1N60A

Crystal structure of the cu,mo-co dehydrogenase (codh); cyanide-inactivated form
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
161
structure length
161
Chain Sequence
b'KAHIELTINGHPVEALVEPRTLLIHFIREQQNLTGAHIGCDTSHCGACTVDLDGMSVKSCTMFAVQANGASITTIEGMAAPDGTLSALQEGFRMMHGLQCGYCTPGMIMRSHRLLQENPSPTEAEIRFGIGGNLCRCTGYQNIVKAIQYAAAKINGVPFEE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Carbon monoxide dehydrogenase small chain
publication title Catalysis at a dinuclear [CuSMo(=O)OH] cluster in a CO dehydrogenase resolved at 1.1-A resolution
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 49
structure length 161
sequence length 161
chains with identical sequence D
ec nomenclature ec 1.2.5.3: Aerobic carbon monoxide dehydrogenase.
pdb deposition date 2002-11-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00111 Fer2 2Fe-2S iron-sulfur cluster binding domain
A PF01799 Fer2_2 [2Fe-2S] binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.120 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 [2Fe-2S]-binding domain 1n60A02
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1n60A01
3AE5B 3VR8B 1DOIA 2WU2B 2Y5CA 1N60A 3FC4A 2BS2B 1QT9A 2G1EA 4IDIA 3RPFC 1J7CA 3SFEB 3NVWA 3W5VB 1JWAD 5EE1A 3P4QB 2JX5A 5C3JB 2K9XA 3AE3B 2L83A 4ZHPA 1N62A 4YSYB 3HVZA 4YSZB 2L52A 2MH7A 4N58A 3NVVA 1RWSA 2PVGC 3AE9B 2M19A 1J7AA 1FO4A 4KX6B 1JWBD 1E0ZA 3W9CB 1GPXA 2LEKA 4YTNB 1EWYC 3EUB2 1N61A 1AWDA 3AE8B 1XLOA 3AECB 3AEBB 3WCQA 5AUIA 4YSXB 1OQQA 1NEKB 4HROA 2N0SB 2W54A 1TKGA 3B2GA 3DWMA 3AE6B 2M56B 1JRPA 3L4PA 1T3QA 1RYJA 3AEAB 2WDVB 1DOXA 1FM0D 1V97A 2H89B 1XLPA 1E9MA 4C7YA 2WP9B 1TKYA 2WDRB 3CWIA 1YQ3B 4FXCA 3SFDB 1N5XA 4US8A 3NVYA 3AM9A 3P1MA 1B9RA 2CJOA 1DOYA 3AEEB 1QOAA 1VJKA 2PKOA 1GAQB 1DGJA 1F0ZA 2B76B 1UWMA 3AB5A 4USAA 3BIID 1XLQA 4LTUA 2BT6A 2BS4B 2DBYA 2ACZB 4JWSC 5C2TB 3VRBB 1NYQA 3AE1B 2KAJA 3P4PB 1ZOYB 1L6VA 2PVOD 3DWGC 1SF0A 4ZHOA 2WDQB 1FRRA 1L0VB 1FMAD 1OQRA 2CU3A 1E6EB 3LXFA 4YT0B 2W55A 5EE9A 3NS1A 2PIAA 3NVZA 1WYGA 2H88B 4HRSA 1TYGB 1SIJA 3LB8C 4US9A 3AN1A 3P63A 2KMMA 1SB3C 1YJIA 1JQ4A 1YQ4B 1ZXIA 4A9AA 4WQMA 1A70A 3PO0A 5G5HA 4C80A 3AMZA 1FRDA 3AH7A 4JWUC 4WWMA 3P4SB 1IUEA 1WRIA 1XO3A 3AE2B 1N5WA 5H92C 4P6VF 3W5UB 2HTME 5GXGB 3SR6A 1PUTA 1KRHA 1WGKA 4ZOHC 3CIRB 1QOFA 1XLNA 1CZPA 1QF6A 2QJLA 1V8CA 3HRDD 2E3TA 4ITKA 3FAHA 4YTPB 1FIQA 1VDVA 1N63A 4N59A 5EE0A 3VRAB 3ZYYX 2BS3B 2WLBA 4C7ZA 2MJEA 2MJ3A 1KFYB 1JW9D 3AEFB 1OFFA 5G5GA 3NRZA 3KWLA 5H8YE 1NVID 1E7PB 1FXIA 3B2FA 5MPOA 2CJNA 2W3RA 1ROEA 1TJEA 1FXAA 2Q5WD 3P4RB 3AE4B 1NYRA 2WU5B 1J7BA 1WXQA 3VR9B 1AYFA 3B9JA 2DWQA 3AV8A 2WQYB 4N6EB 1QOBA 1QOGA 1PFDA 1RFKA 2K22A 1FFUA 1ZUD2 2EKIA 2OHFA 1KF6B 3ABVB 1JALA 2K5PA 3AEDB 2MJDA 2W3SA 1PDXA 1TKEA 2QIEB 4YTMB 3ETRA 1I7HA 1FFVA 1CJEA 1RM6C 1JROA 1QLBB 1WWTA 2FBWB 2JQRB 5AUKA 2WS3B 3HUIA 1R7SA 1NENB 1YJJA 1L5PA 1ZP0B 3AEGB 4YXDB 5EE3A 4JX1C 1E10A 1NI3A 3AE7B 2AX5A 1VLBA 1L6UA
chains in the Genus database with same CATH superfamily
2V1YA 2UVUA 1IG6A 5CRXA 5AEKB 4AQ7A 1DOQA 4YD2A 4RF0A 5AK6A 1NNLA 2KWCA 3RBEA 3DBLB 4WWNA 4Y2QA 1JCKB 1TK5A 1U4AA 5IIOA 1BPBA 3H8MA 1KW4A 3V6HA 1UBIA 2FCNA 1BT0A 1X66A 3HHMA 5AHXA 3TACB 1TS3A 3MTNB 3PV1A 4MGZE 1J0GA 2G9HD 3ZNHB 2QKQA 4YSXB 3W1SC 3WKDA 1YT3A 5AUIA 2DKZA 8ICLA 3E9SA 2L05A 3V6JA 1V97A 1BUIC 1T0YA 2B6GA 1XF5L 2WP9B 3M9OB 4RPYA 3H8SA 4O3OA 1DGJA 3BS5A 1GC7A 3AB5A 3RTVA 9ICHA 3RB4A 1WGGA 4YFKA 1D3ZA 4KVGB 3SV4A 3VQIA 4FJYA 5ALFA 2DENB 2BCVA 1J8CA 2PVOD 3ZLZA 2PMVA 2OCEA 5KFVA 4M9GA 1P7FA 2L8JA 1V38A 3PZPA 3M6KA 1RXWA 3QARA 2AEHA 1WYGA 2JRIB 3BVMA 4I29A 2IO1B 2KMMA 1SB3C 4JGHB 4HCPB 1P7EA 2K8BB 5ALZA 4JLCA 1L7NA 4TKNA 4P0PB 5LXHA 5H92C 3GFKB 3ZKJC 2JXJA 1MQ2A 2KC2A 3V6CB 3SDLC 4R63A 1QQ6A 5HP4A 1QOFA 1WGDA 1ZQXA 1M94A 2ZJDA 4AJWA 2OOBB 3ZNGC 4KMOB 9ICJA 1Y56A 2VJ5A 4DS4A 4QZHA 5J17A 3Q8RB 3B0AA 3PS6A 5KHOA 2HDOA 2EANA 1JW9D 4XWTA 4DSKA 4QW8A 2AU0A 3B2FA 3H6NA 5AK4A 4EENA 1FXAA 2R61A 3H7PB 1KTQA 2K8AA 1RG6A 1J7BA 1L7MA 1DK2A 3PX0A 3SEBA 3F5EA 2WQYB 2V3NA 3J81j 3NY5A 3OWEB 4QNLA 4JV2A 5A0LA 3QIJA 4O9MA 3C1ZA 3ZD8A 4DL5A 1PVRA 4JQWC 4NLCA 5DB8A 2GI9A 2ISPA 2LMRA 4KLTA 2LGIA 2QMTA 3ABVB 2K5PA 3WK8A 3OLMD 1I7HA 2HDEA 5D2MB 4DFDA 2WXPA 4F5RA 1ZQEA 5AUKA 4Q44A 3VXWA 1LGRA 2LM4A 1L5PA 4IM0A 4W9EA 1Z00B 4ZYNA 1UHUA 3AH7A 1S1QB 5D49A 2KLCA 3APDA 1UPHA 5AKYA 1J97A 3Q8CA 3N3KB 5J18A 4S17A 4GFJA 2MUTA 4W9KA 2IJ0A 3BQ1A 3ZGZA 5FK9C 4PS7A 2L52A 5AKLA 2H3IA 2ALZA 4CF5A 2V9WA 3N1YC 4MSQB 4MELA 4B9NA 1MJDA 4IG7B 4PS3A 4IW0A 2BQUA 9ICFA 3BQ2A 1EWYC 5TR5A 5KFDA 2IOFA 2Z0EB 1ZQAA 7ICLA 3BYYB 4G0NB 1G6JA 1U4BA 4ANWA 4FFDA 3ZXVA 1B0XA 3B2GA 2QCZA 2JRZA 5HHDG 3OHAA 2NO5A 4JV1A 2J4XA 2WDVB 1X1MA 2FE9A 2BHNA 1FM0D 3SENA 1Q3VA 5IOIA 2FUHB 2WF6A 4PYUA 2V0GA 2CJOA 3HKZF 4UB2A 4PHEA 3SZ2A 1S0OA 2C2RA 4Z6DA 2IO0B 4DSFA 5IP4D 2RQ5A 4DOBA 2BBCA 2KKVA 1TGZB 4LTUA 2IY1B 1T6BX 2LUMA 1URJA 1ZOYB 3PTFC 1SF0A 2XCAA 1KL9A 2KKPA 2EH9A 1FMAD 2MX2A 3PREA 5KHQA 2WAQF 4HPMB 3QU7A 5ALPA 5EE9A 4AYBF 3KTQA 8ICTA 3NS1A 2ZUCA 2ZW1A 4DL4A 4CE6A 4NY0A 4K4HA 2R8GA 3GOEA 4QZCA 4R3DA 4A9AA 4F4KA 4J9NA 1T4GA 5DBBA 4LNNA 3RI7C 3F5AA 4KKJA 2LGYA 3BY4B 2ZNVC 2ZCBA 1T8EA 4G11A 1WWUA 2LYBA 2KVZA 2NR2A 4DXAB 1UGJA 2KICA 2IPKD 7ICVA 1K5OA 2PI5A 5HKHA 3F2CA 2NPTA 4PS8A 2DAJA 2D07B 3N28A 4GC7A 4UB4A 7ICHA 2SAKA 3HRDD 4TUQA 1E8YA 3DBHI 4DWIA 4N59A 2YB1A 1V9PA 5AZFA 3M6ZA 3PR4A 2WDTB 2ZJ5A 3U4EG 4IL6U 4TQRA 1L7OA 2MBBB 2BCRA 5G5GA 3N97B 2Q4TA 8ICAA 1WRDB 3KWLA 3OJ3A 2Z0DB 3Q8AA 3RAXA 5BMIA 2PKEA 2C7MB 4B9VA 2F44A 2SEBD 4RZRA 4F5QA 2W3RA 1MI0A 1TJEA 2Q5WD 4B6WA 4M9NA 1ZD4A 2WU5B 1WXQA 1XS9D 1S0MA 4IM3A 3R7QA 4K3CA 2G0AA 1NK6A 2ONQA 3RNGC 1SL1A 2W9CA 4ED1A 3NUQA 2MJDA 3RN9C 5KT5A 1HQRD 1TKEA 5KG7A 5CP2A 5KFQA 4FE3A 4FN2A 2M17A 2B21A 1V1OA 3MJWA 3MJ5A 5KFJA 2KDIA 4NPNA 2BYTA 3TFRA 3MGHA 4J9KA 1SGGA 2IY0B 2IHNA 2WU2B 4YWGG 2AGOA 4DK5A 5L1IA 4I2BA 3PSEB 2ASLA 4G3XB 3OJSA 4M2YA 2DZMA 3AUOA 3K9PB 3JPSA 2NVUI 2K60A 3U2SC 4C4VA 2KZMA 4EYHB 2FNJB 3C19A 4EELA 1J7AA 2ZIVA 3PHXB 5TSSA 2C7HA 3PRMB 5AM0A 2XY7A 3PR5B 8ICYA 3T5JA 5HI1A 3E0FA 4HDOA 4DFMA 4W9LA 4F4YA 1C7YA 5D4BA 1K1QA 3ZTDA 5CA7A 2KJHB 3L4PA 5ALSA 1I4RA 3GB1A 4ED7A 4W9CA 4KN7A 2W7OA 1XLPA 1E9MA 1HIWA 1DRGA 4EUTA 3UF8A 4C8KA 3AM9A 2RHFA 3OHBA 2ZNVB 3T5LA 3JVZX 3ML8A 4PK1A 4DSIA 1XLQA 5ALJA 4TSSA 3A9KA 2A3VA 3AE1B 5HR6A 1IGDA 4GXJA 1U48A 2J0MA 1HTQA 3V3XA 4XGAB 4FADA 3P4PB 4ZHOA 2YEPB 4Y2VA 1F2RI 3LXFA 3ZTCA 2KJ8A 4ECSA 1E6EB 5ALTA 5TZVA 4KMUA 1ZQOA 2L0FA 3BINA 1Q46A 4KKIA 5T8IA 3GS2A 4YMNA 4BZAA 2JZZA 4C8NA 3PO0A 5L1MA 3AMZA 3LVVA 3P4SB 1WX9A 2DYBA 5KFEA 2V3PA 2R8HA 1QSSA 4RGMA 2F77X 5JTIA 1XD3B 2J6TA 1T94A 4GOCA 3SD7A 4YQWA 4BVUC 1ZD3A 4I2JA 4M6WA 4PZNA 4RUAA 1VZ8A 3IDWA 4O3SA 8ICRA 5HHIA 2OWOA 1JRUA 3QC8B 2NRTA 3AQFA 4E3CA 4FHKA 4MEXA 2HMXA 4ELVA 4RU9A 2BWFA 3TI0A 3GIIA 1BMLC 3R3MA 3R8BA 3ZUNA 4O0IA 2LPEA 2R8IA 3N4MB 1A76A 1WX8A 3ALBA 4F72A 1D9FA 3BK1A 3AE4B 3FILA 1UELA 3UI3A 1L7PA 4CDGA 2FPKA 2D2QA 8ICOA 1WG8A 1JI7A 4QZBA 1YN4A 4X57B 3NASA 1LFDA 3LWLA 1C79A 1QOBA 3ECIA 1NI2A 4I2EA 4PJ0U 3Q8BA 9ICVA 2YMPA 4EZ9A 4EYIB 3ETRA 4MDKE 1WXVA 4RGTA 2KIWA 2N9LA 1QQ7A 4B0MA 4Q2JA 2FLLA 1MA7A 4OHJA 1K1SA 3K4GA 1S10A 4WAAA 1XEEA 5EWFA 2DYMA 3HJEA 1NI3A 4GLSC 3TKAA 4J9PA 1M6YA 2K4EA 3IV6A 3HP6A 2JMGA 1E5WA 1DK3A 2G1EA 4MGYE 2ZJAA 2C60A 2YN4A 3G6XA 2Y9TA 1N62A 1NJXA 4OD0A 4RQ5A 4E0DA 1J19A 4M0AA 4UDUC 4F1SA 5AM4A 3N1XC 3QK0A 3AU5A 3GIKA 3BVGA 4M0WA 4ED6A 5J2GA 3V7JA 5AM1A 3ETLA 4NXZA 2VKQA 1ZETA 3QUQA 3IG8A 9ICIA 4J9QA 3WIMA 2O2VA 4PYZA 5J2HA 4XWWA 2NS5A 1GUAB 1B22A 2NPTB 4LNKA 5ALYA 2J6UA 2FE8A 2JXXA 2LHEA 1QQRA 3CF6E 4I2CA 2E1FA 4Y2RA 2KO3A 1X2IA 4Y2YA 2XY5A 2D3CA 2LMCA 3K1RB 3UGBB 2KP7A 3PLVA 3NZ3A 4ICVA 2FIDA 4QWAA 3LDAA 1ZQZA 2DBYA 3ED5A 2LJIA 3MC1A 4ASWC 2M0XA 3NZUA 2BGFA 5ALNA 4GDLB 4ANUA 9ICMA 2NRWA 3DWGC 3OSNA 7ICNA 1L0XB 2W11A 1YNTE 4HKQA 2JH1A 5AKEA 1N6ZA 4RH6A 2HHUA 3RNBC 1GB1A 2Z7JA 4TQSA 4Q8FA 3JPNA 2JEJA 3KOOA 4DOAA 1UNSA 4ANXA 2UWQA 2W9CB 2RMMA 3D2NA 4DEZA 2RDJA 3O13A 2EAOA 2BB6A 4BKTA 4DHJD 2WFAA 3D32A 1V85A 1KRHA 1V6EA 3TIXA 4ARIA 4OJLA 2DZKA 1NJWA 5DG7A 2E3TA 2OJWA 3RD2A 1FIQA 1YZ6A 3IT6B 1Y88A 1EF5A 3VRAB 3MABA 3A1QB 4BBNC 3WALA 2YVCA 1YD8U 3A9JB 3UXOA 4O5CA 5I4DA 2E8NA 5EWEA 2DNFA 4C4VB 2Z8LA 1BPZA 3TEXA 4LJOB 2ZIVB 9ICOA 3PZ7A 1NYRA 8ICXA 3KHHA 4OVZA 5KFHA 1UF0A 4OVUA 5BOLA 4DDGD 1WJ6A 3TANA 1QOGA 4M8MA 4GB9A 4G50A 1FD6A 4ECVA 2BR0A 2O6VA 1WJNA 2FJ6A 1STEA 4HJKA 1PGBA 3WK7A 2GH1A 4UB8U 1VR9A 3TARA 3M63B 1JN3A 3QUCA 4CF3A 3Q8LA 1YJJA 1DXSA 4YXDB 4RPZA 3VH4B 2VA8A 1D8LA 1NK5A 3AE7B 3PSFA 4WWPA 2WXOA 1QZEA 1KLVA 5DG8A 3SYZA 3A9KB 2A1AA 2BKEA 7ICPA 2RDHA 3H8HA 3IBEA 2G09A 4R66A 3MP9A 4MJSA 3RJJA 1TKDA 1J7CA 3RPFC 5J29A 2INDC 2V3SA 1IV8A 3KKAA 5CJ7A 1S77D 5D6JB 1PUZA 2QLTA 3DQVA 1UA0A 3NGDA 1NZPA 2XEWA 4E74A 3C29A 1WR1A 5DGAA 2QILA 3FKYA 3W9CB 2BPCA 2MEKA 3DBRI 1N61A 5CEHA 1ZKHA 4GC6A 5CHFA 4IC7B 1IXRA 1HEKA 4F71A 1QLNA 4CQNA 3WCQA 2YLMA 4XYCA 5AKKA 4HCNB 5KT3A 4A6QA 3E58A 4HAIA 2FMSA 1ZOLA 4M04A 1CMXB 1I4PA 4YG2A 1PK1A 5KTQA 3GV7B 2DFLA 5ALIA 3P1MA 1MPEA 4M01A 3H9DA 2BTEA 3TUOA 2ZCCA 1Z4OA 4M6WB 9ICQA 2LRUA 4R64A 4LJPB 3N1ZC 3H4DA 2BYVE 3MC0B 3V7KA 1R4NB 2MLBA 4HVBA 3N7SC 4YXMA 1MVKA 3C8YA 2AJQA 1KKXA 4WJQA 3ZD9A 3VTWA 1MHHE 5KFSA 5AI8A 4YT0B 3RMKC 4BXOA 3RULA 1BNPA 3RJEA 3UXPA 2EDUA 9ICTA 3WAMA 3ZXRA 3DCGA 1JWMD 3FILB 3SI8A 1BPDA 2IGHA 3WU2U 3OAWA 2KDFB 3JPRA 2GBRA 4A8XC 2LZ6A 3UIPB 3PMNA 2XCPA 3PW5A 4UQGA 5JZEB 2FMQA 1P98A 4NAWA 3FDSA 2KX0A 2KWDA 3NOBA 3OG5A 2IBIB 2ZZPB 1B4FA 4EBCA 4C8LA 2BWES 5KG1A 1C4PA 3N30A 3V61A 9ICSA 2IA6A 8ICVA 4WAFA 2BQ3A 3GU3A 5IA7A 1ACCA 2HBMA 1NK7A 4S0RA 4KGTA 1VDVA 4QWBA 1N63A 4RQ6A 1T0RC 3H8WA 2QEJC 1OUQA 2FCQA 3I3TB 1SKSA 3LK9A 2MJEA 5DLFA 1EWCA 3O0FA 4IQWA 3SAGA 1SBBB 1F1HA 1K51A 3KHLA 5MPOA 9ICKA 4KGRA 3P4RB 3CYMA 4LVSA 2L3ZA 5D94A 2WB1F 4DXFA 4M0WB 4IKGA 3PVLA 1HJPA 3B9JA 3OJUA 3AV8A 5DBAA 3HX0A 5IN7A 5L1KA 3C21A 2O2VB 2GBJA 5KFUA 2OHFA 3T3OA 2EMSA 2CS4A 4QWEA 4YTMB 1PZNA 2NO4A 5JU5A 2DPJA 1EXNA 1X9WA 1SSNA 1CJEA 4ECTA 2WXLA 4A55A 4NZLB 3PHWB 1R7SA 5DB7A 9ICAA 4EFOA 5FKAC 3KKAC 2WF7A 5D3IB 5E6JA 4DQQA 1E10A 3RRHA 1E8WA 2ON8A 3I1YA 4GSWA 4RFBA 2G5HB 4J9LA 2G06A 3WK4A 4AP9A 3H0RB 3PSPA 3QXGA 1AARA 3PMLA 1R4MI 2BS2B 5EE1A 3IFWB 3AQEA 4KSLC 2PFNA 2MRPA 2KE7A 1BPYA 2MH7A 2AQ2B 3NVVA 2BYFA 3TQ1A 2M19A 1FO4A 4YL8A 3WK5A 7ICQA 4TURA 1VJ5A 4O3MA 1JIHA 2Y9UA 3PRPB 4JK1A 4KLJA 2F3NA 4QZEA 4JWNA 2LYAA 4A8EA 3RNEC 4F92B 3ZIMA 5DPRA 5D46A 5KG5A 2W8LA 2J6SA 3DWMA 5HG2A 2JEIA 5AIBA 1RYJA 4XDDA 2K89A 1RDFA 1HUZA 9ICCA 2JYEA 4I2FA 2N7JA 4FXCA 2LKYA 1E8ZA 2KT7A 4ZRIA 5KG3A 4MFFA 1PYWD 2EAPA 2LBOA 3PRZA 1BPXA 2I5HA 4UAWA 2UU7A 3L17A 4IM2A 4UAVA 1TZ1A 3M95A 3D6JA 1TY0A 5C2TB 1XU4A 2FLNA 2YX8A 1WF9A 1V9JA 2BCSA 2K6DB 3A0BU 2J42A 1IBXA 5J0TA 2FUG1 2KQ7A 2CU3A 2C22A 1E90A 5AIAA 1ZQTA 5J2JA 2CRXA 4L2YA 3Q8MA 1ZGUB 4FJVB 4YD1A 4MT5A 4OVVA 2RLTA 3C2KA 2MSED 3B08A 3RFZB 3A33B 4YVZA 4IOIE 1YIWA 2W8KA 2O6VB 1ZQDA 1MG8A 1LVHA 4EX7A 2JT4B 4NLGA 2IOHA 5CHVC 3KVFB 5AKGA 1XO3A 2BB5A 1N5WA 1JWSD 3DHIC 4Y2JA 1PUTA 1D5XC 2V4IB 2WXMA 2Y1IA 3MDCA 5BPCA 3Q8PB 1OTRB 1V8CA 2QJLA 2E5SA 4ITKA 4ZRKA 1A5RA 4CO7A 3DBSA 2XY6A 4RM8A 1I4GA 3ZO5B 1KFDA 4XQ8A 2PE6B 8ICZA 4LNOA 4HK2A 4MJSB 1L3UA 4OJ5A 3Q3FA 3MR6A 1KFYB 1S97A 1XCQL 3C2MA 2KN5A 8ICGA 2Y5BB 2KMDA 4ECXA 4IRDA 1L6NA 2KYWA 3KZXA 2WXKA 4FHJA 3BZKA 3UXNA 2AL6A 2RR9A 2DWQA 5AKZA 5FR6A 3QU2A 7ICEA 4LNIA 2I2YA 2CN1A 1KF6B 4KLSA 3GE3C 1ED1A 5J2FA 3RRGA 3AEDB 2HOQA 4KLQA 1K50A 1PK1B 1Q5WB 4DO9A 2YMMA 4MGKE 5J2EA 5FR3A 5J0QA 5AI9A 3C2LA 1WWTA 2P6RA 3RUIB 1D4BA 2HOIA 3JSVA 2NMQA 4F8CB 4MH0E 1ZQFA 3EPGA 4Q43A 1V5OA 3RH6A 8ICWA 1FEHA 5ALDA 4ECWA 1RXVA 4PHDA 1NJYA 4CGZA 1DYQA 1FNVA 2DLBA 3JYUA 2Y1JA 1WM2A 1ZQHA 3SFEB 2BPFA 4KLIA 2BF8B 3W5VB 3U7DA 2JYTA 4BXOB 2JX5A 5KT7A 1I4QA 5D3DA 2QB1A 1B43A 3DV9A 2REXA 8ICKA 3OGUA 3RB6A 1EM7A 1ZQJA 1ZQ1C 1LO5D 3AE9B 3MR2A 1Q8KA 4KX6B 2AGPA 4DLEA 5TISU 1JWBD 3H0MB 5B66U 4HKZE 1T5XD 2YMQA 2JEGA 1K8RB 2JZPA 2I6XA 3F53A 4UAYA 4NAWB 2NBWB 3V60A 4CYEA 5ALKA 3C28A 1T0SC 1A0PA 2JWZA 1WJ4A 3R9KA 3ZDAA 4QIWC 1UZXB 2IGDA 1LQBA 3KFUF 2JRHA 3ZJVA 2D8CA 4KLEA 2AQ1B 2LGDA 2V9HA 4MF2A 2H3QA 2QC8A 2F1HA 5JHBA 2AHOB 3WKEA 5KFFA 4FULA 1WR6E 1IM4A 3TEYA 3PVXA 1ZJNA 3JPOA 5L9XA 3TL5A 2Y0SF 2V4LA 2W03A 2ZIXA 5IINA 4UB1A 3LVWA 1WYWB 4C0ZA 4XDCA 2DQNB 4RQ2A 3V6KA 3WA0A 5HR7A 4K4IA 3RAQA 1TTNA 2K0PA 1AW7A 5IIIA 3NG0A 4NQLB 4XC2A 5J2RA 2JY6A 3KHRA 1RYRA 3MFGA 4UAUA 2GB1A 4HLEA 2RPQA 3LJ3A 5J2CA 1S0VA 2KEYA 2K39A 3J9CA 2K3UA 3V6EB 1TAUA 3N7PD 2KDMA 3UQBA 5KAFU 5IIKA 4P2HA 2IOFK 1QSYA 3H4BA 3ML9A 3TMPB 1L8OA 2Q0ZX 5HMMA 2B3AA 1WE6A 4ZOHC 3A4SC 1Z19A 3SV3A 4ZRPA 9ICEA 2QB0A 3BDPA 1SV4A 5F3XB 5EE0A 3ZYYX 4JL9A 1S9FA 3KWVA 4C00A 2HVIA 4HPLB 1CEZA 1LV5A 1B1ZA 2XC9A 2MA1A 1ZQRA 2RGFA 1NVID 4OW0A 2C28A 2N9XA 4F4WA 3LWMA 4F50A 2KZ3A 4DDID 2KOBA 2AYOB 2EAMA 3L0WB 3BQTA 2WHIA 2GLEA 3RJKA 2INCC 5DQGA 5C5JA 5J2DA 3VHTC 1PFDA 3PO5A 3DBRB 4LDTD 4DS5A 3VC8A 7ICJA 4P0QB 3QCAA 2J0KA 4JE3B 5ALRA 3GV8B 3SAHA 1OGWA 4MFCA 2NTSA 2F2AB 4QZ8A 2HHWA 2FBWB 2NCNA 1X6JA 4O3PA 1Q0WB 4GDKA 1ZQKA 4ELTA 3ONNA 2LD9A 3QEBZ 2LWPA 5DPWA 3IG3A 5LLIA 5JHAA 1GOZA 1P9DU 2JWUA 2WLBA 2ZUBA 2W9AA 1TS4A 2W43A 4BWMA 2WWZA 1IBXB 3FM9A 3PZDA 2KSOA 4KZ0A 5J0SA 3HVZA 4UB3A 2M0NA 1D9DA 2H3VA 4TV3A 3ZDCA 1Z2MA 2K4IA 2N9PC 3RZWC 2BGWA 3Q8KA 1GPXA 1RPLA 4DL3A 5L1JA 1ZQQA 5C1ZA 3AULA 2ODGA 1WXAA 4MFAA 4FBTA 2TSSA 1NK8A 5AI6A 2FPMA 4EBDA 1T3QA 5L1LA 3M7DA 4DCCA 3BS5B 5IILA 1SZHA 2PLPA 2OM6A 2H89B 2KC1A 3JW0X 2A19A 2KMAA 4C7YA 3QYPA 4TUSA 2GRIA 3L16A 1QSLA 2HBKA 3APCA 3M8RA 2OEDA 3HM3A 3QAQA 2D3GA 1COKA 1ISNA 1F9JA 3IG5A 2ZEQA 1UWMA 5DGBA 4JWSC 2H3FA 5CR0A 1NYQA 2VRRB 2BKRB 1FCLA 3O65B 1MSWD 4DQOC 1C9FA 1XNSA 2DKXA 2EZXA 5GTHU 1WY8A 5EDSA 1ZQCA 1E8XA 3TEZA 5AK5A 4QZFA 2J7QB 1FXTB 2OYYA 4ARCA 1ZDVA 2M0AA 4US9A 1BGXT 3KBBA 2HBLA 5EWGA 2N9KA 1ZXIA 1YOVB 4K7WA 3R66C 3GV5B 3GIMA 4C8OA 2VANA 4QWDA 5C0YA 1SZPA 4KLFA 4U7CA 1L4ZB 2L5YA 1KLUD 2GOLA 3QU4A 1ZQMA 2M8SA 3AE2B 1IYFA 1WE7A 2LXAA 2KJ5A 1HUOA 1C1YB 4JWMA 4DF8A 4I6NB 3JSVB 4RM9A 3SR6A 5HFYA 3VUWA 1WGKA 2PMZC 1SV0A 2KTQA 1RQNA 4I28A 1SEBD 4C4TA 1EO6A 3Q3JA 3NS8A 4BDPA 2A5UA 1Z5SB 1WH3A 4C7ZA 4EX6A 3Q3OC 1R4MB 3H40A 2KX3A 1L3TA 2PPHA 3BWUD 2KD0A 1CQVA 2IO2B 2L76A 3GZNI 5IO9A 3KHGA 4WJ3B 4MF8A 4RQ3A 2PEAA 2BDUA 1KSPA 2G08A 2EKIA 3BZDB 1WSPA 1QKZA 5L83A 2LHDA 3SAFA 3DVNV 2BZFA 4GXIA 3SQIA 2KVRA 2LFIA 1YJ1A 4I6LB 2MUTB 9ICWA 1KDHA 4BAXA 3MR3A 2IYDB 1X9SA 8ICFA 2B0CA 3BVZA 3DOWA 3IRUA 5D7GA 1EU4A 2I1KA 2HCFA 1QT9A 2KHVA 4IS7A 5C3JB 3LDZE 3QE9Y 4CF4A 3KQ4A 4RCOA 2INNE 3H8JA 4N58A 3M9NB 4JB3A 2KANA 5KFAA 1WXMA 3WK9A 1QQ5A 3VAWA 3PW7A 3EUB2 5K4LA 5KG2A 3QZ7A 4O3NA 2K1FA 3Q3NC 2I1QA 1S3SG 4AS1A 1NEKB 4HROA 2AGQA 4OO1J 4P4PA 2N0SB 4EOYA 2BVCA 2E8PA 3AU2A 2KTFA 2DF4B 4P1CC 1IP9A 2E8OA 1I42A 3C0RB 1A77A 1TKYA 2D11A 5KG0A 4QZ9A 3P2BA 1F77A 1E7VA 2QB0B 5AM2A 5ALQA 4KLDA 1L3SA 2KTRA 4ICAA 4ZYSA 4RNMA 1K53A 3IHQB 1T0QC 3RNCC 2EZZA 4NJ8A 2BT6A 1XCTL 1I35A 1TV9A 2WXHA 2VZKD 4K81A 4EBEA 2FMPA 1NKEA 5DKWA 5KFRA 2XK5A 1K52A 2ICIA 2WXGA 1MG4A 3V05A 5H2FU 5IIJA 4TQ1A 1KFTA 2H88B 5CX3A 4EEKA 3EECA 4WJNA 3RZFA 3QUBA 1YQ4B 3QA8A 3UQAA 1SV0C 3TADA 1TK0A 1NK0A 5DQHA 2ZXHA 5KFXA 1RYUA 4PZOA 2MWSB 3DVGY 2D3DA 1C4AA 1HE8A 5KL1B 4DBGA 4M9HA 4J9MA 8ICSA 3Q8EA 4GDKB 1XWLA 2J53A 3TJPA 5GXGB 4GLXA 4MH8A 1WGHA 3U8ZA 2BQQA 3QU5A 5ALOA 4O5EA 5GMVA 2PFQA 3MC9A 3VH3B 4BKSD 2BS3B 1WZ0A 5KFPA 4ACOA 1LXDA 3EW9A 3QX1A 2N7DA 2I1JA 3BJYA 4DXGA 3ZW3A 1FXIA 3Q2AC 3KUCB 3EPIA 3QQ8B 3OSPA 1SJED 3I9V1 5KFYA 2DUYA 3U30A 3ISDA 1WGYA 1SL2A 2G5IB 2WGSA 3VR9B 3PV8A 2EKEC 5AZGA 3L5KA 3N9YC 2NYVA 4RGOS 2MRLA 1WCNA 1UD7A 5J0YA 2C7NB 4TMAB 2HVHA 2LVOA 3DPDA 3M3JA 2CPRA 3WKCA 4Z6FA 2HHSA 9ICRA 5AI0A 4RGNA 3BK2A 9ICUA 1NENB 1ZP0B 5JH5C 2FI1A 2Z59B 3MC8A 2JF5A 4R65A 4B0EA 3TEWA 3ZJTA 2IZVB 2KNBA 3CNHA 3BS7A 4IDIA 3PW0A 1V1PA 3PSIA 1ZQIA 1JWAD 4YN4A 2FLPA 4E71A 2ZTDA 4ED8A 1ZD5A 3T3NA 2WTFA 1E7UA 3R2IA 4P4MA 4DSEA 2JU6X 4C4RA 3PSTA 5E6OA 5C23A 2KKCA 1YN3A 3R7RA 1E0ZA 4W9GA 4DQIA 4II2B 3V7LA 1UUPA 5BYRA 2LEKA 1V49A 4KTQA 4RF1A 3PY8A 4I2HA 3WKAA 1LM8B 3ZDEA 1OQYA 1OQQA 2RD0A 2XNAC 4KLGA 5KFIA 2YQEA 2JGAA 4IWQA 1D8YA 4QZDA 5DPTA 2YMLA 1TS2A 2WDRB 1YQ3B 4US8A 3ZVVA 2JSVX 5IIMA 3IP4B 4ED2A 2KZRA 1QH9A 5KFLA 5DCNA 2JUOA 3Q14C 5KFBA 5CHWA 2HOFA 2DPIA 1GAQB 3AL0B 4QAYA 8ICIA 5BMHA 2BS4B 4B6JA 1Z1VA 1U47A 1L5UA 4KIKA 2KAJA 2KZZA 2BKFA 4Q45A 4YR2A 3QJZA 3TADC 2KHWB 1L0VB 4B9LA 1PVPA 5CB1A 1NBFC 3HKZC 2WDQB 4CCHA 3IHPC 4BWJA 4DWFA 1C78A 3A4RA 3MDAA 1U49A 1A6SA 2DZIA 1ZYQA 3UQ2A 2KFKA 4MEMA 4P4OA 1NJZA 1WZ3A 2F76X 1P0RA 1FPYA 4W9HA 2XGQA 4C80A 1FRDA 2YEPF 1ZQUA 1IUEA 1YZ7A 3CW2C 1C76A 1XSNA 1COOA 2ZXIA 5AKJA 4UARA 2K8BA 1F2RC 3BQ0A 1NK9A 2MU2A 3DBHB 4NLZA 1TE2A 4P0PA 2WXQA 2MP2A 4DHJB 4LLGM 4GGQA 5DDMA 4NJ7A 2KWUB 4RT3A 2F8KA 2KXJA 1N48A 3AI5A 2PW9A 2CJNA 2W9MA 4NY8A 3LYYA 1SXDA 1ZJMA 7ICMA 3UMCA 1RYSA 4K7SA 1NKBA 1F5SA 1KEJA 4ZDVA 4N6EB 3QEAZ 2L00B 1FNUA 1M4VA 4FZMA 1JALA 4QZIA 3KYCD 2FDRA 1KLGD 3I76A 2LHTA 1Z3EB 4RQ8A 4O5KA 1QLBB 2R2QA 2ZPNA 4II3B 4RQ1A 1ZE3D 5J2KA 3HUIA 4I2GA 3KW5B 2KTRB 3IAM1 3IT4B 1KFSA 2CHZA 2RDGA 5BO4B 1VLBA 5GTIU 4A3PA 4DLGA 4J03A 3AE5B 5LNK1 3ZRFA 3RR8A 1N60A 3FC4A 3IAS1 3W1SA 4DQRA 1ZW7A 3NVWA 1SE2A 4TUPA 3EGRA 2XK5B 2ZIUA 2L83A 4F2SA 1SWVA 4UBBA 4CRXA 2LYHA 1VZ6A 3Q8FA 1L8LA 5BMGA 4A20A 4GIBA 2F1JA 4IRCA 1O08A 4XUSA 4F5NA 5J2AA 2W7PA 4M47A 4YTNB 4RNOA 4BFRA 5T14A 4Y2TA 2HJ1A 4IUMB 1V80A 3RH5A 2K8CA 2UVWA 2C2DA 2G3QB 1GB4A 3AE6B 2GWSA 4FS1A 4YR0A 1X9MA 5G55A 1PQSA 2HTHA 1EF1A 2QDFA 4FBUA 2IMWP 4KN4A 4F4XA 2NRXA 1DOYA 1GG3A 3AEEB 2JV3A 3K9OB 2L1AA 4RQ0A 1P7DA 1TT5B 2GLSA 2PKOA 3SHQA 3NTUA 3IM1A 4USAA 1PGAA 4OJPA 2X38A 2BPGA 1WGRA 4F8RA 4WJPA 2KDBA 3I5JC 5JRTA 2QHOA 1CUKA 3UM9A 7ICSA 4IR1A 3ZDBA 1OQRA 2RDBC 3ENEA 3ISCA 4YMMA 3WAOA 1V81A 3VVWB 2KOXA 3D2SA 1KLNA 3H1UA 2HD5B 1SIJA 3GZNB 1GC6A 1JWUD 3DDCB 1WCLA 3HVDA 3P63A 1U9LA 3H7SA 3CP8A 1T3NA 1TAQA 4BOZB 5L95C 3JPQA 1ZRMA 2NTTA 3BYTB 4WWMA 3S2AA 4KX5A 1HZ5A 1I4HA 2JXTA 3PT2B 1WXSA 4DL2A 1UGMA 3T79A 2M4NA 4W9JA 2LVPA 3L13A 4I2AA 2K6QA 3CIRB 3MGIA 5AKXA 4NJ6A 1QF6A 3PPAA 4XZ4A 2KQSA 2KN7A 4B9SA 4M02A 1V1PB 2HHXA 2OXOA 4Y2XA 1KN5A 3M1YA 1OFFA 4PH5A 1KM7A 5DB6A 2LI5A 2R18A 3W1YA 4IRKA 7ICGA 4ED0A 3EFUA 1ZPSA 4GXBA 1ROEA 2GO7A 5DDYA 2K25A 1NKCA 2FCSA 5HHHA 2RDIA 2K22A 2KLGA 2MAXA 1JUDA 2MBHA 5J8YA 2KFNA 4YR3A 1SGHA 3ICXA 4Z6EA 2BPSA 2NBVB 2K4PA 1WUDA 2N4FA 2JHDA 4JMUA 5HMLA 2PE9A 5E6NA 2LASA 1ZQPA 5E6PA 4NNJB 5KG4A 1SJHD 2BW2A 2WF9A 3QU9A 4EZKA 1L6UA 2FIFA 4KIKB 1IPGA 1HEZE 4B95A 4F3OA 1H38A 4KX3A 5CTRC 2DAFA 5ALGA 4O3QA 5KG6A 2GBKA 3EC8A 4NV0A 3I63C 3CRXA 2EQYA 4L23A 4YSYB 4YSZB 1ZQLA 4P16A 4AJYB 2A1JA 1L4DB 2KFKB 4DFPA 3I57A 2D6FC 1VD2A 1WFYA 3QNMA 4DFJA 8ICEA 3DHGC 2GBMA 1XLOA 2VA2A 3GDXA 1C4CA 2IDYA 3CSTA 2WXRA 1L2NA 3AEVA 3RFAA 5BOMA 1V5TA 1BPEA 1J2NA 3CWIA 1B9RA 4J9SA 1JMLA 3M9MB 2MP2B 4ANVA 3H0LB 1EUVB 4DOCA 4Y2SA 4LZGA 2KK8A 2B76B 1TS5A 2A4ZA 3L10B 1D5MC 2ACZB 2M9NA 3EA6A 2AWTA 4QWCA 3JPPA 3T5KA 4KDLB 4KSKC 1ENFA 4C4SA 1WWVA 4R8UA 4YXJA 1GNUA 3ZRCA 2FAZA 2HE7A 5AICA 1GJZA 4Q8EA 7ICUA 1OEYA 5J0XA 2WF8A 5AM3A 1JX4A 1A70A 2WXJA 4KDIC 2KQ4X 2M1MA 2ASJA 4BBNF 4HXDA 2JPHA 2HTME 4IQUA 3CSFA 3MGVA 1S0NA 3KH0A 3N32A 2YY6A 1XLNA 2W9NA 3QWZB 3E2EA 4NJCA 2J0JA 1UH6A 1SE9A 4DFKA 1TAMA 3FAHA 2OJRA 4K3BA 3U7ZA 4F7ZA 3RF9A 4YP3A 4I2DA 3LYSA 4L1BA 4F91B 2WXIA 2ZIUB 2W9BA 1ZQGA 2I9GA 8ICHA 1XXGA 1Y8RC 3N20C 4A90A 5AKHA 4I6PA 1AROP 1MHXA 5J8YC 2CHXA 3VDZA 8ICBA 5AM5A 1NZBA 2K8CB 2KWVB 2N9EB 1FFUA 2CR5A 4MM3A 1LB2B 4H2AA 4MACA 2QARA 1C77A 3QHTA 5DB9A 3UPQA 5ALHA 2G4SA 5ALLA 3RJHA 3AEGB 2KD1A 2ZG6A 2HW3A 4PGYA 3RT3B 2AX5A 2BCUA 4J9RA 2PFOA 3VR8B 4RNNA 5KFKA 3TAQA 3MFIA 1XSPA 2ES6A 4PL2A 3P4QB 3KZIU 5AI4A 3AE3B 5J0OA 2WHEA 3EFCA 3T9LA 1MQ3A 4PGQA 1RWSA 4Z6CA 4KITB 2OEHA 4F2RA 4REZA 4FZLA 1KJTA 1SL0A 1D5ZC 3Q3MC 5KT2A 8ICPA 4DQSA 1SWWA 3ZDTA 2RRDA 4RPXA 2W54A 3GE8C 1ZQBA 2QSDA 3AEAB 4DHZE 2HHQA 5F9LA 3OJ4B 1DOXA 4RUCA 4KV2A 3RH4A 1QTMA 3Q6BA 3PZ8A 1SKRA 5KT6A 4YCXA 3SFDB 2VA3A 4GXKA 2Y3AA 5KFTA 7ICKA 3DDHA 1F0MA 4WIPA 2JH7A 4NLKA 1QOAA 1VJKA 3ZJUA 3RJGA 3TAPA 3N7RC 8ICCA 1PGXA 2MBOA 3M8SA 2AH5A 2WX1A 3KUDB 1NK4A 4DF4A 3VRBB 2O6KA 2KMCA 3VFKA 4B9TA 1RAXA 1R4NI 2EZYA 3NHEB 2KVCA 1OW5A 3V72A 2ASDA 3TCAA 3T8MA 4UW9A 2NRVA 3ZDDA 2X8XX 2YTUA 4GDLA 1UT5A 5B5EU 5DPSA 2MCNB 1JQ4A 2IHMA 4DL7A 4QJFB 5G5HA 3Q69A 4JWUC 4MSMB 2BCQA 4QZAA 3UINB 1HA5A 1UT8A 1AN8A 2MQJA 1WRIA 3ZQ4A 1ZQNA 4QW9A 3W5UB 1NDDA 4XX5A 4M9JA 2JR5A 3SU8X 1VCBA 4AOFA 1CZPA 4ZRQA 2WXFA 2KFZA 2KACA 3ORYA 4YTPB 4MGIE 2P66A 3L08A 3MHSD 1JXEA 3RJFA 1YX5B 1S76D 2L7RA 2DHZA 2MJ3A 2ASQA 5KNIA 9ICNA 1YN5A 3NZSA 1WMHA 5KFNA 4QZGA 2WXNA 1C20A 2WF5A 4IR9A 1VZ7A 1U45A 3T3FA 1X42A 2A1JB 1FEZA 4JV0A 4NL9A 1Q10A 2KV2A 4IQTA 2D3BA 2NBUA 3A1QA 3HT3A 4GIVA 7ICIA 2JZ3B 4TQ0A 3A9JA 2H5XA 4PPXA 5KL8B 1HZ6A 2MA9B 1AYFA 4W9IA 8ICUA 2NV3A 4DQPA 2LUEA 5ALXA 1RFKA 4RQMA 4ECZA 4CHKA 1KRPA 9ICXA 5ALWA 3SMVA 1ZQSA 2F1IA 2W3SA 2QIEB 3H7IA 1NOMA 2C5LC 3RBDA 1JROA 2WB1C 3ZDMC 4N9F4 2VJ4A 4LDTB 1JMSA 4HJGE 1PVQA 1SXTA 1DGSA 3B0XA 1Q1OA 3RNFC 2KJRA 3ISBA 2XN9C 1RQLA 3B0YA 2ZTEA 4HEA1 3MBYA 3UMBA 4O3RA 9ICPA 1ZDXA 4UBCA 3KLSX 4JIOU 3HILA 4ZHPA 5J0PA 4R8UB 1H4RA 2OH2A 4XRHA 2K4HA 2N1VA 8ICNA 4BKSA 7ICTA 3GP7A 5EOZA 4ECYA 4GU2A 2N1RA 1SIFA 4RQ4A 3AE8B 5KFWA 2CKHB 4LJXA 1XO1A 2DGZA 2DZJA 2KFJA 2BQRA 3AECB 4DL6A 2ISOA 1XC9A 5KFGA 3AEBB 2GMIC 4WQOB 4D2KA 2F8LA 1TKGA 2L32A 4YMOA 1JRPA 1KH0A 2EMTA 2LGSA 1WM3A 2M56B 4FJZA 4OZCA 3KD3A 4EZLA 4F93B 3RJIA 3OTQA 3MR5A 5ALMA 2JZBA 1UCVA 1N5XA 2G07A 2LJ5A 2ZIXB 3NUHB 3BIID 2UVVA 5JUMA 1TK8A 8ICMA 2ZUDA 2H3ZA 2W9BB 4Y2PA 3EYZA 2PFPA 1YX6B 4LK0M 3VUYA 2R8JA 1AQ6A 3BZCA 3T5HA 1V2YA 4IWPA 2HHVA 4FO6A 3DBLI 2KJ6A 3RB3A 2PIAA 4ECQA 4A3OA 4HRSA 3E56A 1C3TA 2XGPA 2CU1A 1YJIA 4UASA 5E79U 1RZTA 9ICGA 1ESFA 4MM3B 1UWXA 4C56C 4OCZA 4NLNA 2IGGA 2HJ8A 4K1RB 2QARB 1WJUA 5G2NA 1XO0A 2DYOA 4WJOA 2E1EA 5DQIA 3PGEA 1X9XA 4EZ6A 3HM6X 3V62A 1S5LU 3W2DA 2UVRA 5KFMA 1HXYD 5KAIU 2FCMA 7ICFA 3AU6A 3QX7A 2IBKA 3EHVA 4NL9C 3C5GA 2AQ3B 3KYDD 3IVFA 1IGCA 1KBUA 1FCCC 3PW4A 2KVSA 2HHTA 1QILA 4WWOA 2KJ9A 4J3OD 3SEIA 2XBBC 4NQKE 4ELUA 2V4QA 3NRZA 3F2DA 5DG9A 1E7PB 5ALVA 1KTKA 4BX9C 4EEWA 3THVA 3APFA 3HPOA 4EE2A 2CXYA 4EEYA 1S8OA 1QCKA 4K7UA 1SXEA 3ZNID 4G3IA 1ET6A 3C5FA 5KT4A 5ALUA 4B9UA 1ZUD2 4ZRJA 3VUXA 4J9OA 4I27A 2ZIWA 1Q3UA 1SKWA 1BXTA 2EELA 1PK3A 3BQ7A 5J2IA 3L3FX 1RM6C 1YMHE 4BUGA 2XICA 2G4DB 4Y2UA 4OZBA 4KLUA 2KSOB 5EE3A 4CNQA 5BYSA 3GIJA 4M9LA 3HWTA 4KZCA 1DOIA 4F4ZA 1F52A 1TIFA 2Y5CA 2LI6A 3PX4A 4FBJB 2C2EA 5BYQA 4RQNA 3F2BA 4P7IA 4AWJA 4PGXA 2K9XA 5IAAC 3HK0A 2R2OA 4NM2A 1HTOA 8ICQA 4EKUA 3TFSA 3AXCA 2KK0A 2LM1A 1ZQWA 4LZDA 8ICJA 1EU3A 1I4XA 4ECUA 2LXCA 2LRWA 2PVGC 4QIWF 2KHQA 3G6VA 2PXIA 4NAMA 3GZFA 4F5OA 1CRXA 1AWDA 4HDQA 4PHPA 2ESEA 1MFWA 2BYEA 2KG5A 4KLOA 5KFZA 4MEYA 2Y5PA 4JPSA 3AU4A 5DLGA 1V86A 2PI4A 1KQQA 2DX5B 4LCDE 4M8NA 1FNWA 2AQ4A 4OJOA 1XSLA 1TZOA 2D5GA 3P42A 5IKCM 1LKYA 4PL1A 2HSZA 1L3VA 1OEYJ 2PJHA 1F0ZA 4IWOA 4FZNA 4I2IA 4GN1A 2ZVOA 2MBQA 1WMHB 2INPE 2RPVA 3GQCA 3RR7A 3PX6A 5AKIA 1WIAA 3RYTA 4ED3A 2BDPA 1FRRA 2FPLA 4RMAA 4ZH4A 2VIXA 4FS2A 3SD5A 3NVZA 3JPTA 2KIVA 2KNJA 4HYKA 2P6UA 3UMGA 5F9NA 2UYZB 3AN1A 1J2MA 4UATA 2NRZA 2VZKB 3GILA 4RNAA 4TUUA 5CHGA 4U6PA 2Y0SC 4WQMA 3ZI4A 1ZQVA 3WAPA 2ZW0A 1F44A 2MBEA 2W82A 4FLHA 2XVTA 1ZXHA 1ZQYA 5ALEA 5FP0A 3M62B 3IXSA 2MSNA 3S6JA 3QZ8A 3PW2A 2L0TA 4W9FA 4UAZA 4C8MA 4KLLA 5AZHA 2HI0A 5J0UA 1VRAB 4NLBA 2WX0A 2ATLA 1O03A 3MFHA 1MN8A 4X5VA 1UQVA 4GMVA 2E6XA 4EZJA 1P1AA 4RQ7A 3X0WA 1N56A 3X23A 5H8YE 3WK6A 3HW8A 4UB5A 4IC9A 4DSJA 4WURA 2P35A 4G9BA 4OZAA 4BOSC 2WAQC 3I28A 4AYBC 1JXLA 3KUZA 3EZ5A 1IIPA 2I38A 4M00A 1N2XA 4K4GA 1YQBA 1PDXA 4UB6U 4LNFA 1FFVA 2JZBB 2GOWA 2JQRB 2ZVNA 2W04A 2XO7A 4B9KA 1Z1BA 4JX1C 4B9MA 1GO3F 1MC8A 7ICOA 3Q8SB 3RNAC 4RT2A 5HNKA 4BGDA 3Q8QB 3QUTA 4J6IA 3K1ZA 1L7YA 3U26A 3D2QA 1RLFA 4PT5A 1D8BA 3C1YA 2G45B 5DBCA 1RRBA 3VTVA 1ZD2P 4ECRA 3H7PA 3UQ0A 3DHHC 1KOTA 2AXTU 2WYQA 1XT9B 1Z4NA 4DHZB 3C23A 3ZNZB 2HBJA 3HIZA 2JEFA 3PNCA 2D10A 1X40A 3NJTA 3OPXA 4NWIA 3NVYA 3VCBA 2VH2A 1CK1A 2C9WB 2RSUA 4AUQC 4DSLA 4AP4C 1Z00A 4BJQA 2CHWA 3R2TA 2N7EA 2AL3A 1TY2A 4ICUA 1XQQA 1ET9A 2D3AA 4P1BC 3FYHA 1UA1A 2IO3B 4IQVA 4FA6A 3WANA 1L6VA 3URYA 2KN4A 3ALRA 2O6VD 2W55A 2DL0A 2E8MA 5KFCA 2V4RA 5J2BA 4PHAA 1TYGB 5J0RA 3LB8C 9ICLA 2PMZF 3DEEA 5LXIB 1BNOA 2MW5A 1ZRNA 2XI9A 4KLMA 4XA5A 1TFRA 2ZIWB 5AI5A 4KLHA 4F5PA 3PO4A 5KFOA 2K8HA 4P6VF 3DVNU 2ZTCA 4ACFA 2PTLA 2ZJ8A 3VTUA 3ONSA 5CWRA 1BVSA 2RP5A 4MHVA 3TSSA 3UIOB 3U52E 4WH4A 2XIDA 1WI0A 1T7PA 3TBLD 3A0HU 3K75D 1SE4A 2YB4A 4BKGA 3RCZA 1CI4A 2LGXA 5J0WA 3EWAA 3AEFB 2KDEB 3G6YA 5JXVA 3IN5A 3WKBA 3RB0A 7ICRA 1TVAA 4KGSA 1OXJA 2ZPYA 1H8CA 1WX7A 2JVCA 3CMMB 1TBEA 2R8KA 1P3QU 2LVQA 4W9DA 5AK3A 3NRWA 2WNMA 2GBNA 2VH1A 2J52A 9ICBA 4NM1A 1UBQA 1X6IA 4HPPA 4HWIB 4URKA 3L54A 2AQ0A 4O1NA 1LKYB 2MHJA 2WS3B 4OJ6A 3B1LX 1RFAA 3PLUA 3MHZA 4P0QA 1L0YB 1ECWA 4XE0A 2N1WA 1D6EC 3DVGX 4JUZA 1SE3A
chains in the Genus database with same CATH topology
2WXOA 3BVZA 3VR8B 3H8HA 2RDHA 5D7GA 4AQ7A 1EU4A 1QT9A 3RPFC 3MP9A 1J7CA 4RF0A 3P4QB 5C3JB 3AE3B 3KQ4A 4RCOA 2INNE 1JCKB 4N58A 1RWSA 4REZA 2QILA 3W9CB 1D5ZC 1TS3A 2MEKA 3EUB2 1N61A 2G9HD 4CQNA 3WCQA 4YSXB 5AUIA 4AS1A 1NEKB 4HROA 2N0SB 2W54A 4A6QA 2QSDA 3E9SA 1I4PA 3AEAB 1DOXA 1V97A 1BUIC 3PZ8A 1XF5L 2WP9B 1TKYA 3SFDB 2Y3AA 3P1MA 1F77A 1MPEA 2BTEA 4WIPA 1QOAA 1VJKA 3TUOA 3ZJUA 4ZYSA 1DGJA 1K53A 1PGXA 3AB5A 3MC0B 2BT6A 1XCTL 3VRBB 1MVKA 3C8YA 3VQIA 2WXHA 2VZKD 1MHHE 2PVOD 2PMVA 4YT0B 4XE0A 1K52A 1P7FA 2ICIA 2WXGA 3V05A 1JWMD 3FILB 2IGHA 4TQ1A 1WYGA 2H88B 3BVMA 2KMMA 1SB3C 1JQ4A 1YQ4B 4A8XC 1P7EA 3Q69A 5G5HA 4JWUC 1HA5A 1C4AA 1AN8A 2KWDA 1WRIA 3ZQ4A 3Q8EA 5H92C 4GDKB 3W5UB 2J53A 5GXGB 1C4PA 4WAFA 4MH8A 1QOFA 1CZPA 4ZRQA 1ACCA 2WXFA 2KACA 4YTPB 4KGTA 1VDVA 1N63A 1Y56A 2QEJC 2BS3B 2MJEA 2MJ3A 1JW9D 1YN5A 1EWCA 4XWTA 1SBBB 2WXNA 4DXGA 1K51A 3B2FA 1VZ7A 1FXIA 5MPOA 1Q10A 1SJED 3I9V1 4KGRA 1FXAA 2R61A 3P4RB 1J7BA 4DXFA 4IKGA 1HZ6A 3VR9B 1AYFA 3B9JA 3SEBA 3AV8A 2WQYB 2V3NA 3N9YC 4RGOS 3OWEB 1RFKA 4TMAB 3T3OA 2GI9A 2LGIA 2OHFA 2QMTA 3ABVB 2K5PA 2W3SA 2QIEB 4YTMB 1I7HA 2HDEA 1SSNA 1CJEA 1JROA 2WXPA 5AUKA 2WXLA 4RGNA 4A55A 3BK2A 4NZLB 1R7SA 1NENB 1ZP0B 1L5PA 4HJGE 1SXTA 5FKAC 5D3IB 5E6JA 1E10A 4B0EA 2XN9C 3TEWA 3ZJTA 3AH7A 2ON8A 4HEA1 4RFBA 4OZAA 1ZDXA 3Q8CA 2BS2B 4IDIA 1V1PA 3KLSX 1JWAD 5EE1A 2IJ0A 4ZHPA 3T3NA 3ZGZA 3R2IA 5FK9C 2L52A 2MH7A 2AQ2B 2JU6X 3NVVA 2M19A 1FO4A 1YN3A 1E0ZA 3GP7A 1UUPA 5BYRA 2LEKA 4RF1A 1EWYC 3AE8B 3BYYB 3AECB 3AEBB 1OQQA 4D2KA 5HG2A 3B2GA 2XNAC 1TKGA 2L32A 3DWMA 5HHDG 2M56B 1JRPA 1KH0A 1RYJA 4XDDA 2J4XA 4OZCA 2WDVB 1FM0D 2JYEA 2N7JA 1TS2A 2WDRB 4FXCA 1YQ3B 1N5XA 4US8A 2JSVX 2V0GA 2CJOA 1PYWD 2BBCA 1GAQB 3NUHB 3BIID 4LTUA 5BMHA 2BS4B 1T6BX 5C2TB 1TY0A 4LK0M 2LUMA 2KAJA 1ZOYB 2J42A 1IBXA 1SF0A 2FUG1 2WDQB 1L0VB 2CU3A 1FMAD 5EE9A 3NS1A 1C78A 2PIAA 4L2YA 2ZW1A 4HRSA 3E56A 4MT5A 3RFZB 1YJIA 4R3DA 4A9AA 4IOIE 4MM3B 1ESFA 4KKJA 1UWXA 4C80A 4C56C 1FRDA 2YEPF 2IGGA 1IUEA 1XO3A 2BB5A 1N5WA 2DYOA 1C76A 1JWSD 1UGJA 2IPKD 1PUTA 3W2DA 1F2RC 1D5XC 2V4IB 2WXMA 1HXYD 2QJLA 1V8CA 2SAKA 3HRDD 2WXQA 4ITKA 2AQ3B 4N59A 1I4GA 4LLGM 1IGCA 1FCCC 3U4EG 1KFYB 1QILA 4J3OD 1XCQL 5G5GA 3Q8AA 3NRZA 3KWLA 5BMIA 1E7PB 1KTKA 2PW9A 2CJNA 2SEBD 2W3RA 1MI0A 1TJEA 2Q5WD 2WXKA 4EE2A 3LYYA 2WU5B 1WXQA 2DWQA 4N6EB 1ET6A 1FNUA 2I2YA 2ONQA 1ZUD2 1M4VA 1KF6B 1JALA 1BXTA 3AEDB 1KLGD 2MJDA 1TKEA 1HQRD 1K50A 2EELA 5FR3A 1RM6C 1QLBB 1WWTA 1ZE3D 1YMHE 3HUIA 1D4BA 1V1OA 2NMQA 3IAM1 3IT4B 4OZBA 5EE3A 2RDGA 3MJ5A 5BYSA 2BYTA 1VLBA 1FEHA 5LNK1 3AE5B 1DYQA 1DOIA 1FNVA 2DLBA 2WU2B 2Y5CA 4YWGG 1N60A 3FC4A 3IAS1 3SFEB 3W1SA 3W5VB 3NVWA 5BYQA 1SE2A 2JYTA 3EGRA 2JX5A 1I4QA 5D3DA 2K9XA 2L83A 3U2SC 1VZ6A 1EM7A 3Q8FA 1EU3A 1I4XA 1LO5D 2PVGC 3AE9B 5BMGA 1J7AA 4KX6B 1JWBD 5TSSA 4NAMA 4HKZE 4YTNB 1T5XD 1AWDA 5HI1A 2JZPA 4NAWB 2Y5PA 4JPSA 1GB4A 3AE6B 3L4PA 1I4RA 3GB1A 1XLPA 1E9MA 2IGDA 1FNWA 1TZOA 2D5GA 3ZJVA 3AM9A 1DOYA 3P42A 2AQ1B 3AEEB 2L1AA 2PKOA 1F0ZA 4USAA 1PGAA 1XLQA 4TSSA 3TEYA 2X38A 2INPE 3AE1B 2RPVA 1IGDA 3V3XA 3P4PB 4ZHOA 2YEPB 1F2RI 1FRRA 1OQRA 3LXFA 4XDCA 1E6EB 3NVZA 2K0PA 1AW7A 5T8IA 4KKIA 1SIJA 2VZKB 1JWUD 3GS2A 3HVDA 3AN1A 3MFGA 3P63A 4RNAA 4TQ0A 2GB1A 4WQMA 3PO0A 2NTTA 3BYTB 3AMZA 3J9CA 2K3UA 4WWMA 3P4SB 2KDMA 1HZ5A 1I4HA 2JXTA 2V3PA 2ZW0A 4RGMA 2W82A 1ZXHA 4ZOHC 3CIRB 3IXSA 4ZRPA 1QF6A 5EE0A 1VRAB 1VZ8A 3ZYYX 1V1PB 3KWVA 2E6XA 1OFFA 1B1ZA 4OW0A 1NVID 5H8YE 1BMLC 3R8BA 1ZPSA 1ROEA 4WURA 3BK1A 3AE4B 3FILA 3UI3A 1YN4A 1C79A 1QOBA 1PFDA 2K22A 2I38A 3Q8BA 1PDXA 4JE3B 3ETRA 4RGTA 2NTSA 1FFVA 2N9LA 2FBWB 2JQRB 4B0MA 4Q2JA 4OHJA 1XEEA 1SJHD 2DYMA 2BW2A 4JX1C 1NI3A 4GLSC 1GOZA 2JWUA 2WLBA 1L6UA 1HEZE 1TS4A 2G1EA 1IBXB 4L23A 1N62A 4YSYB 3HVZA 4YSZB 4PT5A 4P16A 4UDUC 1L4DB 3I57A 1GPXA 3BVGA 4M0WA 1XLOA 1C4CA 2IDYA 4XWWA 2WXRA 2TSSA 1T3QA 2PLPA 2H89B 2FE8A 4C7YA 2LHEA 3CWIA 1QQRA 2GRIA 1B9RA 3NVYA 1JMLA 2LMCA 1CK1A 2OEDA 3NZ3A 3R2TA 2B76B 1TS5A 1UWMA 1TY2A 2DBYA 2LJIA 1D5MC 1ET9A 2ACZB 4JWSC 1NYQA 3EA6A 4GDLB 1FCLA 1L6VA 3DWGC 3URYA 1ENFA 1L0XB 1YNTE 4DQOC 1C9FA 2KN4A 2W55A 3TEZA 4HKQA 4RH6A 1GB1A 4ARCA 1ZDVA 1TYGB 2M0AA 3LB8C 4US9A 2N9KA 1ZXIA 1UNSA 2WXJA 1A70A 1L4ZB 2RMMA 2KQ4X 1KLUD 3O13A 2BB6A 3AE2B 4P6VF 2HTME 5HFYA 3SR6A 1KRHA 1WGKA 2PTLA 1XLNA 4ARIA 4NJCA 3TSSA 2E3TA 3U52E 1SEBD 3FAHA 4WH4A 3U7ZA 1FIQA 3IT6B 3VRAB 1SE4A 4L1BA 4C7ZA 2WXIA 3AEFB 1XXGA 4A90A 5I4DA 5JXVA 3BWUD 1MHXA 4KGSA 2Z8LA 1CQVA 3TEXA 3PZ7A 1NYRA 4OVZA 2WNMA 1QOGA 2J52A 1FFUA 2EKIA 1FD6A 1STEA 4H2AA 1PGBA 3BZDB 4MACA 1C77A 1VR9A 1WSPA 1QKZA 4O1NA 2LHDA 2WS3B 1YJJA 3AEGB 2LFIA 4YXDB 3MHZA 1L0YB 3AE7B 1D6EC 2AX5A 1SE3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3AE5 B;  3VR8 B;  1DOI A;  2WU2 B;  2Y5C A;  1N60 A;  3FC4 A;  2BS2 B;  1QT9 A;  2G1E A;  4IDI A;  3RPF C;  1J7C A;  3SFE B;  3NVW A;  3W5V B;  1JWA D;  5EE1 A;  3P4Q B;  2JX5 A;  5C3J B;  2K9X A;  3AE3 B;  2L83 A;  4ZHP A;  1N62 A;  4YSY B;  3HVZ A;  4YSZ B;  2L52 A;  2MH7 A;  4N58 A;  3NVV A;  1RWS A;  2PVG C;  3AE9 B;  2M19 A;  1J7A A;  1FO4 A;  4KX6 B;  1JWB D;  1E0Z A;  3W9C B;  1GPX A;  2LEK A;  4YTN B;  1EWY C;  3EUB 2;  1N61 A;  1AWD A;  3AE8 B;  1XLO A;  3AEC B;  3AEB B;  3WCQ A;  5AUI A;  4YSX B;  1OQQ A;  1NEK B;  4HRO A;  2N0S B;  2W54 A;  1TKG A;  3B2G A;  3DWM A;  3AE6 B;  2M56 B;  1JRP A;  3L4P A;  1T3Q A;  1RYJ A;  3AEA B;  2WDV B;  1DOX A;  1FM0 D;  1V97 A;  2H89 B;  1XLP A;  1E9M A;  4C7Y A;  2WP9 B;  1TKY A;  2WDR B;  3CWI A;  1YQ3 B;  4FXC A;  3SFD B;  1N5X A;  4US8 A;  3NVY A;  3AM9 A;  3P1M A;  1B9R A;  2CJO A;  1DOY A;  3AEE B;  1QOA A;  1VJK A;  2PKO A;  1GAQ B;  1DGJ A;  1F0Z A;  2B76 B;  1UWM A;  3AB5 A;  4USA A;  3BII D;  1XLQ A;  4LTU A;  2BT6 A;  2BS4 B;  2DBY A;  2ACZ B;  4JWS C;  5C2T B;  3VRB B;  1NYQ A;  3AE1 B;  2KAJ A;  3P4P B;  1ZOY B;  1L6V A;  2PVO D;  3DWG C;  1SF0 A;  4ZHO A;  2WDQ B;  1FRR A;  1L0V B;  1FMA D;  1OQR A;  2CU3 A;  1E6E B;  3LXF A;  4YT0 B;  2W55 A;  5EE9 A;  3NS1 A;  2PIA A;  3NVZ A;  1WYG A;  2H88 B;  4HRS A;  1TYG B;  1SIJ A;  3LB8 C;  4US9 A;  3AN1 A;  3P63 A;  2KMM A;  1SB3 C;  1YJI A;  1JQ4 A;  1YQ4 B;  1ZXI A;  4A9A A;  4WQM A;  1A70 A;  3PO0 A;  5G5H A;  4C80 A;  3AMZ A;  1FRD A;  3AH7 A;  4JWU C;  4WWM A;  3P4S B;  1IUE A;  1WRI A;  1XO3 A;  3AE2 B;  1N5W A;  5H92 C;  4P6V F;  3W5U B;  2HTM E;  5GXG B;  3SR6 A;  1PUT A;  1KRH A;  1WGK A;  4ZOH C;  3CIR B;  1QOF A;  1XLN A;  1CZP A;  1QF6 A;  2QJL A;  1V8C A;  3HRD D;  2E3T A;  4ITK A;  3FAH A;  4YTP B;  1FIQ A;  1VDV A;  1N63 A;  4N59 A;  5EE0 A;  3VRA B;  3ZYY X;  2BS3 B;  2WLB A;  4C7Z A;  2MJE A;  2MJ3 A;  1KFY B;  1JW9 D;  3AEF B;  1OFF A;  5G5G A;  3NRZ A;  3KWL A;  5H8Y E;  1NVI D;  1E7P B;  1FXI A;  3B2F A;  5MPO A;  2CJN A;  2W3R A;  1ROE A;  1TJE A;  1FXA A;  2Q5W D;  3P4R B;  3AE4 B;  1NYR A;  2WU5 B;  1J7B A;  1WXQ A;  3VR9 B;  1AYF A;  3B9J A;  2DWQ A;  3AV8 A;  2WQY B;  4N6E B;  1QOB A;  1QOG A;  1PFD A;  1RFK A;  2K22 A;  1FFU A;  1ZUD 2;  2EKI A;  2OHF A;  1KF6 B;  3ABV B;  1JAL A;  2K5P A;  3AED B;  2MJD A;  2W3S A;  1PDX A;  1TKE A;  2QIE B;  4YTM B;  3ETR A;  1I7H A;  1FFV A;  1CJE A;  1RM6 C;  1JRO A;  1QLB B;  1WWT A;  2FBW B;  2JQR B;  5AUK A;  2WS3 B;  3HUI A;  1R7S A;  1NEN B;  1YJJ A;  1L5P A;  1ZP0 B;  3AEG B;  4YXD B;  5EE3 A;  4JX1 C;  1E10 A;  1NI3 A;  3AE7 B;  2AX5 A;  1VLB A;  1L6U A; 
#chains in the Genus database with same CATH topology
 2V1Y A;  2UVU A;  1IG6 A;  5CRX A;  5AEK B;  4AQ7 A;  1DOQ A;  4YD2 A;  4RF0 A;  5AK6 A;  1NNL A;  2KWC A;  3RBE A;  3DBL B;  4WWN A;  4Y2Q A;  1JCK B;  1TK5 A;  1U4A A;  5IIO A;  1BPB A;  3H8M A;  1KW4 A;  3V6H A;  1UBI A;  2FCN A;  1BT0 A;  1X66 A;  3HHM A;  5AHX A;  3TAC B;  1TS3 A;  3MTN B;  3PV1 A;  4MGZ E;  1J0G A;  2G9H D;  3ZNH B;  2QKQ A;  4YSX B;  3W1S C;  3WKD A;  1YT3 A;  5AUI A;  2DKZ A;  8ICL A;  3E9S A;  2L05 A;  3V6J A;  1V97 A;  1BUI C;  1T0Y A;  2B6G A;  1XF5 L;  2WP9 B;  3M9O B;  4RPY A;  3H8S A;  4O3O A;  1DGJ A;  3BS5 A;  1GC7 A;  3AB5 A;  3RTV A;  9ICH A;  3RB4 A;  1WGG A;  4YFK A;  1D3Z A;  4KVG B;  3SV4 A;  3VQI A;  4FJY A;  5ALF A;  2DEN B;  2BCV A;  1J8C A;  2PVO D;  3ZLZ A;  2PMV A;  2OCE A;  5KFV A;  4M9G A;  1P7F A;  2L8J A;  1V38 A;  3PZP A;  3M6K A;  1RXW A;  3QAR A;  2AEH A;  1WYG A;  2JRI B;  3BVM A;  4I29 A;  2IO1 B;  2KMM A;  1SB3 C;  4JGH B;  4HCP B;  1P7E A;  2K8B B;  5ALZ A;  4JLC A;  1L7N A;  4TKN A;  4P0P B;  5LXH A;  5H92 C;  3GFK B;  3ZKJ C;  2JXJ A;  1MQ2 A;  2KC2 A;  3V6C B;  3SDL C;  4R63 A;  1QQ6 A;  5HP4 A;  1QOF A;  1WGD A;  1ZQX A;  1M94 A;  2ZJD A;  4AJW A;  2OOB B;  3ZNG C;  4KMO B;  9ICJ A;  1Y56 A;  2VJ5 A;  4DS4 A;  4QZH A;  5J17 A;  3Q8R B;  3B0A A;  3PS6 A;  5KHO A;  2HDO A;  2EAN A;  1JW9 D;  4XWT A;  4DSK A;  4QW8 A;  2AU0 A;  3B2F A;  3H6N A;  5AK4 A;  4EEN A;  1FXA A;  2R61 A;  3H7P B;  1KTQ A;  2K8A A;  1RG6 A;  1J7B A;  1L7M A;  1DK2 A;  3PX0 A;  3SEB A;  3F5E A;  2WQY B;  2V3N A;  3J81 j;  3NY5 A;  3OWE B;  4QNL A;  4JV2 A;  5A0L A;  3QIJ A;  4O9M A;  3C1Z A;  3ZD8 A;  4DL5 A;  1PVR A;  4JQW C;  4NLC A;  5DB8 A;  2GI9 A;  2ISP A;  2LMR A;  4KLT A;  2LGI A;  2QMT A;  3ABV B;  2K5P A;  3WK8 A;  3OLM D;  1I7H A;  2HDE A;  5D2M B;  4DFD A;  2WXP A;  4F5R A;  1ZQE A;  5AUK A;  4Q44 A;  3VXW A;  1LGR A;  2LM4 A;  1L5P A;  4IM0 A;  4W9E A;  1Z00 B;  4ZYN A;  1UHU A;  3AH7 A;  1S1Q B;  5D49 A;  2KLC A;  3APD A;  1UPH A;  5AKY A;  1J97 A;  3Q8C A;  3N3K B;  5J18 A;  4S17 A;  4GFJ A;  2MUT A;  4W9K A;  2IJ0 A;  3BQ1 A;  3ZGZ A;  5FK9 C;  4PS7 A;  2L52 A;  5AKL A;  2H3I A;  2ALZ A;  4CF5 A;  2V9W A;  3N1Y C;  4MSQ B;  4MEL A;  4B9N A;  1MJD A;  4IG7 B;  4PS3 A;  4IW0 A;  2BQU A;  9ICF A;  3BQ2 A;  1EWY C;  5TR5 A;  5KFD A;  2IOF A;  2Z0E B;  1ZQA A;  7ICL A;  3BYY B;  4G0N B;  1G6J A;  1U4B A;  4ANW A;  4FFD A;  3ZXV A;  1B0X A;  3B2G A;  2QCZ A;  2JRZ A;  5HHD G;  3OHA A;  2NO5 A;  4JV1 A;  2J4X A;  2WDV B;  1X1M A;  2FE9 A;  2BHN A;  1FM0 D;  3SEN A;  1Q3V A;  5IOI A;  2FUH B;  2WF6 A;  4PYU A;  2V0G A;  2CJO A;  3HKZ F;  4UB2 A;  4PHE A;  3SZ2 A;  1S0O A;  2C2R A;  4Z6D A;  2IO0 B;  4DSF A;  5IP4 D;  2RQ5 A;  4DOB A;  2BBC A;  2KKV A;  1TGZ B;  4LTU A;  2IY1 B;  1T6B X;  2LUM A;  1URJ A;  1ZOY B;  3PTF C;  1SF0 A;  2XCA A;  1KL9 A;  2KKP A;  2EH9 A;  1FMA D;  2MX2 A;  3PRE A;  5KHQ A;  2WAQ F;  4HPM B;  3QU7 A;  5ALP A;  5EE9 A;  4AYB F;  3KTQ A;  8ICT A;  3NS1 A;  2ZUC A;  2ZW1 A;  4DL4 A;  4CE6 A;  4NY0 A;  4K4H A;  2R8G A;  3GOE A;  4QZC A;  4R3D A;  4A9A A;  4F4K A;  4J9N A;  1T4G A;  5DBB A;  4LNN A;  3RI7 C;  3F5A A;  4KKJ A;  2LGY A;  3BY4 B;  2ZNV C;  2ZCB A;  1T8E A;  4G11 A;  1WWU A;  2LYB A;  2KVZ A;  2NR2 A;  4DXA B;  1UGJ A;  2KIC A;  2IPK D;  7ICV A;  1K5O A;  2PI5 A;  5HKH A;  3F2C A;  2NPT A;  4PS8 A;  2DAJ A;  2D07 B;  3N28 A;  4GC7 A;  4UB4 A;  7ICH A;  2SAK A;  3HRD D;  4TUQ A;  1E8Y A;  3DBH I;  4DWI A;  4N59 A;  2YB1 A;  1V9P A;  5AZF A;  3M6Z A;  3PR4 A;  2WDT B;  2ZJ5 A;  3U4E G;  4IL6 U;  4TQR A;  1L7O A;  2MBB B;  2BCR A;  5G5G A;  3N97 B;  2Q4T A;  8ICA A;  1WRD B;  3KWL A;  3OJ3 A;  2Z0D B;  3Q8A A;  3RAX A;  5BMI A;  2PKE A;  2C7M B;  4B9V A;  2F44 A;  2SEB D;  4RZR A;  4F5Q A;  2W3R A;  1MI0 A;  1TJE A;  2Q5W D;  4B6W A;  4M9N A;  1ZD4 A;  2WU5 B;  1WXQ A;  1XS9 D;  1S0M A;  4IM3 A;  3R7Q A;  4K3C A;  2G0A A;  1NK6 A;  2ONQ A;  3RNG C;  1SL1 A;  2W9C A;  4ED1 A;  3NUQ A;  2MJD A;  3RN9 C;  5KT5 A;  1HQR D;  1TKE A;  5KG7 A;  5CP2 A;  5KFQ A;  4FE3 A;  4FN2 A;  2M17 A;  2B21 A;  1V1O A;  3MJW A;  3MJ5 A;  5KFJ A;  2KDI A;  4NPN A;  2BYT A;  3TFR A;  3MGH A;  4J9K A;  1SGG A;  2IY0 B;  2IHN A;  2WU2 B;  4YWG G;  2AGO A;  4DK5 A;  5L1I A;  4I2B A;  3PSE B;  2ASL A;  4G3X B;  3OJS A;  4M2Y A;  2DZM A;  3AUO A;  3K9P B;  3JPS A;  2NVU I;  2K60 A;  3U2S C;  4C4V A;  2KZM A;  4EYH B;  2FNJ B;  3C19 A;  4EEL A;  1J7A A;  2ZIV A;  3PHX B;  5TSS A;  2C7H A;  3PRM B;  5AM0 A;  2XY7 A;  3PR5 B;  8ICY A;  3T5J A;  5HI1 A;  3E0F A;  4HDO A;  4DFM A;  4W9L A;  4F4Y A;  1C7Y A;  5D4B A;  1K1Q A;  3ZTD A;  5CA7 A;  2KJH B;  3L4P A;  5ALS A;  1I4R A;  3GB1 A;  4ED7 A;  4W9C A;  4KN7 A;  2W7O A;  1XLP A;  1E9M A;  1HIW A;  1DRG A;  4EUT A;  3UF8 A;  4C8K A;  3AM9 A;  2RHF A;  3OHB A;  2ZNV B;  3T5L A;  3JVZ X;  3ML8 A;  4PK1 A;  4DSI A;  1XLQ A;  5ALJ A;  4TSS A;  3A9K A;  2A3V A;  3AE1 B;  5HR6 A;  1IGD A;  4GXJ A;  1U48 A;  2J0M A;  1HTQ A;  3V3X A;  4XGA B;  4FAD A;  3P4P B;  4ZHO A;  2YEP B;  4Y2V A;  1F2R I;  3LXF A;  3ZTC A;  2KJ8 A;  4ECS A;  1E6E B;  5ALT A;  5TZV A;  4KMU A;  1ZQO A;  2L0F A;  3BIN A;  1Q46 A;  4KKI A;  5T8I A;  3GS2 A;  4YMN A;  4BZA A;  2JZZ A;  4C8N A;  3PO0 A;  5L1M A;  3AMZ A;  3LVV A;  3P4S B;  1WX9 A;  2DYB A;  5KFE A;  2V3P A;  2R8H A;  1QSS A;  4RGM A;  2F77 X;  5JTI A;  1XD3 B;  2J6T A;  1T94 A;  4GOC A;  3SD7 A;  4YQW A;  4BVU C;  1ZD3 A;  4I2J A;  4M6W A;  4PZN A;  4RUA A;  1VZ8 A;  3IDW A;  4O3S A;  8ICR A;  5HHI A;  2OWO A;  1JRU A;  3QC8 B;  2NRT A;  3AQF A;  4E3C A;  4FHK A;  4MEX A;  2HMX A;  4ELV A;  4RU9 A;  2BWF A;  3TI0 A;  3GII A;  1BML C;  3R3M A;  3R8B A;  3ZUN A;  4O0I A;  2LPE A;  2R8I A;  3N4M B;  1A76 A;  1WX8 A;  3ALB A;  4F72 A;  1D9F A;  3BK1 A;  3AE4 B;  3FIL A;  1UEL A;  3UI3 A;  1L7P A;  4CDG A;  2FPK A;  2D2Q A;  8ICO A;  1WG8 A;  1JI7 A;  4QZB A;  1YN4 A;  4X57 B;  3NAS A;  1LFD A;  3LWL A;  1C79 A;  1QOB A;  3ECI A;  1NI2 A;  4I2E A;  4PJ0 U;  3Q8B A;  9ICV A;  2YMP A;  4EZ9 A;  4EYI B;  3ETR A;  4MDK E;  1WXV A;  4RGT A;  2KIW A;  2N9L A;  1QQ7 A;  4B0M A;  4Q2J A;  2FLL A;  1MA7 A;  4OHJ A;  1K1S A;  3K4G A;  1S10 A;  4WAA A;  1XEE A;  5EWF A;  2DYM A;  3HJE A;  1NI3 A;  4GLS C;  3TKA A;  4J9P A;  1M6Y A;  2K4E A;  3IV6 A;  3HP6 A;  2JMG A;  1E5W A;  1DK3 A;  2G1E A;  4MGY E;  2ZJA A;  2C60 A;  2YN4 A;  3G6X A;  2Y9T A;  1N62 A;  1NJX A;  4OD0 A;  4RQ5 A;  4E0D A;  1J19 A;  4M0A A;  4UDU C;  4F1S A;  5AM4 A;  3N1X C;  3QK0 A;  3AU5 A;  3GIK A;  3BVG A;  4M0W A;  4ED6 A;  5J2G A;  3V7J A;  5AM1 A;  3ETL A;  4NXZ A;  2VKQ A;  1ZET A;  3QUQ A;  3IG8 A;  9ICI A;  4J9Q A;  3WIM A;  2O2V A;  4PYZ A;  5J2H A;  4XWW A;  2NS5 A;  1GUA B;  1B22 A;  2NPT B;  4LNK A;  5ALY A;  2J6U A;  2FE8 A;  2JXX A;  2LHE A;  1QQR A;  3CF6 E;  4I2C A;  2E1F A;  4Y2R A;  2KO3 A;  1X2I A;  4Y2Y A;  2XY5 A;  2D3C A;  2LMC A;  3K1R B;  3UGB B;  2KP7 A;  3PLV A;  3NZ3 A;  4ICV A;  2FID A;  4QWA A;  3LDA A;  1ZQZ A;  2DBY A;  3ED5 A;  2LJI A;  3MC1 A;  4ASW C;  2M0X A;  3NZU A;  2BGF A;  5ALN A;  4GDL B;  4ANU A;  9ICM A;  2NRW A;  3DWG C;  3OSN A;  7ICN A;  1L0X B;  2W11 A;  1YNT E;  4HKQ A;  2JH1 A;  5AKE A;  1N6Z A;  4RH6 A;  2HHU A;  3RNB C;  1GB1 A;  2Z7J A;  4TQS A;  4Q8F A;  3JPN A;  2JEJ A;  3KOO A;  4DOA A;  1UNS A;  4ANX A;  2UWQ A;  2W9C B;  2RMM A;  3D2N A;  4DEZ A;  2RDJ A;  3O13 A;  2EAO A;  2BB6 A;  4BKT A;  4DHJ D;  2WFA A;  3D32 A;  1V85 A;  1KRH A;  1V6E A;  3TIX A;  4ARI A;  4OJL A;  2DZK A;  1NJW A;  5DG7 A;  2E3T A;  2OJW A;  3RD2 A;  1FIQ A;  1YZ6 A;  3IT6 B;  1Y88 A;  1EF5 A;  3VRA B;  3MAB A;  3A1Q B;  4BBN C;  3WAL A;  2YVC A;  1YD8 U;  3A9J B;  3UXO A;  4O5C A;  5I4D A;  2E8N A;  5EWE A;  2DNF A;  4C4V B;  2Z8L A;  1BPZ A;  3TEX A;  4LJO B;  2ZIV B;  9ICO A;  3PZ7 A;  1NYR A;  8ICX A;  3KHH A;  4OVZ A;  5KFH A;  1UF0 A;  4OVU A;  5BOL A;  4DDG D;  1WJ6 A;  3TAN A;  1QOG A;  4M8M A;  4GB9 A;  4G50 A;  1FD6 A;  4ECV A;  2BR0 A;  2O6V A;  1WJN A;  2FJ6 A;  1STE A;  4HJK A;  1PGB A;  3WK7 A;  2GH1 A;  4UB8 U;  1VR9 A;  3TAR A;  3M63 B;  1JN3 A;  3QUC A;  4CF3 A;  3Q8L A;  1YJJ A;  1DXS A;  4YXD B;  4RPZ A;  3VH4 B;  2VA8 A;  1D8L A;  1NK5 A;  3AE7 B;  3PSF A;  4WWP A;  2WXO A;  1QZE A;  1KLV A;  5DG8 A;  3SYZ A;  3A9K B;  2A1A A;  2BKE A;  7ICP A;  2RDH A;  3H8H A;  3IBE A;  2G09 A;  4R66 A;  3MP9 A;  4MJS A;  3RJJ A;  1TKD A;  1J7C A;  3RPF C;  5J29 A;  2IND C;  2V3S A;  1IV8 A;  3KKA A;  5CJ7 A;  1S77 D;  5D6J B;  1PUZ A;  2QLT A;  3DQV A;  1UA0 A;  3NGD A;  1NZP A;  2XEW A;  4E74 A;  3C29 A;  1WR1 A;  5DGA A;  2QIL A;  3FKY A;  3W9C B;  2BPC A;  2MEK A;  3DBR I;  1N61 A;  5CEH A;  1ZKH A;  4GC6 A;  5CHF A;  4IC7 B;  1IXR A;  1HEK A;  4F71 A;  1QLN A;  4CQN A;  3WCQ A;  2YLM A;  4XYC A;  5AKK A;  4HCN B;  5KT3 A;  4A6Q A;  3E58 A;  4HAI A;  2FMS A;  1ZOL A;  4M04 A;  1CMX B;  1I4P A;  4YG2 A;  1PK1 A;  5KTQ A;  3GV7 B;  2DFL A;  5ALI A;  3P1M A;  1MPE A;  4M01 A;  3H9D A;  2BTE A;  3TUO A;  2ZCC A;  1Z4O A;  4M6W B;  9ICQ A;  2LRU A;  4R64 A;  4LJP B;  3N1Z C;  3H4D A;  2BYV E;  3MC0 B;  3V7K A;  1R4N B;  2MLB A;  4HVB A;  3N7S C;  4YXM A;  1MVK A;  3C8Y A;  2AJQ A;  1KKX A;  4WJQ A;  3ZD9 A;  3VTW A;  1MHH E;  5KFS A;  5AI8 A;  4YT0 B;  3RMK C;  4BXO A;  3RUL A;  1BNP A;  3RJE A;  3UXP A;  2EDU A;  9ICT A;  3WAM A;  3ZXR A;  3DCG A;  1JWM D;  3FIL B;  3SI8 A;  1BPD A;  2IGH A;  3WU2 U;  3OAW A;  2KDF B;  3JPR A;  2GBR A;  4A8X C;  2LZ6 A;  3UIP B;  3PMN A;  2XCP A;  3PW5 A;  4UQG A;  5JZE B;  2FMQ A;  1P98 A;  4NAW A;  3FDS A;  2KX0 A;  2KWD A;  3NOB A;  3OG5 A;  2IBI B;  2ZZP B;  1B4F A;  4EBC A;  4C8L A;  2BWE S;  5KG1 A;  1C4P A;  3N30 A;  3V61 A;  9ICS A;  2IA6 A;  8ICV A;  4WAF A;  2BQ3 A;  3GU3 A;  5IA7 A;  1ACC A;  2HBM A;  1NK7 A;  4S0R A;  4KGT A;  1VDV A;  4QWB A;  1N63 A;  4RQ6 A;  1T0R C;  3H8W A;  2QEJ C;  1OUQ A;  2FCQ A;  3I3T B;  1SKS A;  3LK9 A;  2MJE A;  5DLF A;  1EWC A;  3O0F A;  4IQW A;  3SAG A;  1SBB B;  1F1H A;  1K51 A;  3KHL A;  5MPO A;  9ICK A;  4KGR A;  3P4R B;  3CYM A;  4LVS A;  2L3Z A;  5D94 A;  2WB1 F;  4DXF A;  4M0W B;  4IKG A;  3PVL A;  1HJP A;  3B9J A;  3OJU A;  3AV8 A;  5DBA A;  3HX0 A;  5IN7 A;  5L1K A;  3C21 A;  2O2V B;  2GBJ A;  5KFU A;  2OHF A;  3T3O A;  2EMS A;  2CS4 A;  4QWE A;  4YTM B;  1PZN A;  2NO4 A;  5JU5 A;  2DPJ A;  1EXN A;  1X9W A;  1SSN A;  1CJE A;  4ECT A;  2WXL A;  4A55 A;  4NZL B;  3PHW B;  1R7S A;  5DB7 A;  9ICA A;  4EFO A;  5FKA C;  3KKA C;  2WF7 A;  5D3I B;  5E6J A;  4DQQ A;  1E10 A;  3RRH A;  1E8W A;  2ON8 A;  3I1Y A;  4GSW A;  4RFB A;  2G5H B;  4J9L A;  2G06 A;  3WK4 A;  4AP9 A;  3H0R B;  3PSP A;  3QXG A;  1AAR A;  3PML A;  1R4M I;  2BS2 B;  5EE1 A;  3IFW B;  3AQE A;  4KSL C;  2PFN A;  2MRP A;  2KE7 A;  1BPY A;  2MH7 A;  2AQ2 B;  3NVV A;  2BYF A;  3TQ1 A;  2M19 A;  1FO4 A;  4YL8 A;  3WK5 A;  7ICQ A;  4TUR A;  1VJ5 A;  4O3M A;  1JIH A;  2Y9U A;  3PRP B;  4JK1 A;  4KLJ A;  2F3N A;  4QZE A;  4JWN A;  2LYA A;  4A8E A;  3RNE C;  4F92 B;  3ZIM A;  5DPR A;  5D46 A;  5KG5 A;  2W8L A;  2J6S A;  3DWM A;  5HG2 A;  2JEI A;  5AIB A;  1RYJ A;  4XDD A;  2K89 A;  1RDF A;  1HUZ A;  9ICC A;  2JYE A;  4I2F A;  2N7J A;  4FXC A;  2LKY A;  1E8Z A;  2KT7 A;  4ZRI A;  5KG3 A;  4MFF A;  1PYW D;  2EAP A;  2LBO A;  3PRZ A;  1BPX A;  2I5H A;  4UAW A;  2UU7 A;  3L17 A;  4IM2 A;  4UAV A;  1TZ1 A;  3M95 A;  3D6J A;  1TY0 A;  5C2T B;  1XU4 A;  2FLN A;  2YX8 A;  1WF9 A;  1V9J A;  2BCS A;  2K6D B;  3A0B U;  2J42 A;  1IBX A;  5J0T A;  2FUG 1;  2KQ7 A;  2CU3 A;  2C22 A;  1E90 A;  5AIA A;  1ZQT A;  5J2J A;  2CRX A;  4L2Y A;  3Q8M A;  1ZGU B;  4FJV B;  4YD1 A;  4MT5 A;  4OVV A;  2RLT A;  3C2K A;  2MSE D;  3B08 A;  3RFZ B;  3A33 B;  4YVZ A;  4IOI E;  1YIW A;  2W8K A;  2O6V B;  1ZQD A;  1MG8 A;  1LVH A;  4EX7 A;  2JT4 B;  4NLG A;  2IOH A;  5CHV C;  3KVF B;  5AKG A;  1XO3 A;  2BB5 A;  1N5W A;  1JWS D;  3DHI C;  4Y2J A;  1PUT A;  1D5X C;  2V4I B;  2WXM A;  2Y1I A;  3MDC A;  5BPC A;  3Q8P B;  1OTR B;  1V8C A;  2QJL A;  2E5S A;  4ITK A;  4ZRK A;  1A5R A;  4CO7 A;  3DBS A;  2XY6 A;  4RM8 A;  1I4G A;  3ZO5 B;  1KFD A;  4XQ8 A;  2PE6 B;  8ICZ A;  4LNO A;  4HK2 A;  4MJS B;  1L3U A;  4OJ5 A;  3Q3F A;  3MR6 A;  1KFY B;  1S97 A;  1XCQ L;  3C2M A;  2KN5 A;  8ICG A;  2Y5B B;  2KMD A;  4ECX A;  4IRD A;  1L6N A;  2KYW A;  3KZX A;  2WXK A;  4FHJ A;  3BZK A;  3UXN A;  2AL6 A;  2RR9 A;  2DWQ A;  5AKZ A;  5FR6 A;  3QU2 A;  7ICE A;  4LNI A;  2I2Y A;  2CN1 A;  1KF6 B;  4KLS A;  3GE3 C;  1ED1 A;  5J2F A;  3RRG A;  3AED B;  2HOQ A;  4KLQ A;  1K50 A;  1PK1 B;  1Q5W B;  4DO9 A;  2YMM A;  4MGK E;  5J2E A;  5FR3 A;  5J0Q A;  5AI9 A;  3C2L A;  1WWT A;  2P6R A;  3RUI B;  1D4B A;  2HOI A;  3JSV A;  2NMQ A;  4F8C B;  4MH0 E;  1ZQF A;  3EPG A;  4Q43 A;  1V5O A;  3RH6 A;  8ICW A;  1FEH A;  5ALD A;  4ECW A;  1RXV A;  4PHD A;  1NJY A;  4CGZ A;  1DYQ A;  1FNV A;  2DLB A;  3JYU A;  2Y1J A;  1WM2 A;  1ZQH A;  3SFE B;  2BPF A;  4KLI A;  2BF8 B;  3W5V B;  3U7D A;  2JYT A;  4BXO B;  2JX5 A;  5KT7 A;  1I4Q A;  5D3D A;  2QB1 A;  1B43 A;  3DV9 A;  2REX A;  8ICK A;  3OGU A;  3RB6 A;  1EM7 A;  1ZQJ A;  1ZQ1 C;  1LO5 D;  3AE9 B;  3MR2 A;  1Q8K A;  4KX6 B;  2AGP A;  4DLE A;  5TIS U;  1JWB D;  3H0M B;  5B66 U;  4HKZ E;  1T5X D;  2YMQ A;  2JEG A;  1K8R B;  2JZP A;  2I6X A;  3F53 A;  4UAY A;  4NAW B;  2NBW B;  3V60 A;  4CYE A;  5ALK A;  3C28 A;  1T0S C;  1A0P A;  2JWZ A;  1WJ4 A;  3R9K A;  3ZDA A;  4QIW C;  1UZX B;  2IGD A;  1LQB A;  3KFU F;  2JRH A;  3ZJV A;  2D8C A;  4KLE A;  2AQ1 B;  2LGD A;  2V9H A;  4MF2 A;  2H3Q A;  2QC8 A;  2F1H A;  5JHB A;  2AHO B;  3WKE A;  5KFF A;  4FUL A;  1WR6 E;  1IM4 A;  3TEY A;  3PVX A;  1ZJN A;  3JPO A;  5L9X A;  3TL5 A;  2Y0S F;  2V4L A;  2W03 A;  2ZIX A;  5IIN A;  4UB1 A;  3LVW A;  1WYW B;  4C0Z A;  4XDC A;  2DQN B;  4RQ2 A;  3V6K A;  3WA0 A;  5HR7 A;  4K4I A;  3RAQ A;  1TTN A;  2K0P A;  1AW7 A;  5III A;  3NG0 A;  4NQL B;  4XC2 A;  5J2R A;  2JY6 A;  3KHR A;  1RYR A;  3MFG A;  4UAU A;  2GB1 A;  4HLE A;  2RPQ A;  3LJ3 A;  5J2C A;  1S0V A;  2KEY A;  2K39 A;  3J9C A;  2K3U A;  3V6E B;  1TAU A;  3N7P D;  2KDM A;  3UQB A;  5KAF U;  5IIK A;  4P2H A;  2IOF K;  1QSY A;  3H4B A;  3ML9 A;  3TMP B;  1L8O A;  2Q0Z X;  5HMM A;  2B3A A;  1WE6 A;  4ZOH C;  3A4S C;  1Z19 A;  3SV3 A;  4ZRP A;  9ICE A;  2QB0 A;  3BDP A;  1SV4 A;  5F3X B;  5EE0 A;  3ZYY X;  4JL9 A;  1S9F A;  3KWV A;  4C00 A;  2HVI A;  4HPL B;  1CEZ A;  1LV5 A;  1B1Z A;  2XC9 A;  2MA1 A;  1ZQR A;  2RGF A;  1NVI D;  4OW0 A;  2C28 A;  2N9X A;  4F4W A;  3LWM A;  4F50 A;  2KZ3 A;  4DDI D;  2KOB A;  2AYO B;  2EAM A;  3L0W B;  3BQT A;  2WHI A;  2GLE A;  3RJK A;  2INC C;  5DQG A;  5C5J A;  5J2D A;  3VHT C;  1PFD A;  3PO5 A;  3DBR B;  4LDT D;  4DS5 A;  3VC8 A;  7ICJ A;  4P0Q B;  3QCA A;  2J0K A;  4JE3 B;  5ALR A;  3GV8 B;  3SAH A;  1OGW A;  4MFC A;  2NTS A;  2F2A B;  4QZ8 A;  2HHW A;  2FBW B;  2NCN A;  1X6J A;  4O3P A;  1Q0W B;  4GDK A;  1ZQK A;  4ELT A;  3ONN A;  2LD9 A;  3QEB Z;  2LWP A;  5DPW A;  3IG3 A;  5LLI A;  5JHA A;  1GOZ A;  1P9D U;  2JWU A;  2WLB A;  2ZUB A;  2W9A A;  1TS4 A;  2W43 A;  4BWM A;  2WWZ A;  1IBX B;  3FM9 A;  3PZD A;  2KSO A;  4KZ0 A;  5J0S A;  3HVZ A;  4UB3 A;  2M0N A;  1D9D A;  2H3V A;  4TV3 A;  3ZDC A;  1Z2M A;  2K4I A;  2N9P C;  3RZW C;  2BGW A;  3Q8K A;  1GPX A;  1RPL A;  4DL3 A;  5L1J A;  1ZQQ A;  5C1Z A;  3AUL A;  2ODG A;  1WXA A;  4MFA A;  4FBT A;  2TSS A;  1NK8 A;  5AI6 A;  2FPM A;  4EBD A;  1T3Q A;  5L1L A;  3M7D A;  4DCC A;  3BS5 B;  5IIL A;  1SZH A;  2PLP A;  2OM6 A;  2H89 B;  2KC1 A;  3JW0 X;  2A19 A;  2KMA A;  4C7Y A;  3QYP A;  4TUS A;  2GRI A;  3L16 A;  1QSL A;  2HBK A;  3APC A;  3M8R A;  2OED A;  3HM3 A;  3QAQ A;  2D3G A;  1COK A;  1ISN A;  1F9J A;  3IG5 A;  2ZEQ A;  1UWM A;  5DGB A;  4JWS C;  2H3F A;  5CR0 A;  1NYQ A;  2VRR B;  2BKR B;  1FCL A;  3O65 B;  1MSW D;  4DQO C;  1C9F A;  1XNS A;  2DKX A;  2EZX A;  5GTH U;  1WY8 A;  5EDS A;  1ZQC A;  1E8X A;  3TEZ A;  5AK5 A;  4QZF A;  2J7Q B;  1FXT B;  2OYY A;  4ARC A;  1ZDV A;  2M0A A;  4US9 A;  1BGX T;  3KBB A;  2HBL A;  5EWG A;  2N9K A;  1ZXI A;  1YOV B;  4K7W A;  3R66 C;  3GV5 B;  3GIM A;  4C8O A;  2VAN A;  4QWD A;  5C0Y A;  1SZP A;  4KLF A;  4U7C A;  1L4Z B;  2L5Y A;  1KLU D;  2GOL A;  3QU4 A;  1ZQM A;  2M8S A;  3AE2 B;  1IYF A;  1WE7 A;  2LXA A;  2KJ5 A;  1HUO A;  1C1Y B;  4JWM A;  4DF8 A;  4I6N B;  3JSV B;  4RM9 A;  3SR6 A;  5HFY A;  3VUW A;  1WGK A;  2PMZ C;  1SV0 A;  2KTQ A;  1RQN A;  4I28 A;  1SEB D;  4C4T A;  1EO6 A;  3Q3J A;  3NS8 A;  4BDP A;  2A5U A;  1Z5S B;  1WH3 A;  4C7Z A;  4EX6 A;  3Q3O C;  1R4M B;  3H40 A;  2KX3 A;  1L3T A;  2PPH A;  3BWU D;  2KD0 A;  1CQV A;  2IO2 B;  2L76 A;  3GZN I;  5IO9 A;  3KHG A;  4WJ3 B;  4MF8 A;  4RQ3 A;  2PEA A;  2BDU A;  1KSP A;  2G08 A;  2EKI A;  3BZD B;  1WSP A;  1QKZ A;  5L83 A;  2LHD A;  3SAF A;  3DVN V;  2BZF A;  4GXI A;  3SQI A;  2KVR A;  2LFI A;  1YJ1 A;  4I6L B;  2MUT B;  9ICW A;  1KDH A;  4BAX A;  3MR3 A;  2IYD B;  1X9S A;  8ICF A;  2B0C A;  3BVZ A;  3DOW A;  3IRU A;  5D7G A;  1EU4 A;  2I1K A;  2HCF A;  1QT9 A;  2KHV A;  4IS7 A;  5C3J B;  3LDZ E;  3QE9 Y;  4CF4 A;  3KQ4 A;  4RCO A;  2INN E;  3H8J A;  4N58 A;  3M9N B;  4JB3 A;  2KAN A;  5KFA A;  1WXM A;  3WK9 A;  1QQ5 A;  3VAW A;  3PW7 A;  3EUB 2;  5K4L A;  5KG2 A;  3QZ7 A;  4O3N A;  2K1F A;  3Q3N C;  2I1Q A;  1S3S G;  4AS1 A;  1NEK B;  4HRO A;  2AGQ A;  4OO1 J;  4P4P A;  2N0S B;  4EOY A;  2BVC A;  2E8P A;  3AU2 A;  2KTF A;  2DF4 B;  4P1C C;  1IP9 A;  2E8O A;  1I42 A;  3C0R B;  1A77 A;  1TKY A;  2D11 A;  5KG0 A;  4QZ9 A;  3P2B A;  1F77 A;  1E7V A;  2QB0 B;  5AM2 A;  5ALQ A;  4KLD A;  1L3S A;  2KTR A;  4ICA A;  4ZYS A;  4RNM A;  1K53 A;  3IHQ B;  1T0Q C;  3RNC C;  2EZZ A;  4NJ8 A;  2BT6 A;  1XCT L;  1I35 A;  1TV9 A;  2WXH A;  2VZK D;  4K81 A;  4EBE A;  2FMP A;  1NKE A;  5DKW A;  5KFR A;  2XK5 A;  1K52 A;  2ICI A;  2WXG A;  1MG4 A;  3V05 A;  5H2F U;  5IIJ A;  4TQ1 A;  1KFT A;  2H88 B;  5CX3 A;  4EEK A;  3EEC A;  4WJN A;  3RZF A;  3QUB A;  1YQ4 B;  3QA8 A;  3UQA A;  1SV0 C;  3TAD A;  1TK0 A;  1NK0 A;  5DQH A;  2ZXH A;  5KFX A;  1RYU A;  4PZO A;  2MWS B;  3DVG Y;  2D3D A;  1C4A A;  1HE8 A;  5KL1 B;  4DBG A;  4M9H A;  4J9M A;  8ICS A;  3Q8E A;  4GDK B;  1XWL A;  2J53 A;  3TJP A;  5GXG B;  4GLX A;  4MH8 A;  1WGH A;  3U8Z A;  2BQQ A;  3QU5 A;  5ALO A;  4O5E A;  5GMV A;  2PFQ A;  3MC9 A;  3VH3 B;  4BKS D;  2BS3 B;  1WZ0 A;  5KFP A;  4ACO A;  1LXD A;  3EW9 A;  3QX1 A;  2N7D A;  2I1J A;  3BJY A;  4DXG A;  3ZW3 A;  1FXI A;  3Q2A C;  3KUC B;  3EPI A;  3QQ8 B;  3OSP A;  1SJE D;  3I9V 1;  5KFY A;  2DUY A;  3U30 A;  3ISD A;  1WGY A;  1SL2 A;  2G5I B;  2WGS A;  3VR9 B;  3PV8 A;  2EKE C;  5AZG A;  3L5K A;  3N9Y C;  2NYV A;  4RGO S;  2MRL A;  1WCN A;  1UD7 A;  5J0Y A;  2C7N B;  4TMA B;  2HVH A;  2LVO A;  3DPD A;  3M3J A;  2CPR A;  3WKC A;  4Z6F A;  2HHS A;  9ICR A;  5AI0 A;  4RGN A;  3BK2 A;  9ICU A;  1NEN B;  1ZP0 B;  5JH5 C;  2FI1 A;  2Z59 B;  3MC8 A;  2JF5 A;  4R65 A;  4B0E A;  3TEW A;  3ZJT A;  2IZV B;  2KNB A;  3CNH A;  3BS7 A;  4IDI A;  3PW0 A;  1V1P A;  3PSI A;  1ZQI A;  1JWA D;  4YN4 A;  2FLP A;  4E71 A;  2ZTD A;  4ED8 A;  1ZD5 A;  3T3N A;  2WTF A;  1E7U A;  3R2I A;  4P4M A;  4DSE A;  2JU6 X;  4C4R A;  3PST A;  5E6O A;  5C23 A;  2KKC A;  1YN3 A;  3R7R A;  1E0Z A;  4W9G A;  4DQI A;  4II2 B;  3V7L A;  1UUP A;  5BYR A;  2LEK A;  1V49 A;  4KTQ A;  4RF1 A;  3PY8 A;  4I2H A;  3WKA A;  1LM8 B;  3ZDE A;  1OQY A;  1OQQ A;  2RD0 A;  2XNA C;  4KLG A;  5KFI A;  2YQE A;  2JGA A;  4IWQ A;  1D8Y A;  4QZD A;  5DPT A;  2YML A;  1TS2 A;  2WDR B;  1YQ3 B;  4US8 A;  3ZVV A;  2JSV X;  5IIM A;  3IP4 B;  4ED2 A;  2KZR A;  1QH9 A;  5KFL A;  5DCN A;  2JUO A;  3Q14 C;  5KFB A;  5CHW A;  2HOF A;  2DPI A;  1GAQ B;  3AL0 B;  4QAY A;  8ICI A;  5BMH A;  2BS4 B;  4B6J A;  1Z1V A;  1U47 A;  1L5U A;  4KIK A;  2KAJ A;  2KZZ A;  2BKF A;  4Q45 A;  4YR2 A;  3QJZ A;  3TAD C;  2KHW B;  1L0V B;  4B9L A;  1PVP A;  5CB1 A;  1NBF C;  3HKZ C;  2WDQ B;  4CCH A;  3IHP C;  4BWJ A;  4DWF A;  1C78 A;  3A4R A;  3MDA A;  1U49 A;  1A6S A;  2DZI A;  1ZYQ A;  3UQ2 A;  2KFK A;  4MEM A;  4P4O A;  1NJZ A;  1WZ3 A;  2F76 X;  1P0R A;  1FPY A;  4W9H A;  2XGQ A;  4C80 A;  1FRD A;  2YEP F;  1ZQU A;  1IUE A;  1YZ7 A;  3CW2 C;  1C76 A;  1XSN A;  1COO A;  2ZXI A;  5AKJ A;  4UAR A;  2K8B A;  1F2R C;  3BQ0 A;  1NK9 A;  2MU2 A;  3DBH B;  4NLZ A;  1TE2 A;  4P0P A;  2WXQ A;  2MP2 A;  4DHJ B;  4LLG M;  4GGQ A;  5DDM A;  4NJ7 A;  2KWU B;  4RT3 A;  2F8K A;  2KXJ A;  1N48 A;  3AI5 A;  2PW9 A;  2CJN A;  2W9M A;  4NY8 A;  3LYY A;  1SXD A;  1ZJM A;  7ICM A;  3UMC A;  1RYS A;  4K7S A;  1NKB A;  1F5S A;  1KEJ A;  4ZDV A;  4N6E B;  3QEA Z;  2L00 B;  1FNU A;  1M4V A;  4FZM A;  1JAL A;  4QZI A;  3KYC D;  2FDR A;  1KLG D;  3I76 A;  2LHT A;  1Z3E B;  4RQ8 A;  4O5K A;  1QLB B;  2R2Q A;  2ZPN A;  4II3 B;  4RQ1 A;  1ZE3 D;  5J2K A;  3HUI A;  4I2G A;  3KW5 B;  2KTR B;  3IAM 1;  3IT4 B;  1KFS A;  2CHZ A;  2RDG A;  5BO4 B;  1VLB A;  5GTI U;  4A3P A;  4DLG A;  4J03 A;  3AE5 B;  5LNK 1;  3ZRF A;  3RR8 A;  1N60 A;  3FC4 A;  3IAS 1;  3W1S A;  4DQR A;  1ZW7 A;  3NVW A;  1SE2 A;  4TUP A;  3EGR A;  2XK5 B;  2ZIU A;  2L83 A;  4F2S A;  1SWV A;  4UBB A;  4CRX A;  2LYH A;  1VZ6 A;  3Q8F A;  1L8L A;  5BMG A;  4A20 A;  4GIB A;  2F1J A;  4IRC A;  1O08 A;  4XUS A;  4F5N A;  5J2A A;  2W7P A;  4M47 A;  4YTN B;  4RNO A;  4BFR A;  5T14 A;  4Y2T A;  2HJ1 A;  4IUM B;  1V80 A;  3RH5 A;  2K8C A;  2UVW A;  2C2D A;  2G3Q B;  1GB4 A;  3AE6 B;  2GWS A;  4FS1 A;  4YR0 A;  1X9M A;  5G55 A;  1PQS A;  2HTH A;  1EF1 A;  2QDF A;  4FBU A;  2IMW P;  4KN4 A;  4F4X A;  2NRX A;  1DOY A;  1GG3 A;  3AEE B;  2JV3 A;  3K9O B;  2L1A A;  4RQ0 A;  1P7D A;  1TT5 B;  2GLS A;  2PKO A;  3SHQ A;  3NTU A;  3IM1 A;  4USA A;  1PGA A;  4OJP A;  2X38 A;  2BPG A;  1WGR A;  4F8R A;  4WJP A;  2KDB A;  3I5J C;  5JRT A;  2QHO A;  1CUK A;  3UM9 A;  7ICS A;  4IR1 A;  3ZDB A;  1OQR A;  2RDB C;  3ENE A;  3ISC A;  4YMM A;  3WAO A;  1V81 A;  3VVW B;  2KOX A;  3D2S A;  1KLN A;  3H1U A;  2HD5 B;  1SIJ A;  3GZN B;  1GC6 A;  1JWU D;  3DDC B;  1WCL A;  3HVD A;  3P63 A;  1U9L A;  3H7S A;  3CP8 A;  1T3N A;  1TAQ A;  4BOZ B;  5L95 C;  3JPQ A;  1ZRM A;  2NTT A;  3BYT B;  4WWM A;  3S2A A;  4KX5 A;  1HZ5 A;  1I4H A;  2JXT A;  3PT2 B;  1WXS A;  4DL2 A;  1UGM A;  3T79 A;  2M4N A;  4W9J A;  2LVP A;  3L13 A;  4I2A A;  2K6Q A;  3CIR B;  3MGI A;  5AKX A;  4NJ6 A;  1QF6 A;  3PPA A;  4XZ4 A;  2KQS A;  2KN7 A;  4B9S A;  4M02 A;  1V1P B;  2HHX A;  2OXO A;  4Y2X A;  1KN5 A;  3M1Y A;  1OFF A;  4PH5 A;  1KM7 A;  5DB6 A;  2LI5 A;  2R18 A;  3W1Y A;  4IRK A;  7ICG A;  4ED0 A;  3EFU A;  1ZPS A;  4GXB A;  1ROE A;  2GO7 A;  5DDY A;  2K25 A;  1NKC A;  2FCS A;  5HHH A;  2RDI A;  2K22 A;  2KLG A;  2MAX A;  1JUD A;  2MBH A;  5J8Y A;  2KFN A;  4YR3 A;  1SGH A;  3ICX A;  4Z6E A;  2BPS A;  2NBV B;  2K4P A;  1WUD A;  2N4F A;  2JHD A;  4JMU A;  5HML A;  2PE9 A;  5E6N A;  2LAS A;  1ZQP A;  5E6P A;  4NNJ B;  5KG4 A;  1SJH D;  2BW2 A;  2WF9 A;  3QU9 A;  4EZK A;  1L6U A;  2FIF A;  4KIK B;  1IPG A;  1HEZ E;  4B95 A;  4F3O A;  1H38 A;  4KX3 A;  5CTR C;  2DAF A;  5ALG A;  4O3Q A;  5KG6 A;  2GBK A;  3EC8 A;  4NV0 A;  3I63 C;  3CRX A;  2EQY A;  4L23 A;  4YSY B;  4YSZ B;  1ZQL A;  4P16 A;  4AJY B;  2A1J A;  1L4D B;  2KFK B;  4DFP A;  3I57 A;  2D6F C;  1VD2 A;  1WFY A;  3QNM A;  4DFJ A;  8ICE A;  3DHG C;  2GBM A;  1XLO A;  2VA2 A;  3GDX A;  1C4C A;  2IDY A;  3CST A;  2WXR A;  1L2N A;  3AEV A;  3RFA A;  5BOM A;  1V5T A;  1BPE A;  1J2N A;  3CWI A;  1B9R A;  4J9S A;  1JML A;  3M9M B;  2MP2 B;  4ANV A;  3H0L B;  1EUV B;  4DOC A;  4Y2S A;  4LZG A;  2KK8 A;  2B76 B;  1TS5 A;  2A4Z A;  3L10 B;  1D5M C;  2ACZ B;  2M9N A;  3EA6 A;  2AWT A;  4QWC A;  3JPP A;  3T5K A;  4KDL B;  4KSK C;  1ENF A;  4C4S A;  1WWV A;  4R8U A;  4YXJ A;  1GNU A;  3ZRC A;  2FAZ A;  2HE7 A;  5AIC A;  1GJZ A;  4Q8E A;  7ICU A;  1OEY A;  5J0X A;  2WF8 A;  5AM3 A;  1JX4 A;  1A70 A;  2WXJ A;  4KDI C;  2KQ4 X;  2M1M A;  2ASJ A;  4BBN F;  4HXD A;  2JPH A;  2HTM E;  4IQU A;  3CSF A;  3MGV A;  1S0N A;  3KH0 A;  3N32 A;  2YY6 A;  1XLN A;  2W9N A;  3QWZ B;  3E2E A;  4NJC A;  2J0J A;  1UH6 A;  1SE9 A;  4DFK A;  1TAM A;  3FAH A;  2OJR A;  4K3B A;  3U7Z A;  4F7Z A;  3RF9 A;  4YP3 A;  4I2D A;  3LYS A;  4L1B A;  4F91 B;  2WXI A;  2ZIU B;  2W9B A;  1ZQG A;  2I9G A;  8ICH A;  1XXG A;  1Y8R C;  3N20 C;  4A90 A;  5AKH A;  4I6P A;  1ARO P;  1MHX A;  5J8Y C;  2CHX A;  3VDZ A;  8ICB A;  5AM5 A;  1NZB A;  2K8C B;  2KWV B;  2N9E B;  1FFU A;  2CR5 A;  4MM3 A;  1LB2 B;  4H2A A;  4MAC A;  2QAR A;  1C77 A;  3QHT A;  5DB9 A;  3UPQ A;  5ALH A;  2G4S A;  5ALL A;  3RJH A;  3AEG B;  2KD1 A;  2ZG6 A;  2HW3 A;  4PGY A;  3RT3 B;  2AX5 A;  2BCU A;  4J9R A;  2PFO A;  3VR8 B;  4RNN A;  5KFK A;  3TAQ A;  3MFI A;  1XSP A;  2ES6 A;  4PL2 A;  3P4Q B;  3KZI U;  5AI4 A;  3AE3 B;  5J0O A;  2WHE A;  3EFC A;  3T9L A;  1MQ3 A;  4PGQ A;  1RWS A;  4Z6C A;  4KIT B;  2OEH A;  4F2R A;  4REZ A;  4FZL A;  1KJT A;  1SL0 A;  1D5Z C;  3Q3M C;  5KT2 A;  8ICP A;  4DQS A;  1SWW A;  3ZDT A;  2RRD A;  4RPX A;  2W54 A;  3GE8 C;  1ZQB A;  2QSD A;  3AEA B;  4DHZ E;  2HHQ A;  5F9L A;  3OJ4 B;  1DOX A;  4RUC A;  4KV2 A;  3RH4 A;  1QTM A;  3Q6B A;  3PZ8 A;  1SKR A;  5KT6 A;  4YCX A;  3SFD B;  2VA3 A;  4GXK A;  2Y3A A;  5KFT A;  7ICK A;  3DDH A;  1F0M A;  4WIP A;  2JH7 A;  4NLK A;  1QOA A;  1VJK A;  3ZJU A;  3RJG A;  3TAP A;  3N7R C;  8ICC A;  1PGX A;  2MBO A;  3M8S A;  2AH5 A;  2WX1 A;  3KUD B;  1NK4 A;  4DF4 A;  3VRB B;  2O6K A;  2KMC A;  3VFK A;  4B9T A;  1RAX A;  1R4N I;  2EZY A;  3NHE B;  2KVC A;  1OW5 A;  3V72 A;  2ASD A;  3TCA A;  3T8M A;  4UW9 A;  2NRV A;  3ZDD A;  2X8X X;  2YTU A;  4GDL A;  1UT5 A;  5B5E U;  5DPS A;  2MCN B;  1JQ4 A;  2IHM A;  4DL7 A;  4QJF B;  5G5H A;  3Q69 A;  4JWU C;  4MSM B;  2BCQ A;  4QZA A;  3UIN B;  1HA5 A;  1UT8 A;  1AN8 A;  2MQJ A;  1WRI A;  3ZQ4 A;  1ZQN A;  4QW9 A;  3W5U B;  1NDD A;  4XX5 A;  4M9J A;  2JR5 A;  3SU8 X;  1VCB A;  4AOF A;  1CZP A;  4ZRQ A;  2WXF A;  2KFZ A;  2KAC A;  3ORY A;  4YTP B;  4MGI E;  2P66 A;  3L08 A;  3MHS D;  1JXE A;  3RJF A;  1YX5 B;  1S76 D;  2L7R A;  2DHZ A;  2MJ3 A;  2ASQ A;  5KNI A;  9ICN A;  1YN5 A;  3NZS A;  1WMH A;  5KFN A;  4QZG A;  2WXN A;  1C20 A;  2WF5 A;  4IR9 A;  1VZ7 A;  1U45 A;  3T3F A;  1X42 A;  2A1J B;  1FEZ A;  4JV0 A;  4NL9 A;  1Q10 A;  2KV2 A;  4IQT A;  2D3B A;  2NBU A;  3A1Q A;  3HT3 A;  4GIV A;  7ICI A;  2JZ3 B;  4TQ0 A;  3A9J A;  2H5X A;  4PPX A;  5KL8 B;  1HZ6 A;  2MA9 B;  1AYF A;  4W9I A;  8ICU A;  2NV3 A;  4DQP A;  2LUE A;  5ALX A;  1RFK A;  4RQM A;  4ECZ A;  4CHK A;  1KRP A;  9ICX A;  5ALW A;  3SMV A;  1ZQS A;  2F1I A;  2W3S A;  2QIE B;  3H7I A;  1NOM A;  2C5L C;  3RBD A;  1JRO A;  2WB1 C;  3ZDM C;  4N9F 4;  2VJ4 A;  4LDT B;  1JMS A;  4HJG E;  1PVQ A;  1SXT A;  1DGS A;  3B0X A;  1Q1O A;  3RNF C;  2KJR A;  3ISB A;  2XN9 C;  1RQL A;  3B0Y A;  2ZTE A;  4HEA 1;  3MBY A;  3UMB A;  4O3R A;  9ICP A;  1ZDX A;  4UBC A;  3KLS X;  4JIO U;  3HIL A;  4ZHP A;  5J0P A;  4R8U B;  1H4R A;  2OH2 A;  4XRH A;  2K4H A;  2N1V A;  8ICN A;  4BKS A;  7ICT A;  3GP7 A;  5EOZ A;  4ECY A;  4GU2 A;  2N1R A;  1SIF A;  4RQ4 A;  3AE8 B;  5KFW A;  2CKH B;  4LJX A;  1XO1 A;  2DGZ A;  2DZJ A;  2KFJ A;  2BQR A;  3AEC B;  4DL6 A;  2ISO A;  1XC9 A;  5KFG A;  3AEB B;  2GMI C;  4WQO B;  4D2K A;  2F8L A;  1TKG A;  2L32 A;  4YMO A;  1JRP A;  1KH0 A;  2EMT A;  2LGS A;  1WM3 A;  2M56 B;  4FJZ A;  4OZC A;  3KD3 A;  4EZL A;  4F93 B;  3RJI A;  3OTQ A;  3MR5 A;  5ALM A;  2JZB A;  1UCV A;  1N5X A;  2G07 A;  2LJ5 A;  2ZIX B;  3NUH B;  3BII D;  2UVV A;  5JUM A;  1TK8 A;  8ICM A;  2ZUD A;  2H3Z A;  2W9B B;  4Y2P A;  3EYZ A;  2PFP A;  1YX6 B;  4LK0 M;  3VUY A;  2R8J A;  1AQ6 A;  3BZC A;  3T5H A;  1V2Y A;  4IWP A;  2HHV A;  4FO6 A;  3DBL I;  2KJ6 A;  3RB3 A;  2PIA A;  4ECQ A;  4A3O A;  4HRS A;  3E56 A;  1C3T A;  2XGP A;  2CU1 A;  1YJI A;  4UAS A;  5E79 U;  1RZT A;  9ICG A;  1ESF A;  4MM3 B;  1UWX A;  4C56 C;  4OCZ A;  4NLN A;  2IGG A;  2HJ8 A;  4K1R B;  2QAR B;  1WJU A;  5G2N A;  1XO0 A;  2DYO A;  4WJO A;  2E1E A;  5DQI A;  3PGE A;  1X9X A;  4EZ6 A;  3HM6 X;  3V62 A;  1S5L U;  3W2D A;  2UVR A;  5KFM A;  1HXY D;  5KAI U;  2FCM A;  7ICF A;  3AU6 A;  3QX7 A;  2IBK A;  3EHV A;  4NL9 C;  3C5G A;  2AQ3 B;  3KYD D;  3IVF A;  1IGC A;  1KBU A;  1FCC C;  3PW4 A;  2KVS A;  2HHT A;  1QIL A;  4WWO A;  2KJ9 A;  4J3O D;  3SEI A;  2XBB C;  4NQK E;  4ELU A;  2V4Q A;  3NRZ A;  3F2D A;  5DG9 A;  1E7P B;  5ALV A;  1KTK A;  4BX9 C;  4EEW A;  3THV A;  3APF A;  3HPO A;  4EE2 A;  2CXY A;  4EEY A;  1S8O A;  1QCK A;  4K7U A;  1SXE A;  3ZNI D;  4G3I A;  1ET6 A;  3C5F A;  5KT4 A;  5ALU A;  4B9U A;  1ZUD 2;  4ZRJ A;  3VUX A;  4J9O A;  4I27 A;  2ZIW A;  1Q3U A;  1SKW A;  1BXT A;  2EEL A;  1PK3 A;  3BQ7 A;  5J2I A;  3L3F X;  1RM6 C;  1YMH E;  4BUG A;  2XIC A;  2G4D B;  4Y2U A;  4OZB A;  4KLU A;  2KSO B;  5EE3 A;  4CNQ A;  5BYS A;  3GIJ A;  4M9L A;  3HWT A;  4KZC A;  1DOI A;  4F4Z A;  1F52 A;  1TIF A;  2Y5C A;  2LI6 A;  3PX4 A;  4FBJ B;  2C2E A;  5BYQ A;  4RQN A;  3F2B A;  4P7I A;  4AWJ A;  4PGX A;  2K9X A;  5IAA C;  3HK0 A;  2R2O A;  4NM2 A;  1HTO A;  8ICQ A;  4EKU A;  3TFS A;  3AXC A;  2KK0 A;  2LM1 A;  1ZQW A;  4LZD A;  8ICJ A;  1EU3 A;  1I4X A;  4ECU A;  2LXC A;  2LRW A;  2PVG C;  4QIW F;  2KHQ A;  3G6V A;  2PXI A;  4NAM A;  3GZF A;  4F5O A;  1CRX A;  1AWD A;  4HDQ A;  4PHP A;  2ESE A;  1MFW A;  2BYE A;  2KG5 A;  4KLO A;  5KFZ A;  4MEY A;  2Y5P A;  4JPS A;  3AU4 A;  5DLG A;  1V86 A;  2PI4 A;  1KQQ A;  2DX5 B;  4LCD E;  4M8N A;  1FNW A;  2AQ4 A;  4OJO A;  1XSL A;  1TZO A;  2D5G A;  3P42 A;  5IKC M;  1LKY A;  4PL1 A;  2HSZ A;  1L3V A;  1OEY J;  2PJH A;  1F0Z A;  4IWO A;  4FZN A;  4I2I A;  4GN1 A;  2ZVO A;  2MBQ A;  1WMH B;  2INP E;  2RPV A;  3GQC A;  3RR7 A;  3PX6 A;  5AKI A;  1WIA A;  3RYT A;  4ED3 A;  2BDP A;  1FRR A;  2FPL A;  4RMA A;  4ZH4 A;  2VIX A;  4FS2 A;  3SD5 A;  3NVZ A;  3JPT A;  2KIV A;  2KNJ A;  4HYK A;  2P6U A;  3UMG A;  5F9N A;  2UYZ B;  3AN1 A;  1J2M A;  4UAT A;  2NRZ A;  2VZK B;  3GIL A;  4RNA A;  4TUU A;  5CHG A;  4U6P A;  2Y0S C;  4WQM A;  3ZI4 A;  1ZQV A;  3WAP A;  2ZW0 A;  1F44 A;  2MBE A;  2W82 A;  4FLH A;  2XVT A;  1ZXH A;  1ZQY A;  5ALE A;  5FP0 A;  3M62 B;  3IXS A;  2MSN A;  3S6J A;  3QZ8 A;  3PW2 A;  2L0T A;  4W9F A;  4UAZ A;  4C8M A;  4KLL A;  5AZH A;  2HI0 A;  5J0U A;  1VRA B;  4NLB A;  2WX0 A;  2ATL A;  1O03 A;  3MFH A;  1MN8 A;  4X5V A;  1UQV A;  4GMV A;  2E6X A;  4EZJ A;  1P1A A;  4RQ7 A;  3X0W A;  1N56 A;  3X23 A;  5H8Y E;  3WK6 A;  3HW8 A;  4UB5 A;  4IC9 A;  4DSJ A;  4WUR A;  2P35 A;  4G9B A;  4OZA A;  4BOS C;  2WAQ C;  3I28 A;  4AYB C;  1JXL A;  3KUZ A;  3EZ5 A;  1IIP A;  2I38 A;  4M00 A;  1N2X A;  4K4G A;  1YQB A;  1PDX A;  4UB6 U;  4LNF A;  1FFV A;  2JZB B;  2GOW A;  2JQR B;  2ZVN A;  2W04 A;  2XO7 A;  4B9K A;  1Z1B A;  4JX1 C;  4B9M A;  1GO3 F;  1MC8 A;  7ICO A;  3Q8S B;  3RNA C;  4RT2 A;  5HNK A;  4BGD A;  3Q8Q B;  3QUT A;  4J6I A;  3K1Z A;  1L7Y A;  3U26 A;  3D2Q A;  1RLF A;  4PT5 A;  1D8B A;  3C1Y A;  2G45 B;  5DBC A;  1RRB A;  3VTV A;  1ZD2 P;  4ECR A;  3H7P A;  3UQ0 A;  3DHH C;  1KOT A;  2AXT U;  2WYQ A;  1XT9 B;  1Z4N A;  4DHZ B;  3C23 A;  3ZNZ B;  2HBJ A;  3HIZ A;  2JEF A;  3PNC A;  2D10 A;  1X40 A;  3NJT A;  3OPX A;  4NWI A;  3NVY A;  3VCB A;  2VH2 A;  1CK1 A;  2C9W B;  2RSU A;  4AUQ C;  4DSL A;  4AP4 C;  1Z00 A;  4BJQ A;  2CHW A;  3R2T A;  2N7E A;  2AL3 A;  1TY2 A;  4ICU A;  1XQQ A;  1ET9 A;  2D3A A;  4P1B C;  3FYH A;  1UA1 A;  2IO3 B;  4IQV A;  4FA6 A;  3WAN A;  1L6V A;  3URY A;  2KN4 A;  3ALR A;  2O6V D;  2W55 A;  2DL0 A;  2E8M A;  5KFC A;  2V4R A;  5J2B A;  4PHA A;  1TYG B;  5J0R A;  3LB8 C;  9ICL A;  2PMZ F;  3DEE A;  5LXI B;  1BNO A;  2MW5 A;  1ZRN A;  2XI9 A;  4KLM A;  4XA5 A;  1TFR A;  2ZIW B;  5AI5 A;  4KLH A;  4F5P A;  3PO4 A;  5KFO A;  2K8H A;  4P6V F;  3DVN U;  2ZTC A;  4ACF A;  2PTL A;  2ZJ8 A;  3VTU A;  3ONS A;  5CWR A;  1BVS A;  2RP5 A;  4MHV A;  3TSS A;  3UIO B;  3U52 E;  4WH4 A;  2XID A;  1WI0 A;  1T7P A;  3TBL D;  3A0H U;  3K75 D;  1SE4 A;  2YB4 A;  4BKG A;  3RCZ A;  1CI4 A;  2LGX A;  5J0W A;  3EWA A;  3AEF B;  2KDE B;  3G6Y A;  5JXV A;  3IN5 A;  3WKB A;  3RB0 A;  7ICR A;  1TVA A;  4KGS A;  1OXJ A;  2ZPY A;  1H8C A;  1WX7 A;  2JVC A;  3CMM B;  1TBE A;  2R8K A;  1P3Q U;  2LVQ A;  4W9D A;  5AK3 A;  3NRW A;  2WNM A;  2GBN A;  2VH1 A;  2J52 A;  9ICB A;  4NM1 A;  1UBQ A;  1X6I A;  4HPP A;  4HWI B;  4URK A;  3L54 A;  2AQ0 A;  4O1N A;  1LKY B;  2MHJ A;  2WS3 B;  4OJ6 A;  3B1L X;  1RFA A;  3PLU A;  3MHZ A;  4P0Q A;  1L0Y B;  1ECW A;  4XE0 A;  2N1W A;  1D6E C;  3DVG X;  4JUZ A;  1SE3 A; 
#chains in the Genus database with same CATH homology
 2WXO A;  3BVZ A;  3VR8 B;  3H8H A;  2RDH A;  5D7G A;  4AQ7 A;  1EU4 A;  1QT9 A;  3RPF C;  3MP9 A;  1J7C A;  4RF0 A;  3P4Q B;  5C3J B;  3AE3 B;  3KQ4 A;  4RCO A;  2INN E;  1JCK B;  4N58 A;  1RWS A;  4REZ A;  2QIL A;  3W9C B;  1D5Z C;  1TS3 A;  2MEK A;  3EUB 2;  1N61 A;  2G9H D;  4CQN A;  3WCQ A;  4YSX B;  5AUI A;  4AS1 A;  1NEK B;  4HRO A;  2N0S B;  2W54 A;  4A6Q A;  2QSD A;  3E9S A;  1I4P A;  3AEA B;  1DOX A;  1V97 A;  1BUI C;  3PZ8 A;  1XF5 L;  2WP9 B;  1TKY A;  3SFD B;  2Y3A A;  3P1M A;  1F77 A;  1MPE A;  2BTE A;  4WIP A;  1QOA A;  1VJK A;  3TUO A;  3ZJU A;  4ZYS A;  1DGJ A;  1K53 A;  1PGX A;  3AB5 A;  3MC0 B;  2BT6 A;  1XCT L;  3VRB B;  1MVK A;  3C8Y A;  3VQI A;  2WXH A;  2VZK D;  1MHH E;  2PVO D;  2PMV A;  4YT0 B;  4XE0 A;  1K52 A;  1P7F A;  2ICI A;  2WXG A;  3V05 A;  1JWM D;  3FIL B;  2IGH A;  4TQ1 A;  1WYG A;  2H88 B;  3BVM A;  2KMM A;  1SB3 C;  1JQ4 A;  1YQ4 B;  4A8X C;  1P7E A;  3Q69 A;  5G5H A;  4JWU C;  1HA5 A;  1C4A A;  1AN8 A;  2KWD A;  1WRI A;  3ZQ4 A;  3Q8E A;  5H92 C;  4GDK B;  3W5U B;  2J53 A;  5GXG B;  1C4P A;  4WAF A;  4MH8 A;  1QOF A;  1CZP A;  4ZRQ A;  1ACC A;  2WXF A;  2KAC A;  4YTP B;  4KGT A;  1VDV A;  1N63 A;  1Y56 A;  2QEJ C;  2BS3 B;  2MJE A;  2MJ3 A;  1JW9 D;  1YN5 A;  1EWC A;  4XWT A;  1SBB B;  2WXN A;  4DXG A;  1K51 A;  3B2F A;  1VZ7 A;  1FXI A;  5MPO A;  1Q10 A;  1SJE D;  3I9V 1;  4KGR A;  1FXA A;  2R61 A;  3P4R B;  1J7B A;  4DXF A;  4IKG A;  1HZ6 A;  3VR9 B;  1AYF A;  3B9J A;  3SEB A;  3AV8 A;  2WQY B;  2V3N A;  3N9Y C;  4RGO S;  3OWE B;  1RFK A;  4TMA B;  3T3O A;  2GI9 A;  2LGI A;  2OHF A;  2QMT A;  3ABV B;  2K5P A;  2W3S A;  2QIE B;  4YTM B;  1I7H A;  2HDE A;  1SSN A;  1CJE A;  1JRO A;  2WXP A;  5AUK A;  2WXL A;  4RGN A;  4A55 A;  3BK2 A;  4NZL B;  1R7S A;  1NEN B;  1ZP0 B;  1L5P A;  4HJG E;  1SXT A;  5FKA C;  5D3I B;  5E6J A;  1E10 A;  4B0E A;  2XN9 C;  3TEW A;  3ZJT A;  3AH7 A;  2ON8 A;  4HEA 1;  4RFB A;  4OZA A;  1ZDX A;  3Q8C A;  2BS2 B;  4IDI A;  1V1P A;  3KLS X;  1JWA D;  5EE1 A;  2IJ0 A;  4ZHP A;  3T3N A;  3ZGZ A;  3R2I A;  5FK9 C;  2L52 A;  2MH7 A;  2AQ2 B;  2JU6 X;  3NVV A;  2M19 A;  1FO4 A;  1YN3 A;  1E0Z A;  3GP7 A;  1UUP A;  5BYR A;  2LEK A;  4RF1 A;  1EWY C;  3AE8 B;  3BYY B;  3AEC B;  3AEB B;  1OQQ A;  4D2K A;  5HG2 A;  3B2G A;  2XNA C;  1TKG A;  2L32 A;  3DWM A;  5HHD G;  2M56 B;  1JRP A;  1KH0 A;  1RYJ A;  4XDD A;  2J4X A;  4OZC A;  2WDV B;  1FM0 D;  2JYE A;  2N7J A;  1TS2 A;  2WDR B;  4FXC A;  1YQ3 B;  1N5X A;  4US8 A;  2JSV X;  2V0G A;  2CJO A;  1PYW D;  2BBC A;  1GAQ B;  3NUH B;  3BII D;  4LTU A;  5BMH A;  2BS4 B;  1T6B X;  5C2T B;  1TY0 A;  4LK0 M;  2LUM A;  2KAJ A;  1ZOY B;  2J42 A;  1IBX A;  1SF0 A;  2FUG 1;  2WDQ B;  1L0V B;  2CU3 A;  1FMA D;  5EE9 A;  3NS1 A;  1C78 A;  2PIA A;  4L2Y A;  2ZW1 A;  4HRS A;  3E56 A;  4MT5 A;  3RFZ B;  1YJI A;  4R3D A;  4A9A A;  4IOI E;  4MM3 B;  1ESF A;  4KKJ A;  1UWX A;  4C80 A;  4C56 C;  1FRD A;  2YEP F;  2IGG A;  1IUE A;  1XO3 A;  2BB5 A;  1N5W A;  2DYO A;  1C76 A;  1JWS D;  1UGJ A;  2IPK D;  1PUT A;  3W2D A;  1F2R C;  1D5X C;  2V4I B;  2WXM A;  1HXY D;  2QJL A;  1V8C A;  2SAK A;  3HRD D;  2WXQ A;  4ITK A;  2AQ3 B;  4N59 A;  1I4G A;  4LLG M;  1IGC A;  1FCC C;  3U4E G;  1KFY B;  1QIL A;  4J3O D;  1XCQ L;  5G5G A;  3Q8A A;  3NRZ A;  3KWL A;  5BMI A;  1E7P B;  1KTK A;  2PW9 A;  2CJN A;  2SEB D;  2W3R A;  1MI0 A;  1TJE A;  2Q5W D;  2WXK A;  4EE2 A;  3LYY A;  2WU5 B;  1WXQ A;  2DWQ A;  4N6E B;  1ET6 A;  1FNU A;  2I2Y A;  2ONQ A;  1ZUD 2;  1M4V A;  1KF6 B;  1JAL A;  1BXT A;  3AED B;  1KLG D;  2MJD A;  1TKE A;  1HQR D;  1K50 A;  2EEL A;  5FR3 A;  1RM6 C;  1QLB B;  1WWT A;  1ZE3 D;  1YMH E;  3HUI A;  1D4B A;  1V1O A;  2NMQ A;  3IAM 1;  3IT4 B;  4OZB A;  5EE3 A;  2RDG A;  3MJ5 A;  5BYS A;  2BYT A;  1VLB A;  1FEH A;  5LNK 1;  3AE5 B;  1DYQ A;  1DOI A;  1FNV A;  2DLB A;  2WU2 B;  2Y5C A;  4YWG G;  1N60 A;  3FC4 A;  3IAS 1;  3SFE B;  3W1S A;  3W5V B;  3NVW A;  5BYQ A;  1SE2 A;  2JYT A;  3EGR A;  2JX5 A;  1I4Q A;  5D3D A;  2K9X A;  2L83 A;  3U2S C;  1VZ6 A;  1EM7 A;  3Q8F A;  1EU3 A;  1I4X A;  1LO5 D;  2PVG C;  3AE9 B;  5BMG A;  1J7A A;  4KX6 B;  1JWB D;  5TSS A;  4NAM A;  4HKZ E;  4YTN B;  1T5X D;  1AWD A;  5HI1 A;  2JZP A;  4NAW B;  2Y5P A;  4JPS A;  1GB4 A;  3AE6 B;  3L4P A;  1I4R A;  3GB1 A;  1XLP A;  1E9M A;  2IGD A;  1FNW A;  1TZO A;  2D5G A;  3ZJV A;  3AM9 A;  1DOY A;  3P42 A;  2AQ1 B;  3AEE B;  2L1A A;  2PKO A;  1F0Z A;  4USA A;  1PGA A;  1XLQ A;  4TSS A;  3TEY A;  2X38 A;  2INP E;  3AE1 B;  2RPV A;  1IGD A;  3V3X A;  3P4P B;  4ZHO A;  2YEP B;  1F2R I;  1FRR A;  1OQR A;  3LXF A;  4XDC A;  1E6E B;  3NVZ A;  2K0P A;  1AW7 A;  5T8I A;  4KKI A;  1SIJ A;  2VZK B;  1JWU D;  3GS2 A;  3HVD A;  3AN1 A;  3MFG A;  3P63 A;  4RNA A;  4TQ0 A;  2GB1 A;  4WQM A;  3PO0 A;  2NTT A;  3BYT B;  3AMZ A;  3J9C A;  2K3U A;  4WWM A;  3P4S B;  2KDM A;  1HZ5 A;  1I4H A;  2JXT A;  2V3P A;  2ZW0 A;  4RGM A;  2W82 A;  1ZXH A;  4ZOH C;  3CIR B;  3IXS A;  4ZRP A;  1QF6 A;  5EE0 A;  1VRA B;  1VZ8 A;  3ZYY X;  1V1P B;  3KWV A;  2E6X A;  1OFF A;  1B1Z A;  4OW0 A;  1NVI D;  5H8Y E;  1BML C;  3R8B A;  1ZPS A;  1ROE A;  4WUR A;  3BK1 A;  3AE4 B;  3FIL A;  3UI3 A;  1YN4 A;  1C79 A;  1QOB A;  1PFD A;  2K22 A;  2I38 A;  3Q8B A;  1PDX A;  4JE3 B;  3ETR A;  4RGT A;  2NTS A;  1FFV A;  2N9L A;  2FBW B;  2JQR B;  4B0M A;  4Q2J A;  4OHJ A;  1XEE A;  1SJH D;  2DYM A;  2BW2 A;  4JX1 C;  1NI3 A;  4GLS C;  1GOZ A;  2JWU A;  2WLB A;  1L6U A;  1HEZ E;  1TS4 A;  2G1E A;  1IBX B;  4L23 A;  1N62 A;  4YSY B;  3HVZ A;  4YSZ B;  4PT5 A;  4P16 A;  4UDU C;  1L4D B;  3I57 A;  1GPX A;  3BVG A;  4M0W A;  1XLO A;  1C4C A;  2IDY A;  4XWW A;  2WXR A;  2TSS A;  1T3Q A;  2PLP A;  2H89 B;  2FE8 A;  4C7Y A;  2LHE A;  3CWI A;  1QQR A;  2GRI A;  1B9R A;  3NVY A;  1JML A;  2LMC A;  1CK1 A;  2OED A;  3NZ3 A;  3R2T A;  2B76 B;  1TS5 A;  1UWM A;  1TY2 A;  2DBY A;  2LJI A;  1D5M C;  1ET9 A;  2ACZ B;  4JWS C;  1NYQ A;  3EA6 A;  4GDL B;  1FCL A;  1L6V A;  3DWG C;  3URY A;  1ENF A;  1L0X B;  1YNT E;  4DQO C;  1C9F A;  2KN4 A;  2W55 A;  3TEZ A;  4HKQ A;  4RH6 A;  1GB1 A;  4ARC A;  1ZDV A;  1TYG B;  2M0A A;  3LB8 C;  4US9 A;  2N9K A;  1ZXI A;  1UNS A;  2WXJ A;  1A70 A;  1L4Z B;  2RMM A;  2KQ4 X;  1KLU D;  3O13 A;  2BB6 A;  3AE2 B;  4P6V F;  2HTM E;  5HFY A;  3SR6 A;  1KRH A;  1WGK A;  2PTL A;  1XLN A;  4ARI A;  4NJC A;  3TSS A;  2E3T A;  3U52 E;  1SEB D;  3FAH A;  4WH4 A;  3U7Z A;  1FIQ A;  3IT6 B;  3VRA B;  1SE4 A;  4L1B A;  4C7Z A;  2WXI A;  3AEF B;  1XXG A;  4A90 A;  5I4D A;  5JXV A;  3BWU D;  1MHX A;  4KGS A;  2Z8L A;  1CQV A;  3TEX A;  3PZ7 A;  1NYR A;  4OVZ A;  2WNM A;  1QOG A;  2J52 A;  1FFU A;  2EKI A;  1FD6 A;  1STE A;  4H2A A;  1PGB A;  3BZD B;  4MAC A;  1C77 A;  1VR9 A;  1WSP A;  1QKZ A;  4O1N A;  2LHD A;  2WS3 B;  1YJJ A;  3AEG B;  2LFI A;  4YXD B;  3MHZ A;  1L0Y B;  3AE7 B;  1D6E C;  2AX5 A;  1SE3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...