A 2BWES 2I38A 4AJWA 1UPHA 3P63A 5ALNA 1WH3A 2IYDB 4RQ6A 5J0XA 3PTFC 4N9F4 3MFGA 3OPXA 2WXFA 2L0FA 2QC8A 2REXA 4R8UB 1KFTA 3EFUA 1OFFA 4WH4A 4ZRIA 4E74A 3ONSA 4G9BA 2CN1A 4FN2A 3SI8A 4PHDA 2JXTA 1M4VA 2ESEA 3WALA 4PJ0U 2G5HB 3PW7A 4NLZA 1WUDA 1ZQCA 2FNJB 9ICLA 2ZNVC 2MJ3A 1XD3B 4WQMA 2CHXA 4UB6U 1WYWB 1TZ1A 2AQ3B 4KZCA 5IO9A 1X42A 4J9PA 2MA1A 3WK8A 4O5KA 2PI5A 2K22A 1ZQXA 3RJGA 4KX5A 3WK7A 2M9NA 3M95A 3M62B 1OXJA 2E6XA 3RULA 3U7DA 3L16A 4IWPA 3QUCA 2ZVNA 3DHHC 3OLMD 4NLNA 1SXTA 4K1RB 4PGQA 2PFNA 4YWGG 5KL8B 1ZE3D 9ICRA 2JF5A 4JMUA 2G4SA 3NGDA 2KEYA 2JV3A 1KRHA 2OCEA 3U7ZA 3DWGC 2K8CB 4FADA 1NJWA 1T4GA 3KWLA 3BZCA 3QX7A 2LVOA 2PKEA 4C4SA 2WB1C 2QIEB 1WX9A 2G07A 5HR6A 4QZGA 2D11A 1C4CA 5EWEA 1YQBA 2KKVA 3NHEB 1ZD2P 2RDHA 4KDLB 3F2DA 2P35A 3QARA 2BKRB 3L10B 3PSIA 3X0WA 4DDGD 3VAWA 1J7AA 2C7MB 4YXMA 1T7PA 3RT3B 4DXFA 2IBIB 1K1QA 4R64A 1STEA 4ICUA 4ITKA 1IGCA 2FBWB 3CRXA 4ICAA 3I63C 4LTUA 5E79U 5J0UA 5G55A 2BTEA 3I28A 1S3SG 3RN9C 2KZRA 2D6FC 2ZZPB 5L1JA 2WXLA 4RGTA 3KQ4A 4MT5A 5ALEA 3SFDB 2WAQF 2ICIA 2PFQA 8ICZA 4YT0B 4OJOA 4ELTA 2WXKA 2LGYA 4MJSA 2ZUBA 1ZQDA 3M63B 4M00A 4X57B 4FZLA 2KSOB 2HDEA 5AM0A 1J7CA 2O2VA 1TKEA 4KVGB 5J0WA 2LHDA 3BINA 2IGDA 3GDXA 4M0AA 9ICBA 4Y2YA 5IIKA 3UQ0A 1GG3A 1I42A 4QWDA 5T14A 1NI2A 2CXYA 4QWCA 4TUSA 1L7MA 2H5XA 8ICRA 2LGXA 3BQ2A 2C22A 1ACCA 4J9QA 5L9XA 3QK0A 2W55A 2N1RA 2G09A 1O03A 4PS7A 2G08A 9ICKA 2Y5PA 3W1YA 1SV0C 3NZSA 1MQ3A 4Y2JA 3VHTC 4PGYA 3PZPA 3D6JA 1NK5A 2QB0A 2FMQA 3NVVA 3K1RB 2LFIA 2G9HD 2F3NA 3GIIA 1EXNA 3GV8B 5ALIA 3AE5B 3P4QB 1N5WA 4DSJA 2BS2B 1XNSA 3RJJA 1H8CA 1VZ7A 2CR5A 9ICFA 2VA2A 3PT2B 5FR3A 2KDEB 2EAPA 3SEIA 4QZ9A 5L83A 1LB2B 2RDBC 5BMIA 2YMMA 4NLKA 4W9EA 4FBUA 4BKSA 4PS8A 1E5WA 1L4ZB 2FMPA 4W9HA 3APCA 4JE3B 4DSEA 4TSSA 2KVRA 1N2XA 3RTVA 3WKCA 1V1OA 4UBCA 1S76D 3Q8RB 1DK2A 4HCNB 9ICGA 1DOXA 3JPTA 4N6EB 4AYBF 2A5UA 3OTQA 2P66A 3BQTA 4KLEA 2FAZA 3DVGX 5J17A 5ALKA 2CJNA 3W1SA 1SL1A 2K89A 1WX7A 4XUSA 5G2NA 3WK6A 4QZDA 2DYOA 8ICEA 2N0SB 2KDBA 1ZQPA 3EFCA 4TKNA 1JROA 2HSZA 2JY6A 4HJGE 1IBXB 4ANUA 1HJPA 4EYIB 3KWVA 4Y2RA 2IGHA 2BB5A 3BWUD 3DOWA 1ZQ1C 2OJRA 1XC9A 4W9CA 5KFKA 4P16A 1JWAD 3FYHA 1T0RC 3ZKJC 4HYKA 3K75D 4E3CA 4I2JA 4NLBA 7ICLA 1EF1A 3P1MA 5CHFA 1PFDA 2ZEQA 5DPTA 5AKGA 3E9SA 3MR5A 3ZO5B 4ZYSA 2FPKA 4A20A 4UB8U 4W9JA 2YEPF 3ZNGC 4TURA 3H8MA 1R4NI 3K9OB 4MGIE 3AEBB 3Q6BA 4KLGA 2KYWA 5IIIA 3SD5A 3H8WA 3GFKB 5CHGA 2AWTA 2WXMA 3MC9A 4NJ8A 4ELUA 3ENEA 3UXPA 1TJEA 5BO4B 9ICAA 4UAZA 2ODGA 1UWMA 3O13A 5KFTA 1V9PA 1ZQNA 2BKEA 4BFRA 3UIPB 2DLBA 4YTMB 1P3QU 2QMTA 3QU5A 7ICVA 4GIBA 1E0ZA 2HHSA 4K4GA 2F2AB 1FEHA 4ACFA 4RMAA 1QSSA 4DFDA 5IA7A 3EYZA 2EDUA 2RD0A 4DQRA 2KWCA 5AUKA 3IAM1 1ZQRA 1WWTA 5D49A 3AE7B 3FILA 3TEWA 5AM1A 1UA1A 1KQQA 3UXNA 4IS7A 4O3SA 4KLDA 2KOXA 2KSOA 3K9PB 5L1LA 2WHEA 2XVTA 1MQ2A 4FXCA 2IOHA 3C8YA 5KFBA 1V6EA 3ZDBA 2XO7A 4Y2TA 2BQUA 4I6NB 1I4XA 2KKCA 1L2NA 5D7GA 1CEZA 2ZIWB 1Q8KA 3AUOA 2ZIUB 2IJ0A 3PW5A 4BXOB 4YFKA 2Z0DB 4X5VA 2K6QA 1E7VA 5AKEA 2KG5A 4ED1A 4GLXA 1FPYA 5J0SA 3V05A 4M6WB 5KFAA 3UQ2A 3WKBA 2PJHA 3AV8A 3KBBA 3RYTA 1J2NA 1NYQA 4JX1C 4OJ6A 3N4MB 4UB5A 3L0WB 2ZPYA 2ZUDA 1N62A 1TBEA 3ZJUA 4JV0A 1ZQAA 1UBQA 3GQCA 2LI6A 4QIWC 3MC0B 3T79A 5F9NA 5KT5A 3M8SA 4EZKA 2RDJA 4P2HA 8ICFA 4BUGA 2J0MA 2H3QA 4TUUA 5KG3A 2FE8A 4EBDA 4C8OA 1YX6B 4DOBA 4P0PA 1EF5A 3BS7A 3V7JA 5C0YA 2D10A 4LJPB 1B0XA 5J2CA 5J0QA 2OHFA 2F8LA 1I4PA 5IIJA 1JRPA 2M17A 3B2FA 4A6QA 4IQVA 3QHTA 1D4BA 4IQUA 4RUCA 3IXSA 2WU2B 1ZQLA 3A4RA 2N7JA 2WDTB 1BPEA 2PMVA 8ICQA 2ZW0A 2J0KA 1FD6A 2MBHA 1IG6A 2VA3A 9ICWA 4DFJA 1NKBA 5KFPA 4LDTD 1ZQKA 3PNCA 2IHNA 1WF9A 4ECRA 1P7DA 3IN5A 4GXKA 3SMVA 7ICIA 3VH3B 1VCBA 3WAOA 4C4RA 3D32A 1GNUA 4ECYA 2IY1B 2PKOA 3F5EA 4BVUC 3TMPB 2UWQA 1YT3A 4NY8A 4TUPA 5J18A 1ZQTA 4DQQA 3FM9A 1T8EA 4PPXA 2LASA 8ICWA 2PVOD 3ZIMA 2N7DA 2YY6A 1QSYA 4WAFA 1KN5A 4ARIA 2PFPA 4QIWF 1J2MA 4P0PB 2KTQA 3H9DA 3NUHB 2KICA 2HBJA 5B5EU 9ICCA 2HVIA 2IGGA 4AJYB 3PGEA 1GO3F 2JH7A 3RF9A 2BB6A 1T0SC 2R8IA 2IOFA 4YMOA 4ECUA 4ED0A 1F2RC 1S0OA 3FC4A 2NBWB 9ICNA 2LVPA 2NBVB 2M56B 3DHIC 3JSVB 4OZCA 2L83A 2BZFA 4UB4A 2FPMA 3KTQA 1I4RA 3RFZB 1JXEA 3WKEA 2LI5A 9ICMA 1WE7A 2AX5A 2KMDA 3R2TA 1WCNA 3BYYB 2W54A 5DCNA 3VTVA 4K3CA 3OJ3A 3ZDMC 1FRRA 3PS6A 1IM4A 2GBJA 4QJFB 2K8BB 4RNOA 3MFHA 4GC6A 3PLUA 4MGYE 4EBCA 2ASDA 2WX0A 1A5RA 4WWPA 2ASLA 2AJQA 1XLPA 1RWSA 1WGDA 4BWMA 3WK5A 2BQ3A 3RAXA 1QKZA 5E6NA 4TQ0A 4LZDA 2OEDA 1GB4A 4M04A 5AI4A 2V4QA 4F4YA 2NTSA 2WYQA 4Z6EA 4FHJA 3R9KA 4EYHB 4Z6CA 2KLGA 3PRZA 3KW5B 4QZAA 4LZGA 3H1UA 4ASWC 1L5PA 3PRPB 1PZNA 2JPHA 4JLCA 4ECXA 3DPDA 4ZRPA 3EHVA 2K4IA 2LJIA 1L3VA 2WS3B 1TS4A 3KZXA 4XGAB 2ZCCA 1TKDA 1ED1A 4RPZA 3HHMA 4UB2A 3Q8QB 4KLUA 1YOVB 3HW8A 2XCPA 5CP2A 1XSLA 3N30A 3C23A 4ANXA 3W9CB 1TKYA 1TFRA 1Y88A 1PYWD 4RH6A 3ZNHB 3NTUA 2KE7A 4Y2QA 8ICOA 2ONQA 1YIWA 1KOTA 3IDWA 3NS8A 3ZNZB 2QEJC 8ICVA 4MH0E 4EOYA 3D2NA 4C4TA 1VJ5A 2Y0SF 3MHZA 5CHWA 3QC8B 4DL3A 2ACZB 1E8XA 5H8YE 3PR4A 3C5FA 3C5GA 5AHXA 5E6JA 4MF2A 2KFKB 3N1ZC 1ZQOA 2HHTA 3QIJA 2AQ4A 2ZPNA 2V3SA 4RT3A 4EFOA 7ICKA 1CQVA 4A3OA 1TS3A 5HR7A 4XRHA 2EQYA 2J6UA 1ESFA 5FKAC 4RQ1A 1Z1BA 3LXFA 3LWLA 3K4GA 4YXJA 4MEXA 2JXXA 2KQ7A 4WJPA 3B0XA 2DWQA 2R18A 4C7YA 1SL2A 2X8XX 1FCCC 1L6NA 4MELA 4NLGA 4IM0A 4K7WA 4EBEA 1T3QA 2NO5A 3TEXA 5KG7A 2JRIB 5DG9A 2KWDA 4A3PA 3CP8A 5AIBA 2BVCA 3BQ1A 2HJ1A 4KN4A 1T3NA 2JEFA 4NL9A 5IIOA 3AQFA 4YN4A 2HHQA 2KC1A 1T0QC 4F4XA 4IC7B 4C8LA 1KLGD 4JQWC 4LJXA 2L3ZA 4RT2A 5BOLA 4A8XC 2PMZC 4I2AA 5KFNA 1NENB 3H8JA 3KD3A 4GGQA 1XF5L 2YMQA 3DHGC 3A1QB 2QKQA 4KLHA 3H0RB 1K51A 2V9HA 1ZGUB 2ON8A 4UARA 3Q8KA 1N63A 1ZDXA 3AU5A 2MSNA 3F5AA 2DZJA 3IRUA 3ZQ4A 1TIFA 1UNSA 3AULA 4IM3A 2KTFA 2N9EB 2R2QA 1DK3A 4NJ7A 4Z6DA 4C7ZA 4JPSA 3N1YC 1UZXB 3GZNB 3Q14C 2IOFK 4PYZA 1V38A 3X23A 3GIKA 2WXQA 3APFA 5ALSA 2ZUCA 1XU4A 3M9OB 4F71A 3ISCA 1SF0A 4MM3A 4FJVB 4I29A 1L3TA 3HIZA 1YQ3B 3OJ4B 3DEEA 4CE6A 1E8YA 4RU9A 4WJNA 2V9WA 1TGZB 4EELA 3ZUNA 1F52A 3PMNA 2AL3A 3T3OA 4RQ2A 1WGHA 2MW5A 9ICSA 3B08A 3CW2C 3NZ3A 4NL9C 3B1LX 2KWUB 4I2GA 1S77D 1WWUA 3J9CA 1BUIC 2KQ4X 2WXGA 2YVCA 4NQKE 5HI1A 1P1AA 1UHUA 3GIMA 2HVHA 3WAPA 4BOSC 2VH2A 3IT4B 4JWUC 1TK8A 3PX0A 2WF6A 1KDHA 2K9XA 2V4LA 4CO7A 4P4OA 4JWMA 1YQ4B 2IO1B 3WAMA 2JZBA 2KJ5A 5ALQA 3TL5A 2EKIA 3H8HA 2PIAA 5CHVC 1AYFA 1ZQYA 5DB8A 1L6UA 1ZXHA 2N1VA 3UM9A 4P6VF 5DPRA 2HDOA 2JZBB 4ECQA 2D3DA 2HHWA 2D3GA 2DHZA 1Z00A 3VUWA 3PW4A 4DCCA 2AU0A 4MHVA 5TR5A 2YX8A 3QWZB 5AK5A 1I35A 1MPEA 4BXOA 1D5MC 1ZP0B 2J52A 2FE9A 3T5JA 1QZEA 3T9LA 5DBBA 2D2QA 4AQ7A 2XK5A 2DZKA 4DLGA 2DKXA 3ISDA 4F50A 1CRXA 2K5PA 2WDVB 3U8ZA 2YN4A 3MJWA 1VDVA 1HQRD 2OWOA 1JWMD 3PZ8A 4YMNA 1NJZA 1HTOA 3KKAC 3PVXA 1VD2A 3L3FX 3PW0A 4BZAA 3L5KA 2D5GA 1ISNA 3APDA 2W11A 4U7CA 4W9DA 2Z59B 5D3DA 4Q8EA 3O65B 1SKRA 2LUMA 2C7NB 4R65A 3OWEB 2KFNA 1U4BA 2KNJA 5ALGA 4YQWA 1RFKA 5JRTA 3PX4A 2ZIXB 1ZQEA 3V62A 3VUYA 3ISBA 1EU4A 3PV1A 3W2DA 3NASA 3A9KB 1IV8A 2NYVA 5AKJA 1TVAA 4QAYA 1TAUA 4A9AA 4RF0A 4Z6FA 1T5XD 1KSPA 4PYUA 2F1IA 2F44A 1WMHA 1SWWA 4GN1A 2CJOA 3KUDB 2XC9A 1RDFA 3V7LA 3SDLC 4DEZA 3VUXA 5KT2A 5DB9A 2M8SA 3QJZA 1QOAA 2MRPA 4YTPB 4KLIA 4RQ3A 4DSIA 1VRAB 1IIPA 2KN5A 3OHBA 4PT5A 2VH1A 3R3MA 4TQSA 4ZHOA 3HJEA 2WF7A 2KMAA 3AB5A 3HVDA 2XY7A 2PEAA 4AP9A 3AEVA 5JUMA 2HOQA 4RF1A 2KT7A 1LXDA 2BCVA 2J53A 1E6EB 4C4VB 2XI9A 9ICQA 2BQRA 1FIQA 1Q3UA 4OVUA 4RQNA 4QWAA 4IRKA 3R7QA 1LV5A 1RFAA 4OJ5A 3NZUA 4HPPA 3BS5B 2W9CA 5ALXA 1SKWA 1C9FA 2KTRB 3AE4B 2KACA 3BZDB 3NVWA 2CS4A 4AYBC 2ZIUA 2WXIA 1SIFA 2GO7A 4IRCA 1KKXA 2X38A 3NY5A 4KITB 3N7RC 1K52A 4GXJA 5HKHA 1URJA 1I4HA 3SAGA 1JALA 3ZVVA 4XC2A 4IR9A 1XT9B 2VKQA 1DOIA 1WXAA 2FCSA 5E6PA 3QU4A 4Q45A 5DB6A 2AYOB 2NPTA 1CJEA 1YN3A 1ZKHA 4RM8A 4ACOA 4C00A 2QSDA 1JMSA 3IBEA 2V0GA 1V80A 2JX5A 3R2IA 2MH7A 3U4EG 3JPOA 1UT5A 1RRBA 3N7PD 1N56A 4W9FA 5HHDG 4K81A 2EKEC 2PTLA 3RNCC 2W7PA 1ZQWA 2ZTCA 2I2YA 1H38A 1L8OA 2GI9A 3BQ7A 2RDGA 1Z4OA 2JEJA 2HCFA 1I4GA 1FXIA 4RNAA 2Y5CA 4BAXA 4K4IA 2KJ6A 1X9XA 1FEZA 2KHWB 4JWSC 5HP4A 3LWMA 2UVUA 4CGZA 3BVMA 1C4PA 1LO5D 1B22A 4EEYA 4I27A 2RDIA 4BKGA 3PZ7A 1PGBA 5KFIA 1PVRA 2KDFB 3LDAA 2XGQA 4O3QA 3GS2A 3JPPA 3E0FA 4RQ4A 4NM2A 2KJ9A 5KFDA 2WXHA 1CUKA 4I2BA 3M1YA 5BOMA 2G06A 1C7YA 4RM9A 2HD5B 1XO3A 2W9BA 4DHZE 3V6EB 3KHGA 4YL8A 1P9DU 2FUG1 2K60A 2WXPA 4O5EA 3B0AA 1BNOA 3MP9A 1WYGA 2V4IB 5AK4A 3GZNI 4CF3A 4TQ1A 1YJ1A 2HW3A 4XA5A 2A4ZA 1N5XA 5CJ7A 4PZOA 4EX7A 2DL0A 7ICSA 3V72A 3RBEA 1GPXA 2KX3A 5KT3A 1D8BA 1C20A 4IR1A 3AEAB 4NXZA 3RJKA 2BCRA 2JH1A 1FNWA 4OO1J 1WX8A 4KIKA 2K8CA 3DCGA 4ZHPA 4MGKE 4YR2A 1OW5A 3G6YA 2RSUA 1K50A 2E5SA 8ICCA 3CWIA 3PPAA 3BS5A 2KIVA 1P98A 4J6IA 3JPRA 4US8A 1ZQVA 3DV9A 3T5HA 4DXGA 1ECWA 4UB3A 4UATA 3RH4A 2ZG6A 4UASA 3BIID 1PK1B 1JWSD 2ISOA 1UA0A 2KZZA 2BKFA 2CHWA 4E71A 2RRDA 4KKIA 8ICNA 4PZNA 8ICTA 3DVNV 3KYCD 2OH2A 3AH7A 5ALMA 3P4RB 4JWNA 1EWCA 5KFYA 4GSWA 4QNLA 3OGUA 2PPHA 1S5LU 3ORYA 3H40A 5ALPA 2V4RA 4F3OA 2ZJAA 5G5GA 1SJHD 3IM1A 1COOA 3FKYA 1Q3VA 1P0RA 3ZRFA 3JPQA 5JXVA 2JZ3B 1TE2A 3IFWB 5C23A 3ZJVA 3MR3A 2DAFA 4LK0M 1D9DA 2KZMA 4KLLA 4G50A 2DBYA 4KSKC 4YVZA 2R8HA 3M9NB 5DG7A 2ISPA 4J9LA 2H3VA 5TSSA 1U45A 4FO6A 1V86A 2BF8B 4IDIA 2LM4A 2IO2B 2LVQA 1A77A 2Q0ZX 4A8EA 5DDYA 4BKTA 4GC7A 4B0EA 2LD9A 1QQ7A 3GV7B 1Z5SB 4BGDA 1HUOA 3KUCB 3PHWB 3UMBA 2LBOA 2E8OA 3ZGZA 4DDID 2RLTA 1DOQA 1SEBD 4Q2JA 7ICTA 3RB0A 2Y9TA 2O6KA 2I1JA 1ZXIA 7ICPA 4YTNB 1Q5WB 2MHJA 3EC8A 3K1ZA 3VRBB 1J97A 4WJQA 3MR6A 1YN4A 2JZPA 2YLMA 2MEKA 1UQVA 2IZVB 1FNVA 2JGAA 5KFMA 3RNGC 2HTME 3SV3A 1L0VB 4NM1A 3EA6A 3AE2B 1J7BA 1NVID 2W04A 3RD2A 2BYTA 4QW9A 1ZQUA 5CR0A 4N58A 1M6YA 2DQNB 5F3XB 3A9JB 3ZTCA 2LGIA 3URYA 4KZ0A 3MC1A 2AQ0A 2JU6X 4Y2SA 3KVFB 3QAQA 3OSPA 5AM5A 3R66C 2LYAA 1HTQA 2IDYA 2QCZA 2FCNA 4IKGA 2W3SA 5GTHU 4I2IA 3DWMA 3C2KA 2WX1A 1JRUA 4PL1A 4K4HA 1JXLA 1ZUD2 3H0LB 2KMCA 1WSPA 5AKYA 4J9OA 1FFVA 3EW9A 2F1JA 2KD0A 1VZ6A 4O3NA 3ZDEA 4EZLA 4KGTA 4QZIA 4WQOB 5BMHA 3RFAA 3N7SC 1NZBA 1V1PA 4MSMB 2PVGC 2HMXA 4MGZE 1WGKA 4HVBA 7ICOA 3V6CB 3KOOA 3PY8A 4JK1A 2JMGA 2RQ5A 4OCZA 5H2FU 2C60A 3GOEA 3T5LA 2XY6A 1C79A 1JWUD 3QU7A 1COKA 3BVZA 3RPFC 3UXOA 1WM3A 4B6JA 2DZMA 4XWTA 3H0MB 1PVPA 5J2KA 1QOFA 2J7QB 5AZGA 4KLJA 3HILA 3QYPA 4YG2A 4JB3A 4ECZA 4M9HA 1C76A 1WXMA 3TUOA 4ECVA 1AQ6A 1YX5B 4R3DA 1GJZA 1E10A 4KLMA 3MGVA 3KKAA 1TTNA 1L5UA 2LXCA 1T94A 4P4PA 4RZRA 5KAIU 4M9NA 4OW0A 2IO0B 3TSSA 1EUVB 4UBBA 1WJ6A 8ICXA 3ZD8A 1FM0D 4IW0A 7ICFA 3AEGB 3WK4A 3LDZE 4P1BC 1Q46A 4IRDA 2O6VA 2LRWA 3TIXA 5AIAA 4OJLA 2M0XA 3SZ2A 3H7PB 2G4DB 3MHSD 3ED5A 1YMHE 1L3SA 1ZW7A 1SKSA 2BS3B 1WWVA 5ALLA 1UF0A 1FCLA 5J2RA 2BCSA 2KFJA 4DHJB 2L1AA 4QZEA 5KHQA 4C4VA 2CPRA 5ALHA 1NJYA 4C56C 1MC8A 2L0TA 5BYQA 5A0LA 5CA7A 3P42A 4RNMA 1CMXB 2M0AA 3V7KA 4F5PA 3UMCA 4WWOA 5AI0A 2W8KA 1ZQFA 3M8RA 2KZ3A 2BDUA 5JU5A 1S0NA 3PMLA 3AQEA 2BPGA 2ZJDA 3TARA 4YSZB 2MSED 1V81A 4DF8A 1NNLA 4U6PA 3OAWA 3R8BA 2BGFA 4NAWB 2DUYA 2JVCA 3BK2A 2PI4A 4O3OA 4DOAA 5DBAA 3GE3C 1D8LA 4HLEA 3UQAA 3VDZA 1BPDA 3B2GA 1ZYQA 4K7UA 2K4HA 2NTTA 2NRVA 2KDMA 2ZJ5A 4FHKA 4JUZA 2HHUA 4KGSA 3V60A 5EE1A 1IYFA 5AK6A 8ICPA 3RB6A 1XXGA 2TSSA 3KYDD 2OM6A 4ELVA 4O3MA 4G3IA 4PHEA 1RQNA 4BJQA 1ROEA 1TKGA 3E56A 9ICXA 2QJLA 3ECIA 5FR6A 2LUEA 3QZ8A 3SAFA 7ICUA 4MFAA 5J2AA 3PSEB 3E2EA 2HBLA 4I2DA 1K8RB 2N9LA 3I9V1 5HG2A 1RXWA 3SFEB 3Q69A 4B9KA 2O2VB 7ICRA 2KVCA 1FXAA 2YB1A 4KLOA 4O3RA 2Y1IA 1C1YB 4CQNA 3A0BU 5J0RA 1OUQA 5KFHA 3SYZA 4DL7A 2D3CA 3MJ5A 3GU3A 4DFMA 4B9LA 1NK4A 3EZ5A 3M7DA 2FUHB 1MN8A 3IHQB 2A1AA 3GV5B 4E0DA 3RI7C 1K5OA 2FJ6A 5AKKA 1A76A 2ALZA 2FMSA 3SQIA 3TEYA 3P4SB 1UD7A 2UVWA 3JPSA 2AGOA 2R61A 1PGXA 2G0AA 1PK1A 3B0YA 2AQ2B 1SGGA 5G5HA 1GUAB 3GIJA 3FAHA 2DPIA 1GAQB 4Q43A 1CI4A 5KFQA 4ED3A 3JSVA 3PHXB 4IQTA 5J2HA 3PRMB 4A55A 2H3IA 2KV2A 3Q3MC 3QUQA 1ZQHA 4BDPA 1XCQL 2KJHB 3IP4B 1XS9D 3C28A 1X9MA 4YCXA 1XCTL 2JEGA 3HPOA 2KX0A 1V8CA 1RZTA 9ICJA 1TK0A 5KL1B 2K8AA 5HHIA 1A70A 2CHZA 3H7PA 4JL9A 3H7SA 2NBUA 5DLGA 1HZ5A 1Y56A 3VVWB 2W03A 4ANVA 2W8LA 3JVZX 5D2MB 1DGJA 5HMMA 8ICIA 4NZLB 1XLQA 2I6XA 4Q44A 5L1IA 5KG6A 1R4MI 3L54A 4I6LB 1QQRA 3QUTA 1LKYB 2BYFA 1UGMA 2C2RA 4B9MA 2G3QB 2RGFA 3L17A 5AM4A 1SV0A 2MRLA 2KLCA 1C77A 4NQLB 4MF8A 3MGHA 1V5OA 1MG8A 2IMWP 4ED6A 4B9TA 3QQ8B 2WF9A 4DHJD 2WWZA 1QQ5A 2WXRA 2A1JB 4KLFA 3ZLZA 1L8LA 4DFPA 4CDGA 1BMLC 3BY4B 3KLSX 4IM2A 3IVFA 4XWWA 2A19A 3VFKA 2E1EA 3TKAA 2O6VD 4KX3A 4D2KA 1MG4A 3JW0X 1YN5A 3WANA 4W9LA 3T8MA 4JGHB 3H7IA 4RNNA 1ZQBA 4M9GA 4YXDB 2JUOA 3AU2A 4OZAA 3B9JA 4LJOB 2B6GA 3KFUF 2JZZA 3DVNU 4EEKA 3UQBA 1QF6A 4Q8FA 3RJHA 4YSYB 5D3IB 1DXSA 3IV6A 4TMAB 3N97B 2KDIA 2RPQA 2ASJA 5J2GA 2XK5B 3DBHB 4IQWA 4DQIA 1N48A 2KK0A 2VRRB 1XEEA 5CTRC 3RNEC 2HE7A 5KFVA 4PGXA 2WF5A 4FJZA 4I2FA 4B9NA 3QA8A 3A33B 4XDDA 4KTQA 1WGYA 4JIOU 5E6OA 1D5XC 4UAVA 4M8MA 1LVHA 4FLHA 1HUZA 4C80A 5HMLA 4P0QA 4M9JA 1R4MB 1P7FA 2I9GA 3NVYA 3PV8A 3L08A 4KMOB 4NWIA 2Y9UA 3RNBC 4USAA 2ZIWA 5AI9A 4DS5A 2XNAC 3UINB 4BBNF 4DK5A 1H4RA 1V2YA 3RMKC 5DG8A 3SU8X 4F5QA 1QT9A 2SEBD 2RHFA 4JV1A 2B76B 3H4BA 1C78A 1OTRB 2WDQB 3DBRB 5C3JB 5JHBA 3D2SA 4ZDVA 2GBNA 2NO4A 3HKZF 1L7YA 1F77A 1TK5A 4F2SA 3MGIA 1ZQSA 2B3AA 1L7PA 1Z4NA 5L1KA 3GE8C 3AEEB 2ZXHA 2YTUA 9ICUA 4RPYA 2GH1A 4MFFA 1KJTA 4HJKA 2AHOB 3VR8B 2I1KA 2N9PC 3NUQA 1ZOYB 1XSPA 2JWZA 3BVGA 3GZFA 4QW8A 4BX9C 3LJ3A 4FZMA 3EUB2 3NOBA 2ZNVB 3TI0A 2ZIVB 2BDPA 3EPIA 4DQPA 5L95C 1E7PB 5ALTA 2R8JA 2GB1A 4HKQA 3I1YA 4II2B 4B9UA 1ZQZA 5J2EA 2G1EA 2JYEA 5CEHA 2WXJA 1LQBA 3ZD9A 2M19A 2MP2A 9ICIA 3OG5A 3Q2AC 2BPCA 3THVA 3W5UB 3UI3A 4R66A 3UPQA 3U2SC 1SV4A 4TUQA 2KXJA 3AEFB 3SR6A 1T0YA 1F2RI 1PVQA 3VC8A 4YR0A 3TAPA 4BWJA 2DX5B 3AE9B 2SAKA 4J9MA 3AN1A 5AI8A 1ZPSA 5J0TA 3NG0A 5ALFA 3PLVA 4GDKA 3TADA 1BPYA 2WXOA 5AKXA 1YJJA 5BPCA 1DOYA 4H2AA 2K4PA 2EMTA 5AM3A 3CMMB 1ZQJA 4EEWA 2Z0EB 1S0MA 5KFFA 2YQEA 1QSLA 5J2FA 2NRWA 4DLEA 3VTWA 1WJUA 4RPXA 3Q8AA 3H8SA 7ICMA 1WXSA 2BBCA 1WG8A 5KHOA 5D4BA 2KVZA 5T8IA 2GOWA 4G3XB 4A90A 4AUQC 4B9SA 2EH9A 1O08A 1WRIA 4F91B 5J0PA 4I6PA 1XO1A 3N1XC 2W9NA 1B4FA 4MACA 4DF4A 2H89B 4ZRQA 1DRGA 3Q8EA 2KAJA 1MHHE 4F5NA 4HPMB 2KN4A 4KSLC 3F2BA 3IG5A 4KN7A 3OSNA 4J3OD 2Q4TA 3PO4A 1ET6A 3AMZA 7ICEA 5DB7A 4LLGM 4J03A 5KT4A 1Y8RC 4IUMB 3N28A 2OXOA 4L1BA 4GXBA 2MCNB 3WIMA 2W9BB 2Y5BB 4DS4A 4HRSA 1G6JA 2LKYA 5K4LA 3Q8BA 4J9KA 2F1HA 2D07B 1JWBD 2L52A 1V1PB 2MU2A 2OJWA 4FULA 3N20C 4ECTA 4HPLB 1NK6A 3TAQA 2CRXA 3ZDDA 2AEHA 2MBQA 4DL4A 4XQ8A 1D5ZC 2QB0B 1SBBB 3HRDD 1ZD4A 4DO9A 4RUAA 3RUIB 3WKAA 4CF4A 3RB3A 1NZPA 1UT8A 1QOBA 5DPWA 4UAUA 2ZIVA 5EE3A 2MP2B 3ML9A 5I4DA 2VA8A 2MA9B 3WU2U 3VCBA 4LNNA 2K8BA 2GOLA 1MJDA 4MDKE 2NCNA 5H92C 1RYJA 5KFJA 3GB1A 3PR5B 2LEKA 5C5JA 1RYSA 3EECA 5B66U 4PHPA 4UAWA 3ZYYX 3RNFC 3O0FA 1F0ZA 4S0RA 2INCC 4WAAA 5EWFA 2VANA 2IPKD 3ONNA 2J0JA 1NEKB 2W43A 3MDAA 1ZDVA 3AE6B 1SL0A 4DHZB 3UMGA 3I57A 5C1ZA 1BPBA 1UGJA 5IAAC 2XGPA 2L32A 2RMMA 3MBYA 3SAHA 5EDSA 3ETLA 3I76A 3C29A 2AQ1B 3C0RB 2PXIA 3AU4A 3ZNID 2GLSA 2LRUA 4Y2XA 4DSFA 4I2CA 2GMIC 3RJIA 3ZDTA 1L0XB 4O3PA 3Q8PB 1T6BX 3RZWC 1KFDA 2FDRA 4EX6A 3ZXRA 1B9RA 4UB1A 4EZ9A 3M3JA 2N9XA 2EAOA 4F5RA 2K1FA 1UH6A 2JRHA 2INNE 2FLNA 1BPXA 3PSPA 2KKPA 2P6RA 1YNTE 4Y2VA 2FPLA 2I5HA 2WF8A 2QDFA 3ETRA 1UELA 1A6SA 2K6DB 5CX3A 3EGRA 1Q1OA 1OGWA 2EANA 8ICGA 2L5YA 2PMZF 4HROA 3TCAA 2INDC 2N7EA 3C21A 5KT6A 2JSVX 2D3AA 1X6JA 3WKDA 4HAIA 3AE3B 2KMMA 3TFSA 4GDLA 2VIXA 2QLTA 1VR9A 2CKHB 2LGDA 5DDMA 4NAMA 3AU6A 1V5TA 1SXDA 2VZKD 1TZOA 2Z7JA 1KBUA 8ICJA 4OD0A 3G6XA 1LM8B 7ICQA 4GDKB 1XO0A 2HOIA 2OYYA 4MEMA 3A4SC 3QCAA 3PVLA 4HK2A 8ICUA 1SE9A 2F76X 1ZQIA 5DQGA 1J19A 5BYRA 4LCDE 1ZOLA 4ZOHC 3EPGA 1AROP 5J8YC 3GILA 3Q8LA 4GXIA 4DQSA 3ZJTA 1DGSA 5IN7A 2BPSA 4R8UA 4XDCA 3P4PB 4KDIC 1U49A 5ALVA 2D8CA 4WJ3B 4XZ4A 3CIRB 1F0MA 1IPGA 5ALZA 1U48A 1NK9A 4KGRA 2L7RA 3F2CA 5J0YA 1BXTA 4GIVA 1HA5A 1TAMA 4MH8A 2Q5WD 2FLPA 4HWIB 4XYCA 2HI0A 2ZW1A 3VTUA 4F2RA 1AW7A 5ALOA 4DL5A 5HFYA 2MUTB 5KFEA 4HEA1 3DQVA 1LFDA 1EU3A 3LB8C 4BBNC 2H88B 2ATLA 1WR1A 2C7HA 2L8JA 4FJYA 2LYBA 4J9RA 4KV2A 2LXAA 5AM2A 3DBLB 2WFAA 1KL9A 5KFWA 4P0QB 2XIDA 2DKZA 2KANA 4M02A 4RQ8A 2JQRB 1Z00B 3VXWA 1R4NB 3SD7A 5J29A 3V6KA 5LXIB 2WXNA 2H3ZA 4QZBA 3VR9B 5J2DA 1X66A 2MWSB 1KFSA 3AE1B 5CRXA 5EE0A 1ZD5A 2N9KA 2JHDA 3ALBA 3MABA 2DYMA 5ALUA 5EE9A 2QARA 4EUTA 5HNKA 3CNHA 4AOFA 4DFKA 4UDUC 1IGDA 1SSNA 2E8NA 5KTQA 3IHPC 1KTKA 2DZIA 1KTQA 3BK1A 3RB4A 1QILA 3T3NA 1QQ6A 3ABVB 2Z8LA 2M1MA 2XN9C 4M47A 5F9LA 1PGAA 4EKUA 1IP9A 5D46A 1QLBB 5LLIA 4M2YA 4LNFA 2EZXA 5ALDA 1ZQMA 1GOZA 4XX5A 3WCQA 2JYTA 3UIOB 1MI0A 3DVGY 2K4EA 2NRXA 4NJCA 5C2TB 3QX1A 1C4AA 1MHXA 1KLUD 2LWPA 3OJSA 2LYHA 2GBRA 1EM7A 2BS4B 2WHIA 4LNOA 1V97A 4W9IA 2CU3A 1Z2MA 1FRDA 2WGSA 1MSWD 4F93B 5CWRA 3RH6A 3SHQA 4B0MA 2HBKA 2AGPA 1VLBA 9ICHA 2XY5A 2K0PA 3W1SC 3CF6E 3P2BA 4URKA 4DL6A 2BT6A 2ZIXA 1X6IA 5TZVA 2NV3A 4ZRKA 4PHAA 4FS2A 4MSQB 2A3VA 2ASQA 1WZ3A 2LGSA 4F92B 3ZTDA 2PE6B 1FXTB 4OVZA 5DGBA 2W9CB 1X40A 4WURA 4WWNA 1R7SA 4ECSA 5BMGA 3IT6B 4ED2A 2C28A 1S1QB 3J81j 4AP4C 1PK3A 2W3RA 5JTIA 1PDXA 3RRGA 1NKCA 4F7ZA 3T5KA 1MFWA 3D2QA 3M6ZA 2KVSA 2KQSA 2R2OA 1VZ8A 2J6SA 2YMLA 2CU1A 3Q3OC 4MEYA 1NKEA 2BW2A 1E7UA 3AEDB 2NRZA 2MJEA 1FMAD 2N4FA 4KIKB 3NRWA 1GB1A 2YB4A 2UYZB 2XEWA 2D3BA 3VH4B 4DOCA 3JYUA 4B9VA 1JW9D 3MC8A 4RGNA 5AK3A 2PLPA 4WIPA 1KRPA 2J42A 1FFUA 1EO6A 4IG7B 3RH5A 3FILB 1NOMA 4GU2A 5KFGA 1Q0WB 4FBJB 4FS1A 2L05A 3RRHA 3HVZA 4O1NA 2BHNA 4DL2A 3U52E 3BYTB 2EAMA 1TAQA 3IAS1 4II3B 1Z1VA 2YMPA 3HP6A 2KFZA 3T3FA 2K8HA 3JPNA 4UW9A 1JI7A 5IP4D 2JXJA 3PSTA 3G6VA 2EZZA 3KHRA 1QLNA 2Y3AA 1XWLA 1L4DB 3L13A 4HDOA 4G11A 4IWQA 2LMCA 2N1WA 4LVSA 4UQGA 3QEAZ 2FI1A 1D9FA 4ANWA 1JCKB 2V1YA 1SWVA 3LYSA 1WI0A 2KHQA 4IL6U 1NK0A 1OQYA 7ICHA 2KJRA 1L7OA 3N32A 3Q8FA 2JRZA 1JIHA 3MFIA 2AGQA 2MBBB 3C2MA 3NRZA 5IIMA 2GRIA 2QILA 4YSXB 5JH5C 1KLVA 2C9WB 4UAYA 3BDPA 4FE3A 2MAXA 2JWUA 1SZHA 3MTNB 4LNKA 1ZETA 4KLQA 4NV0A 2DF4B 1SZPA 3NS1A 2JR5A 2ES6A 4ECWA 5DQIA 5IKCM 4F8RA 4GLSC 1S9FA 1NJXA 2DNFA 3FDSA 1J8CA 1GC7A 2R8KA 5ALWA 2VZKB 5KG0A 2WTFA 2DPJA 2MX2A 3E58A 4RQ5A 2AH5A 2UVRA 4JV2A 2XBBC 4ZH4A 5AZFA 1XLNA 1WFYA 1IUEA 2NPTB 3PZDA 3M6KA 1TY0A 8ICKA 1E90A 4DBGA 1YZ6A 1GC6A 1M94A 3RZFA 1V85A 4QZHA 1D8YA 5GXGB 8ICAA 1KM7A 1NK7A 4RQ0A 5KFOA 4N59A 7ICNA 1N60A 1OEYA 1QCKA 2W82A 1S8OA 3C1YA 5AKZA 5J2JA 3HM6X 4K7SA 1QOGA 1S0VA 5AICA 4RQ7A 5ALYA 4B95A 1PUTA 2INPE 1X1MA 2MBOA 4CNQA 3Q8CA 2C5LC 1HE8A 2HBMA 4EZ6A 1WIAA 2NS5A 3RJEA 4QZ8A 4GB9A 2K39A 4R63A 2KHVA 5DLFA 3I3TB 5GMVA 4QWEA 4EE2A 2WB1F 4RCOA 3N3KB 2OOBB 2KC2A 2OEHA 1RG6A 3TJPA 2KJ8A 1WJNA 1V49A 3QE9Y 5IILA 3TFRA 5KG4A 5AI5A 4KX6B 4I28A 4IC9A 3QZ7A 1FNUA 4ARCA 3V6HA 4DSLA 2EMSA 4PS3A 2BGWA 5HHHA 2NMQA 2AXTU 2LHTA 3ZW3A 3ZXVA 5FK9C 3BQ0A 4Y2UA 4PH5A 2KN7A 4CRXA 5DGAA 3DDCB 5KFLA 2BCUA 4KLTA 4NNJB 2MBEA 2MQJA 3F53A 2M4NA 4K3BA 1S97A 1D6EC 2IBKA 4M8NA 4REZA 2BPFA 3AM9A 5ALRA 1WR6E 1OEYJ 1HEKA 1QH9A 5J8YA 2V3PA 3LK9A 1QTMA 1WMHB 4G0NB 3RR8A 3LVWA 5JZEB 3A9KA 1NYRA 2E1FA 1FO4A 2DFLA 1Z3EB 2W9AA 4J9NA 1V9JA 3WA0A 4ZRJA 2MLBA 3ZDCA 4OHJA 9ICVA 1BGXT 4US9A 2HHVA 5IINA 3VQIA 4CF5A 3RAQA 4RFBA 4IWOA 1X2IA 2LHEA 2A1JA 2IHMA 5AKHA 1E8WA 3AL0B 4WJOA 2LMRA 5GTIU 5J0OA 1ZQQA 2IO3B 4M6WA 1U4AA 1P7EA 1JN3A 1TYGB 2JT4B 1RAXA 2WNMA 5KFCA 1BPZA 1SIJA 1SE3A 1BNPA 2FLLA 1LKYA 4BOZB 2BYVE 2UU7A 3NJTA 4RQMA 4M9LA 3AI5A 4O5CA 3HT3A 3ICXA 1KF6B 4YP3A 4OJPA 1KLNA 2G45B 5CB1A 2QARB 2KFKA 4EENA 2L76A 1ET9A 2W7OA 1F1HA 2BR0A 3TACB 4F5OA 1WJ4A 4NPNA 1AN8A 1SJED 1C3TA 9ICPA 5AUIA 7ICJA 1Z19A 1F44A 4I2HA 2QHOA 5DQHA 3V61A 5KFXA 2R8GA 5TISU 4YD2A 1WGRA 5DPSA 4C8KA 7ICGA 1HIWA 1N61A 1XSNA 4DSKA 1XLOA 4KKJA 2H3FA 1L7NA 2HHXA 3QXGA 1JX4A 1HEZE 3QU9A 5EWGA 1AARA 1RQLA 2ZCBA 4ED8A 2DENB 4LDTB 1X9SA 3PSFA 1K53A 1I7HA 2MUTA 3Q3FA 4P7IA 2KK8A 2B0CA 4FZNA 1RYRA 3DBRI 1WGGA 4IOIE 4M0WA 1BT0A 4M01A 3V3XA 1RM6C 2DGZA 3BJYA 2KWVB 2O6VB 3PW2A 3C19A 3N9YC 4ICVA 4W9GA 3SEBA 1PUZA 2ZTEA 4P1CC 1TT5B 2FIFA 4YR3A 4FBTA 2WLBA 4W9KA 1TS5A 1UUPA 1BVSA 5KFRA 1KH0A 2WQYB 4NAWA 5AKIA 3MDCA 3CSFA 4C8MA 2JEIA 4M0WB 3DBSA 4MM3B 4TQRA 3Q8SB 4GOCA 1SGHA 1K1SA 1RPLA 4F72A 3HM3A 2ZVOA 3HUIA 4F1SA 1CZPA 1WCLA 3ALRA 4HDQA 3A0HU 3DDHA 1B1ZA 4QWBA 4C8NA 3Q3JA 3S6JA 3TBLD 2IA6A 8ICLA 3PO5A 4DQOC 4HXDA 3ZRCA 3OHAA 2FCQA 4HKZE 4XE0A 2BCQA 1U47A 1IXRA 3UF8A 5AI6A 3KH0A 2RPVA 1WM2A 1SE2A 3RBDA 1RYUA 5DBCA 2VJ4A 1S10A 5ALJA 1PQSA 1SE4A 2EELA 4F4ZA 1UCVA 5AZHA 2J4XA 1WE6A 3A1QA 2UVVA 5MPOA 3GP7A 5LNK1 5KFZA 2WDRB 2FIDA 3VRAB 1U9LA 5J2BA 4O9MA 3IG8A 4GDLB 2G5IB 1E8ZA 5DKWA 3OJUA 8ICBA 3AE8B 2KO3A 3KHHA 8ICYA 2F8KA 1F9JA 3LVVA 3PO0A 2F77X 4AWJA 2E8PA 3RR7A 1HZ6A 3TQ1A 4GFJA 1L3UA 1IBXA 5KFSA 4MFCA 1L0YB 4L23A 1ZJNA 4PK1A 1KFYB 1UBIA 2Y1JA 5AKLA 3HKZC 4O0IA 1B43A 1VJKA 3TEZA 4CCHA 1ZRNA 4Y2PA 3L4PA 1TS2A 3R7RA 3S2AA 4KMUA 2GBKA 5J2IA 1KW4A 1SB3C 4PL2A 3C2LA 2AL6A 2IY0B 3MR2A 2BYEA 2NVUI 2MJDA 5L1MA 1TY2A 4HCPB 1ENFA 4YD1A 1CK1A 2RR9A 2ZXIA 3ZI4A 5FP0A 5EOZA 3NVZA 4OVVA 4DXAB 2BWFA 1E9MA 1Q10A 4I2EA 9ICEA 3DBLI 2J6TA 4L2YA 2FCMA 3BZKA 2BQQA 3ML8A 5D94A 4YMMA 3I5JC 3QUBA 2C2EA 8ICMA 3HWTA 2KP7A 1L6VA 3PREA 4S17A 4WWMA 2WP9B 1DYQA 2NRTA 1JUDA 1WY8A 2DYBA 5AEKB 9ICOA 1OQRA 4ZYNA 1X9WA 3RJFA 3SV4A 1YZ7A 5KG1A 4DWIA 2KD1A 3HX0A 5KT7A 1ZQGA 3DBHI 3H4DA 1MA7A 1ZJMA 2K3UA 2K25A 2KIWA 3TANA 5KG5A 3U26A 2HTHA 3Q3NC 4J9SA 4RGOS 2ZJ8A 4P4MA 1ZRMA 1WXVA 2HJ8A 3KUZA 2RP5A 2LPEA 2EZYA 2PFOA 4RGMA 5KFUA 2HOFA 2C2DA 2XICA 1NBFC 1WZ0A 2M0NA 3H6NA 3HK0A 3QU2A 1YJIA 4F4WA 5IOIA 4BKSD 3CYMA 4KLSA 3M9MB 1AWDA 3UGBB 3EWAA 1XQQA 2QB1A
chains in the Genus database with same CATH topology
4ZRPA 2WU5B 4XWTA 2LJIA 1QOFA 2WS3B 1TS4A 5BYRA 4ZOHC 1C76A 1MVKA 3TUOA 3ZJTA 1OQQA 4R3DA 4XDCA 3AECB 3P4PB 3W9CB 1E10A 1TKYA 1PYWD 3CIRB 4RH6A 2V3NA 2ONQA 1UWXA 4KGRA 4OW0A 3TSSA 2E3TA 1I4QA 2QEJC 1BXTA 1HA5A 4MH8A 2Q5WD 1FM0D 3MHZA 2ZW1A 1JQ4A 2ACZB 3AEGB 1WXQA 1AW7A 5H8YE 5E6JA 5HFYA 2PW9A 4AS1A 4HEA1 1YMHE 1EU3A 3LB8C 2H88B 1JMLA 2BS3B 1CQVA 1FCLA 1TS3A 1ESFA 2L1AA 5FKAC 5BYSA 1HXYD 2YEPB 4C56C 3LXFA 2JQRB 4C7YA 2DWQA 5BYQA 3P42A 2M0AA 2WXNA 1FCCC 1EWYC 4OZBA 3W5VB 3VR9B 3TEXA 1T3QA 1NI3A 2KWDA 3LYYA 3AE1B 2N9KA 2I38A 5EE0A 3P63A 2DYMA 5EE9A 4UDUC 1IGDA 3MFGA 2WXFA 4YSZB 1SSNA 1KLGD 3R8BA 1KTKA 3BK1A 1OFFA 4NAWB 1QILA 4WH4A 4A8XC 3T3NA 3BK2A 2Z8LA 2XN9C 2JXTA 1NENB 1M4VA 3B2GA 1PGAA 1XF5L 2NTTA 2KDMA 2MJ3A 4KGSA 1QLBB 4WQMA 1K51A 5EE1A 1XXGA 2ON8A 1N63A 1ZDXA 2TSSA 1GOZA 3WCQA 2AQ3B 2JYTA 1MI0A 3E56A 1ROEA 1TKGA 4NJCA 2QJLA 3ZQ4A 1UNSA 2K22A 5C2TB 1C4AA 4C7ZA 4JPSA 1MHXA 1KLUD 2E6XA 2N9LA 3I9V1 5HG2A 3SFEB 3Q69A 1EM7A 2BS4B 2WXQA 1FXAA 1V97A 1SF0A 1SXTA 2CU3A 1FRDA 4YWGG 1ZE3D 4CQNA 1YQ3B 4B0MA 3MJ5A 1KRHA 3T3OA 1VLBA 3NZ3A 3U7ZA 3DWGC 2K0PA 3J9CA 1BUIC 2KQ4X 2WXGA 3KWLA 5HI1A 3P4SB 3TEYA 2BT6A 2R61A 3IT4B 2QIEB 4JWUC 1PGXA 2AQ2B 3VRAB 5G5HA 1GAQB 3FAHA 2K9XA 1C4CA 4A55A 1YQ4B 4OVZA 2EKIA 3H8HA 2RDHA 4WURA 1XCQL 1R7SA 2PIAA 5BMGA 3IT6B 1AYFA 1L6UA 1ZXHA 1XCTL 4P6VF 1J7AA 1V8CA 2W3RA 4DXFA 1PDXA 1A70A 1MPEA 1STEA 4ITKA 1IGCA 2FBWB 1D5MC 1HZ5A 1Y56A 1VZ8A 2J52A 1ZP0B 4LTUA 2BTEA 4AQ7A 2BW2A 1DGJA 3AEDB 4RGTA 2WXLA 3KQ4A 4MT5A 2MJEA 4NZLB 1FMAD 1XLQA 3SFDB 1GB1A 2ICIA 2K5PA 2WDVB 4YT0B 1QQRA 1VDVA 1HQRD 1JWMD 2WXKA 1JW9D 3PZ8A 4RGNA 2PLPA 4WIPA 2HDEA 2J42A 1FFUA 1J7CA 1C77A 2D5GA 1TKEA 3FILB 2LHDA 2IGDA 3HVZA 4O1NA 5D3DA 3U52E 2LUMA 3BYTB 3OWEB 2WXRA 3IAS1 1RFKA 1BMLC 3KLSX 1EU4A 4XWWA 3W2DA 2Y3AA 1L4DB 4A9AA 4D2KA 4RF0A 1T5XD 2LMCA 1ACCA 1YN5A 2W55A 1JCKB 4YXDB 2CJOA 4OZAA 2Y5PA 3Q8FA 3B9JA 1QOAA 4YTPB 3NRZA 1QF6A 2GRIA 1VRAB 2QILA 4YSYB 4TMAB 5D3IB 4YSXB 3NVVA 2JWUA 2LFIA 2G9HD 4PT5A 3P4QB 3AE5B 1N5WA 2BS2B 4ZHOA 3NS1A 3AB5A 1XEEA 3HVDA 1VZ7A 5FR3A 4RF1A 4GLSC 2J53A 4XDDA 1E6EB 5BMIA 1FIQA 2VZKB 1D5XC 1L4ZB 4TSSA 4JE3B 4C80A 1C9FA 1XLNA 3AE4B 1V1OA 2KACA 1P7FA 3BZDB 3NVWA 1IUEA 3NVYA 2WXIA 1DOXA 1TY0A 2X38A 4N6EB 4USAA 1K52A 2XNAC 2CJNA 5GXGB 1I4HA 3W1SA 1QT9A 1JALA 4N59A 2SEBD 2DYOA 2N0SB 1N60A 1JROA 2B76B 1DOIA 1C78A 2W82A 4HJGE 1IBXB 2WDQB 5C3JB 1QOGA 1CJEA 1F77A 1YN3A 3KWVA 2QSDA 2IGHA 2BB5A 3BWUD 2V0GA 2JX5A 3R2IA 1PUTA 2INPE 2MH7A 3AEEB 3U4EG 4P16A 3Q8CA 1JWAD 5HHDG 3P1MA 1PFDA 2PTLA 3VR8B 4EE2A 3BVGA 3E9SA 4RCOA 1ZOYB 2I2YA 4ZYSA 2GI9A 2YEPF 2RDGA 1I4GA 3EUB2 1FXIA 4RNAA 2Y5CA 3AEBB 4KX6B 1E7PB 1FNUA 4ARCA 2GB1A 2NMQA 2WXMA 4HKQA 4JWSC 5FK9C 1TJEA 2G1EA 3BVMA 1C4PA 1UWMA 2JYEA 2WXJA 3O13A 1LO5D 2M19A 1D6EC 4REZA 3AM9A 3PZ7A 1PGBA 3W5UB 2V3PA 2DLBA 3UI3A 4YTMB 2QMTA 3U2SC 1E0ZA 3AEFB 3SR6A 1NYRA 3GS2A 1FO4A 1F2RI 3AE9B 2SAKA 1FEHA 2WXHA 4OHJA 3AN1A 1ZPSA 4US9A 3VQIA 4RFBA 1XO3A 2LHEA 2WXOA 3IAM1 1YJJA 5AUKA 1DOYA 1WWTA 4H2AA 3AE7B 3FILA 3TEWA 2FUG1 2WXPA 4FXCA 1P7EA 1WYGA 3MP9A 2V4IB 1TYGB 2WNMA 4TQ1A 3C8YA 1SIJA 1SE3A 3Q8AA 1N5XA 2BBCA 5T8IA 1GPXA 1I4XA 4A90A 5D7GA 1KF6B 3AEAB 1FNWA 1ET9A 1WRIA 4ZHPA 2IJ0A 1AN8A 1SJED 1K50A 3CWIA 5AUIA 3V05A 4MACA 3AV8A 4US8A 2H89B 4ZRQA 3Q8EA 1NYQA 2KAJA 4JX1C 1MHHE 4DXGA 2KN4A 1XLOA 1N61A 4KKJA 3BIID 1N62A 1JWSD 3ZJUA 1HEZE 4J3OD 3MC0B 1ET6A 4KKIA 3AMZA 1K53A 1I7HA 3AH7A 3P4RB 4LLGM 1EWCA 2FE8A 4L1BA 1SJHD 3ABVB 4M0WA 5G5GA 4IOIE 3V3XA 4HRSA 1RM6C 3Q8BA 3SEBA 3N9YC 1I4PA 2OHFA 4A6QA 5JXVA 1JRPA 1JWBD 2L52A 1V1PB 3B2FA 3ZJVA 1D4BA 4LK0M 2WLBA 2WU2B 3IXSA 1TS5A 1UUPA 2DBYA 1D5ZC 2N7JA 2PMVA 1SBBB 3HRDD 1KH0A 2WQYB 2ZW0A 1FD6A 1QOBA 4MM3B 5TSSA 5EE3A 5I4DA 3HUIA 1CZPA 4IDIA 1B1ZA 4B0EA 5H92C 4DQOC 1RYJA 3GB1A 4HKZE 4XE0A 2LEKA 3ZYYX 2RPVA 3ZGZA 1F0ZA 1SE2A 2PKOA 2EELA 2IPKD 1SE4A 1SEBD 4Q2JA 2J4XA 1NEKB 5MPOA 1ZDVA 3GP7A 5LNK1 2WDRB 3AE6B 2PVOD 1ZXIA 4YTNB 3I57A 4GDLB 4WAFA 3VRBB 1UGJA 4ARIA 3AE8B 2L32A 2RMMA 1YN4A 2JZPA 3NUHB 3PO0A 1HZ6A 1IBXA 2MEKA 2AQ1B 1L0YB 1FNVA 2IGGA 4L23A 1KFYB 2HTME 2BB6A 1L0VB 1VJKA 3TEZA 3EA6A 3AE2B 3L4PA 1L0XB 1F2RC 1TS2A 1T6BX 3FC4A 1J7BA 1NVID 1SB3C 1B9RA 2BYTA 2M56B 4OZCA 2L83A 1I4RA 4N58A 2MJDA 3RFZB 1TY2A 1ENFA 2INNE 2AX5A 1CK1A 2LGIA 3R2TA 3URYA 3BYYB 2W54A 1YNTE 2JU6X 3NVZA 3ETRA 3EGRA 2IDYA 1E9MA 2W3SA 1Q10A 3DWMA 1FRRA 4IKGA 4L2YA 4HROA 1ZUD2 4WWMA 1L6VA 2WP9B 1WSPA 1DYQA 1OQRA 2JSVX 1FFVA 3AE3B 1VZ6A 2KMMA 1XLPA 1RWSA 4KGTA 1QKZA 1VR9A 5BMHA 2K3UA 4TQ0A 4NAMA 1V1PA 2OEDA 2PVGC 1GB4A 2VZKD 1TZOA 1WGKA 2NTSA 4RGOS 4RGMA 4GDKB 1C79A 1JWUD 1YJIA 1L5PA 1AWDA 3BVZA 3RPFC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1RM6 C;  1JRO A;  2B76 B;  1DOI A;  2QIE B;  2WU5 B;  4JWU C;  3VRA B;  5G5H A;  1QOF A;  1GAQ B;  3FAH A;  2K9X A;  1JRP A;  1JWB D;  2L52 A;  2OHF A;  4ZOH C;  1QOG A;  2WDQ B;  2WS3 B;  3B2F A;  1CJE A;  1YQ4 B;  2EKI A;  2WLB A;  2WU2 B;  2JX5 A;  1OQQ A;  1R7S A;  2PIA A;  1PUT A;  3W9C B;  1AYF A;  1L6U A;  2DBY A;  2MH7 A;  3AEE B;  3AEC B;  3HRD D;  1JWA D;  1TKY A;  2WQY B;  4P6V F;  1J7A A;  3CIR B;  1V8C A;  3P1M A;  2W3R A;  1PFD A;  1QOB A;  1PDX A;  2E3T A;  3VR8 B;  5EE3 A;  1ZOY B;  1A70 A;  3HUI A;  4ITK A;  1CZP A;  2Q5W D;  1FM0 D;  4IDI A;  2FBW B;  1ZP0 B;  3EUB 2;  1FXI A;  2ACZ B;  3AEG B;  1WXQ A;  2Y5C A;  4LTU A;  5H8Y E;  1JQ4 A;  3AEB B;  1DGJ A;  3AED B;  4KX6 B;  5H92 C;  1E7P B;  1RYJ A;  2MJE A;  1FMA D;  1XLQ A;  3SFD B;  2LEK A;  2K5P A;  3LB8 C;  2WDV B;  4JWS C;  2H88 B;  2BS3 B;  4YT0 B;  3ZYY X;  1VDV A;  1TJE A;  1F0Z A;  1JW9 D;  2PKO A;  2G1E A;  1UWM A;  2M19 A;  1NEK B;  1FFU A;  1J7C A;  2BT6 A;  5MPO A;  3LXF A;  2JQR B;  3AM9 A;  1TKE A;  2WDR B;  3AE6 B;  2PVO D;  1ZXI A;  4YTN B;  3W5U B;  4YTM B;  4C7Y A;  2DWQ A;  3HVZ A;  3W5V B;  3VRB B;  1EWY C;  3AEF B;  3SR6 A;  1NYR A;  1E0Z A;  3VR9 B;  1T3Q A;  1FO4 A;  1NI3 A;  3AE8 B;  3AE9 B;  1RFK A;  3AE1 B;  3AN1 A;  3PO0 A;  5EE0 A;  4US9 A;  3P63 A;  5EE9 A;  1XO3 A;  5AUK A;  1KFY B;  2N0S B;  1YJJ A;  4A9A A;  1DOY A;  1WWT A;  2HTM E;  3AE7 B;  1L0V B;  1VJK A;  2W55 A;  3AE2 B;  3L4P A;  4YSZ B;  4YXD B;  3FC4 A;  1J7B A;  1NVI D;  1OFF A;  2CJO A;  1SB3 C;  4FXC A;  1B9R A;  1WYG A;  2M56 B;  3B9J A;  1TYG B;  2L83 A;  1QOA A;  4N58 A;  4YTP B;  1NEN B;  1SIJ A;  2MJD A;  3B2G A;  3NRZ A;  1QF6 A;  2AX5 A;  1N5X A;  4YSY B;  2W54 A;  4YSX B;  3NVV A;  2MJ3 A;  4WQM A;  1QLB B;  1GPX A;  3NVZ A;  5EE1 A;  3ETR A;  3P4Q B;  1KF6 B;  1N63 A;  3AE5 B;  1N5W A;  3AEA B;  1E10 A;  2BS2 B;  1E9M A;  2W3S A;  4ZHO A;  3NS1 A;  1FRR A;  3AB5 A;  3DWM A;  3WCQ A;  1WRI A;  1ROE A;  1TKG A;  4ZHP A;  4HRO A;  1ZUD 2;  4WWM A;  2QJL A;  1L6V A;  3CWI A;  2K22 A;  5AUI A;  2WP9 B;  5C2T B;  4C7Z A;  1OQR A;  1E6E B;  3AV8 A;  1FIQ A;  4US8 A;  2H89 B;  1FFV A;  3SFE B;  2BS4 B;  1NYQ A;  2KAJ A;  3AE3 B;  3P4P B;  1FXA A;  4JX1 C;  1V97 A;  1SF0 A;  2KMM A;  1XLO A;  1N61 A;  1RWS A;  1XLP A;  2CU3 A;  4C80 A;  1FRD A;  3BII D;  1N62 A;  1XLN A;  3AE4 B;  1YQ3 B;  3NVW A;  1IUE A;  3NVY A;  2PVG C;  1DOX A;  1WGK A;  4N6E B;  3AMZ A;  1KRH A;  4USA A;  1VLB A;  1I7H A;  3AH7 A;  2CJN A;  3P4R B;  5GXG B;  3DWG C;  5C3J B;  3KWL A;  1QT9 A;  3P4S B;  1JAL A;  1YJI A;  1L5P A;  3ABV B;  4N59 A;  1AWD A;  3RPF C;  5G5G A;  4HRS A;  1N60 A; 
#chains in the Genus database with same CATH topology
 5KG2 A;  1N6Z A;  2WU5 B;  2GLE A;  5D6J B;  1ZD3 A;  1SXE A;  2LZ6 A;  1MVK A;  3U30 A;  9ICT A;  4NJ6 A;  1OQQ A;  2KNB A;  3WK9 A;  1RXV A;  3AEC B;  2L00 B;  2I1Q A;  1LGR A;  2XCA A;  4DWF A;  3PX6 A;  4B6W A;  4FFD A;  5KNI A;  3KHL A;  2V3N A;  4MJS B;  1UWX A;  3RNA C;  2Y0S C;  2E3T A;  1I4Q A;  4ED7 A;  2LJ5 A;  1F5S A;  4C0Z A;  2KOB A;  1NK8 A;  4QZC A;  1RLF A;  1JQ4 A;  3KZI U;  4LNI A;  1WXQ A;  2ZTD A;  2B21 A;  2GWS A;  2WAQ C;  2PE9 A;  2E8M A;  2PW9 A;  4AS1 A;  2NR2 A;  4TV3 A;  3AXC A;  3ZDA A;  4QZF A;  1JML A;  2GBM A;  3IG3 A;  4F8C B;  2DAJ A;  3RCZ A;  1NDD A;  1YD8 U;  2KTR A;  3A9J A;  1A0P A;  4CHK A;  5BYS A;  1HXY D;  4CYE A;  2YEP B;  4GMV A;  2VJ5 A;  2P6U A;  5JHA A;  5LXH A;  8ICH A;  2W9M A;  4FA6 A;  4NLC A;  2LM1 A;  8ICS A;  3W5V B;  4OZB A;  1EWY C;  1D3Z A;  1WRD B;  3CST A;  1KEJ A;  1NI3 A;  1J0G A;  5KAF U;  4F4K A;  3C1Z A;  4NY0 A;  3SEN A;  3LYY A;  3QNM A;  3TAD C;  3V6J A;  3Q8M A;  3QEB Z;  4EZJ A;  1TV9 A;  2BWE S;  2I38 A;  4AJW A;  1UPH A;  3P63 A;  5ALN A;  1WH3 A;  2IYD B;  4RQ6 A;  5J0X A;  3PTF C;  4N9F 4;  3MFG A;  3OPX A;  2WXF A;  2L0F A;  2QC8 A;  2REX A;  4R8U B;  1KFT A;  3EFU A;  1OFF A;  4WH4 A;  4ZRI A;  4E74 A;  3ONS A;  4G9B A;  2CN1 A;  4FN2 A;  3SI8 A;  4PHD A;  2JXT A;  1M4V A;  2ESE A;  3WAL A;  4PJ0 U;  2G5H B;  3PW7 A;  4NLZ A;  1WUD A;  1ZQC A;  2FNJ B;  9ICL A;  2ZNV C;  2MJ3 A;  1XD3 B;  4WQM A;  2CHX A;  4UB6 U;  1WYW B;  1TZ1 A;  2AQ3 B;  4KZC A;  5IO9 A;  1X42 A;  4J9P A;  2MA1 A;  3WK8 A;  4O5K A;  2PI5 A;  2K22 A;  1ZQX A;  3RJG A;  4KX5 A;  3WK7 A;  2M9N A;  3M95 A;  3M62 B;  1OXJ A;  2E6X A;  3RUL A;  3U7D A;  3L16 A;  4IWP A;  3QUC A;  2ZVN A;  3DHH C;  3OLM D;  4NLN A;  1SXT A;  4K1R B;  4PGQ A;  2PFN A;  4YWG G;  5KL8 B;  1ZE3 D;  9ICR A;  2JF5 A;  4JMU A;  2G4S A;  3NGD A;  2KEY A;  2JV3 A;  1KRH A;  2OCE A;  3U7Z A;  3DWG C;  2K8C B;  4FAD A;  1NJW A;  1T4G A;  3KWL A;  3BZC A;  3QX7 A;  2LVO A;  2PKE A;  4C4S A;  2WB1 C;  2QIE B;  1WX9 A;  2G07 A;  5HR6 A;  4QZG A;  2D11 A;  1C4C A;  5EWE A;  1YQB A;  2KKV A;  3NHE B;  1ZD2 P;  2RDH A;  4KDL B;  3F2D A;  2P35 A;  3QAR A;  2BKR B;  3L10 B;  3PSI A;  3X0W A;  4DDG D;  3VAW A;  1J7A A;  2C7M B;  4YXM A;  1T7P A;  3RT3 B;  4DXF A;  2IBI B;  1K1Q A;  4R64 A;  1STE A;  4ICU A;  4ITK A;  1IGC A;  2FBW B;  3CRX A;  4ICA A;  3I63 C;  4LTU A;  5E79 U;  5J0U A;  5G55 A;  2BTE A;  3I28 A;  1S3S G;  3RN9 C;  2KZR A;  2D6F C;  2ZZP B;  5L1J A;  2WXL A;  4RGT A;  3KQ4 A;  4MT5 A;  5ALE A;  3SFD B;  2WAQ F;  2ICI A;  2PFQ A;  8ICZ A;  4YT0 B;  4OJO A;  4ELT A;  2WXK A;  2LGY A;  4MJS A;  2ZUB A;  1ZQD A;  3M63 B;  4M00 A;  4X57 B;  4FZL A;  2KSO B;  2HDE A;  5AM0 A;  1J7C A;  2O2V A;  1TKE A;  4KVG B;  5J0W A;  2LHD A;  3BIN A;  2IGD A;  3GDX A;  4M0A A;  9ICB A;  4Y2Y A;  5IIK A;  3UQ0 A;  1GG3 A;  1I42 A;  4QWD A;  5T14 A;  1NI2 A;  2CXY A;  4QWC A;  4TUS A;  1L7M A;  2H5X A;  8ICR A;  2LGX A;  3BQ2 A;  2C22 A;  1ACC A;  4J9Q A;  5L9X A;  3QK0 A;  2W55 A;  2N1R A;  2G09 A;  1O03 A;  4PS7 A;  2G08 A;  9ICK A;  2Y5P A;  3W1Y A;  1SV0 C;  3NZS A;  1MQ3 A;  4Y2J A;  3VHT C;  4PGY A;  3PZP A;  3D6J A;  1NK5 A;  2QB0 A;  2FMQ A;  3NVV A;  3K1R B;  2LFI A;  2G9H D;  2F3N A;  3GII A;  1EXN A;  3GV8 B;  5ALI A;  3AE5 B;  3P4Q B;  1N5W A;  4DSJ A;  2BS2 B;  1XNS A;  3RJJ A;  1H8C A;  1VZ7 A;  2CR5 A;  9ICF A;  2VA2 A;  3PT2 B;  5FR3 A;  2KDE B;  2EAP A;  3SEI A;  4QZ9 A;  5L83 A;  1LB2 B;  2RDB C;  5BMI A;  2YMM A;  4NLK A;  4W9E A;  4FBU A;  4BKS A;  4PS8 A;  1E5W A;  1L4Z B;  2FMP A;  4W9H A;  3APC A;  4JE3 B;  4DSE A;  4TSS A;  2KVR A;  1N2X A;  3RTV A;  3WKC A;  1V1O A;  4UBC A;  1S76 D;  3Q8R B;  1DK2 A;  4HCN B;  9ICG A;  1DOX A;  3JPT A;  4N6E B;  4AYB F;  2A5U A;  3OTQ A;  2P66 A;  3BQT A;  4KLE A;  2FAZ A;  3DVG X;  5J17 A;  5ALK A;  2CJN A;  3W1S A;  1SL1 A;  2K89 A;  1WX7 A;  4XUS A;  5G2N A;  3WK6 A;  4QZD A;  2DYO A;  8ICE A;  2N0S B;  2KDB A;  1ZQP A;  3EFC A;  4TKN A;  1JRO A;  2HSZ A;  2JY6 A;  4HJG E;  1IBX B;  4ANU A;  1HJP A;  4EYI B;  3KWV A;  4Y2R A;  2IGH A;  2BB5 A;  3BWU D;  3DOW A;  1ZQ1 C;  2OJR A;  1XC9 A;  4W9C A;  5KFK A;  4P16 A;  1JWA D;  3FYH A;  1T0R C;  3ZKJ C;  4HYK A;  3K75 D;  4E3C A;  4I2J A;  4NLB A;  7ICL A;  1EF1 A;  3P1M A;  5CHF A;  1PFD A;  2ZEQ A;  5DPT A;  5AKG A;  3E9S A;  3MR5 A;  3ZO5 B;  4ZYS A;  2FPK A;  4A20 A;  4UB8 U;  4W9J A;  2YEP F;  3ZNG C;  4TUR A;  3H8M A;  1R4N I;  3K9O B;  4MGI E;  3AEB B;  3Q6B A;  4KLG A;  2KYW A;  5III A;  3SD5 A;  3H8W A;  3GFK B;  5CHG A;  2AWT A;  2WXM A;  3MC9 A;  4NJ8 A;  4ELU A;  3ENE A;  3UXP A;  1TJE A;  5BO4 B;  9ICA A;  4UAZ A;  2ODG A;  1UWM A;  3O13 A;  5KFT A;  1V9P A;  1ZQN A;  2BKE A;  4BFR A;  3UIP B;  2DLB A;  4YTM B;  1P3Q U;  2QMT A;  3QU5 A;  7ICV A;  4GIB A;  1E0Z A;  2HHS A;  4K4G A;  2F2A B;  1FEH A;  4ACF A;  4RMA A;  1QSS A;  4DFD A;  5IA7 A;  3EYZ A;  2EDU A;  2RD0 A;  4DQR A;  2KWC A;  5AUK A;  3IAM 1;  1ZQR A;  1WWT A;  5D49 A;  3AE7 B;  3FIL A;  3TEW A;  5AM1 A;  1UA1 A;  1KQQ A;  3UXN A;  4IS7 A;  4O3S A;  4KLD A;  2KOX A;  2KSO A;  3K9P B;  5L1L A;  2WHE A;  2XVT A;  1MQ2 A;  4FXC A;  2IOH A;  3C8Y A;  5KFB A;  1V6E A;  3ZDB A;  2XO7 A;  4Y2T A;  2BQU A;  4I6N B;  1I4X A;  2KKC A;  1L2N A;  5D7G A;  1CEZ A;  2ZIW B;  1Q8K A;  3AUO A;  2ZIU B;  2IJ0 A;  3PW5 A;  4BXO B;  4YFK A;  2Z0D B;  4X5V A;  2K6Q A;  1E7V A;  5AKE A;  2KG5 A;  4ED1 A;  4GLX A;  1FPY A;  5J0S A;  3V05 A;  4M6W B;  5KFA A;  3UQ2 A;  3WKB A;  2PJH A;  3AV8 A;  3KBB A;  3RYT A;  1J2N A;  1NYQ A;  4JX1 C;  4OJ6 A;  3N4M B;  4UB5 A;  3L0W B;  2ZPY A;  2ZUD A;  1N62 A;  1TBE A;  3ZJU A;  4JV0 A;  1ZQA A;  1UBQ A;  3GQC A;  2LI6 A;  4QIW C;  3MC0 B;  3T79 A;  5F9N A;  5KT5 A;  3M8S A;  4EZK A;  2RDJ A;  4P2H A;  8ICF A;  4BUG A;  2J0M A;  2H3Q A;  4TUU A;  5KG3 A;  2FE8 A;  4EBD A;  4C8O A;  1YX6 B;  4DOB A;  4P0P A;  1EF5 A;  3BS7 A;  3V7J A;  5C0Y A;  2D10 A;  4LJP B;  1B0X A;  5J2C A;  5J0Q A;  2OHF A;  2F8L A;  1I4P A;  5IIJ A;  1JRP A;  2M17 A;  3B2F A;  4A6Q A;  4IQV A;  3QHT A;  1D4B A;  4IQU A;  4RUC A;  3IXS A;  2WU2 B;  1ZQL A;  3A4R A;  2N7J A;  2WDT B;  1BPE A;  2PMV A;  8ICQ A;  2ZW0 A;  2J0K A;  1FD6 A;  2MBH A;  1IG6 A;  2VA3 A;  9ICW A;  4DFJ A;  1NKB A;  5KFP A;  4LDT D;  1ZQK A;  3PNC A;  2IHN A;  1WF9 A;  4ECR A;  1P7D A;  3IN5 A;  4GXK A;  3SMV A;  7ICI A;  3VH3 B;  1VCB A;  3WAO A;  4C4R A;  3D32 A;  1GNU A;  4ECY A;  2IY1 B;  2PKO A;  3F5E A;  4BVU C;  3TMP B;  2UWQ A;  1YT3 A;  4NY8 A;  4TUP A;  5J18 A;  1ZQT A;  4DQQ A;  3FM9 A;  1T8E A;  4PPX A;  2LAS A;  8ICW A;  2PVO D;  3ZIM A;  2N7D A;  2YY6 A;  1QSY A;  4WAF A;  1KN5 A;  4ARI A;  2PFP A;  4QIW F;  1J2M A;  4P0P B;  2KTQ A;  3H9D A;  3NUH B;  2KIC A;  2HBJ A;  5B5E U;  9ICC A;  2HVI A;  2IGG A;  4AJY B;  3PGE A;  1GO3 F;  2JH7 A;  3RF9 A;  2BB6 A;  1T0S C;  2R8I A;  2IOF A;  4YMO A;  4ECU A;  4ED0 A;  1F2R C;  1S0O A;  3FC4 A;  2NBW B;  9ICN A;  2LVP A;  2NBV B;  2M56 B;  3DHI C;  3JSV B;  4OZC A;  2L83 A;  2BZF A;  4UB4 A;  2FPM A;  3KTQ A;  1I4R A;  3RFZ B;  1JXE A;  3WKE A;  2LI5 A;  9ICM A;  1WE7 A;  2AX5 A;  2KMD A;  3R2T A;  1WCN A;  3BYY B;  2W54 A;  5DCN A;  3VTV A;  4K3C A;  3OJ3 A;  3ZDM C;  1FRR A;  3PS6 A;  1IM4 A;  2GBJ A;  4QJF B;  2K8B B;  4RNO A;  3MFH A;  4GC6 A;  3PLU A;  4MGY E;  4EBC A;  2ASD A;  2WX0 A;  1A5R A;  4WWP A;  2ASL A;  2AJQ A;  1XLP A;  1RWS A;  1WGD A;  4BWM A;  3WK5 A;  2BQ3 A;  3RAX A;  1QKZ A;  5E6N A;  4TQ0 A;  4LZD A;  2OED A;  1GB4 A;  4M04 A;  5AI4 A;  2V4Q A;  4F4Y A;  2NTS A;  2WYQ A;  4Z6E A;  4FHJ A;  3R9K A;  4EYH B;  4Z6C A;  2KLG A;  3PRZ A;  3KW5 B;  4QZA A;  4LZG A;  3H1U A;  4ASW C;  1L5P A;  3PRP B;  1PZN A;  2JPH A;  4JLC A;  4ECX A;  3DPD A;  4ZRP A;  3EHV A;  2K4I A;  2LJI A;  1L3V A;  2WS3 B;  1TS4 A;  3KZX A;  4XGA B;  2ZCC A;  1TKD A;  1ED1 A;  4RPZ A;  3HHM A;  4UB2 A;  3Q8Q B;  4KLU A;  1YOV B;  3HW8 A;  2XCP A;  5CP2 A;  1XSL A;  3N30 A;  3C23 A;  4ANX A;  3W9C B;  1TKY A;  1TFR A;  1Y88 A;  1PYW D;  4RH6 A;  3ZNH B;  3NTU A;  2KE7 A;  4Y2Q A;  8ICO A;  2ONQ A;  1YIW A;  1KOT A;  3IDW A;  3NS8 A;  3ZNZ B;  2QEJ C;  8ICV A;  4MH0 E;  4EOY A;  3D2N A;  4C4T A;  1VJ5 A;  2Y0S F;  3MHZ A;  5CHW A;  3QC8 B;  4DL3 A;  2ACZ B;  1E8X A;  5H8Y E;  3PR4 A;  3C5F A;  3C5G A;  5AHX A;  5E6J A;  4MF2 A;  2KFK B;  3N1Z C;  1ZQO A;  2HHT A;  3QIJ A;  2AQ4 A;  2ZPN A;  2V3S A;  4RT3 A;  4EFO A;  7ICK A;  1CQV A;  4A3O A;  1TS3 A;  5HR7 A;  4XRH A;  2EQY A;  2J6U A;  1ESF A;  5FKA C;  4RQ1 A;  1Z1B A;  3LXF A;  3LWL A;  3K4G A;  4YXJ A;  4MEX A;  2JXX A;  2KQ7 A;  4WJP A;  3B0X A;  2DWQ A;  2R18 A;  4C7Y A;  1SL2 A;  2X8X X;  1FCC C;  1L6N A;  4MEL A;  4NLG A;  4IM0 A;  4K7W A;  4EBE A;  1T3Q A;  2NO5 A;  3TEX A;  5KG7 A;  2JRI B;  5DG9 A;  2KWD A;  4A3P A;  3CP8 A;  5AIB A;  2BVC A;  3BQ1 A;  2HJ1 A;  4KN4 A;  1T3N A;  2JEF A;  4NL9 A;  5IIO A;  3AQF A;  4YN4 A;  2HHQ A;  2KC1 A;  1T0Q C;  4F4X A;  4IC7 B;  4C8L A;  1KLG D;  4JQW C;  4LJX A;  2L3Z A;  4RT2 A;  5BOL A;  4A8X C;  2PMZ C;  4I2A A;  5KFN A;  1NEN B;  3H8J A;  3KD3 A;  4GGQ A;  1XF5 L;  2YMQ A;  3DHG C;  3A1Q B;  2QKQ A;  4KLH A;  3H0R B;  1K51 A;  2V9H A;  1ZGU B;  2ON8 A;  4UAR A;  3Q8K A;  1N63 A;  1ZDX A;  3AU5 A;  2MSN A;  3F5A A;  2DZJ A;  3IRU A;  3ZQ4 A;  1TIF A;  1UNS A;  3AUL A;  4IM3 A;  2KTF A;  2N9E B;  2R2Q A;  1DK3 A;  4NJ7 A;  4Z6D A;  4C7Z A;  4JPS A;  3N1Y C;  1UZX B;  3GZN B;  3Q14 C;  2IOF K;  4PYZ A;  1V38 A;  3X23 A;  3GIK A;  2WXQ A;  3APF A;  5ALS A;  2ZUC A;  1XU4 A;  3M9O B;  4F71 A;  3ISC A;  1SF0 A;  4MM3 A;  4FJV B;  4I29 A;  1L3T A;  3HIZ A;  1YQ3 B;  3OJ4 B;  3DEE A;  4CE6 A;  1E8Y A;  4RU9 A;  4WJN A;  2V9W A;  1TGZ B;  4EEL A;  3ZUN A;  1F52 A;  3PMN A;  2AL3 A;  3T3O A;  4RQ2 A;  1WGH A;  2MW5 A;  9ICS A;  3B08 A;  3CW2 C;  3NZ3 A;  4NL9 C;  3B1L X;  2KWU B;  4I2G A;  1S77 D;  1WWU A;  3J9C A;  1BUI C;  2KQ4 X;  2WXG A;  2YVC A;  4NQK E;  5HI1 A;  1P1A A;  1UHU A;  3GIM A;  2HVH A;  3WAP A;  4BOS C;  2VH2 A;  3IT4 B;  4JWU C;  1TK8 A;  3PX0 A;  2WF6 A;  1KDH A;  2K9X A;  2V4L A;  4CO7 A;  4P4O A;  4JWM A;  1YQ4 B;  2IO1 B;  3WAM A;  2JZB A;  2KJ5 A;  5ALQ A;  3TL5 A;  2EKI A;  3H8H A;  2PIA A;  5CHV C;  1AYF A;  1ZQY A;  5DB8 A;  1L6U A;  1ZXH A;  2N1V A;  3UM9 A;  4P6V F;  5DPR A;  2HDO A;  2JZB B;  4ECQ A;  2D3D A;  2HHW A;  2D3G A;  2DHZ A;  1Z00 A;  3VUW A;  3PW4 A;  4DCC A;  2AU0 A;  4MHV A;  5TR5 A;  2YX8 A;  3QWZ B;  5AK5 A;  1I35 A;  1MPE A;  4BXO A;  1D5M C;  1ZP0 B;  2J52 A;  2FE9 A;  3T5J A;  1QZE A;  3T9L A;  5DBB A;  2D2Q A;  4AQ7 A;  2XK5 A;  2DZK A;  4DLG A;  2DKX A;  3ISD A;  4F50 A;  1CRX A;  2K5P A;  2WDV B;  3U8Z A;  2YN4 A;  3MJW A;  1VDV A;  1HQR D;  2OWO A;  1JWM D;  3PZ8 A;  4YMN A;  1NJZ A;  1HTO A;  3KKA C;  3PVX A;  1VD2 A;  3L3F X;  3PW0 A;  4BZA A;  3L5K A;  2D5G A;  1ISN A;  3APD A;  2W11 A;  4U7C A;  4W9D A;  2Z59 B;  5D3D A;  4Q8E A;  3O65 B;  1SKR A;  2LUM A;  2C7N B;  4R65 A;  3OWE B;  2KFN A;  1U4B A;  2KNJ A;  5ALG A;  4YQW A;  1RFK A;  5JRT A;  3PX4 A;  2ZIX B;  1ZQE A;  3V62 A;  3VUY A;  3ISB A;  1EU4 A;  3PV1 A;  3W2D A;  3NAS A;  3A9K B;  1IV8 A;  2NYV A;  5AKJ A;  1TVA A;  4QAY A;  1TAU A;  4A9A A;  4RF0 A;  4Z6F A;  1T5X D;  1KSP A;  4PYU A;  2F1I A;  2F44 A;  1WMH A;  1SWW A;  4GN1 A;  2CJO A;  3KUD B;  2XC9 A;  1RDF A;  3V7L A;  3SDL C;  4DEZ A;  3VUX A;  5KT2 A;  5DB9 A;  2M8S A;  3QJZ A;  1QOA A;  2MRP A;  4YTP B;  4KLI A;  4RQ3 A;  4DSI A;  1VRA B;  1IIP A;  2KN5 A;  3OHB A;  4PT5 A;  2VH1 A;  3R3M A;  4TQS A;  4ZHO A;  3HJE A;  2WF7 A;  2KMA A;  3AB5 A;  3HVD A;  2XY7 A;  2PEA A;  4AP9 A;  3AEV A;  5JUM A;  2HOQ A;  4RF1 A;  2KT7 A;  1LXD A;  2BCV A;  2J53 A;  1E6E B;  4C4V B;  2XI9 A;  9ICQ A;  2BQR A;  1FIQ A;  1Q3U A;  4OVU A;  4RQN A;  4QWA A;  4IRK A;  3R7Q A;  1LV5 A;  1RFA A;  4OJ5 A;  3NZU A;  4HPP A;  3BS5 B;  2W9C A;  5ALX A;  1SKW A;  1C9F A;  2KTR B;  3AE4 B;  2KAC A;  3BZD B;  3NVW A;  2CS4 A;  4AYB C;  2ZIU A;  2WXI A;  1SIF A;  2GO7 A;  4IRC A;  1KKX A;  2X38 A;  3NY5 A;  4KIT B;  3N7R C;  1K52 A;  4GXJ A;  5HKH A;  1URJ A;  1I4H A;  3SAG A;  1JAL A;  3ZVV A;  4XC2 A;  4IR9 A;  1XT9 B;  2VKQ A;  1DOI A;  1WXA A;  2FCS A;  5E6P A;  3QU4 A;  4Q45 A;  5DB6 A;  2AYO B;  2NPT A;  1CJE A;  1YN3 A;  1ZKH A;  4RM8 A;  4ACO A;  4C00 A;  2QSD A;  1JMS A;  3IBE A;  2V0G A;  1V80 A;  2JX5 A;  3R2I A;  2MH7 A;  3U4E G;  3JPO A;  1UT5 A;  1RRB A;  3N7P D;  1N56 A;  4W9F A;  5HHD G;  4K81 A;  2EKE C;  2PTL A;  3RNC C;  2W7P A;  1ZQW A;  2ZTC A;  2I2Y A;  1H38 A;  1L8O A;  2GI9 A;  3BQ7 A;  2RDG A;  1Z4O A;  2JEJ A;  2HCF A;  1I4G A;  1FXI A;  4RNA A;  2Y5C A;  4BAX A;  4K4I A;  2KJ6 A;  1X9X A;  1FEZ A;  2KHW B;  4JWS C;  5HP4 A;  3LWM A;  2UVU A;  4CGZ A;  3BVM A;  1C4P A;  1LO5 D;  1B22 A;  4EEY A;  4I27 A;  2RDI A;  4BKG A;  3PZ7 A;  1PGB A;  5KFI A;  1PVR A;  2KDF B;  3LDA A;  2XGQ A;  4O3Q A;  3GS2 A;  3JPP A;  3E0F A;  4RQ4 A;  4NM2 A;  2KJ9 A;  5KFD A;  2WXH A;  1CUK A;  4I2B A;  3M1Y A;  5BOM A;  2G06 A;  1C7Y A;  4RM9 A;  2HD5 B;  1XO3 A;  2W9B A;  4DHZ E;  3V6E B;  3KHG A;  4YL8 A;  1P9D U;  2FUG 1;  2K60 A;  2WXP A;  4O5E A;  3B0A A;  1BNO A;  3MP9 A;  1WYG A;  2V4I B;  5AK4 A;  3GZN I;  4CF3 A;  4TQ1 A;  1YJ1 A;  2HW3 A;  4XA5 A;  2A4Z A;  1N5X A;  5CJ7 A;  4PZO A;  4EX7 A;  2DL0 A;  7ICS A;  3V72 A;  3RBE A;  1GPX A;  2KX3 A;  5KT3 A;  1D8B A;  1C20 A;  4IR1 A;  3AEA B;  4NXZ A;  3RJK A;  2BCR A;  2JH1 A;  1FNW A;  4OO1 J;  1WX8 A;  4KIK A;  2K8C A;  3DCG A;  4ZHP A;  4MGK E;  4YR2 A;  1OW5 A;  3G6Y A;  2RSU A;  1K50 A;  2E5S A;  8ICC A;  3CWI A;  3PPA A;  3BS5 A;  2KIV A;  1P98 A;  4J6I A;  3JPR A;  4US8 A;  1ZQV A;  3DV9 A;  3T5H A;  4DXG A;  1ECW A;  4UB3 A;  4UAT A;  3RH4 A;  2ZG6 A;  4UAS A;  3BII D;  1PK1 B;  1JWS D;  2ISO A;  1UA0 A;  2KZZ A;  2BKF A;  2CHW A;  4E71 A;  2RRD A;  4KKI A;  8ICN A;  4PZN A;  8ICT A;  3DVN V;  3KYC D;  2OH2 A;  3AH7 A;  5ALM A;  3P4R B;  4JWN A;  1EWC A;  5KFY A;  4GSW A;  4QNL A;  3OGU A;  2PPH A;  1S5L U;  3ORY A;  3H40 A;  5ALP A;  2V4R A;  4F3O A;  2ZJA A;  5G5G A;  1SJH D;  3IM1 A;  1COO A;  3FKY A;  1Q3V A;  1P0R A;  3ZRF A;  3JPQ A;  5JXV A;  2JZ3 B;  1TE2 A;  3IFW B;  5C23 A;  3ZJV A;  3MR3 A;  2DAF A;  4LK0 M;  1D9D A;  2KZM A;  4KLL A;  4G50 A;  2DBY A;  4KSK C;  4YVZ A;  2R8H A;  3M9N B;  5DG7 A;  2ISP A;  4J9L A;  2H3V A;  5TSS A;  1U45 A;  4FO6 A;  1V86 A;  2BF8 B;  4IDI A;  2LM4 A;  2IO2 B;  2LVQ A;  1A77 A;  2Q0Z X;  4A8E A;  5DDY A;  4BKT A;  4GC7 A;  4B0E A;  2LD9 A;  1QQ7 A;  3GV7 B;  1Z5S B;  4BGD A;  1HUO A;  3KUC B;  3PHW B;  3UMB A;  2LBO A;  2E8O A;  3ZGZ A;  4DDI D;  2RLT A;  1DOQ A;  1SEB D;  4Q2J A;  7ICT A;  3RB0 A;  2Y9T A;  2O6K A;  2I1J A;  1ZXI A;  7ICP A;  4YTN B;  1Q5W B;  2MHJ A;  3EC8 A;  3K1Z A;  3VRB B;  1J97 A;  4WJQ A;  3MR6 A;  1YN4 A;  2JZP A;  2YLM A;  2MEK A;  1UQV A;  2IZV B;  1FNV A;  2JGA A;  5KFM A;  3RNG C;  2HTM E;  3SV3 A;  1L0V B;  4NM1 A;  3EA6 A;  3AE2 B;  1J7B A;  1NVI D;  2W04 A;  3RD2 A;  2BYT A;  4QW9 A;  1ZQU A;  5CR0 A;  4N58 A;  1M6Y A;  2DQN B;  5F3X B;  3A9J B;  3ZTC A;  2LGI A;  3URY A;  4KZ0 A;  3MC1 A;  2AQ0 A;  2JU6 X;  4Y2S A;  3KVF B;  3QAQ A;  3OSP A;  5AM5 A;  3R66 C;  2LYA A;  1HTQ A;  2IDY A;  2QCZ A;  2FCN A;  4IKG A;  2W3S A;  5GTH U;  4I2I A;  3DWM A;  3C2K A;  2WX1 A;  1JRU A;  4PL1 A;  4K4H A;  1JXL A;  1ZUD 2;  3H0L B;  2KMC A;  1WSP A;  5AKY A;  4J9O A;  1FFV A;  3EW9 A;  2F1J A;  2KD0 A;  1VZ6 A;  4O3N A;  3ZDE A;  4EZL A;  4KGT A;  4QZI A;  4WQO B;  5BMH A;  3RFA A;  3N7S C;  1NZB A;  1V1P A;  4MSM B;  2PVG C;  2HMX A;  4MGZ E;  1WGK A;  4HVB A;  7ICO A;  3V6C B;  3KOO A;  3PY8 A;  4JK1 A;  2JMG A;  2RQ5 A;  4OCZ A;  5H2F U;  2C60 A;  3GOE A;  3T5L A;  2XY6 A;  1C79 A;  1JWU D;  3QU7 A;  1COK A;  3BVZ A;  3RPF C;  3UXO A;  1WM3 A;  4B6J A;  2DZM A;  4XWT A;  3H0M B;  1PVP A;  5J2K A;  1QOF A;  2J7Q B;  5AZG A;  4KLJ A;  3HIL A;  3QYP A;  4YG2 A;  4JB3 A;  4ECZ A;  4M9H A;  1C76 A;  1WXM A;  3TUO A;  4ECV A;  1AQ6 A;  1YX5 B;  4R3D A;  1GJZ A;  1E10 A;  4KLM A;  3MGV A;  3KKA A;  1TTN A;  1L5U A;  2LXC A;  1T94 A;  4P4P A;  4RZR A;  5KAI U;  4M9N A;  4OW0 A;  2IO0 B;  3TSS A;  1EUV B;  4UBB A;  1WJ6 A;  8ICX A;  3ZD8 A;  1FM0 D;  4IW0 A;  7ICF A;  3AEG B;  3WK4 A;  3LDZ E;  4P1B C;  1Q46 A;  4IRD A;  2O6V A;  2LRW A;  3TIX A;  5AIA A;  4OJL A;  2M0X A;  3SZ2 A;  3H7P B;  2G4D B;  3MHS D;  3ED5 A;  1YMH E;  1L3S A;  1ZW7 A;  1SKS A;  2BS3 B;  1WWV A;  5ALL A;  1UF0 A;  1FCL A;  5J2R A;  2BCS A;  2KFJ A;  4DHJ B;  2L1A A;  4QZE A;  5KHQ A;  4C4V A;  2CPR A;  5ALH A;  1NJY A;  4C56 C;  1MC8 A;  2L0T A;  5BYQ A;  5A0L A;  5CA7 A;  3P42 A;  4RNM A;  1CMX B;  2M0A A;  3V7K A;  4F5P A;  3UMC A;  4WWO A;  5AI0 A;  2W8K A;  1ZQF A;  3M8R A;  2KZ3 A;  2BDU A;  5JU5 A;  1S0N A;  3PML A;  3AQE A;  2BPG A;  2ZJD A;  3TAR A;  4YSZ B;  2MSE D;  1V81 A;  4DF8 A;  1NNL A;  4U6P A;  3OAW A;  3R8B A;  2BGF A;  4NAW B;  2DUY A;  2JVC A;  3BK2 A;  2PI4 A;  4O3O A;  4DOA A;  5DBA A;  3GE3 C;  1D8L A;  4HLE A;  3UQA A;  3VDZ A;  1BPD A;  3B2G A;  1ZYQ A;  4K7U A;  2K4H A;  2NTT A;  2NRV A;  2KDM A;  2ZJ5 A;  4FHK A;  4JUZ A;  2HHU A;  4KGS A;  3V60 A;  5EE1 A;  1IYF A;  5AK6 A;  8ICP A;  3RB6 A;  1XXG A;  2TSS A;  3KYD D;  2OM6 A;  4ELV A;  4O3M A;  4G3I A;  4PHE A;  1RQN A;  4BJQ A;  1ROE A;  1TKG A;  3E56 A;  9ICX A;  2QJL A;  3ECI A;  5FR6 A;  2LUE A;  3QZ8 A;  3SAF A;  7ICU A;  4MFA A;  5J2A A;  3PSE B;  3E2E A;  2HBL A;  4I2D A;  1K8R B;  2N9L A;  3I9V 1;  5HG2 A;  1RXW A;  3SFE B;  3Q69 A;  4B9K A;  2O2V B;  7ICR A;  2KVC A;  1FXA A;  2YB1 A;  4KLO A;  4O3R A;  2Y1I A;  1C1Y B;  4CQN A;  3A0B U;  5J0R A;  1OUQ A;  5KFH A;  3SYZ A;  4DL7 A;  2D3C A;  3MJ5 A;  3GU3 A;  4DFM A;  4B9L A;  1NK4 A;  3EZ5 A;  3M7D A;  2FUH B;  1MN8 A;  3IHQ B;  2A1A A;  3GV5 B;  4E0D A;  3RI7 C;  1K5O A;  2FJ6 A;  5AKK A;  1A76 A;  2ALZ A;  2FMS A;  3SQI A;  3TEY A;  3P4S B;  1UD7 A;  2UVW A;  3JPS A;  2AGO A;  2R61 A;  1PGX A;  2G0A A;  1PK1 A;  3B0Y A;  2AQ2 B;  1SGG A;  5G5H A;  1GUA B;  3GIJ A;  3FAH A;  2DPI A;  1GAQ B;  4Q43 A;  1CI4 A;  5KFQ A;  4ED3 A;  3JSV A;  3PHX B;  4IQT A;  5J2H A;  3PRM B;  4A55 A;  2H3I A;  2KV2 A;  3Q3M C;  3QUQ A;  1ZQH A;  4BDP A;  1XCQ L;  2KJH B;  3IP4 B;  1XS9 D;  3C28 A;  1X9M A;  4YCX A;  1XCT L;  2JEG A;  3HPO A;  2KX0 A;  1V8C A;  1RZT A;  9ICJ A;  1TK0 A;  5KL1 B;  2K8A A;  5HHI A;  1A70 A;  2CHZ A;  3H7P A;  4JL9 A;  3H7S A;  2NBU A;  5DLG A;  1HZ5 A;  1Y56 A;  3VVW B;  2W03 A;  4ANV A;  2W8L A;  3JVZ X;  5D2M B;  1DGJ A;  5HMM A;  8ICI A;  4NZL B;  1XLQ A;  2I6X A;  4Q44 A;  5L1I A;  5KG6 A;  1R4M I;  3L54 A;  4I6L B;  1QQR A;  3QUT A;  1LKY B;  2BYF A;  1UGM A;  2C2R A;  4B9M A;  2G3Q B;  2RGF A;  3L17 A;  5AM4 A;  1SV0 A;  2MRL A;  2KLC A;  1C77 A;  4NQL B;  4MF8 A;  3MGH A;  1V5O A;  1MG8 A;  2IMW P;  4ED6 A;  4B9T A;  3QQ8 B;  2WF9 A;  4DHJ D;  2WWZ A;  1QQ5 A;  2WXR A;  2A1J B;  4KLF A;  3ZLZ A;  1L8L A;  4DFP A;  4CDG A;  1BML C;  3BY4 B;  3KLS X;  4IM2 A;  3IVF A;  4XWW A;  2A19 A;  3VFK A;  2E1E A;  3TKA A;  2O6V D;  4KX3 A;  4D2K A;  1MG4 A;  3JW0 X;  1YN5 A;  3WAN A;  4W9L A;  3T8M A;  4JGH B;  3H7I A;  4RNN A;  1ZQB A;  4M9G A;  4YXD B;  2JUO A;  3AU2 A;  4OZA A;  3B9J A;  4LJO B;  2B6G A;  3KFU F;  2JZZ A;  3DVN U;  4EEK A;  3UQB A;  1QF6 A;  4Q8F A;  3RJH A;  4YSY B;  5D3I B;  1DXS A;  3IV6 A;  4TMA B;  3N97 B;  2KDI A;  2RPQ A;  2ASJ A;  5J2G A;  2XK5 B;  3DBH B;  4IQW A;  4DQI A;  1N48 A;  2KK0 A;  2VRR B;  1XEE A;  5CTR C;  3RNE C;  2HE7 A;  5KFV A;  4PGX A;  2WF5 A;  4FJZ A;  4I2F A;  4B9N A;  3QA8 A;  3A33 B;  4XDD A;  4KTQ A;  1WGY A;  4JIO U;  5E6O A;  1D5X C;  4UAV A;  4M8M A;  1LVH A;  4FLH A;  1HUZ A;  4C80 A;  5HML A;  4P0Q A;  4M9J A;  1R4M B;  1P7F A;  2I9G A;  3NVY A;  3PV8 A;  3L08 A;  4KMO B;  4NWI A;  2Y9U A;  3RNB C;  4USA A;  2ZIW A;  5AI9 A;  4DS5 A;  2XNA C;  3UIN B;  4BBN F;  4DK5 A;  1H4R A;  1V2Y A;  3RMK C;  5DG8 A;  3SU8 X;  4F5Q A;  1QT9 A;  2SEB D;  2RHF A;  4JV1 A;  2B76 B;  3H4B A;  1C78 A;  1OTR B;  2WDQ B;  3DBR B;  5C3J B;  5JHB A;  3D2S A;  4ZDV A;  2GBN A;  2NO4 A;  3HKZ F;  1L7Y A;  1F77 A;  1TK5 A;  4F2S A;  3MGI A;  1ZQS A;  2B3A A;  1L7P A;  1Z4N A;  5L1K A;  3GE8 C;  3AEE B;  2ZXH A;  2YTU A;  9ICU A;  4RPY A;  2GH1 A;  4MFF A;  1KJT A;  4HJK A;  2AHO B;  3VR8 B;  2I1K A;  2N9P C;  3NUQ A;  1ZOY B;  1XSP A;  2JWZ A;  3BVG A;  3GZF A;  4QW8 A;  4BX9 C;  3LJ3 A;  4FZM A;  3EUB 2;  3NOB A;  2ZNV B;  3TI0 A;  2ZIV B;  2BDP A;  3EPI A;  4DQP A;  5L95 C;  1E7P B;  5ALT A;  2R8J A;  2GB1 A;  4HKQ A;  3I1Y A;  4II2 B;  4B9U A;  1ZQZ A;  5J2E A;  2G1E A;  2JYE A;  5CEH A;  2WXJ A;  1LQB A;  3ZD9 A;  2M19 A;  2MP2 A;  9ICI A;  3OG5 A;  3Q2A C;  2BPC A;  3THV A;  3W5U B;  3UI3 A;  4R66 A;  3UPQ A;  3U2S C;  1SV4 A;  4TUQ A;  2KXJ A;  3AEF B;  3SR6 A;  1T0Y A;  1F2R I;  1PVQ A;  3VC8 A;  4YR0 A;  3TAP A;  4BWJ A;  2DX5 B;  3AE9 B;  2SAK A;  4J9M A;  3AN1 A;  5AI8 A;  1ZPS A;  5J0T A;  3NG0 A;  5ALF A;  3PLV A;  4GDK A;  3TAD A;  1BPY A;  2WXO A;  5AKX A;  1YJJ A;  5BPC A;  1DOY A;  4H2A A;  2K4P A;  2EMT A;  5AM3 A;  3CMM B;  1ZQJ A;  4EEW A;  2Z0E B;  1S0M A;  5KFF A;  2YQE A;  1QSL A;  5J2F A;  2NRW A;  4DLE A;  3VTW A;  1WJU A;  4RPX A;  3Q8A A;  3H8S A;  7ICM A;  1WXS A;  2BBC A;  1WG8 A;  5KHO A;  5D4B A;  2KVZ A;  5T8I A;  2GOW A;  4G3X B;  4A90 A;  4AUQ C;  4B9S A;  2EH9 A;  1O08 A;  1WRI A;  4F91 B;  5J0P A;  4I6P A;  1XO1 A;  3N1X C;  2W9N A;  1B4F A;  4MAC A;  4DF4 A;  2H89 B;  4ZRQ A;  1DRG A;  3Q8E A;  2KAJ A;  1MHH E;  4F5N A;  4HPM B;  2KN4 A;  4KSL C;  3F2B A;  3IG5 A;  4KN7 A;  3OSN A;  4J3O D;  2Q4T A;  3PO4 A;  1ET6 A;  3AMZ A;  7ICE A;  5DB7 A;  4LLG M;  4J03 A;  5KT4 A;  1Y8R C;  4IUM B;  3N28 A;  2OXO A;  4L1B A;  4GXB A;  2MCN B;  3WIM A;  2W9B B;  2Y5B B;  4DS4 A;  4HRS A;  1G6J A;  2LKY A;  5K4L A;  3Q8B A;  4J9K A;  2F1H A;  2D07 B;  1JWB D;  2L52 A;  1V1P B;  2MU2 A;  2OJW A;  4FUL A;  3N20 C;  4ECT A;  4HPL B;  1NK6 A;  3TAQ A;  2CRX A;  3ZDD A;  2AEH A;  2MBQ A;  4DL4 A;  4XQ8 A;  1D5Z C;  2QB0 B;  1SBB B;  3HRD D;  1ZD4 A;  4DO9 A;  4RUA A;  3RUI B;  3WKA A;  4CF4 A;  3RB3 A;  1NZP A;  1UT8 A;  1QOB A;  5DPW A;  4UAU A;  2ZIV A;  5EE3 A;  2MP2 B;  3ML9 A;  5I4D A;  2VA8 A;  2MA9 B;  3WU2 U;  3VCB A;  4LNN A;  2K8B A;  2GOL A;  1MJD A;  4MDK E;  2NCN A;  5H92 C;  1RYJ A;  5KFJ A;  3GB1 A;  3PR5 B;  2LEK A;  5C5J A;  1RYS A;  3EEC A;  5B66 U;  4PHP A;  4UAW A;  3ZYY X;  3RNF C;  3O0F A;  1F0Z A;  4S0R A;  2INC C;  4WAA A;  5EWF A;  2VAN A;  2IPK D;  3ONN A;  2J0J A;  1NEK B;  2W43 A;  3MDA A;  1ZDV A;  3AE6 B;  1SL0 A;  4DHZ B;  3UMG A;  3I57 A;  5C1Z A;  1BPB A;  1UGJ A;  5IAA C;  2XGP A;  2L32 A;  2RMM A;  3MBY A;  3SAH A;  5EDS A;  3ETL A;  3I76 A;  3C29 A;  2AQ1 B;  3C0R B;  2PXI A;  3AU4 A;  3ZNI D;  2GLS A;  2LRU A;  4Y2X A;  4DSF A;  4I2C A;  2GMI C;  3RJI A;  3ZDT A;  1L0X B;  4O3P A;  3Q8P B;  1T6B X;  3RZW C;  1KFD A;  2FDR A;  4EX6 A;  3ZXR A;  1B9R A;  4UB1 A;  4EZ9 A;  3M3J A;  2N9X A;  2EAO A;  4F5R A;  2K1F A;  1UH6 A;  2JRH A;  2INN E;  2FLN A;  1BPX A;  3PSP A;  2KKP A;  2P6R A;  1YNT E;  4Y2V A;  2FPL A;  2I5H A;  2WF8 A;  2QDF A;  3ETR A;  1UEL A;  1A6S A;  2K6D B;  5CX3 A;  3EGR A;  1Q1O A;  1OGW A;  2EAN A;  8ICG A;  2L5Y A;  2PMZ F;  4HRO A;  3TCA A;  2IND C;  2N7E A;  3C21 A;  5KT6 A;  2JSV X;  2D3A A;  1X6J A;  3WKD A;  4HAI A;  3AE3 B;  2KMM A;  3TFS A;  4GDL A;  2VIX A;  2QLT A;  1VR9 A;  2CKH B;  2LGD A;  5DDM A;  4NAM A;  3AU6 A;  1V5T A;  1SXD A;  2VZK D;  1TZO A;  2Z7J A;  1KBU A;  8ICJ A;  4OD0 A;  3G6X A;  1LM8 B;  7ICQ A;  4GDK B;  1XO0 A;  2HOI A;  2OYY A;  4MEM A;  3A4S C;  3QCA A;  3PVL A;  4HK2 A;  8ICU A;  1SE9 A;  2F76 X;  1ZQI A;  5DQG A;  1J19 A;  5BYR A;  4LCD E;  1ZOL A;  4ZOH C;  3EPG A;  1ARO P;  5J8Y C;  3GIL A;  3Q8L A;  4GXI A;  4DQS A;  3ZJT A;  1DGS A;  5IN7 A;  2BPS A;  4R8U A;  4XDC A;  3P4P B;  4KDI C;  1U49 A;  5ALV A;  2D8C A;  4WJ3 B;  4XZ4 A;  3CIR B;  1F0M A;  1IPG A;  5ALZ A;  1U48 A;  1NK9 A;  4KGR A;  2L7R A;  3F2C A;  5J0Y A;  1BXT A;  4GIV A;  1HA5 A;  1TAM A;  4MH8 A;  2Q5W D;  2FLP A;  4HWI B;  4XYC A;  2HI0 A;  2ZW1 A;  3VTU A;  4F2R A;  1AW7 A;  5ALO A;  4DL5 A;  5HFY A;  2MUT B;  5KFE A;  4HEA 1;  3DQV A;  1LFD A;  1EU3 A;  3LB8 C;  4BBN C;  2H88 B;  2ATL A;  1WR1 A;  2C7H A;  2L8J A;  4FJY A;  2LYB A;  4J9R A;  4KV2 A;  2LXA A;  5AM2 A;  3DBL B;  2WFA A;  1KL9 A;  5KFW A;  4P0Q B;  2XID A;  2DKZ A;  2KAN A;  4M02 A;  4RQ8 A;  2JQR B;  1Z00 B;  3VXW A;  1R4N B;  3SD7 A;  5J29 A;  3V6K A;  5LXI B;  2WXN A;  2H3Z A;  4QZB A;  3VR9 B;  5J2D A;  1X66 A;  2MWS B;  1KFS A;  3AE1 B;  5CRX A;  5EE0 A;  1ZD5 A;  2N9K A;  2JHD A;  3ALB A;  3MAB A;  2DYM A;  5ALU A;  5EE9 A;  2QAR A;  4EUT A;  5HNK A;  3CNH A;  4AOF A;  4DFK A;  4UDU C;  1IGD A;  1SSN A;  2E8N A;  5KTQ A;  3IHP C;  1KTK A;  2DZI A;  1KTQ A;  3BK1 A;  3RB4 A;  1QIL A;  3T3N A;  1QQ6 A;  3ABV B;  2Z8L A;  2M1M A;  2XN9 C;  4M47 A;  5F9L A;  1PGA A;  4EKU A;  1IP9 A;  5D46 A;  1QLB B;  5LLI A;  4M2Y A;  4LNF A;  2EZX A;  5ALD A;  1ZQM A;  1GOZ A;  4XX5 A;  3WCQ A;  2JYT A;  3UIO B;  1MI0 A;  3DVG Y;  2K4E A;  2NRX A;  4NJC A;  5C2T B;  3QX1 A;  1C4A A;  1MHX A;  1KLU D;  2LWP A;  3OJS A;  2LYH A;  2GBR A;  1EM7 A;  2BS4 B;  2WHI A;  4LNO A;  1V97 A;  4W9I A;  2CU3 A;  1Z2M A;  1FRD A;  2WGS A;  1MSW D;  4F93 B;  5CWR A;  3RH6 A;  3SHQ A;  4B0M A;  2HBK A;  2AGP A;  1VLB A;  9ICH A;  2XY5 A;  2K0P A;  3W1S C;  3CF6 E;  3P2B A;  4URK A;  4DL6 A;  2BT6 A;  2ZIX A;  1X6I A;  5TZV A;  2NV3 A;  4ZRK A;  4PHA A;  4FS2 A;  4MSQ B;  2A3V A;  2ASQ A;  1WZ3 A;  2LGS A;  4F92 B;  3ZTD A;  2PE6 B;  1FXT B;  4OVZ A;  5DGB A;  2W9C B;  1X40 A;  4WUR A;  4WWN A;  1R7S A;  4ECS A;  5BMG A;  3IT6 B;  4ED2 A;  2C28 A;  1S1Q B;  3J81 j;  4AP4 C;  1PK3 A;  2W3R A;  5JTI A;  1PDX A;  3RRG A;  1NKC A;  4F7Z A;  3T5K A;  1MFW A;  3D2Q A;  3M6Z A;  2KVS A;  2KQS A;  2R2O A;  1VZ8 A;  2J6S A;  2YML A;  2CU1 A;  3Q3O C;  4MEY A;  1NKE A;  2BW2 A;  1E7U A;  3AED B;  2NRZ A;  2MJE A;  1FMA D;  2N4F A;  4KIK B;  3NRW A;  1GB1 A;  2YB4 A;  2UYZ B;  2XEW A;  2D3B A;  3VH4 B;  4DOC A;  3JYU A;  4B9V A;  1JW9 D;  3MC8 A;  4RGN A;  5AK3 A;  2PLP A;  4WIP A;  1KRP A;  2J42 A;  1FFU A;  1EO6 A;  4IG7 B;  3RH5 A;  3FIL B;  1NOM A;  4GU2 A;  5KFG A;  1Q0W B;  4FBJ B;  4FS1 A;  2L05 A;  3RRH A;  3HVZ A;  4O1N A;  2BHN A;  4DL2 A;  3U52 E;  3BYT B;  2EAM A;  1TAQ A;  3IAS 1;  4II3 B;  1Z1V A;  2YMP A;  3HP6 A;  2KFZ A;  3T3F A;  2K8H A;  3JPN A;  4UW9 A;  1JI7 A;  5IP4 D;  2JXJ A;  3PST A;  3G6V A;  2EZZ A;  3KHR A;  1QLN A;  2Y3A A;  1XWL A;  1L4D B;  3L13 A;  4HDO A;  4G11 A;  4IWQ A;  2LMC A;  2N1W A;  4LVS A;  4UQG A;  3QEA Z;  2FI1 A;  1D9F A;  4ANW A;  1JCK B;  2V1Y A;  1SWV A;  3LYS A;  1WI0 A;  2KHQ A;  4IL6 U;  1NK0 A;  1OQY A;  7ICH A;  2KJR A;  1L7O A;  3N32 A;  3Q8F A;  2JRZ A;  1JIH A;  3MFI A;  2AGQ A;  2MBB B;  3C2M A;  3NRZ A;  5IIM A;  2GRI A;  2QIL A;  4YSX B;  5JH5 C;  1KLV A;  2C9W B;  4UAY A;  3BDP A;  4FE3 A;  2MAX A;  2JWU A;  1SZH A;  3MTN B;  4LNK A;  1ZET A;  4KLQ A;  4NV0 A;  2DF4 B;  1SZP A;  3NS1 A;  2JR5 A;  2ES6 A;  4ECW A;  5DQI A;  5IKC M;  4F8R A;  4GLS C;  1S9F A;  1NJX A;  2DNF A;  3FDS A;  1J8C A;  1GC7 A;  2R8K A;  5ALW A;  2VZK B;  5KG0 A;  2WTF A;  2DPJ A;  2MX2 A;  3E58 A;  4RQ5 A;  2AH5 A;  2UVR A;  4JV2 A;  2XBB C;  4ZH4 A;  5AZF A;  1XLN A;  1WFY A;  1IUE A;  2NPT B;  3PZD A;  3M6K A;  1TY0 A;  8ICK A;  1E90 A;  4DBG A;  1YZ6 A;  1GC6 A;  1M94 A;  3RZF A;  1V85 A;  4QZH A;  1D8Y A;  5GXG B;  8ICA A;  1KM7 A;  1NK7 A;  4RQ0 A;  5KFO A;  4N59 A;  7ICN A;  1N60 A;  1OEY A;  1QCK A;  2W82 A;  1S8O A;  3C1Y A;  5AKZ A;  5J2J A;  3HM6 X;  4K7S A;  1QOG A;  1S0V A;  5AIC A;  4RQ7 A;  5ALY A;  4B95 A;  1PUT A;  2INP E;  1X1M A;  2MBO A;  4CNQ A;  3Q8C A;  2C5L C;  1HE8 A;  2HBM A;  4EZ6 A;  1WIA A;  2NS5 A;  3RJE A;  4QZ8 A;  4GB9 A;  2K39 A;  4R63 A;  2KHV A;  5DLF A;  3I3T B;  5GMV A;  4QWE A;  4EE2 A;  2WB1 F;  4RCO A;  3N3K B;  2OOB B;  2KC2 A;  2OEH A;  1RG6 A;  3TJP A;  2KJ8 A;  1WJN A;  1V49 A;  3QE9 Y;  5IIL A;  3TFR A;  5KG4 A;  5AI5 A;  4KX6 B;  4I28 A;  4IC9 A;  3QZ7 A;  1FNU A;  4ARC A;  3V6H A;  4DSL A;  2EMS A;  4PS3 A;  2BGW A;  5HHH A;  2NMQ A;  2AXT U;  2LHT A;  3ZW3 A;  3ZXV A;  5FK9 C;  3BQ0 A;  4Y2U A;  4PH5 A;  2KN7 A;  4CRX A;  5DGA A;  3DDC B;  5KFL A;  2BCU A;  4KLT A;  4NNJ B;  2MBE A;  2MQJ A;  3F53 A;  2M4N A;  4K3B A;  1S97 A;  1D6E C;  2IBK A;  4M8N A;  4REZ A;  2BPF A;  3AM9 A;  5ALR A;  1WR6 E;  1OEY J;  1HEK A;  1QH9 A;  5J8Y A;  2V3P A;  3LK9 A;  1QTM A;  1WMH B;  4G0N B;  3RR8 A;  3LVW A;  5JZE B;  3A9K A;  1NYR A;  2E1F A;  1FO4 A;  2DFL A;  1Z3E B;  2W9A A;  4J9N A;  1V9J A;  3WA0 A;  4ZRJ A;  2MLB A;  3ZDC A;  4OHJ A;  9ICV A;  1BGX T;  4US9 A;  2HHV A;  5IIN A;  3VQI A;  4CF5 A;  3RAQ A;  4RFB A;  4IWO A;  1X2I A;  2LHE A;  2A1J A;  2IHM A;  5AKH A;  1E8W A;  3AL0 B;  4WJO A;  2LMR A;  5GTI U;  5J0O A;  1ZQQ A;  2IO3 B;  4M6W A;  1U4A A;  1P7E A;  1JN3 A;  1TYG B;  2JT4 B;  1RAX A;  2WNM A;  5KFC A;  1BPZ A;  1SIJ A;  1SE3 A;  1BNP A;  2FLL A;  1LKY A;  4BOZ B;  2BYV E;  2UU7 A;  3NJT A;  4RQM A;  4M9L A;  3AI5 A;  4O5C A;  3HT3 A;  3ICX A;  1KF6 B;  4YP3 A;  4OJP A;  1KLN A;  2G45 B;  5CB1 A;  2QAR B;  2KFK A;  4EEN A;  2L76 A;  1ET9 A;  2W7O A;  1F1H A;  2BR0 A;  3TAC B;  4F5O A;  1WJ4 A;  4NPN A;  1AN8 A;  1SJE D;  1C3T A;  9ICP A;  5AUI A;  7ICJ A;  1Z19 A;  1F44 A;  4I2H A;  2QHO A;  5DQH A;  3V61 A;  5KFX A;  2R8G A;  5TIS U;  4YD2 A;  1WGR A;  5DPS A;  4C8K A;  7ICG A;  1HIW A;  1N61 A;  1XSN A;  4DSK A;  1XLO A;  4KKJ A;  2H3F A;  1L7N A;  2HHX A;  3QXG A;  1JX4 A;  1HEZ E;  3QU9 A;  5EWG A;  1AAR A;  1RQL A;  2ZCB A;  4ED8 A;  2DEN B;  4LDT B;  1X9S A;  3PSF A;  1K53 A;  1I7H A;  2MUT A;  3Q3F A;  4P7I A;  2KK8 A;  2B0C A;  4FZN A;  1RYR A;  3DBR I;  1WGG A;  4IOI E;  4M0W A;  1BT0 A;  4M01 A;  3V3X A;  1RM6 C;  2DGZ A;  3BJY A;  2KWV B;  2O6V B;  3PW2 A;  3C19 A;  3N9Y C;  4ICV A;  4W9G A;  3SEB A;  1PUZ A;  2ZTE A;  4P1C C;  1TT5 B;  2FIF A;  4YR3 A;  4FBT A;  2WLB A;  4W9K A;  1TS5 A;  1UUP A;  1BVS A;  5KFR A;  1KH0 A;  2WQY B;  4NAW A;  5AKI A;  3MDC A;  3CSF A;  4C8M A;  2JEI A;  4M0W B;  3DBS A;  4MM3 B;  4TQR A;  3Q8S B;  4GOC A;  1SGH A;  1K1S A;  1RPL A;  4F72 A;  3HM3 A;  2ZVO A;  3HUI A;  4F1S A;  1CZP A;  1WCL A;  3ALR A;  4HDQ A;  3A0H U;  3DDH A;  1B1Z A;  4QWB A;  4C8N A;  3Q3J A;  3S6J A;  3TBL D;  2IA6 A;  8ICL A;  3PO5 A;  4DQO C;  4HXD A;  3ZRC A;  3OHA A;  2FCQ A;  4HKZ E;  4XE0 A;  2BCQ A;  1U47 A;  1IXR A;  3UF8 A;  5AI6 A;  3KH0 A;  2RPV A;  1WM2 A;  1SE2 A;  3RBD A;  1RYU A;  5DBC A;  2VJ4 A;  1S10 A;  5ALJ A;  1PQS A;  1SE4 A;  2EEL A;  4F4Z A;  1UCV A;  5AZH A;  2J4X A;  1WE6 A;  3A1Q A;  2UVV A;  5MPO A;  3GP7 A;  5LNK 1;  5KFZ A;  2WDR B;  2FID A;  3VRA B;  1U9L A;  5J2B A;  4O9M A;  3IG8 A;  4GDL B;  2G5I B;  1E8Z A;  5DKW A;  3OJU A;  8ICB A;  3AE8 B;  2KO3 A;  3KHH A;  8ICY A;  2F8K A;  1F9J A;  3LVV A;  3PO0 A;  2F77 X;  4AWJ A;  2E8P A;  3RR7 A;  1HZ6 A;  3TQ1 A;  4GFJ A;  1L3U A;  1IBX A;  5KFS A;  4MFC A;  1L0Y B;  4L23 A;  1ZJN A;  4PK1 A;  1KFY B;  1UBI A;  2Y1J A;  5AKL A;  3HKZ C;  4O0I A;  1B43 A;  1VJK A;  3TEZ A;  4CCH A;  1ZRN A;  4Y2P A;  3L4P A;  1TS2 A;  3R7R A;  3S2A A;  4KMU A;  2GBK A;  5J2I A;  1KW4 A;  1SB3 C;  4PL2 A;  3C2L A;  2AL6 A;  2IY0 B;  3MR2 A;  2BYE A;  2NVU I;  2MJD A;  5L1M A;  1TY2 A;  4HCP B;  1ENF A;  4YD1 A;  1CK1 A;  2RR9 A;  2ZXI A;  3ZI4 A;  5FP0 A;  5EOZ A;  3NVZ A;  4OVV A;  4DXA B;  2BWF A;  1E9M A;  1Q10 A;  4I2E A;  9ICE A;  3DBL I;  2J6T A;  4L2Y A;  2FCM A;  3BZK A;  2BQQ A;  3ML8 A;  5D94 A;  4YMM A;  3I5J C;  3QUB A;  2C2E A;  8ICM A;  3HWT A;  2KP7 A;  1L6V A;  3PRE A;  4S17 A;  4WWM A;  2WP9 B;  1DYQ A;  2NRT A;  1JUD A;  1WY8 A;  2DYB A;  5AEK B;  9ICO A;  1OQR A;  4ZYN A;  1X9W A;  3RJF A;  3SV4 A;  1YZ7 A;  5KG1 A;  4DWI A;  2KD1 A;  3HX0 A;  5KT7 A;  1ZQG A;  3DBH I;  3H4D A;  1MA7 A;  1ZJM A;  2K3U A;  2K25 A;  2KIW A;  3TAN A;  5KG5 A;  3U26 A;  2HTH A;  3Q3N C;  4J9S A;  4RGO S;  2ZJ8 A;  4P4M A;  1ZRM A;  1WXV A;  2HJ8 A;  3KUZ A;  2RP5 A;  2LPE A;  2EZY A;  2PFO A;  4RGM A;  5KFU A;  2HOF A;  2C2D A;  2XIC A;  1NBF C;  1WZ0 A;  2M0N A;  3H6N A;  3HK0 A;  3QU2 A;  1YJI A;  4F4W A;  5IOI A;  4BKS D;  3CYM A;  4KLS A;  3M9M B;  1AWD A;  3UGB B;  3EWA A;  1XQQ A;  2QB1 A; 
#chains in the Genus database with same CATH homology
 4ZRP A;  2WU5 B;  4XWT A;  2LJI A;  1QOF A;  2WS3 B;  1TS4 A;  5BYR A;  4ZOH C;  1C76 A;  1MVK A;  3TUO A;  3ZJT A;  1OQQ A;  4R3D A;  4XDC A;  3AEC B;  3P4P B;  3W9C B;  1E10 A;  1TKY A;  1PYW D;  3CIR B;  4RH6 A;  2V3N A;  2ONQ A;  1UWX A;  4KGR A;  4OW0 A;  3TSS A;  2E3T A;  1I4Q A;  2QEJ C;  1BXT A;  1HA5 A;  4MH8 A;  2Q5W D;  1FM0 D;  3MHZ A;  2ZW1 A;  1JQ4 A;  2ACZ B;  3AEG B;  1WXQ A;  1AW7 A;  5H8Y E;  5E6J A;  5HFY A;  2PW9 A;  4AS1 A;  4HEA 1;  1YMH E;  1EU3 A;  3LB8 C;  2H88 B;  1JML A;  2BS3 B;  1CQV A;  1FCL A;  1TS3 A;  1ESF A;  2L1A A;  5FKA C;  5BYS A;  1HXY D;  2YEP B;  4C56 C;  3LXF A;  2JQR B;  4C7Y A;  2DWQ A;  5BYQ A;  3P42 A;  2M0A A;  2WXN A;  1FCC C;  1EWY C;  4OZB A;  3W5V B;  3VR9 B;  3TEX A;  1T3Q A;  1NI3 A;  2KWD A;  3LYY A;  3AE1 B;  2N9K A;  2I38 A;  5EE0 A;  3P63 A;  2DYM A;  5EE9 A;  4UDU C;  1IGD A;  3MFG A;  2WXF A;  4YSZ B;  1SSN A;  1KLG D;  3R8B A;  1KTK A;  3BK1 A;  1OFF A;  4NAW B;  1QIL A;  4WH4 A;  4A8X C;  3T3N A;  3BK2 A;  2Z8L A;  2XN9 C;  2JXT A;  1NEN B;  1M4V A;  3B2G A;  1PGA A;  1XF5 L;  2NTT A;  2KDM A;  2MJ3 A;  4KGS A;  1QLB B;  4WQM A;  1K51 A;  5EE1 A;  1XXG A;  2ON8 A;  1N63 A;  1ZDX A;  2TSS A;  1GOZ A;  3WCQ A;  2AQ3 B;  2JYT A;  1MI0 A;  3E56 A;  1ROE A;  1TKG A;  4NJC A;  2QJL A;  3ZQ4 A;  1UNS A;  2K22 A;  5C2T B;  1C4A A;  4C7Z A;  4JPS A;  1MHX A;  1KLU D;  2E6X A;  2N9L A;  3I9V 1;  5HG2 A;  3SFE B;  3Q69 A;  1EM7 A;  2BS4 B;  2WXQ A;  1FXA A;  1V97 A;  1SF0 A;  1SXT A;  2CU3 A;  1FRD A;  4YWG G;  1ZE3 D;  4CQN A;  1YQ3 B;  4B0M A;  3MJ5 A;  1KRH A;  3T3O A;  1VLB A;  3NZ3 A;  3U7Z A;  3DWG C;  2K0P A;  3J9C A;  1BUI C;  2KQ4 X;  2WXG A;  3KWL A;  5HI1 A;  3P4S B;  3TEY A;  2BT6 A;  2R61 A;  3IT4 B;  2QIE B;  4JWU C;  1PGX A;  2AQ2 B;  3VRA B;  5G5H A;  1GAQ B;  3FAH A;  2K9X A;  1C4C A;  4A55 A;  1YQ4 B;  4OVZ A;  2EKI A;  3H8H A;  2RDH A;  4WUR A;  1XCQ L;  1R7S A;  2PIA A;  5BMG A;  3IT6 B;  1AYF A;  1L6U A;  1ZXH A;  1XCT L;  4P6V F;  1J7A A;  1V8C A;  2W3R A;  4DXF A;  1PDX A;  1A70 A;  1MPE A;  1STE A;  4ITK A;  1IGC A;  2FBW B;  1D5M C;  1HZ5 A;  1Y56 A;  1VZ8 A;  2J52 A;  1ZP0 B;  4LTU A;  2BTE A;  4AQ7 A;  2BW2 A;  1DGJ A;  3AED B;  4RGT A;  2WXL A;  3KQ4 A;  4MT5 A;  2MJE A;  4NZL B;  1FMA D;  1XLQ A;  3SFD B;  1GB1 A;  2ICI A;  2K5P A;  2WDV B;  4YT0 B;  1QQR A;  1VDV A;  1HQR D;  1JWM D;  2WXK A;  1JW9 D;  3PZ8 A;  4RGN A;  2PLP A;  4WIP A;  2HDE A;  2J42 A;  1FFU A;  1J7C A;  1C77 A;  2D5G A;  1TKE A;  3FIL B;  2LHD A;  2IGD A;  3HVZ A;  4O1N A;  5D3D A;  3U52 E;  2LUM A;  3BYT B;  3OWE B;  2WXR A;  3IAS 1;  1RFK A;  1BML C;  3KLS X;  1EU4 A;  4XWW A;  3W2D A;  2Y3A A;  1L4D B;  4A9A A;  4D2K A;  4RF0 A;  1T5X D;  2LMC A;  1ACC A;  1YN5 A;  2W55 A;  1JCK B;  4YXD B;  2CJO A;  4OZA A;  2Y5P A;  3Q8F A;  3B9J A;  1QOA A;  4YTP B;  3NRZ A;  1QF6 A;  2GRI A;  1VRA B;  2QIL A;  4YSY B;  4TMA B;  5D3I B;  4YSX B;  3NVV A;  2JWU A;  2LFI A;  2G9H D;  4PT5 A;  3P4Q B;  3AE5 B;  1N5W A;  2BS2 B;  4ZHO A;  3NS1 A;  3AB5 A;  1XEE A;  3HVD A;  1VZ7 A;  5FR3 A;  4RF1 A;  4GLS C;  2J53 A;  4XDD A;  1E6E B;  5BMI A;  1FIQ A;  2VZK B;  1D5X C;  1L4Z B;  4TSS A;  4JE3 B;  4C80 A;  1C9F A;  1XLN A;  3AE4 B;  1V1O A;  2KAC A;  1P7F A;  3BZD B;  3NVW A;  1IUE A;  3NVY A;  2WXI A;  1DOX A;  1TY0 A;  2X38 A;  4N6E B;  4USA A;  1K52 A;  2XNA C;  2CJN A;  5GXG B;  1I4H A;  3W1S A;  1QT9 A;  1JAL A;  4N59 A;  2SEB D;  2DYO A;  2N0S B;  1N60 A;  1JRO A;  2B76 B;  1DOI A;  1C78 A;  2W82 A;  4HJG E;  1IBX B;  2WDQ B;  5C3J B;  1QOG A;  1CJE A;  1F77 A;  1YN3 A;  3KWV A;  2QSD A;  2IGH A;  2BB5 A;  3BWU D;  2V0G A;  2JX5 A;  3R2I A;  1PUT A;  2INP E;  2MH7 A;  3AEE B;  3U4E G;  4P16 A;  3Q8C A;  1JWA D;  5HHD G;  3P1M A;  1PFD A;  2PTL A;  3VR8 B;  4EE2 A;  3BVG A;  3E9S A;  4RCO A;  1ZOY B;  2I2Y A;  4ZYS A;  2GI9 A;  2YEP F;  2RDG A;  1I4G A;  3EUB 2;  1FXI A;  4RNA A;  2Y5C A;  3AEB B;  4KX6 B;  1E7P B;  1FNU A;  4ARC A;  2GB1 A;  2NMQ A;  2WXM A;  4HKQ A;  4JWS C;  5FK9 C;  1TJE A;  2G1E A;  3BVM A;  1C4P A;  1UWM A;  2JYE A;  2WXJ A;  3O13 A;  1LO5 D;  2M19 A;  1D6E C;  4REZ A;  3AM9 A;  3PZ7 A;  1PGB A;  3W5U B;  2V3P A;  2DLB A;  3UI3 A;  4YTM B;  2QMT A;  3U2S C;  1E0Z A;  3AEF B;  3SR6 A;  1NYR A;  3GS2 A;  1FO4 A;  1F2R I;  3AE9 B;  2SAK A;  1FEH A;  2WXH A;  4OHJ A;  3AN1 A;  1ZPS A;  4US9 A;  3VQI A;  4RFB A;  1XO3 A;  2LHE A;  2WXO A;  3IAM 1;  1YJJ A;  5AUK A;  1DOY A;  1WWT A;  4H2A A;  3AE7 B;  3FIL A;  3TEW A;  2FUG 1;  2WXP A;  4FXC A;  1P7E A;  1WYG A;  3MP9 A;  2V4I B;  1TYG B;  2WNM A;  4TQ1 A;  3C8Y A;  1SIJ A;  1SE3 A;  3Q8A A;  1N5X A;  2BBC A;  5T8I A;  1GPX A;  1I4X A;  4A90 A;  5D7G A;  1KF6 B;  3AEA B;  1FNW A;  1ET9 A;  1WRI A;  4ZHP A;  2IJ0 A;  1AN8 A;  1SJE D;  1K50 A;  3CWI A;  5AUI A;  3V05 A;  4MAC A;  3AV8 A;  4US8 A;  2H89 B;  4ZRQ A;  3Q8E A;  1NYQ A;  2KAJ A;  4JX1 C;  1MHH E;  4DXG A;  2KN4 A;  1XLO A;  1N61 A;  4KKJ A;  3BII D;  1N62 A;  1JWS D;  3ZJU A;  1HEZ E;  4J3O D;  3MC0 B;  1ET6 A;  4KKI A;  3AMZ A;  1K53 A;  1I7H A;  3AH7 A;  3P4R B;  4LLG M;  1EWC A;  2FE8 A;  4L1B A;  1SJH D;  3ABV B;  4M0W A;  5G5G A;  4IOI E;  3V3X A;  4HRS A;  1RM6 C;  3Q8B A;  3SEB A;  3N9Y C;  1I4P A;  2OHF A;  4A6Q A;  5JXV A;  1JRP A;  1JWB D;  2L52 A;  1V1P B;  3B2F A;  3ZJV A;  1D4B A;  4LK0 M;  2WLB A;  2WU2 B;  3IXS A;  1TS5 A;  1UUP A;  2DBY A;  1D5Z C;  2N7J A;  2PMV A;  1SBB B;  3HRD D;  1KH0 A;  2WQY B;  2ZW0 A;  1FD6 A;  1QOB A;  4MM3 B;  5TSS A;  5EE3 A;  5I4D A;  3HUI A;  1CZP A;  4IDI A;  1B1Z A;  4B0E A;  5H92 C;  4DQO C;  1RYJ A;  3GB1 A;  4HKZ E;  4XE0 A;  2LEK A;  3ZYY X;  2RPV A;  3ZGZ A;  1F0Z A;  1SE2 A;  2PKO A;  2EEL A;  2IPK D;  1SE4 A;  1SEB D;  4Q2J A;  2J4X A;  1NEK B;  5MPO A;  1ZDV A;  3GP7 A;  5LNK 1;  2WDR B;  3AE6 B;  2PVO D;  1ZXI A;  4YTN B;  3I57 A;  4GDL B;  4WAF A;  3VRB B;  1UGJ A;  4ARI A;  3AE8 B;  2L32 A;  2RMM A;  1YN4 A;  2JZP A;  3NUH B;  3PO0 A;  1HZ6 A;  1IBX A;  2MEK A;  2AQ1 B;  1L0Y B;  1FNV A;  2IGG A;  4L23 A;  1KFY B;  2HTM E;  2BB6 A;  1L0V B;  1VJK A;  3TEZ A;  3EA6 A;  3AE2 B;  3L4P A;  1L0X B;  1F2R C;  1TS2 A;  1T6B X;  3FC4 A;  1J7B A;  1NVI D;  1SB3 C;  1B9R A;  2BYT A;  2M56 B;  4OZC A;  2L83 A;  1I4R A;  4N58 A;  2MJD A;  3RFZ B;  1TY2 A;  1ENF A;  2INN E;  2AX5 A;  1CK1 A;  2LGI A;  3R2T A;  3URY A;  3BYY B;  2W54 A;  1YNT E;  2JU6 X;  3NVZ A;  3ETR A;  3EGR A;  2IDY A;  1E9M A;  2W3S A;  1Q10 A;  3DWM A;  1FRR A;  4IKG A;  4L2Y A;  4HRO A;  1ZUD 2;  4WWM A;  1L6V A;  2WP9 B;  1WSP A;  1DYQ A;  1OQR A;  2JSV X;  1FFV A;  3AE3 B;  1VZ6 A;  2KMM A;  1XLP A;  1RWS A;  4KGT A;  1QKZ A;  1VR9 A;  5BMH A;  2K3U A;  4TQ0 A;  4NAM A;  1V1P A;  2OED A;  2PVG C;  1GB4 A;  2VZK D;  1TZO A;  1WGK A;  2NTS A;  4RGO S;  4RGM A;  4GDK B;  1C79 A;  1JWU D;  1YJI A;  1L5P A;  1AWD A;  3BVZ A;  3RPF C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...