1N60A

Crystal structure of the cu,mo-co dehydrogenase (codh); cyanide-inactivated form
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
161
structure length
161
Chain Sequence
KAHIELTINGHPVEALVEPRTLLIHFIREQQNLTGAHIGCDTSHCGACTVDLDGMSVKSCTMFAVQANGASITTIEGMAAPDGTLSALQEGFRMMHGLQCGYCTPGMIMRSHRLLQENPSPTEAEIRFGIGGNLCRCTGYQNIVKAIQYAAAKINGVPFEE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Carbon monoxide dehydrogenase small chain
publication title Catalysis at a dinuclear [CuSMo(=O)OH] cluster in a CO dehydrogenase resolved at 1.1-A resolution
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 49
structure length 161
sequence length 161
chains with identical sequence D
ec nomenclature ec 1.2.5.3: Aerobic carbon monoxide dehydrogenase.
pdb deposition date 2002-11-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00111 Fer2 2Fe-2S iron-sulfur cluster binding domain
A PF01799 Fer2_2 [2Fe-2S] binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.120 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 [2Fe-2S]-binding domain 1n60A02
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1n60A01
1A70A 3WCQA 3AEAB 3LXFA 1WWTA 2BS4B 3B2GA 1YQ4B 1IUEA 4US8A 1CJEA 1CZPA 2L83A 3HUIA 3HRDD 5G5HA 1L5PA 5EE3A 2Q5WD 2E3TA 1NENB 3AEDB 2BS2B 3SFDB 2K5PA 3AEGB 1TKYA 4HRSA 1L6VA 1SIJA 3DWGC 1WGKA 1E9MA 2WU2B 3PO0A 2W3SA 1N60A 1J7CA 3W5VB 3AE8B 2JQRB 4WWMA 1RM6C 3AECB 3AEEB 3AN1A 2PVGC 1QOAA 1WXQA 4N6EB 3LB8C 5GXGB 4ZHOA 1JQ4A 2N0SB 4YSXB 2WS3B 1QOFA 2PIAA 3NVVA 1OFFA 1GAQB 1L6UA 2BT6A 2W3RA 1KRHA 4YSYB 3AE2B 3AM9A 3AE3B 1UWMA 3NS1A 4FXCA 1RWSA 1DOYA 1OQQA 1XLOA 3VR8B 3VRBB 1VDVA 1I7HA 4P6VF 4LTUA 2WDQB 1RYJA 3RPFC 1N61A 1L0VB 4KX6B 1N5WA 1R7SA 2WP9B 2L52A 1JWBD 2W54A 1J7BA 2KMMA 1NVID 2DWQA 1YQ3B 2M19A 1V97A 1WRIA 2PKOA 4IDIA 2QIEB 2MJEA 5AUKA 2MH7A 5EE1A 1FM0D 3AH7A 3L4PA 3SR6A 4US9A 1JWAD 1E7PB 3AMZA 1QLBB 2WU5B 5EE9A 1GPXA 4USAA 3AE4B 3AV8A 1PDXA 1QT9A 1YJIA 2K22A 3P1MA 4C7ZA 1SB3C 2ACZB 3DWMA 5C2TB 5MPOA 3VR9B 4YTPB 3FAHA 2WDVB 4A9AA 1FRDA 1KFYB 4ZOHC 1JW9D 1JALA 2H88B 1JROA 2LEKA 1NYRA 1SF0A 1VLBA 1FMAD 5G5GA 4C7YA 4C80A 2BS3B 1QOGA 1TYGB 1PFDA 1TJEA 1XLQA 3CIRB 1J7AA 4ITKA 4ZHPA 2JX5A 1N5XA 1FFVA 2W55A 3FC4A 1TKEA 3NVZA 2HTME 2PVOD 2WDRB 3AEBB 1FXIA 1NYQA 1ZOYB 2CJNA 2G1EA 3P4SB 4JX1C 4YXDB 3ETRA 2FBWB 1ZP0B 5C3JB 4JWUC 1F0ZA 4N58A 3KWLA 2MJDA 3AE7B 1E0ZA 1E10A 3BIID 1T3QA 2DBYA 1AYFA 1N62A 3B9JA 2KAJA 3P4PB 4JWSC 4WQMA 4YT0B 1FIQA 3NVWA 1XLNA 1JRPA 1VJKA 1N63A 1XO3A 2Y5CA 1QOBA 2WQYB 1YJJA 5AUIA 1NEKB 3SFEB 1V8CA 5H8YE 3VRAB 2CU3A 3P4RB 1ZXIA 3AB5A 4HROA 3P4QB 3ABVB 3AE1B 3NRZA 3EUB2 3AE5B 4YTMB 2EKIA 1ROEA 2OHFA 2QJLA 1E6EB 2WLBA 3HVZA 1DOXA 3W5UB 1TKGA 2H89B 1EWYC 3AE9B 1XLPA 1NI3A 2M56B 4YTNB 4YSZB 1ZUD2 1RFKA 2MJ3A 1DOIA 1FXAA 1OQRA 1WYGA 1DGJA 3AE6B 4N59A 1QF6A 1KF6B 2CJOA 3B2FA 2K9XA 5EE0A 3W9CB 2AX5A 2B76B 1AWDA 1PUTA 3AEFB 3P63A 1B9RA 1FFUA 3ZYYX 1FRRA 5H92C 3NVYA 1FO4A 3CWIA
chains in the Genus database with same CATH superfamily
4JMUA 2JYEA 2O2VB 3EFUA 4REZA 3WANA 1U4AA 3C0RB 5KG6A 5JHBA 1F2RI 5KFEA 7ICHA 1L5PA 1NENB 4RH6A 3RJGA 4KLUA 5IKCM 1ZPSA 1XF5L 4CNQA 1T94A 1Y8RC 3TADA 4LDTB 5AI4A 1D6EC 5E6NA 3U30A 1EU3A 4HEA1 2NVUI 2MRLA 1QOAA 5KTQA 2KVSA 4RQ7A 4QZGA 4ED6A 4ANXA 4EYIB 2N7JA 4ECUA 2KICA 5KT3A 3RRHA 1YJ1A 5BPCA 2PLPA 4LK0M 5D49A 4O3NA 1XLOA 3M63B 3W1YA 2DKZA 3M9OB 3KHLA 1CQVA 3UIPB 1NK4A 4DWFA 1N61A 2E5SA 2A5UA 3I5JC 3PX6A 1XEEA 4M00A 5AKKA 4ED2A 3AU4A 4MGZE 2ZJAA 2AGQA 2KMMA 2L1AA 2N9LA 4NJ7A 2JEGA 4ICUA 1WRIA 2C28A 5KFFA 3ML9A 4BUGA 1QQ5A 4LDTD 2EZYA 2IO1B 3AH7A 3VUYA 3U26A 3IT4B 1T0QC 1UBQA 3AE4B 4LNOA 1HQRD 1PDXA 1V80A 2I2YA 4IOIE 2WF6A 4RQNA 1SB3C 4C7ZA 2UVVA 5ALIA 4LJXA 4RPXA 2W7OA 3KKAC 4DCCA 3RJJA 2F8LA 2JXTA 3RZWC 2RR9A 4RF0A 3LVWA 2FUHB 3H4DA 4RQ8A 4IRDA 1C76A 3L3FX 3IN5A 4EE2A 2INDC 3RN9C 5I4DA 3VFKA 2KN5A 3TMPB 3ML8A 5G5GA 5AKZA 3WKEA 4P0PB 1TYGB 2KVRA 3CRXA 2XC9A 1N5XA 2KDEB 3OJUA 1DK3A 5L1KA 2JRIB 4YXDB 1RDFA 2WX1A 5C23A 2KDFB 2FBWB 2KKPA 3DHHC 4QZ8A 3N20C 4GLXA 2C7NB 4CGZA 4JWUC 4FFDA 2SEBD 4OJ5A 5HP4A 3UQ2A 3ZRFA 3IHQB 4I27A 3MC9A 3Q8QB 1V9JA 3RD2A 3PHWB 5AM0A 4X5VA 2MBHA 4A20A 1RFAA 3NVWA 4DBGA 3HP6A 4F5OA 2GLSA 4MSMB 2KTQA 2NRVA 1QOBA 4BFRA 8ICQA 3KVFB 3RNBC 2ASQA 2L76A 3C8YA 3PLUA 4W9CA 3TAPA 4YMMA 3G6XA 2SAKA 3SEBA 5BOMA 3ONSA 1YN4A 3VUWA 4RPZA 9ICKA 2H89B 3MGVA 2LVQA 1FXAA 4RQ2A 2KJ6A 4M9LA 4S0RA 1H8CA 3J9CA 4CF5A 3QK0A 3N7PD 4XDCA 4FULA 5KHOA 3KBBA 4ARCA 4FZLA 5GMVA 8ICNA 2YY6A 2IO0B 2NRZA 1V38A 2KN4A 3RH6A 2QSDA 2ZIUB 1JX4A 4K3CA 4US8A 3VCBA 1T6BX 4TQSA 2NYVA 3RRGA 2DAJA 2PE9A 5CR0A 3KLSX 4L1BA 4NLCA 4OHJA 2QEJC 2Z59B 2J0JA 2YMMA 3L08A 2HBJA 4P4PA 3PO0A 1U45A 1N60A 1ENFA 1HE8A 2V3PA 3QJZA 4RQ1A 3PRMB 3ISBA 4QZCA 1S9FA 4HPLB 3T5JA 2E8OA 2EQYA 4KLSA 3NUHB 4NPNA 4YG2A 3ZDBA 1D4BA 2KDMA 3HJEA 3TUOA 2L7RA 1QH9A 5J2DA 2BKFA 3JW0X 5JZEB 2D07B 1R4MI 4P6VF 4ECSA 3MDAA 4DOCA 7ICTA 3ZVVA 1R7SA 1LKYA 5HMLA 3MGHA 2KHVA 4MFAA 1OEYA 2WXOA 4ED1A 2MU2A 2WF7A 1E8ZA 4PZOA 2NMQA 3A9JB 4KVGB 4PJ0U 4AYBC 1FM0D 2ZIXB 2MSED 3Q6BA 3NTUA 4UBBA 3HILA 3JSVA 4Q45A 4GC6A 3D2NA 1U49A 3VTVA 1NK0A 3QXGA 4MELA 4F4KA 2BDPA 3VH4B 2XVTA 3T3OA 5ALFA 3KQ4A 1L8OA 3H1UA 4OCZA 3PW0A 4U6PA 1CMXB 1ZQEA 2WXGA 3PRZA 3AULA 2EH9A 3LWMA 2KN7A 9ICMA 4M8NA 1VLBA 4C0ZA 3GE8C 4PHDA 1DRGA 1OUQA 3Q8FA 2HVIA 1FFVA 3V7JA 3IRUA 2FLLA 1OTRB 3IBEA 1ZYQA 1WR6E 3DVNU 8ICPA 2MA9B 2K8BA 5C3JB 5E79U 4IS7A 3PGEA 4PHPA 3WU2U 1K5OA 7ICVA 3AXCA 1HA5A 1TS4A 1YN3A 2DYBA 3MJWA 2WX0A 2NO5A 3MFHA 1RXWA 4O0IA 3FILA 4DLEA 2DX5B 2BCUA 3O0FA 3AU2A 1ZETA 2YQEA 1T3NA 1ZJMA 2FCSA 3BVGA 4RMAA 3BK1A 7ICFA 4JWNA 5T8IA 1HUZA 3I28A 3ZQ4A 2JR5A 3VXWA 4BWJA 2ZTCA 2O2VA 2EZXA 2AWTA 3H7PA 1RYRA 4OJOA 4PS3A 1X6JA 5J2KA 4P2HA 2DENB 2R2QA 2TSSA 1TKGA 3QEBZ 4YSZB 2M56B 1DOIA 3DEEA 2A19A 2LGIA 1RPLA 4M01A 1QTMA 5J0UA 2G5HB 3H40A 2KACA 3W9CB 5J0PA 1A6SA 4PL1A 1PQSA 9ICVA 3EYZA 3JPNA 2K1FA 1YIWA 3RJIA 1AROP 2L5YA 1VJ5A 2ZUBA 1CZPA 4R64A 3HRDD 2ZIVB 4J9LA 1WXVA 4AQ7A 1Z1VA 1F1HA 4MH8A 5ALSA 2K5PA 1O08A 1YOVB 3K9OB 1WX7A 2HI0A 2D3BA 3SU8X 1YZ6A 1K50A 5KFTA 1F2RC 3C21A 8ICJA 2ZW0A 2BYFA 3KH0A 1BPEA 3GDXA 5HG2A 3QX1A 4IKGA 2WXKA 2AJQA 3L54A 4ECVA 3A0HU 2MUTA 2LASA 4DFDA 1LVHA 4DL7A 2ZG6A 9ICWA 1IGCA 1KRHA 5JHAA 5KL1B 3RF9A 3IV6A 4ECWA 2UVWA 2K0PA 2Z0EB 4QZIA 1I7HA 5DB9A 3QE9Y 5D6JB 5DGBA 2WDQB 3Q8AA 4LTUA 2L05A 4KN7A 4YXMA 4FADA 1JWBD 2YEPF 4F72A 3MJ5A 1SZHA 1TAQA 1NVID 2K8CB 2RQ5A 4GXBA 4KIKA 8ICKA 4UATA 2PKOA 4ZDVA 2M8SA 1L7NA 1U4BA 2OH2A 5AM1A 4RGTA 1CI4A 4ICVA 2MCNB 2IDYA 3L4PA 7ICPA 2NPTA 2UWQA 3N1YC 7ICIA 1COKA 2HJ8A 2NRWA 4HAIA 4EBDA 4K4HA 2PMVA 2NPTB 3HIZA 4DHZB 3TEZA 5IIIA 5JU5A 1KFYB 2XICA 1SV0A 4KTQA 3GU3A 2JH1A 2B3AA 1IBXA 4M47A 4FZNA 2LEKA 1ZQGA 1JMLA 4MJSA 1YX5B 1WXMA 4GIBA 4ED0A 1NKEA 3RB4A 1UPHA 4Y2YA 4RNAA 4X57B 3ZDAA 1MI0A 1NYQA 1ZD2P 5TSSA 2INNE 1ZQIA 1Z5SB 4WJNA 4J9KA 1EF1A 4IUMB 5AM5A 2XI9A 2LHDA 4CF4A 3N1XC 1V5TA 2FMPA 2DL0A 4YQWA 4G3XB 3BZCA 3MHSD 1YJJA 2BQRA 4PPXA 2V9HA 2G4DB 3H4BA 3BVZA 1KW4A 4RQ0A 7ICMA 1IG6A 3ZNZB 1UH6A 3VUXA 2NTTA 1T4GA 3AU5A 3F5EA 4KGTA 2PFPA 4YCXA 4EZJA 1NZPA 2ODGA 3P2BA 3PO5A 3AE9B 1NK7A 3PSFA 3TBLD 2AL6A 3UI3A 2F1JA 2I38A 2D3GA 4YN4A 4UB5A 2VZKB 2K9XA 1PUTA 1WXAA 2MW5A 1D5ZC 4E74A 1V9PA 2WXJA 2C2RA 3PX0A 2R8GA 3ZDMC 2GRIA 2KX0A 5A0LA 1AQ6A 5KT7A 3GOEA 1FEHA 3C28A 3H7IA 3A0BU 1HUOA 4DLGA 2DF4B 2N9PC 1HJPA 3AE8B 3E0FA 8ICFA 3TAQA 4XQ8A 5ALVA 4RPYA 4QZAA 2JZPA 3PS6A 4O1NA 4PYUA 1WXQA 1MN8A 4GDKA 1QOFA 1ET9A 2I1JA 3M9MB 5DBCA 1ZQNA 1KOTA 2JPHA 5KFZA 3WKBA 2XCAA 3A9JA 4FXCA 4D2KA 5ALYA 8ICAA 3QA8A 2QKQA 1X40A 4UW9A 4XUSA 3PZDA 3UINB 3R9KA 4DFPA 1GJZA 4M0WB 1I42A 4M2YA 5KFXA 4ANVA 1DK2A 1E8YA 3BYTB 4NJ8A 2RDJA 2FPLA 4DHZE 4QWEA 4F4WA 4ZRKA 7ICEA 1PGBA 2MLBA 5LLIA 2KQ4X 3ORYA 2DZMA 3R3MA 2M19A 4RQ5A 4W9FA 2BBCA 5EE1A 3PVLA 5HHDG 2G4SA 3SR6A 5L1MA 5KG3A 3RFZB 5KFHA 3ZNGC 1IV8A 5DB8A 2ASJA 5AIAA 1ISNA 1ZRMA 1WGDA 4BKTA 5J0RA 1S0VA 4UB6U 2H3FA 5DB6A 4WJPA 5CEHA 1WGHA 2NBWB 4ZOHC 2HMXA 1BXTA 2NO4A 2ONQA 3SD7A 3SI8A 1J7AA 2Z7JA 2E1FA 4C4RA 2R2OA 1X6IA 4JB3A 2VANA 4P4MA 1K8RB 4JX1C 3QCAA 1XSNA 4B9LA 2LPEA 4DSFA 1L0YB 4WWPA 3D6JA 8ICMA 2OM6A 8ICBA 1KSPA 5ALOA 3UQAA 2E1EA 4MH0E 4KLHA 5DDYA 3FKYA 5KFWA 2NTSA 1TS3A 1T7PA 3OHAA 2KOBA 4XRHA 2I6XA 1NDDA 4XE0A 3EPGA 1C78A 2WHIA 1WGYA 2GH1A 1NK6A 2ZIVA 4TSSA 3RZFA 3MR2A 1ACCA 3WK9A 2MJ3A 2NRXA 2PI4A 3R66C 3AE6B 3MC0B 3DBHB 4B0EA 4ARIA 1QF6A 2GI9A 3B2FA 1EO6A 5J2IA 1BPXA 2B76B 3ZRCA 4RQ6A 2GOLA 4MHVA 3CWIA 5D46A 1A70A 2RPQA 1M94A 3SHQA 2G0AA 3UPQA 2VA2A 3Q14C 3X23A 2XEWA 3AI5A 1PK1A 5B66U 5F9NA 2BS2B 1XO0A 5HR7A 2QB0A 2LYAA 1LO5D 1Y56A 2LVOA 3T9LA 1SIJA 2RP5A 3DWGC 3M3JA 4M6WA 2K25A 4RGMA 5J2JA 1R4NI 4EZ6A 2G06A 5DGAA 4F5RA 3KZXA 2MX2A 4E71A 2K39A 5IAAC 2KHQA 4R63A 2R61A 4DQQA 1QKZA 5DPRA 4FS1A 5L1LA 2PIAA 4DDID 4XWTA 1WCLA 4KLMA 3CMMB 3AE2B 5KT4A 3URYA 4HPMB 5F3XB 5AICA 3U52E 3GP7A 4RUCA 3RPFC 1MSWD 4PH5A 2W54A 1C7YA 1R4MB 4I2EA 2LXAA 2IOFA 3CP8A 5J0TA 2IA6A 3MDCA 2EDUA 1ZQBA 2LRUA 5CRXA 3RNCC 4CCHA 2ICIA 2RD0A 2G08A 1XSPA 4BDPA 4ED8A 3PNCA 5IIMA 4YD1A 4RFBA 1E7PB 3DV9A 1C20A 2Y5BB 3M95A 4DFJA 1CK1A 1Q8KA 8ICWA 2I1KA 2KZ3A 3DHIC 2KJRA 3PMLA 7ICRA 5DBAA 1D8LA 3EZ5A 5CX3A 4I2AA 1K53A 4GMVA 2M0AA 4DL6A 5G55A 1B22A 4QWDA 3RJFA 2WGSA 3LDAA 2P35A 3P4SB 4A6QA 2HOIA 1KL9A 1L3UA 3RTVA 4JUZA 1QSLA 2JYTA 1B4FA 4XZ4A 3AE7B 1L7MA 2FIFA 2ISOA 2MBOA 1LKYB 9ICUA 4EZ9A 3OWEB 5AKEA 2KK0A 2F2AB 1MQ2A 2KVZA 2N1RA 4AJWA 1P9DU 4Q8EA 3BZDB 4S17A 4EKUA 4EOYA 1QQRA 2XY5A 2Q0ZX 3PW2A 4NAWB 3M7DA 3AE5B 2W9BA 2OHFA 2EKIA 4B0MA 1A76A 3TL5A 2DZIA 1DOXA 3CW2C 1JWUD 4K7UA 4QWBA 1WYGA 1ZD3A 1ZQ1C 2VJ5A 3E56A 4TUUA 1Q3UA 4NAMA 3V6KA 5FR6A 3SFDB 4YTNB 1FRRA 3LJ3A 4HJGE 3RJHA 2CU1A 4PHAA 3U4EG 3B2GA 2Y1IA 1CJEA 4ELUA 1ZDXA 2FMQA 3N7SC 4MM3A 3TARA 1J2NA 1SKWA 3GZNB 2QARB 3BZKA 1WGKA 2R18A 2K8AA 1GUAB 5TR5A 2BGFA 2LGSA 4F4YA 3GFKB 2YMLA 2HOFA 9ICFA 3FILB 3ISDA 2V3NA 3HW8A 1XNSA 4MFCA 2D2QA 3SV3A 3AL0B 1JCKB 1NJYA 1SEBD 4MT5A 5KFOA 2BCQA 4EX7A 5LNK1 3QU5A 3ZXVA 2NS5A 4YVZA 4TKNA 4KSKC 2QB1A 2XGPA 2K60A 3PSPA 1OQQA 3WALA 3H7PB 2CHWA 1QSSA 1WIAA 3NZSA 3IFWB 3EW9A 1A77A 5AIBA 1DYQA 2J7QB 3UIOB 1KRPA 4URKA 3V60A 2FCNA 1WWVA 2L00B 2W82A 3OJ4B 4W9JA 1PVRA 1J97A 3QEAZ 3APFA 1YQ3B 1ZQRA 2DHZA 4IDIA 2OEDA 1QSYA 3X0WA 1L8LA 1SE4A 1O03A 3VVWB 3L16A 2AEHA 5IA7A 2B21A 4F2RA 3K9PB 5HMMA 1YQBA 1WX8A 4RU9A 3M6ZA 3AEVA 2WTFA 4NJ6A 5IP4D 1UCVA 2R8HA 2F44A 3RJEA 3F2BA 4TUQA 1BMLC 1WY8A 2GBKA 1FRDA 2LUEA 4ZYSA 3V05A 4GDLA 1HTQA 4NLNA 3TFRA 1MFWA 3K75D 2HDEA 4JLCA 5BO4B 3BS5A 2RLTA 4UB3A 1KFTA 4IWOA 4W9GA 5AKLA 4QIWC 1LXDA 1Q0WB 2MUTB 1L6NA 4YR3A 2KYWA 5ALNA 4IM2A 3B1LX 2ZPNA 4DWIA 2XIDA 4C8LA 2JH7A 4JIOU 1UNSA 1T3QA 2EAMA 2RDIA 4OD0A 1PVPA 2R8KA 4K4GA 2JRZA 1RXVA 1YX6B 3IAS1 1NNLA 3WK6A 3R2IA 4Z6CA 4AYBF 1S76D 1WJNA 1CEZA 2ZXIA 2FLNA 2M1MA 3C2MA 4KIKB 4W9HA 4I2HA 1K1QA 3KYDD 2KFNA 2N7DA 3EUB2 1V1OA 2BQ3A 2Z8LA 1E6EB 1Z00B 3M62B 1BPDA 4BAXA 4O3QA 1IIPA 2KIVA 3ZJTA 4ED3A 1Z2MA 2JV3A 2VA3A 4O5EA 2ATLA 3PT2B 1DGJA 3QU4A 2RHFA 5AM4A 1YNTE 3Q8BA 4DF4A 2ESEA 4BXOB 3QHTA 2W11A 8ICCA 4K7WA 1B9RA 3E9SA 2KJ5A 2WF8A 3FDSA 1ZDVA 1IBXB 1BPYA 2FLPA 1TS2A 3NVYA 1HZ5A 1WXSA 2Y9TA 3AEAB 2EMTA 3QQ8B 4UAWA 1JWMD 4Y2UA 1WR1A 4MJSB 1SIFA 4JPSA 2L83A 3HUIA 5T14A 3SZ2A 2Q5WD 4W9EA 2XK5B 3LDZE 3AEGB 9ICOA 2F8KA 4ECYA 3Q8LA 2JZ3B 5AZGA 2OCEA 5EWEA 3EECA 4XC2A 1J7CA 3QYPA 2KOXA 1FCCC 5J2RA 3Q3MC 2PVGC 4GOCA 3UXPA 1WGGA 5KFRA 4TQ0A 2F1HA 2N9KA 5DLFA 3IXSA 1D9FA 4I29A 2ZEQA 2ZNVB 3PMNA 1D8YA 4GFJA 2KFKA 4DK5A 5E6OA 3AM9A 1UWMA 3GV5B 1D5MC 3RI7C 1IPGA 3IHPC 5AI0A 1KJTA 3IG8A 1YN5A 4H2AA 5J8YA 3A1QA 5DPTA 3PVXA 2L52A 5ALTA 2JXJA 1VZ7A 1WI0A 1WGRA 4LJPB 1QQ6A 3PSIA 4KLLA 2FNJB 2PKEA 2WXQA 5DQHA 4YL8A 2LMRA 1GOZA 2CKHB 3PZPA 4GN1A 4YD2A 3WIMA 4BBNF 1L3TA 2WFAA 3PRPB 1S3SG 5MPOA 1PVQA 1BNPA 4YTPB 5IO9A 5KT6A 4NY0A 3Q8RB 3Q8MA 3T8MA 2F77X 2WXPA 1JW9D 2BTEA 1TS5A 4RUAA 3KD3A 3GIJA 1NYRA 2K4HA 1A0PA 5ALDA 2P6UA 5ALWA 3GV7B 2QHOA 4GDKB 4L2YA 1TKEA 2HTME 8ICHA 4DOAA 2G1EA 4KLEA 4DL2A 4Y2PA 3ZNHB 3R8BA 4NAWA 2MSNA 4EBCA 3HPOA 3C2KA 4G0NB 3DBLI 8ICIA 2DBYA 1C3TA 1J0GA 1AYFA 1ZJNA 7ICJA 1P3QU 1M4VA 2CN1A 2HHTA 3PTFC 2AL3A 1KEJA 5KFSA 3C1YA 1VRAB 2Y5CA 2AGOA 4A90A 2MBEA 2JXXA 4Z6EA 4F91B 4FZMA 5EWGA 2Z0DB 5KT5A 3SV4A 3GS2A 3HM3A 3NRZA 1E90A 2R8JA 2CHXA 2H3ZA 3PPAA 1NBFC 4ZRPA 3JPPA 2FIDA 4O9MA 4Y2RA 2W8KA 4QJFB 4ECXA 2CXYA 4DSJA 7ICGA 2MQJA 2WXNA 4J9MA 2D8CA 3KHRA 3RCZA 2QARA 5HKHA 2BHNA 3TFSA 4DO9A 3WKAA 1WM3A 4J6IA 3WK5A 4QZEA 4WQOB 4EZKA 3I63C 5IIJA 4WAFA 5H92C 5J0WA 2CR5A 4RF1A 5DBBA 1UT8A 3FM9A 2V4QA 2E8NA 3DDHA 4RM8A 1MA7A 2WF9A 1FNVA 4C8NA 2EMSA 1KLNA 4JL9A 3S2AA 4F2SA 2BWES 4F1SA 1PUZA 4KMUA 3LK9A 4CE6A 2W3SA 3ZGZA 9ICCA 4J9NA 2EZZA 3VC8A 3Q8CA 4OVUA 1HZ6A 5CP2A 3AQFA 1OEYJ 2UYZB 1XU4A 5KFQA 1GAQB 5D4BA 1ESFA 5L1JA 1SGHA 8ICZA 4K7SA 4OO1J 5JRTA 4XGAB 3WKCA 9ICPA 3GIMA 4MGKE 1OGWA 1B0XA 1IYFA 1V1PB 2MEKA 2LI5A 2D3DA 1SV4A 4I2DA 4QW9A 3AUOA 1V6EA 3V6JA 4UB1A 1J19A 1N6ZA 2CPRA 2BF8B 1STEA 1A5RA 1TZ1A 3APDA 4Y2QA 2K4PA 4TQ1A 3TI0A 3D2SA 2MBBB 4CF3A 2LUMA 1DXSA 1NJXA 2PPHA 4IQTA 4FJZA 2LKYA 2ZJ5A 2UVUA 1GPXA 3N28A 2PXIA 3W1SC 1JWSD 2K22A 2HE7A 1PK1B 3CYMA 2LM4A 5AZHA 2QB0B 4FLHA 4M6WB 5EDSA 1ZQDA 1HEKA 4A8EA 4RNOA 2EELA 5DQGA 4HCPB 1ZD5A 8ICOA 4Y2XA 5DG7A 2G45B 3VHTC 1ZQYA 4NL9A 4AS1A 4DQIA 4HYKA 1K1SA 1XLQA 3CIRB 3K1RB 3BQ1A 4I6LB 5CTRC 1JUDA 2JX5A 3VTWA 3EFCA 2ZTDA 3FC4A 3N4MB 1MJDA 2HJ1A 4EEWA 1FXIA 1H4RA 2KG5A 1ZOYB 5BYRA 2BCSA 5D2MB 2BR0A 1MG4A 5KFCA 3ALBA 2Y0SC 2XNAC 2VA8A 3BJYA 4N58A 2INPE 2HHQA 4LNIA 4LLGM 8ICGA 4O5CA 3WK4A 1Z00A 1WJ4A 5J2EA 2JF5A 2KMAA 1E10A 3B9JA 4KX3A 9ICAA 3B08A 4DXFA 2DKXA 3OJ3A 3UF8A 4J3OD 5KG5A 1NZBA 3K4GA 8ICSA 3H8JA 1WM2A 2K3UA 3MHZA 2HVHA 7ICUA 4BXOA 3O65B 3O13A 4P1BC 3TSSA 3VRAB 3SAFA 2CU3A 2HTHA 3MR5A 1EU4A 4KLFA 1Z1BA 3RR8A 4KKIA 4RGOS 4LCDE 4FA6A 4EZLA 2JRHA 3BQ2A 2CHZA 3DOWA 3HVZA 4L23A 5LXHA 1JRUA 2YB1A 2BYTA 2XK5A 1XLPA 1C4AA 1KKXA 3BINA 1OQRA 1BGXT 2G07A 3A9KB 5J18A 2G9HD 2KZRA 4KLTA 2CJOA 3NS8A 3QU9A 4MDKE 2ZUDA 2YLMA 2KC1A 4DOBA 3OTQA 5J0YA 4JV0A 1TV9A 4F5QA 3APCA 2ZPYA 3LXFA 3NOBA 4HXDA 3TADC 5G5HA 2DLBA 5EE3A 2KANA 3GQCA 3A33B 1X42A 1GB1A 4KDIC 3BDPA 5AKGA 5IINA 1SWWA 5BOLA 2LJIA 3WK8A 5AI5A 2JQRB 4HWIB 2D3CA 2C7MB 2HBKA 5HR6A 3DCGA 3TJPA 3QNMA 1PZNA 5KFUA 5KG2A 1SGGA 4ZHOA 4F8RA 5IN7A 3NVVA 1BUIC 3U8ZA 2IY1B 1ZOLA 4PS7A 4QNLA 4RT2A 9ICNA 4HJKA 3SEIA 5HI1A 5KFMA 2BB6A 2W9BB 1XWLA 2D3AA 4RT3A 2XO7A 1Q46A 2ZVOA 3MFGA 4DSEA 1N5WA 2YB4A 3M9NB 4UDUC 4Q8FA 5JXVA 3KUCB 1WE7A 2RSUA 4EFOA 2V0GA 3ZDCA 4KZCA 1TKDA 2RDBC 4FS2A 4O3MA 4MF2A 2KWVB 4Y2JA 4TURA 1JWAD 4DHJD 2E8PA 5BYQA 3QUCA 1E8XA 2LGDA 3Q3FA 2IJ0A 1DGSA 4MM3B 1DOQA 2MWSB 4JK1A 5FP0A 2IHMA 5ALRA 1JMSA 2PEAA 2UVRA 4IRKA 4MSQB 3Q3OC 1UELA 2JGAA 4NWIA 1UA1A 4NLGA 4EYHB 2LBOA 3ISCA 3KKAA 1XCQL 1WRDB 2BS3B 2GLEA 2KMDA 4ECQA 4EEYA 1ZQTA 2V4RA 3H6NA 2KE7A 4B9VA 4Z6DA 4QZBA 4J9OA 3SYZA 2LMCA 2XCPA 4NJCA 4UAVA 1FCLA 2M17A 1ZP0B 2N1VA 3JPTA 5AKYA 3HWTA 3ZDEA 9ICSA 3KWLA 2KV2A 3ALRA 4A8XC 4BOSC 2B6GA 2KMCA 4I6PA 5ALHA 5JUMA 1X9SA 2QILA 5F9LA 4B6JA 8ICXA 2MHJA 4HLEA 3RYTA 1WSPA 4YXJA 4MGYE 1TVAA 4HROA 1TK5A 2KNJA 2P66A 2JU6X 4HKZE 3AE1B 4AP4C 4KLIA 3DBRI 3U7ZA 2K4IA 5AK4A 3C5GA 2QJLA 2NBVB 5J0OA 4Z6FA 3C5FA 4RQ3A 1ZQVA 3C1ZA 2H3VA 5AKIA 1RLFA 1GC6A 4PGYA 1XT9B 1XQQA 5EOZA 3PSTA 3QARA 2NRTA 2X8XX 4BKSD 3F2DA 4GDLB 2AX5A 1AWDA 2KZMA 7ICKA 4BGDA 1XO1A 2I1QA 1FPYA 1JIHA 3BS5B 4KGSA 1F52A 2KLCA 3PV8A 2IGDA 2YVCA 3HT3A 5ALQA 3H8SA 4IC7B 2PFOA 4NLBA 1KLGD 3V6EB 1C1YB 4HPPA 3GIIA 2WAQC 4FHKA 3HHMA 1RM6C 1V1PA 3PV1A 4II3B 3UMCA 5KFIA 1P7DA 5KFPA 3H8MA 3ZDTA 5DB7A 3G6VA 2BCVA 2K4EA 4YSXB 3B0AA 2AQ3B 1FNWA 2QLTA 1TK8A 1ZGUB 4EELA 3EWAA 3TQ1A 2R8IA 1SXTA 2W9NA 2OWOA 1IGDA 2WXFA 4YSYB 3LVVA 1JN3A 4W9KA 4NQKE 2I5HA 5C0YA 2KKCA 3DVGX 1L0VB 4KDLB 1LV5A 4FBTA 3M8SA 2EAOA 2KXJA 1I4GA 4C4TA 4GU2A 4QAYA 4R65A 1IM4A 4XDDA 2C60A 5CA7A 3T3FA 3HVDA 5AKJA 1B1ZA 2BKRB 4JV2A 2INCC 5AUKA 3I1YA 2DQNB 2KTFA 4DDGD 3ZDDA 2D10A 1L0XB 5J2CA 8ICTA 3AV8A 3JVZX 4DXAB 2W9CB 1YJIA 4B9KA 5AI6A 1GO3F 5ALXA 2PJHA 3DWMA 2IPKD 2YEPB 4F4ZA 2WF5A 1F77A 2LZ6A 3QWZB 5AKHA 1L3SA 1ZXHA 1JALA 3P42A 2PMZC 4JE3B 4FE3A 2A1AA 4ZYNA 2G5IB 1L7YA 2C2EA 4O3PA 4P0QA 1TJEA 4K4IA 2VRRB 4NLZA 2F1IA 4ZHPA 2KFKB 3NVZA 2XBBC 3F2CA 3AU6A 1NJZA 1UGJA 1CUKA 3JYUA 1K52A 5DPSA 2MP2A 4WJQA 1Z4OA 2G3QB 4C4SA 1ZQCA 2BCRA 1E0ZA 2KEYA 5CB1A 3WKDA 1P0RA 4ICAA 4K3BA 1WX9A 2JUOA 4TUSA 2ZTEA 1ZQQA 5ALEA 3A1QB 4J9RA 4P4OA 5EWFA 1S10A 3I57A 1QILA 9ICGA 2JZBB 3A9KA 1V8CA 1SJED 2H3IA 2G09A 3AB5A 2AGPA 1WH3A 1UWXA 3N1ZC 1ZQLA 3TEYA 3ZJUA 2DGZA 3PO4A 4B9MA 4TMAB 1G6JA 5CWRA 2WB1C 3SDLC 4PL2A 2WLBA 1SKSA 3W5UB 2FPKA 1UGMA 3T5KA 2GO7A 4UB2A 3V61A 2RDHA 3KZIU 3VDZA 3NZUA 2LM1A 4N59A 5J2GA 4DS4A 3V6CB 2D11A 2O6VD 2WXLA 4QIWF 3P63A 2MRPA 3QZ7A 4IR1A 4NNJB 2BPSA 1KFDA 5ALLA 1MQ3A 2FCQA 2ALZA 1XC9A 1IUEA 1TZOA 1HEZE 2KFZA 3ZI4A 2E3TA 1V49A 3DVNV 4QWCA 3AEDB 3KUZA 4P1CC 3H0MB 3N7RC 1L3VA 2ON8A 3IAM1 2LGXA 2ZUCA 2BPFA 3AN1A 4J9PA 2DNFA 4O3OA 1LB2B 2N4FA 4I28A 1JQ4A 5J2AA 4PK1A 2J4XA 2F3NA 4M8MA 3RNEC 3R2TA 2FI1A 2BT6A 3K1ZA 4F71A 4I2GA 2XY6A 2FAZA 2N9XA 3N30A 1KM7A 3N9YC 3KYCD 3VTUA 4KGRA 4Q2JA 1RYJA 4GLSC 5J2HA 2C9WB 4ZH4A 4KX6B 1NK8A 4BJQA 2BQQA 3U2SC 1TAUA 5DKWA 4KLDA 1I4RA 3NJTA 2YN4A 5AK6A 3QC8B 2V4IB 1MC8A 3ZD8A 4B9NA 1S97A 4N9F4 1COOA 4G3IA 4YWGG 2RRDA 3RT3B 2GWSA 2KNBA 4US9A 4PYZA 4USAA 2QCZA 4M0AA 3UMGA 5DDMA 1IXRA 3GIKA 4BKSA 1FXTB 5DCNA 1D9DA 1GC7A 1HTOA 1F0MA 1N48A 2KK8A 3NRWA 8ICRA 3VR9B 1TE2A 2W03A 2PFNA 2PI5A 2W8LA 2PW9A 2DPIA 2OJWA 1SWVA 2HDOA 2XGQA 4CRXA 1WMHA 4XX5A 2AU0A 4YMOA 2LFIA 4C80A 4F5NA 5BYSA 5ALGA 2W55A 3UXOA 4C00A 4F4XA 1EM7A 2QDFA 3KHGA 3DHGC 3ETRA 1SXDA 2H5XA 3THVA 2LD9A 4E0DA 4IQWA 3MFIA 2AYOB 3WAPA 2JZZA 2PE6B 3P4PB 1KN5A 2KAJA 2IOHA 4CO7A 4UQGA 2WXHA 4QWAA 4HVBA 2FDRA 3ETLA 2A4ZA 2OXOA 5KFAA 4K1RB 4UAUA 5AKXA 1ZQOA 1Z19A 2KJ9A 1UT5A 3VAWA 1XXGA 3ABVB 2EANA 2YTUA 1S0NA 4ELTA 3TKAA 4YTMB 2YMQA 3RH4A 2OEHA 3BYYB 5J0XA 3QU7A 1NI3A 2W04A 3TANA 4TUPA 4GXKA 4W9LA 5KNIA 1GNUA 3T5HA 4R8UA 3GILA 3TCAA 2BDUA 3V62A 2KSOB 3MR6A 3AEFB 1S1QB 1FFUA 4XA5A 3LWLA 1HIWA 4ECRA 4HK2A 1WWTA 1YQ4B 4M02A 4NM2A 3QAQA 3H8WA 9ICHA 1KTKA 1RYSA 3L5KA 1HXYD 3N97B 2ZIWA 3V7KA 1TY2A 4KN4A 3OGUA 5DG8A 2FE8A 3PSEB 4MGIE 1EF5A 2WU2B 1ZQXA 4BWMA 7ICSA 4O3SA 1UA0A 1VZ6A 1I4XA 1QQ7A 3HKZC 3C2LA 4LNFA 2JHDA 1EXNA 2BWFA 4F93B 2BYEA 3LB8C 4KKJA 3H9DA 4HCNB 4IL6U 5BMIA 1OFFA 4DF8A 3RFAA 3V6HA 3D32A 4C8OA 3L0WB 3B0YA 4MEYA 2C7HA 2GBJA 1WWUA 3PR5B 2CRXA 1UBIA 4EX6A 3VH3B 4WAAA 3ZUNA 2LWPA 3VRBB 2A3VA 4Y2VA 4J9SA 4OZBA 1MHXA 4M9GA 3KOOA 3RB3A 2ISPA 2W9CA 3UXNA 3MGIA 3OG5A 2WP9B 3UQBA 2JMGA 3DPDA 2VJ4A 2KFJA 1SE9A 4ZRIA 1ET6A 4BZAA 1YZ7A 3HM6X 4KITB 5KFBA 3WK7A 2QIEB 4Y2SA 2MJEA 4MEMA 2MH7A 4DQPA 3C23A 1ZRNA 4KX5A 1RZTA 4KLQA 2JWZA 4JGHB 5EE9A 2AXTU 3SAGA 3CNHA 4WWOA 2HBMA 4RGNA 5HNKA 3OSPA 2O6VA 4JQWC 5J17A 2HD5B 1ZQPA 3Q8EA 3FAHA 2RGFA 3RNFC 4DL5A 3C19A 2GB1A 1VZ8A 5D94A 1X2IA 1QCKA 1MVKA 5D3DA 3J81j 2KTRA 1FMAD 5AK3A 4EEKA 1KDHA 4DSLA 9ICXA 3DBHI 2IZVB 2WWZA 4NXZA 2JZBA 2E6XA 3PREA 5KG7A 1TK0A 2KX3A 4NZLB 3Q3NC 4NV0A 5C1ZA 1YD8U 4DXGA 2MJDA 2M4NA 3PW5A 5K4LA 1UUPA 2HHXA 1RAXA 3V72A 2D6FC 3IT6B 2LVPA 4OJLA 3V7LA 5ALPA 4TQRA 3PW7A 1JRPA 3JPQA 8ICLA 1K51A 3ZTCA 3L13A 3HK0A 3NZ3A 4RNMA 4GSWA 2J6TA 1T0YA 3P4RB 1P7EA 1SKRA 1ZXIA 2KP7A 4IM0A 2KQSA 3P4QB 2PTLA 3MTNB 2RPVA 3GV8B 1F5SA 1S0MA 1ED1A 1H38A 4YMNA 3T3NA 2IOFK 3ENEA 3MC1A 3QX7A 4WH4A 4JWMA 2X38A 1AARA 2J0MA 1RG6A 3ONNA 4OJPA 1RFKA 1UD7A 2ZW1A 3DBRB 3N32A 3E58A 2DYMA 2CS4A 5CHWA 1UHUA 4NQLB 3TACB 3KHHA 5KHQA 3EHVA 9ICJA 1FO4A 5E6JA 2WNMA 2HHSA 1NKCA 2Y0SF 1FEZA 3LYSA 3IDWA 1AN8A 2BB5A 3ZIMA 2DZKA 3KW5B 1URJA 2ASDA 1U47A 1N56A 2DPJA 1GG3A 2L0TA 3OAWA 5HHIA 4I2CA 3W5VB 4I6NB 3TIXA 3QZ8A 4R66A 3EGRA 4UASA 1S0OA 4B9UA 4DSIA 1WE6A 3AEEB 4LNNA 5C5JA 5ALMA 9ICEA 2V9WA 2NR2A 4BOZB 2WS3B 4EUTA 1OW5A 3ICXA 4BX9C 5DQIA 4HKQA 5D3IB 4B9SA 3AQEA 2I9GA 4E3CA 1L6UA 5KAIU 3PHXB 3CSFA 4KLGA 5IIOA 3NHEB 4G9BA 5DLGA 2KJ8A 8ICYA 4LZGA 1ZQKA 3R7RA 3VR8B 2DFLA 2JEFA 4B9TA 3NG0A 2VH2A 4OVZA 4RQ4A 5G2NA 1M6YA 1C4PA 4F3OA 2JVCA 4LZDA 3BVMA 1J7BA 2JWUA 1ZQUA 2DUYA 3QUBA 4O5KA 1AW7A 1ZQZA 2EKEC 4RM9A 1ZD4A 3G6YA 1C4CA 3M1YA 4DQSA 4F8CB 4B6WA 3TEWA 1QLBB 3AMZA 3H0RB 1R4NB 2K6DB 4LJOB 3RNAC 1QT9A 1S5LU 3L10B 4KV2A 5C2TB 2LYHA 2ACZB 2NBUA 2J6SA 2FMSA 3GE3C 3ZJVA 2DYOA 1J8CA 4I2JA 1MPEA 1SZPA 1JROA 2W43A 2OOBB 4G11A 4CQNA 3IM1A 1I4PA 3OLMD 2FJ6A 4I2BA 2M0XA 3CF6E 2XN9C 2JY6A 1E7UA 4FBUA 2QC8A 2CJNA 1Q1OA 4XWWA 4OJ6A 5IOIA 2NV3A 2KQ7A 1KLVA 3GB1A 3RJKA 2A1JB 1F9JA 8ICUA 5KFYA 1SJHD 1FIQA 2MA1A 2V4LA 3GZNI 1ECWA 3T5LA 5J0QA 5FKAC 2Y5PA 5KFJA 4C8KA 4LNKA 5H8YE 4C4VB 2KSOA 3D2QA 2BW2A 8ICEA 2QMTA 3E2EA 2IYDB 4DSKA 3T79A 2D5GA 2DZJA 4QZ9A 5J0SA 2KO3A 2IGHA 1IP9A 2E8MA 1RQLA 1ROEA 4BBNC 1T0RC 4IQVA 4Q44A 1U9LA 2IHNA 1EWCA 4WIPA 1EWYC 1L7OA 1CRXA 1ZUD2 1L7PA 9ICBA 3F53A 3DBSA 3PZ8A 3WAOA 3SD5A 1ZE3D 2HBLA 1WUDA 5HHHA 3SENA 2N1WA 4P0QB 4F92B 1X1MA 2WXMA 4QZFA 2AHOB 2FCMA 4WJ3B 5DPWA 2K6QA 1MHHE 3GZFA 2MP2B 5GTIU 2W9MA 5CHVC 4WWMA 1X66A 5AHXA 3KTQA 3PX4A 4FJYA 8ICVA 2C22A 3KUDB 4P0PA 4N6EB 5AZFA 7ICLA 3U7DA 5JH5C 1L2NA 2ZCBA 5KFVA 1UZXB 2KIWA 1UF0A 4W9DA 2ZXHA 1I4HA 1X9XA 2HHWA 4HDQA 2AH5A 1BT0A 3NS1A 1DOYA 3UGBB 1BPZA 2C2DA 1L4ZB 3SMVA 1NKBA 1E8WA 4B95A 5TISU 4FHJA 3L17A 2HHVA 1MG8A 1JXLA 4QZHA 2LXCA 5KT2A 3MC8A 2GBNA 3PR4A 1KTQA 4R3DA 4DEZA 4M9NA 1SE3A 3RMKC 1N2XA 4DHJB 4ED7A 3OJSA 2RMMA 1JXEA 3UQ0A 1SXEA 4OZCA 4ZRQA 4GXIA 3RR7A 2M0NA 4FBJB 2WAQF 1KH0A 2FUG1 3P1MA 4LVSA 3UM9A 2UU7A 7ICNA 3VQIA 1KLUD 3HX0A 3BQ0A 1ZQJA 4PS8A 4FN2A 4C7YA 4CYEA 2LHTA 4GC7A 4DQRA 2ZIUA 4RNNA 4O3RA 1PFDA 2KDIA 1ZQWA 3PLVA 4ACFA 1PK3A 3ED5A 2Y9UA 2PVOD 2WDRB 4ASWC 1NK9A 2KDBA 2KD0A 2JEIA 5KFGA 5KL8B 2W9AA 5KFNA 2BKEA 3OHBA 1NK5A 2J52A 4J03A 4MFFA 1GB4A 4IQUA 2WDTB 2HOQA 2J6UA 2OJRA 3BQ7A 4RCOA 2LJ5A 3RH5A 5L1IA 1XLNA 3S6JA 1YT3A 4A3PA 5ALZA 4KMOB 2ZJ8A 3LYYA 1NEKB 9ICTA 2GMIC 4DFKA 3BS7A 4F50A 2KVCA 4DFMA 3ZW3A 3M6KA 3PY8A 1U48A 2KWDA 4F7ZA 2BGWA 1I35A 1XD3B 4XYCA 1ZQMA 1UQVA 3DVGY 1TGZB 1NJWA 1Q3VA 2PMZF 3H0LB 1PYWD 1WJUA 3OPXA 1BVSA 4IC9A 1V85A 3ZLZA 1B43A 1TIFA 5HFYA 4KZ0A 1WYWB 2W7PA 1WMHB 4BVUC 3NASA 2M9NA 2ZIXA 4MF8A 2VZKD 2BS4B 1T8EA 5AI8A 3FYHA 2ZCCA 1KBUA 3EC8A 4AUQC 5L83A 2Y3AA 9ICRA 4IG7B 4YFKA 3RBEA 3JPOA 1C79A 1V86A 1L6VA 2KZZA 4OW0A 4C56C 3QUTA 3QUQA 4U7CA 1LGRA 4WWNA 3JPSA 9ICLA 2ZZPB 4JV1A 2KWCA 2KWUB 2N9EB 3Q8SB 1X9WA 4DQOC 2K8HA 2N0SB 3IVFA 1C9FA 5B5EU 1WG8A 2AQ0A 3RAXA 1Q10A 2KHWB 1VCBA 2WB1F 3ZD9A 2J0KA 2PFQA 4ANUA 3RBDA 2W3RA 1P98A 4PGQA 5J8YC 5TZVA 1VD2A 2KC2A 1I4QA 1RWSA 2WHEA 1WCNA 1XSLA 1D5XC 1BPBA 5FR3A 1TBEA 2H3QA 4AJYB 5AM3A 3MR3A 1TT5B 2ASLA 3WAMA 4R8UB 1PGAA 4EBEA 1P1AA 4P7IA 2DWQA 2LGYA 1ZQSA 1V97A 4PZNA 2BPCA 1QLNA 1SE2A 2LI6A 2ZJDA 5JTIA 4P16A 4UB4A 3CSTA 3QU2A 3BY4B 3QIJA 3MBYA 2ZIWB 3NY5A 4F5PA 4YR2A 3JPRA 1XS9D 1S8OA 4FJVB 2ES6A 2FPMA 3Q8KA 4A9AA 4AP9A 2LRWA 4I2FA 2A1JA 2GBRA 5KAFU 3RUIB 1V5OA 3R7QA 1LFDA 2KT7A 2FE9A 2BQUA 1RRBA 5KFDA 3I9V1 2P6RA 7ICQA 1J2MA 3Q69A 4Y2TA 4OZAA 2JSVX 3AEBB 1XCTL 3ZNID 4C4VA 1E7VA 4NM1A 3RNGC 4A3OA 1KQQA 1SL0A 1F0ZA 3C29A 5AM2A 3KFUF 5H2FU 3ZKJC 5CHGA 3SQIA 4JWSC 4YT0B 2EAPA 3EPIA 4CDGA 5AK5A 4DL3A 1VJKA 1N63A 4UARA 1XO3A 2WQYB 5E6PA 4IW0A 1Z4NA 2GOWA 3SFEB 1NOMA 4CHKA 4KLOA 2VKQA 1E5WA 3WA0A 2IO3B 4RZRA 4FO6A 4ECTA 1Y88A 1T0SC 2RDGA 2O6KA 3KWVA 1P7FA 5LXIB 2JEJA 3PW4A 1D8BA 2Q4TA 1Z3EB 1V81A 1S77D 1ZQFA 1SSNA 2O6VB 3OSNA 2IBKA 1NI2A 5KG1A 1TTNA 2GBMA 4AOFA 4QW8A 4AWJA 4BKGA 2B0CA 3NUQA 1WFYA 2K8CA 3Q8PB 4G50A 2IO2B 5KG4A 4KSLC 4PGXA 1RYUA 3ZYYX 1TFRA 2IY0B 2KTRB 3WCQA 5J29A 1V2YA 2K89A 4TV3A 2L8JA 3RULA 5BMHA 4NY8A 4YR0A 5ALJA 1TY0A 3DBLB 4WURA 2DAFA 2LYBA 3Q3JA 2LHEA 3ECIA 5KG0A 1TKYA 2J53A 3A4SC 4HRSA 3ZXRA 1T5XD 5IIKA 4K81A 1E9MA 7ICOA 1FD6A 1OXJA 2WYQA 1WZ3A 1SL2A 3DQVA 2HW3A 3AECB 2VH1A 4IM3A 2HSZA 4A55A 4ANWA 1TAMA 3RB0A 5GXGB 4QZDA 2WXRA 3V3XA 2MAXA 3BK2A 4DS5A 2XY7A 5J2FA 4M04A 4DL4A 2JT4B 2MBQA 3AE3B 5CHFA 2J42A 3ZTDA 2ZVNA 2L0FA 1QZEA 1VDVA 1YMHE 2BVCA 1LM8B 3M8RA 2V1YA 2N7EA 2HCFA 3H7SA 1EUVB 3TEXA 3BQTA 2IMWP 2C5LC 5L95C 1ZQHA 4GIVA 4HDOA 2AQ4A 5BMGA 1C77A 4WJOA 4ECZA 5AEKB 4W9IA 4I2IA 1D3ZA 4MACA 1SBBB 1Q5WB 4IR9A 2KJHB 4GXJA 2VIXA 2BPGA 2WU5B 5L9XA 4GB9A 3IP4B 3A4RA 3DDCB 2V3SA 4II2B 4RQMA 3HKZF 3RB6A 1RQNA 4YP3A 5CJ7A 4NL9C 2WDVB 2KLGA 4ELVA 4UAZA 3W1SA 3SAHA 4Q43A 4ACOA 2H88B 4EENA 3F5AA 1BNOA 1SF0A 2IGGA 2L3ZA 3ZO5B 2NCNA 3MABA 1QOGA 3JSVB 1X9MA 3MP9A 4ITKA 3UMBA 2OYYA 3RAQA 1ZQAA 1ZKHA 2Y1JA 9ICIA 2AQ2B 3EA6A 9ICQA 1VR9A 5AI9A 3N3KB 4OVVA 5DG9A 2AQ1B 4UAYA 1L5UA 4NLKA 2KD1A 3IG5A 3BIID 3Q2AC 3IG3A 4GGQA 5FK9C 1N62A 1SV0C 5KFKA 2REXA 4M9HA 3H8HA 4PT5A 4WQMA 4ZRJA 2YX8A 1OQYA 2L32A 5ALKA 1WZ0A 5AUIA 4MEXA 2YMPA 1FNUA 3PZ7A 4M9JA 2K8BB 3BWUD 5IILA 3W2DA 1WJ6A 3I76A 4PHEA 4J9QA 5GTHU 1SL1A 5ALUA 1WF9A 2BYVE 4C8MA 1KFSA 5KFLA 4M0WA 2IBIB 1LQBA 4UB8U 2KKVA 4IWPA 3NGDA 4KLJA 2HHUA 4IWQA 1PGXA 2BZFA 3I3TB 1ZW7A 5J2BA 5D7GA 1KF6B 1F44A 5EE0A 1JI7A 2WXIA 2ZNVC 4UBCA 4IRCA 2F76X 1L4DB 3B0XA
chains in the Genus database with same CATH topology
5E6JA 2WNMA 1A70A 2JYEA 3LXFA 4REZA 1F2RI 1L5PA 5G5HA 2DLBA 5EE3A 1AN8A 2BB5A 1NENB 4RH6A 2BS2B 1GB1A 1LO5D 3T3OA 1Y56A 1ZPSA 1SIJA 3DWGC 2LJIA 1XF5L 4RGMA 3W5VB 1D6EC 3EGRA 2JQRB 1EU3A 4HEA1 3AEEB 1QOAA 2R61A 4ZHOA 4HKQA 1QKZA 2WS3B 2PIAA 3NVVA 2N7JA 5D3IB 4XWTA 1BUIC 1L6UA 2PLPA 4LK0M 3AE2B 5HI1A 3URYA 2BB6A 1XLOA 3VR8B 3U52E 1CQVA 3GP7A 4OVZA 3RPFC 1N61A 3MFGA 1N5WA 1C4PA 4UDUC 1XEEA 5JXVA 2W54A 3BVMA 1J7BA 2KMMA 2JWUA 2L1AA 2N9LA 2V0GA 1AW7A 1WRIA 2ICIA 1C4CA 3AH7A 1JWAD 4RFBA 1QLBB 1E7PB 3AMZA 5BYQA 3TEWA 3IT4B 3AE4B 1HQRD 1PDXA 1QT9A 2IJ0A 4IOIE 2I2YA 4MM3B 4C7ZA 1SB3C 2ACZB 5C2TB 1CK1A 3ZJVA 2DYOA 2JXTA 4RF0A 1C76A 4EE2A 1MPEA 1K53A 5I4DA 1JROA 4CQNA 2M0AA 5G5GA 1XCQL 2BS3B 1TYGB 1I4PA 1N5XA 2XN9C 3P4SB 4A6QA 2CJNA 4YXDB 2LMCA 4NJCA 4XWWA 1FCLA 2FBWB 1ZP0B 4JWUC 2SEBD 2JYTA 3KWLA 4A8XC 3AE7B 3GB1A 2QILA 3OWEB 1SJHD 1FIQA 3NVWA 1QOBA 1WSPA 5FKAC 2Y5PA 3BZDB 3C8YA 5H8YE 2BW2A 2QMTA 1QQRA 4HROA 2JU6X 4HKZE 2D5GA 3AE1B 4NAWB 3U7ZA 2IGHA 2SAKA 3AE5B 4B0MA 2EKIA 1ROEA 2OHFA 2QJLA 3SEBA 1DOXA 1YN4A 1EWCA 2H89B 4WIPA 1EWYC 1JWUD 1ZUD2 1FXAA 1WYGA 3J9CA 4XDCA 3E56A 4ARCA 4GDLB 3PZ8A 2AX5A 1AWDA 4NAMA 3SFDB 1ZE3D 1FRRA 4HJGE 2KN4A 2QSDA 2WXMA 3B2GA 4KGSA 3U4EG 4US8A 1CJEA 1ZDXA 1T6BX 3KLSX 2IGDA 4L1BA 1MHHE 4OHJA 2QEJC 1KLGD 1WGKA 3PO0A 1N60A 1ENFA 4WWMA 1RM6C 1V1PA 2V3PA 3FILB 2V3NA 4N6EB 4YSXB 1JCKB 2AQ3B 1SEBD 3NUHB 4MT5A 1FNWA 5LNK1 1D4BA 1I4HA 4YSYB 1SXTA 2KDMA 2WXFA 3NS1A 1IGDA 3TUOA 1DOYA 1OQQA 1L4ZB 4P6VF 1L0VB 1DYQA 1R7SA 1I4GA 2W82A 2WXOA 4R3DA 1SE3A 4XDDA 1YQ3B 2RMMA 3HVDA 1B1ZA 2NMQA 4IDIA 5AUKA 2OEDA 1FM0D 4OZCA 4ZRQA 1SE4A 1L0XB 3AV8A 1KH0A 2FUG1 3P1MA 1YJIA 3DWMA 2IPKD 3VQIA 2YEPB 1KLUD 1F77A 1BMLC 3KQ4A 1FRDA 1ZXHA 2WXGA 3V05A 4ZYSA 1JALA 3P42A 4JE3B 2HDEA 1VLBA 4C7YA 1PFDA 1TJEA 4ZHPA 3Q8FA 1FFVA 2PVOD 3NVZA 2WDRB 1UGJA 1K52A 5C3JB 2J52A 1HA5A 1E0ZA 1TS4A 1YN3A 1GB4A 1UNSA 1T3QA 3FILA 3IAS1 3R2IA 4RCOA 1XLNA 3I57A 1QILA 3LYYA 1NEKB 1V8CA 1SJED 3BVGA 3BK1A 3AB5A 5T8IA 1UWXA 2KWDA 3TEYA 3ZJUA 3ZQ4A 4TMAB 3EUB2 1V1OA 2Z8LA 1E6EB 2WLBA 2TSSA 3W5UB 1TKGA 3ZJTA 4YSZB 1PYWD 2M56B 1DOIA 2RDHA 1DGJA 4N59A 2LGIA 3Q8BA 1YNTE 2KACA 3W9CB 2WXLA 5HFYA 1B9RA 3E9SA 3P63A 1ZDVA 1IBXB 1TS2A 1HZ5A 3NVYA 3AEAB 2VZKD 1JWMD 2BS4B 4JPSA 1IUEA 1TZOA 2L83A 1CZPA 1HEZE 3HUIA 3HRDD 2Q5WD 4AQ7A 2E3TA 2Y3AA 3AEDB 4MH8A 2K5PA 3AEGB 1C79A 1L6VA 4OW0A 2ON8A 3IAM1 4C56C 1J7CA 1K50A 1F2RC 2ZW0A 1FCCC 3AN1A 2PVGC 4DQOC 4TQ0A 1JQ4A 5HG2A 2N0SB 2N9KA 4IKGA 2J4XA 3IXSA 2WXKA 1Q10A 1C9FA 3R2TA 2BT6A 2W3RA 1IGCA 1KRHA 3AM9A 1UWMA 1I4QA 1RWSA 2K0PA 3N9YC 1D5XC 1D5MC 1I7HA 5FR3A 4KGRA 4Q2JA 4LTUA 2WDQB 3Q8AA 1RYJA 1YN5A 4GLSC 4H2AA 4KX6B 2L52A 3U2SC 1JWBD 2YEPF 1PGAA 1I4RA 1VZ7A 1NVID 3MJ5A 2DWQA 2V4IB 1V97A 2PKOA 1SE2A 2WXQA 4RGTA 4YWGG 2IDYA 3L4PA 4US9A 4P16A 1GOZA 4USAA 5MPOA 3VR9B 4YTPB 2PMVA 3TEZA 4A9AA 1KFYB 2WXPA 1JW9D 2PW9A 2BTEA 1TS5A 1IBXA 2LEKA 1NYRA 2LFIA 3I9V1 4C80A 1JMLA 5BYSA 4GDKB 3Q69A 4L2YA 4OZAA 2W55A 1TKEA 2JSVX 2HTME 3AEBB 1XCTL 4RNAA 1MI0A 1EM7A 1NYQA 2G1EA 5TSSA 2INNE 3ETRA 3R8BA 1F0ZA 2LHDA 2DBYA 1AYFA 3P4PB 2KAJA 4JWSC 4YT0B 1M4VA 2WXHA 1VJKA 1N63A 1XO3A 1VRAB 2Y5CA 2WQYB 1YJJA 4A90A 3SFEB 3BVZA 1XXGA 3ABVB 3GS2A 2NTTA 3NRZA 4YTMB 3KWVA 2RDGA 1P7FA 3BYYB 4ZRPA 4KGTA 3AE9B 4YTNB 1NI3A 1SSNA 2WXNA 3UI3A 2I38A 2VZKB 2K9XA 3AEFB 1PUTA 1D5ZC 1FFUA 3ZYYX 4WAFA 2WXJA 5H92C 4RF1A 3WCQA 1WWTA 5BMHA 1YQ4B 2GRIA 1TY0A 4WURA 1FNVA 1FEHA 1KTKA 1HXYD 2LHEA 1TY2A 1TKYA 2J53A 4HRSA 2FE8A 1T5XD 1E9MA 2WU2B 2W3SA 3AE8B 1FD6A 1VZ6A 3ZGZA 1I4XA 3AECB 3Q8CA 2JZPA 4A55A 4O1NA 1WXQA 1HZ6A 3LB8C 2WXRA 4KKJA 5GXGB 3V3XA 1QOFA 5BMIA 1OFFA 1ET9A 3BK2A 1GAQB 1ESFA 4FXCA 3AE3B 4D2KA 2J42A 1YMHE 1VDVA 3VRBB 1V1PB 4OZBA 2MEKA 1MHXA 3BYTB 3TEXA 2WP9B 1PGBA 2KQ4X 1STEA 1ET6A 5BMGA 4TQ1A 2M19A 1C77A 2QIEB 2LUMA 2BBCA 2MJEA 2MH7A 5EE1A 4MACA 1SBBB 5HHDG 3SR6A 2WU5B 3RFZB 5EE9A 1GPXA 1JWSD 2K22A 4RGNA 3Q8EA 3FAHA 2WDVB 2EELA 3W1SA 4ZOHC 2H88B 2GB1A 1VZ8A 1BXTA 1MVKA 5D3DA 1SF0A 2IGGA 2ONQA 1FMAD 4AS1A 1QOGA 3CIRB 1XLQA 3MP9A 4ITKA 1J7AA 2JX5A 2E6XA 3FC4A 1FXIA 3EA6A 2AQ2B 1ZOYB 4JX1C 5BYRA 1VR9A 4NZLB 2AQ1B 2XNAC 4N58A 4DXGA 2INPE 2MJDA 4LLGM 1UUPA 1E10A 3BIID 1L0YB 5FK9C 1N62A 3B9JA 3IT6B 3H8HA 4WQMA 4PT5A 4DXFA 4J3OD 2L32A 1JRPA 1K51A 2K3UA 3MHZA 5AUIA 3NZ3A 2NTSA 1TS3A 3O13A 1FNUA 3PZ7A 3TSSA 3VRAB 2CU3A 3P4RB 1P7EA 1ZXIA 3BWUD 3W2DA 3P4QB 1EU4A 2PTLA 2RPVA 4KKIA 4RGOS 4XE0A 3T3NA 3HVZA 1C78A 4L23A 4WH4A 4M0WA 2X38A 4TSSA 2BYTA 1ACCA 1XLPA 1C4AA 2ZW1A 1RFKA 2MJ3A 1OQRA 2DYMA 1PGXA 3AE6B 3MC0B 1QF6A 4B0EA 4ARIA 5D7GA 1KF6B 2G9HD 2GI9A 2CJOA 3B2FA 5EE0A 2WXIA 2B76B 1L4DB 1FO4A 3CWIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1A70 A;  3WCQ A;  3AEA B;  3LXF A;  1WWT A;  2BS4 B;  3B2G A;  1YQ4 B;  1IUE A;  4US8 A;  1CJE A;  1CZP A;  2L83 A;  3HUI A;  3HRD D;  5G5H A;  1L5P A;  5EE3 A;  2Q5W D;  2E3T A;  1NEN B;  3AED B;  2BS2 B;  3SFD B;  2K5P A;  3AEG B;  1TKY A;  4HRS A;  1L6V A;  1SIJ A;  3DWG C;  1WGK A;  1E9M A;  2WU2 B;  3PO0 A;  2W3S A;  1N60 A;  1J7C A;  3W5V B;  3AE8 B;  2JQR B;  4WWM A;  1RM6 C;  3AEC B;  3AEE B;  3AN1 A;  2PVG C;  1QOA A;  1WXQ A;  4N6E B;  3LB8 C;  5GXG B;  4ZHO A;  1JQ4 A;  2N0S B;  4YSX B;  2WS3 B;  1QOF A;  2PIA A;  3NVV A;  1OFF A;  1GAQ B;  1L6U A;  2BT6 A;  2W3R A;  1KRH A;  4YSY B;  3AE2 B;  3AM9 A;  3AE3 B;  1UWM A;  3NS1 A;  4FXC A;  1RWS A;  1DOY A;  1OQQ A;  1XLO A;  3VR8 B;  3VRB B;  1VDV A;  1I7H A;  4P6V F;  4LTU A;  2WDQ B;  1RYJ A;  3RPF C;  1N61 A;  1L0V B;  4KX6 B;  1N5W A;  1R7S A;  2WP9 B;  2L52 A;  1JWB D;  2W54 A;  1J7B A;  2KMM A;  1NVI D;  2DWQ A;  1YQ3 B;  2M19 A;  1V97 A;  1WRI A;  2PKO A;  4IDI A;  2QIE B;  2MJE A;  5AUK A;  2MH7 A;  5EE1 A;  1FM0 D;  3AH7 A;  3L4P A;  3SR6 A;  4US9 A;  1JWA D;  1E7P B;  3AMZ A;  1QLB B;  2WU5 B;  5EE9 A;  1GPX A;  4USA A;  3AE4 B;  3AV8 A;  1PDX A;  1QT9 A;  1YJI A;  2K22 A;  3P1M A;  4C7Z A;  1SB3 C;  2ACZ B;  3DWM A;  5C2T B;  5MPO A;  3VR9 B;  4YTP B;  3FAH A;  2WDV B;  4A9A A;  1FRD A;  1KFY B;  4ZOH C;  1JW9 D;  1JAL A;  2H88 B;  1JRO A;  2LEK A;  1NYR A;  1SF0 A;  1VLB A;  1FMA D;  5G5G A;  4C7Y A;  4C80 A;  2BS3 B;  1QOG A;  1TYG B;  1PFD A;  1TJE A;  1XLQ A;  3CIR B;  1J7A A;  4ITK A;  4ZHP A;  2JX5 A;  1N5X A;  1FFV A;  2W55 A;  3FC4 A;  1TKE A;  3NVZ A;  2HTM E;  2PVO D;  2WDR B;  3AEB B;  1FXI A;  1NYQ A;  1ZOY B;  2CJN A;  2G1E A;  3P4S B;  4JX1 C;  4YXD B;  3ETR A;  2FBW B;  1ZP0 B;  5C3J B;  4JWU C;  1F0Z A;  4N58 A;  3KWL A;  2MJD A;  3AE7 B;  1E0Z A;  1E10 A;  3BII D;  1T3Q A;  2DBY A;  1AYF A;  1N62 A;  3B9J A;  2KAJ A;  3P4P B;  4JWS C;  4WQM A;  4YT0 B;  1FIQ A;  3NVW A;  1XLN A;  1JRP A;  1VJK A;  1N63 A;  1XO3 A;  2Y5C A;  1QOB A;  2WQY B;  1YJJ A;  5AUI A;  1NEK B;  3SFE B;  1V8C A;  5H8Y E;  3VRA B;  2CU3 A;  3P4R B;  1ZXI A;  3AB5 A;  4HRO A;  3P4Q B;  3ABV B;  3AE1 B;  3NRZ A;  3EUB 2;  3AE5 B;  4YTM B;  2EKI A;  1ROE A;  2OHF A;  2QJL A;  1E6E B;  2WLB A;  3HVZ A;  1DOX A;  3W5U B;  1TKG A;  2H89 B;  1EWY C;  3AE9 B;  1XLP A;  1NI3 A;  2M56 B;  4YTN B;  4YSZ B;  1ZUD 2;  1RFK A;  2MJ3 A;  1DOI A;  1FXA A;  1OQR A;  1WYG A;  1DGJ A;  3AE6 B;  4N59 A;  1QF6 A;  1KF6 B;  2CJO A;  3B2F A;  2K9X A;  5EE0 A;  3W9C B;  2AX5 A;  2B76 B;  1AWD A;  1PUT A;  3AEF B;  3P63 A;  1B9R A;  1FFU A;  3ZYY X;  1FRR A;  5H92 C;  3NVY A;  1FO4 A;  3CWI A; 
#chains in the Genus database with same CATH topology
 4JMU A;  2JYE A;  2O2V B;  3EFU A;  4REZ A;  3WAN A;  1U4A A;  3C0R B;  5KG6 A;  5JHB A;  1F2R I;  5KFE A;  7ICH A;  1L5P A;  1NEN B;  4RH6 A;  3RJG A;  4KLU A;  5IKC M;  1ZPS A;  1XF5 L;  4CNQ A;  1T94 A;  1Y8R C;  3TAD A;  4LDT B;  5AI4 A;  1D6E C;  5E6N A;  3U30 A;  1EU3 A;  4HEA 1;  2NVU I;  2MRL A;  1QOA A;  5KTQ A;  2KVS A;  4RQ7 A;  4QZG A;  4ED6 A;  4ANX A;  4EYI B;  2N7J A;  4ECU A;  2KIC A;  5KT3 A;  3RRH A;  1YJ1 A;  5BPC A;  2PLP A;  4LK0 M;  5D49 A;  4O3N A;  1XLO A;  3M63 B;  3W1Y A;  2DKZ A;  3M9O B;  3KHL A;  1CQV A;  3UIP B;  1NK4 A;  4DWF A;  1N61 A;  2E5S A;  2A5U A;  3I5J C;  3PX6 A;  1XEE A;  4M00 A;  5AKK A;  4ED2 A;  3AU4 A;  4MGZ E;  2ZJA A;  2AGQ A;  2KMM A;  2L1A A;  2N9L A;  4NJ7 A;  2JEG A;  4ICU A;  1WRI A;  2C28 A;  5KFF A;  3ML9 A;  4BUG A;  1QQ5 A;  4LDT D;  2EZY A;  2IO1 B;  3AH7 A;  3VUY A;  3U26 A;  3IT4 B;  1T0Q C;  1UBQ A;  3AE4 B;  4LNO A;  1HQR D;  1PDX A;  1V80 A;  2I2Y A;  4IOI E;  2WF6 A;  4RQN A;  1SB3 C;  4C7Z A;  2UVV A;  5ALI A;  4LJX A;  4RPX A;  2W7O A;  3KKA C;  4DCC A;  3RJJ A;  2F8L A;  2JXT A;  3RZW C;  2RR9 A;  4RF0 A;  3LVW A;  2FUH B;  3H4D A;  4RQ8 A;  4IRD A;  1C76 A;  3L3F X;  3IN5 A;  4EE2 A;  2IND C;  3RN9 C;  5I4D A;  3VFK A;  2KN5 A;  3TMP B;  3ML8 A;  5G5G A;  5AKZ A;  3WKE A;  4P0P B;  1TYG B;  2KVR A;  3CRX A;  2XC9 A;  1N5X A;  2KDE B;  3OJU A;  1DK3 A;  5L1K A;  2JRI B;  4YXD B;  1RDF A;  2WX1 A;  5C23 A;  2KDF B;  2FBW B;  2KKP A;  3DHH C;  4QZ8 A;  3N20 C;  4GLX A;  2C7N B;  4CGZ A;  4JWU C;  4FFD A;  2SEB D;  4OJ5 A;  5HP4 A;  3UQ2 A;  3ZRF A;  3IHQ B;  4I27 A;  3MC9 A;  3Q8Q B;  1V9J A;  3RD2 A;  3PHW B;  5AM0 A;  4X5V A;  2MBH A;  4A20 A;  1RFA A;  3NVW A;  4DBG A;  3HP6 A;  4F5O A;  2GLS A;  4MSM B;  2KTQ A;  2NRV A;  1QOB A;  4BFR A;  8ICQ A;  3KVF B;  3RNB C;  2ASQ A;  2L76 A;  3C8Y A;  3PLU A;  4W9C A;  3TAP A;  4YMM A;  3G6X A;  2SAK A;  3SEB A;  5BOM A;  3ONS A;  1YN4 A;  3VUW A;  4RPZ A;  9ICK A;  2H89 B;  3MGV A;  2LVQ A;  1FXA A;  4RQ2 A;  2KJ6 A;  4M9L A;  4S0R A;  1H8C A;  3J9C A;  4CF5 A;  3QK0 A;  3N7P D;  4XDC A;  4FUL A;  5KHO A;  3KBB A;  4ARC A;  4FZL A;  5GMV A;  8ICN A;  2YY6 A;  2IO0 B;  2NRZ A;  1V38 A;  2KN4 A;  3RH6 A;  2QSD A;  2ZIU B;  1JX4 A;  4K3C A;  4US8 A;  3VCB A;  1T6B X;  4TQS A;  2NYV A;  3RRG A;  2DAJ A;  2PE9 A;  5CR0 A;  3KLS X;  4L1B A;  4NLC A;  4OHJ A;  2QEJ C;  2Z59 B;  2J0J A;  2YMM A;  3L08 A;  2HBJ A;  4P4P A;  3PO0 A;  1U45 A;  1N60 A;  1ENF A;  1HE8 A;  2V3P A;  3QJZ A;  4RQ1 A;  3PRM B;  3ISB A;  4QZC A;  1S9F A;  4HPL B;  3T5J A;  2E8O A;  2EQY A;  4KLS A;  3NUH B;  4NPN A;  4YG2 A;  3ZDB A;  1D4B A;  2KDM A;  3HJE A;  3TUO A;  2L7R A;  1QH9 A;  5J2D A;  2BKF A;  3JW0 X;  5JZE B;  2D07 B;  1R4M I;  4P6V F;  4ECS A;  3MDA A;  4DOC A;  7ICT A;  3ZVV A;  1R7S A;  1LKY A;  5HML A;  3MGH A;  2KHV A;  4MFA A;  1OEY A;  2WXO A;  4ED1 A;  2MU2 A;  2WF7 A;  1E8Z A;  4PZO A;  2NMQ A;  3A9J B;  4KVG B;  4PJ0 U;  4AYB C;  1FM0 D;  2ZIX B;  2MSE D;  3Q6B A;  3NTU A;  4UBB A;  3HIL A;  3JSV A;  4Q45 A;  4GC6 A;  3D2N A;  1U49 A;  3VTV A;  1NK0 A;  3QXG A;  4MEL A;  4F4K A;  2BDP A;  3VH4 B;  2XVT A;  3T3O A;  5ALF A;  3KQ4 A;  1L8O A;  3H1U A;  4OCZ A;  3PW0 A;  4U6P A;  1CMX B;  1ZQE A;  2WXG A;  3PRZ A;  3AUL A;  2EH9 A;  3LWM A;  2KN7 A;  9ICM A;  4M8N A;  1VLB A;  4C0Z A;  3GE8 C;  4PHD A;  1DRG A;  1OUQ A;  3Q8F A;  2HVI A;  1FFV A;  3V7J A;  3IRU A;  2FLL A;  1OTR B;  3IBE A;  1ZYQ A;  1WR6 E;  3DVN U;  8ICP A;  2MA9 B;  2K8B A;  5C3J B;  5E79 U;  4IS7 A;  3PGE A;  4PHP A;  3WU2 U;  1K5O A;  7ICV A;  3AXC A;  1HA5 A;  1TS4 A;  1YN3 A;  2DYB A;  3MJW A;  2WX0 A;  2NO5 A;  3MFH A;  1RXW A;  4O0I A;  3FIL A;  4DLE A;  2DX5 B;  2BCU A;  3O0F A;  3AU2 A;  1ZET A;  2YQE A;  1T3N A;  1ZJM A;  2FCS A;  3BVG A;  4RMA A;  3BK1 A;  7ICF A;  4JWN A;  5T8I A;  1HUZ A;  3I28 A;  3ZQ4 A;  2JR5 A;  3VXW A;  4BWJ A;  2ZTC A;  2O2V A;  2EZX A;  2AWT A;  3H7P A;  1RYR A;  4OJO A;  4PS3 A;  1X6J A;  5J2K A;  4P2H A;  2DEN B;  2R2Q A;  2TSS A;  1TKG A;  3QEB Z;  4YSZ B;  2M56 B;  1DOI A;  3DEE A;  2A19 A;  2LGI A;  1RPL A;  4M01 A;  1QTM A;  5J0U A;  2G5H B;  3H40 A;  2KAC A;  3W9C B;  5J0P A;  1A6S A;  4PL1 A;  1PQS A;  9ICV A;  3EYZ A;  3JPN A;  2K1F A;  1YIW A;  3RJI A;  1ARO P;  2L5Y A;  1VJ5 A;  2ZUB A;  1CZP A;  4R64 A;  3HRD D;  2ZIV B;  4J9L A;  1WXV A;  4AQ7 A;  1Z1V A;  1F1H A;  4MH8 A;  5ALS A;  2K5P A;  1O08 A;  1YOV B;  3K9O B;  1WX7 A;  2HI0 A;  2D3B A;  3SU8 X;  1YZ6 A;  1K50 A;  5KFT A;  1F2R C;  3C21 A;  8ICJ A;  2ZW0 A;  2BYF A;  3KH0 A;  1BPE A;  3GDX A;  5HG2 A;  3QX1 A;  4IKG A;  2WXK A;  2AJQ A;  3L54 A;  4ECV A;  3A0H U;  2MUT A;  2LAS A;  4DFD A;  1LVH A;  4DL7 A;  2ZG6 A;  9ICW A;  1IGC A;  1KRH A;  5JHA A;  5KL1 B;  3RF9 A;  3IV6 A;  4ECW A;  2UVW A;  2K0P A;  2Z0E B;  4QZI A;  1I7H A;  5DB9 A;  3QE9 Y;  5D6J B;  5DGB A;  2WDQ B;  3Q8A A;  4LTU A;  2L05 A;  4KN7 A;  4YXM A;  4FAD A;  1JWB D;  2YEP F;  4F72 A;  3MJ5 A;  1SZH A;  1TAQ A;  1NVI D;  2K8C B;  2RQ5 A;  4GXB A;  4KIK A;  8ICK A;  4UAT A;  2PKO A;  4ZDV A;  2M8S A;  1L7N A;  1U4B A;  2OH2 A;  5AM1 A;  4RGT A;  1CI4 A;  4ICV A;  2MCN B;  2IDY A;  3L4P A;  7ICP A;  2NPT A;  2UWQ A;  3N1Y C;  7ICI A;  1COK A;  2HJ8 A;  2NRW A;  4HAI A;  4EBD A;  4K4H A;  2PMV A;  2NPT B;  3HIZ A;  4DHZ B;  3TEZ A;  5III A;  5JU5 A;  1KFY B;  2XIC A;  1SV0 A;  4KTQ A;  3GU3 A;  2JH1 A;  2B3A A;  1IBX A;  4M47 A;  4FZN A;  2LEK A;  1ZQG A;  1JML A;  4MJS A;  1YX5 B;  1WXM A;  4GIB A;  4ED0 A;  1NKE A;  3RB4 A;  1UPH A;  4Y2Y A;  4RNA A;  4X57 B;  3ZDA A;  1MI0 A;  1NYQ A;  1ZD2 P;  5TSS A;  2INN E;  1ZQI A;  1Z5S B;  4WJN A;  4J9K A;  1EF1 A;  4IUM B;  5AM5 A;  2XI9 A;  2LHD A;  4CF4 A;  3N1X C;  1V5T A;  2FMP A;  2DL0 A;  4YQW A;  4G3X B;  3BZC A;  3MHS D;  1YJJ A;  2BQR A;  4PPX A;  2V9H A;  2G4D B;  3H4B A;  3BVZ A;  1KW4 A;  4RQ0 A;  7ICM A;  1IG6 A;  3ZNZ B;  1UH6 A;  3VUX A;  2NTT A;  1T4G A;  3AU5 A;  3F5E A;  4KGT A;  2PFP A;  4YCX A;  4EZJ A;  1NZP A;  2ODG A;  3P2B A;  3PO5 A;  3AE9 B;  1NK7 A;  3PSF A;  3TBL D;  2AL6 A;  3UI3 A;  2F1J A;  2I38 A;  2D3G A;  4YN4 A;  4UB5 A;  2VZK B;  2K9X A;  1PUT A;  1WXA A;  2MW5 A;  1D5Z C;  4E74 A;  1V9P A;  2WXJ A;  2C2R A;  3PX0 A;  2R8G A;  3ZDM C;  2GRI A;  2KX0 A;  5A0L A;  1AQ6 A;  5KT7 A;  3GOE A;  1FEH A;  3C28 A;  3H7I A;  3A0B U;  1HUO A;  4DLG A;  2DF4 B;  2N9P C;  1HJP A;  3AE8 B;  3E0F A;  8ICF A;  3TAQ A;  4XQ8 A;  5ALV A;  4RPY A;  4QZA A;  2JZP A;  3PS6 A;  4O1N A;  4PYU A;  1WXQ A;  1MN8 A;  4GDK A;  1QOF A;  1ET9 A;  2I1J A;  3M9M B;  5DBC A;  1ZQN A;  1KOT A;  2JPH A;  5KFZ A;  3WKB A;  2XCA A;  3A9J A;  4FXC A;  4D2K A;  5ALY A;  8ICA A;  3QA8 A;  2QKQ A;  1X40 A;  4UW9 A;  4XUS A;  3PZD A;  3UIN B;  3R9K A;  4DFP A;  1GJZ A;  4M0W B;  1I42 A;  4M2Y A;  5KFX A;  4ANV A;  1DK2 A;  1E8Y A;  3BYT B;  4NJ8 A;  2RDJ A;  2FPL A;  4DHZ E;  4QWE A;  4F4W A;  4ZRK A;  7ICE A;  1PGB A;  2MLB A;  5LLI A;  2KQ4 X;  3ORY A;  2DZM A;  3R3M A;  2M19 A;  4RQ5 A;  4W9F A;  2BBC A;  5EE1 A;  3PVL A;  5HHD G;  2G4S A;  3SR6 A;  5L1M A;  5KG3 A;  3RFZ B;  5KFH A;  3ZNG C;  1IV8 A;  5DB8 A;  2ASJ A;  5AIA A;  1ISN A;  1ZRM A;  1WGD A;  4BKT A;  5J0R A;  1S0V A;  4UB6 U;  2H3F A;  5DB6 A;  4WJP A;  5CEH A;  1WGH A;  2NBW B;  4ZOH C;  2HMX A;  1BXT A;  2NO4 A;  2ONQ A;  3SD7 A;  3SI8 A;  1J7A A;  2Z7J A;  2E1F A;  4C4R A;  2R2O A;  1X6I A;  4JB3 A;  2VAN A;  4P4M A;  1K8R B;  4JX1 C;  3QCA A;  1XSN A;  4B9L A;  2LPE A;  4DSF A;  1L0Y B;  4WWP A;  3D6J A;  8ICM A;  2OM6 A;  8ICB A;  1KSP A;  5ALO A;  3UQA A;  2E1E A;  4MH0 E;  4KLH A;  5DDY A;  3FKY A;  5KFW A;  2NTS A;  1TS3 A;  1T7P A;  3OHA A;  2KOB A;  4XRH A;  2I6X A;  1NDD A;  4XE0 A;  3EPG A;  1C78 A;  2WHI A;  1WGY A;  2GH1 A;  1NK6 A;  2ZIV A;  4TSS A;  3RZF A;  3MR2 A;  1ACC A;  3WK9 A;  2MJ3 A;  2NRX A;  2PI4 A;  3R66 C;  3AE6 B;  3MC0 B;  3DBH B;  4B0E A;  4ARI A;  1QF6 A;  2GI9 A;  3B2F A;  1EO6 A;  5J2I A;  1BPX A;  2B76 B;  3ZRC A;  4RQ6 A;  2GOL A;  4MHV A;  3CWI A;  5D46 A;  1A70 A;  2RPQ A;  1M94 A;  3SHQ A;  2G0A A;  3UPQ A;  2VA2 A;  3Q14 C;  3X23 A;  2XEW A;  3AI5 A;  1PK1 A;  5B66 U;  5F9N A;  2BS2 B;  1XO0 A;  5HR7 A;  2QB0 A;  2LYA A;  1LO5 D;  1Y56 A;  2LVO A;  3T9L A;  1SIJ A;  2RP5 A;  3DWG C;  3M3J A;  4M6W A;  2K25 A;  4RGM A;  5J2J A;  1R4N I;  4EZ6 A;  2G06 A;  5DGA A;  4F5R A;  3KZX A;  2MX2 A;  4E71 A;  2K39 A;  5IAA C;  2KHQ A;  4R63 A;  2R61 A;  4DQQ A;  1QKZ A;  5DPR A;  4FS1 A;  5L1L A;  2PIA A;  4DDI D;  4XWT A;  1WCL A;  4KLM A;  3CMM B;  3AE2 B;  5KT4 A;  3URY A;  4HPM B;  5F3X B;  5AIC A;  3U52 E;  3GP7 A;  4RUC A;  3RPF C;  1MSW D;  4PH5 A;  2W54 A;  1C7Y A;  1R4M B;  4I2E A;  2LXA A;  2IOF A;  3CP8 A;  5J0T A;  2IA6 A;  3MDC A;  2EDU A;  1ZQB A;  2LRU A;  5CRX A;  3RNC C;  4CCH A;  2ICI A;  2RD0 A;  2G08 A;  1XSP A;  4BDP A;  4ED8 A;  3PNC A;  5IIM A;  4YD1 A;  4RFB A;  1E7P B;  3DV9 A;  1C20 A;  2Y5B B;  3M95 A;  4DFJ A;  1CK1 A;  1Q8K A;  8ICW A;  2I1K A;  2KZ3 A;  3DHI C;  2KJR A;  3PML A;  7ICR A;  5DBA A;  1D8L A;  3EZ5 A;  5CX3 A;  4I2A A;  1K53 A;  4GMV A;  2M0A A;  4DL6 A;  5G55 A;  1B22 A;  4QWD A;  3RJF A;  2WGS A;  3LDA A;  2P35 A;  3P4S B;  4A6Q A;  2HOI A;  1KL9 A;  1L3U A;  3RTV A;  4JUZ A;  1QSL A;  2JYT A;  1B4F A;  4XZ4 A;  3AE7 B;  1L7M A;  2FIF A;  2ISO A;  2MBO A;  1LKY B;  9ICU A;  4EZ9 A;  3OWE B;  5AKE A;  2KK0 A;  2F2A B;  1MQ2 A;  2KVZ A;  2N1R A;  4AJW A;  1P9D U;  4Q8E A;  3BZD B;  4S17 A;  4EKU A;  4EOY A;  1QQR A;  2XY5 A;  2Q0Z X;  3PW2 A;  4NAW B;  3M7D A;  3AE5 B;  2W9B A;  2OHF A;  2EKI A;  4B0M A;  1A76 A;  3TL5 A;  2DZI A;  1DOX A;  3CW2 C;  1JWU D;  4K7U A;  4QWB A;  1WYG A;  1ZD3 A;  1ZQ1 C;  2VJ5 A;  3E56 A;  4TUU A;  1Q3U A;  4NAM A;  3V6K A;  5FR6 A;  3SFD B;  4YTN B;  1FRR A;  3LJ3 A;  4HJG E;  3RJH A;  2CU1 A;  4PHA A;  3U4E G;  3B2G A;  2Y1I A;  1CJE A;  4ELU A;  1ZDX A;  2FMQ A;  3N7S C;  4MM3 A;  3TAR A;  1J2N A;  1SKW A;  3GZN B;  2QAR B;  3BZK A;  1WGK A;  2R18 A;  2K8A A;  1GUA B;  5TR5 A;  2BGF A;  2LGS A;  4F4Y A;  3GFK B;  2YML A;  2HOF A;  9ICF A;  3FIL B;  3ISD A;  2V3N A;  3HW8 A;  1XNS A;  4MFC A;  2D2Q A;  3SV3 A;  3AL0 B;  1JCK B;  1NJY A;  1SEB D;  4MT5 A;  5KFO A;  2BCQ A;  4EX7 A;  5LNK 1;  3QU5 A;  3ZXV A;  2NS5 A;  4YVZ A;  4TKN A;  4KSK C;  2QB1 A;  2XGP A;  2K60 A;  3PSP A;  1OQQ A;  3WAL A;  3H7P B;  2CHW A;  1QSS A;  1WIA A;  3NZS A;  3IFW B;  3EW9 A;  1A77 A;  5AIB A;  1DYQ A;  2J7Q B;  3UIO B;  1KRP A;  4URK A;  3V60 A;  2FCN A;  1WWV A;  2L00 B;  2W82 A;  3OJ4 B;  4W9J A;  1PVR A;  1J97 A;  3QEA Z;  3APF A;  1YQ3 B;  1ZQR A;  2DHZ A;  4IDI A;  2OED A;  1QSY A;  3X0W A;  1L8L A;  1SE4 A;  1O03 A;  3VVW B;  3L16 A;  2AEH A;  5IA7 A;  2B21 A;  4F2R A;  3K9P B;  5HMM A;  1YQB A;  1WX8 A;  4RU9 A;  3M6Z A;  3AEV A;  2WTF A;  4NJ6 A;  5IP4 D;  1UCV A;  2R8H A;  2F44 A;  3RJE A;  3F2B A;  4TUQ A;  1BML C;  1WY8 A;  2GBK A;  1FRD A;  2LUE A;  4ZYS A;  3V05 A;  4GDL A;  1HTQ A;  4NLN A;  3TFR A;  1MFW A;  3K75 D;  2HDE A;  4JLC A;  5BO4 B;  3BS5 A;  2RLT A;  4UB3 A;  1KFT A;  4IWO A;  4W9G A;  5AKL A;  4QIW C;  1LXD A;  1Q0W B;  2MUT B;  1L6N A;  4YR3 A;  2KYW A;  5ALN A;  4IM2 A;  3B1L X;  2ZPN A;  4DWI A;  2XID A;  4C8L A;  2JH7 A;  4JIO U;  1UNS A;  1T3Q A;  2EAM A;  2RDI A;  4OD0 A;  1PVP A;  2R8K A;  4K4G A;  2JRZ A;  1RXV A;  1YX6 B;  3IAS 1;  1NNL A;  3WK6 A;  3R2I A;  4Z6C A;  4AYB F;  1S76 D;  1WJN A;  1CEZ A;  2ZXI A;  2FLN A;  2M1M A;  3C2M A;  4KIK B;  4W9H A;  4I2H A;  1K1Q A;  3KYD D;  2KFN A;  2N7D A;  3EUB 2;  1V1O A;  2BQ3 A;  2Z8L A;  1E6E B;  1Z00 B;  3M62 B;  1BPD A;  4BAX A;  4O3Q A;  1IIP A;  2KIV A;  3ZJT A;  4ED3 A;  1Z2M A;  2JV3 A;  2VA3 A;  4O5E A;  2ATL A;  3PT2 B;  1DGJ A;  3QU4 A;  2RHF A;  5AM4 A;  1YNT E;  3Q8B A;  4DF4 A;  2ESE A;  4BXO B;  3QHT A;  2W11 A;  8ICC A;  4K7W A;  1B9R A;  3E9S A;  2KJ5 A;  2WF8 A;  3FDS A;  1ZDV A;  1IBX B;  1BPY A;  2FLP A;  1TS2 A;  3NVY A;  1HZ5 A;  1WXS A;  2Y9T A;  3AEA B;  2EMT A;  3QQ8 B;  4UAW A;  1JWM D;  4Y2U A;  1WR1 A;  4MJS B;  1SIF A;  4JPS A;  2L83 A;  3HUI A;  5T14 A;  3SZ2 A;  2Q5W D;  4W9E A;  2XK5 B;  3LDZ E;  3AEG B;  9ICO A;  2F8K A;  4ECY A;  3Q8L A;  2JZ3 B;  5AZG A;  2OCE A;  5EWE A;  3EEC A;  4XC2 A;  1J7C A;  3QYP A;  2KOX A;  1FCC C;  5J2R A;  3Q3M C;  2PVG C;  4GOC A;  3UXP A;  1WGG A;  5KFR A;  4TQ0 A;  2F1H A;  2N9K A;  5DLF A;  3IXS A;  1D9F A;  4I29 A;  2ZEQ A;  2ZNV B;  3PMN A;  1D8Y A;  4GFJ A;  2KFK A;  4DK5 A;  5E6O A;  3AM9 A;  1UWM A;  3GV5 B;  1D5M C;  3RI7 C;  1IPG A;  3IHP C;  5AI0 A;  1KJT A;  3IG8 A;  1YN5 A;  4H2A A;  5J8Y A;  3A1Q A;  5DPT A;  3PVX A;  2L52 A;  5ALT A;  2JXJ A;  1VZ7 A;  1WI0 A;  1WGR A;  4LJP B;  1QQ6 A;  3PSI A;  4KLL A;  2FNJ B;  2PKE A;  2WXQ A;  5DQH A;  4YL8 A;  2LMR A;  1GOZ A;  2CKH B;  3PZP A;  4GN1 A;  4YD2 A;  3WIM A;  4BBN F;  1L3T A;  2WFA A;  3PRP B;  1S3S G;  5MPO A;  1PVQ A;  1BNP A;  4YTP B;  5IO9 A;  5KT6 A;  4NY0 A;  3Q8R B;  3Q8M A;  3T8M A;  2F77 X;  2WXP A;  1JW9 D;  2BTE A;  1TS5 A;  4RUA A;  3KD3 A;  3GIJ A;  1NYR A;  2K4H A;  1A0P A;  5ALD A;  2P6U A;  5ALW A;  3GV7 B;  2QHO A;  4GDK B;  4L2Y A;  1TKE A;  2HTM E;  8ICH A;  4DOA A;  2G1E A;  4KLE A;  4DL2 A;  4Y2P A;  3ZNH B;  3R8B A;  4NAW A;  2MSN A;  4EBC A;  3HPO A;  3C2K A;  4G0N B;  3DBL I;  8ICI A;  2DBY A;  1C3T A;  1J0G A;  1AYF A;  1ZJN A;  7ICJ A;  1P3Q U;  1M4V A;  2CN1 A;  2HHT A;  3PTF C;  2AL3 A;  1KEJ A;  5KFS A;  3C1Y A;  1VRA B;  2Y5C A;  2AGO A;  4A90 A;  2MBE A;  2JXX A;  4Z6E A;  4F91 B;  4FZM A;  5EWG A;  2Z0D B;  5KT5 A;  3SV4 A;  3GS2 A;  3HM3 A;  3NRZ A;  1E90 A;  2R8J A;  2CHX A;  2H3Z A;  3PPA A;  1NBF C;  4ZRP A;  3JPP A;  2FID A;  4O9M A;  4Y2R A;  2W8K A;  4QJF B;  4ECX A;  2CXY A;  4DSJ A;  7ICG A;  2MQJ A;  2WXN A;  4J9M A;  2D8C A;  3KHR A;  3RCZ A;  2QAR A;  5HKH A;  2BHN A;  3TFS A;  4DO9 A;  3WKA A;  1WM3 A;  4J6I A;  3WK5 A;  4QZE A;  4WQO B;  4EZK A;  3I63 C;  5IIJ A;  4WAF A;  5H92 C;  5J0W A;  2CR5 A;  4RF1 A;  5DBB A;  1UT8 A;  3FM9 A;  2V4Q A;  2E8N A;  3DDH A;  4RM8 A;  1MA7 A;  2WF9 A;  1FNV A;  4C8N A;  2EMS A;  1KLN A;  4JL9 A;  3S2A A;  4F2S A;  2BWE S;  4F1S A;  1PUZ A;  4KMU A;  3LK9 A;  4CE6 A;  2W3S A;  3ZGZ A;  9ICC A;  4J9N A;  2EZZ A;  3VC8 A;  3Q8C A;  4OVU A;  1HZ6 A;  5CP2 A;  3AQF A;  1OEY J;  2UYZ B;  1XU4 A;  5KFQ A;  1GAQ B;  5D4B A;  1ESF A;  5L1J A;  1SGH A;  8ICZ A;  4K7S A;  4OO1 J;  5JRT A;  4XGA B;  3WKC A;  9ICP A;  3GIM A;  4MGK E;  1OGW A;  1B0X A;  1IYF A;  1V1P B;  2MEK A;  2LI5 A;  2D3D A;  1SV4 A;  4I2D A;  4QW9 A;  3AUO A;  1V6E A;  3V6J A;  4UB1 A;  1J19 A;  1N6Z A;  2CPR A;  2BF8 B;  1STE A;  1A5R A;  1TZ1 A;  3APD A;  4Y2Q A;  2K4P A;  4TQ1 A;  3TI0 A;  3D2S A;  2MBB B;  4CF3 A;  2LUM A;  1DXS A;  1NJX A;  2PPH A;  4IQT A;  4FJZ A;  2LKY A;  2ZJ5 A;  2UVU A;  1GPX A;  3N28 A;  2PXI A;  3W1S C;  1JWS D;  2K22 A;  2HE7 A;  1PK1 B;  3CYM A;  2LM4 A;  5AZH A;  2QB0 B;  4FLH A;  4M6W B;  5EDS A;  1ZQD A;  1HEK A;  4A8E A;  4RNO A;  2EEL A;  5DQG A;  4HCP B;  1ZD5 A;  8ICO A;  4Y2X A;  5DG7 A;  2G45 B;  3VHT C;  1ZQY A;  4NL9 A;  4AS1 A;  4DQI A;  4HYK A;  1K1S A;  1XLQ A;  3CIR B;  3K1R B;  3BQ1 A;  4I6L B;  5CTR C;  1JUD A;  2JX5 A;  3VTW A;  3EFC A;  2ZTD A;  3FC4 A;  3N4M B;  1MJD A;  2HJ1 A;  4EEW A;  1FXI A;  1H4R A;  2KG5 A;  1ZOY B;  5BYR A;  2BCS A;  5D2M B;  2BR0 A;  1MG4 A;  5KFC A;  3ALB A;  2Y0S C;  2XNA C;  2VA8 A;  3BJY A;  4N58 A;  2INP E;  2HHQ A;  4LNI A;  4LLG M;  8ICG A;  4O5C A;  3WK4 A;  1Z00 A;  1WJ4 A;  5J2E A;  2JF5 A;  2KMA A;  1E10 A;  3B9J A;  4KX3 A;  9ICA A;  3B08 A;  4DXF A;  2DKX A;  3OJ3 A;  3UF8 A;  4J3O D;  5KG5 A;  1NZB A;  3K4G A;  8ICS A;  3H8J A;  1WM2 A;  2K3U A;  3MHZ A;  2HVH A;  7ICU A;  4BXO A;  3O65 B;  3O13 A;  4P1B C;  3TSS A;  3VRA B;  3SAF A;  2CU3 A;  2HTH A;  3MR5 A;  1EU4 A;  4KLF A;  1Z1B A;  3RR8 A;  4KKI A;  4RGO S;  4LCD E;  4FA6 A;  4EZL A;  2JRH A;  3BQ2 A;  2CHZ A;  3DOW A;  3HVZ A;  4L23 A;  5LXH A;  1JRU A;  2YB1 A;  2BYT A;  2XK5 A;  1XLP A;  1C4A A;  1KKX A;  3BIN A;  1OQR A;  1BGX T;  2G07 A;  3A9K B;  5J18 A;  2G9H D;  2KZR A;  4KLT A;  2CJO A;  3NS8 A;  3QU9 A;  4MDK E;  2ZUD A;  2YLM A;  2KC1 A;  4DOB A;  3OTQ A;  5J0Y A;  4JV0 A;  1TV9 A;  4F5Q A;  3APC A;  2ZPY A;  3LXF A;  3NOB A;  4HXD A;  3TAD C;  5G5H A;  2DLB A;  5EE3 A;  2KAN A;  3GQC A;  3A33 B;  1X42 A;  1GB1 A;  4KDI C;  3BDP A;  5AKG A;  5IIN A;  1SWW A;  5BOL A;  2LJI A;  3WK8 A;  5AI5 A;  2JQR B;  4HWI B;  2D3C A;  2C7M B;  2HBK A;  5HR6 A;  3DCG A;  3TJP A;  3QNM A;  1PZN A;  5KFU A;  5KG2 A;  1SGG A;  4ZHO A;  4F8R A;  5IN7 A;  3NVV A;  1BUI C;  3U8Z A;  2IY1 B;  1ZOL A;  4PS7 A;  4QNL A;  4RT2 A;  9ICN A;  4HJK A;  3SEI A;  5HI1 A;  5KFM A;  2BB6 A;  2W9B B;  1XWL A;  2D3A A;  4RT3 A;  2XO7 A;  1Q46 A;  2ZVO A;  3MFG A;  4DSE A;  1N5W A;  2YB4 A;  3M9N B;  4UDU C;  4Q8F A;  5JXV A;  3KUC B;  1WE7 A;  2RSU A;  4EFO A;  2V0G A;  3ZDC A;  4KZC A;  1TKD A;  2RDB C;  4FS2 A;  4O3M A;  4MF2 A;  2KWV B;  4Y2J A;  4TUR A;  1JWA D;  4DHJ D;  2E8P A;  5BYQ A;  3QUC A;  1E8X A;  2LGD A;  3Q3F A;  2IJ0 A;  1DGS A;  4MM3 B;  1DOQ A;  2MWS B;  4JK1 A;  5FP0 A;  2IHM A;  5ALR A;  1JMS A;  2PEA A;  2UVR A;  4IRK A;  4MSQ B;  3Q3O C;  1UEL A;  2JGA A;  4NWI A;  1UA1 A;  4NLG A;  4EYH B;  2LBO A;  3ISC A;  3KKA A;  1XCQ L;  1WRD B;  2BS3 B;  2GLE A;  2KMD A;  4ECQ A;  4EEY A;  1ZQT A;  2V4R A;  3H6N A;  2KE7 A;  4B9V A;  4Z6D A;  4QZB A;  4J9O A;  3SYZ A;  2LMC A;  2XCP A;  4NJC A;  4UAV A;  1FCL A;  2M17 A;  1ZP0 B;  2N1V A;  3JPT A;  5AKY A;  3HWT A;  3ZDE A;  9ICS A;  3KWL A;  2KV2 A;  3ALR A;  4A8X C;  4BOS C;  2B6G A;  2KMC A;  4I6P A;  5ALH A;  5JUM A;  1X9S A;  2QIL A;  5F9L A;  4B6J A;  8ICX A;  2MHJ A;  4HLE A;  3RYT A;  1WSP A;  4YXJ A;  4MGY E;  1TVA A;  4HRO A;  1TK5 A;  2KNJ A;  2P66 A;  2JU6 X;  4HKZ E;  3AE1 B;  4AP4 C;  4KLI A;  3DBR I;  3U7Z A;  2K4I A;  5AK4 A;  3C5G A;  2QJL A;  2NBV B;  5J0O A;  4Z6F A;  3C5F A;  4RQ3 A;  1ZQV A;  3C1Z A;  2H3V A;  5AKI A;  1RLF A;  1GC6 A;  4PGY A;  1XT9 B;  1XQQ A;  5EOZ A;  3PST A;  3QAR A;  2NRT A;  2X8X X;  4BKS D;  3F2D A;  4GDL B;  2AX5 A;  1AWD A;  2KZM A;  7ICK A;  4BGD A;  1XO1 A;  2I1Q A;  1FPY A;  1JIH A;  3BS5 B;  4KGS A;  1F52 A;  2KLC A;  3PV8 A;  2IGD A;  2YVC A;  3HT3 A;  5ALQ A;  3H8S A;  4IC7 B;  2PFO A;  4NLB A;  1KLG D;  3V6E B;  1C1Y B;  4HPP A;  3GII A;  2WAQ C;  4FHK A;  3HHM A;  1RM6 C;  1V1P A;  3PV1 A;  4II3 B;  3UMC A;  5KFI A;  1P7D A;  5KFP A;  3H8M A;  3ZDT A;  5DB7 A;  3G6V A;  2BCV A;  2K4E A;  4YSX B;  3B0A A;  2AQ3 B;  1FNW A;  2QLT A;  1TK8 A;  1ZGU B;  4EEL A;  3EWA A;  3TQ1 A;  2R8I A;  1SXT A;  2W9N A;  2OWO A;  1IGD A;  2WXF A;  4YSY B;  3LVV A;  1JN3 A;  4W9K A;  4NQK E;  2I5H A;  5C0Y A;  2KKC A;  3DVG X;  1L0V B;  4KDL B;  1LV5 A;  4FBT A;  3M8S A;  2EAO A;  2KXJ A;  1I4G A;  4C4T A;  4GU2 A;  4QAY A;  4R65 A;  1IM4 A;  4XDD A;  2C60 A;  5CA7 A;  3T3F A;  3HVD A;  5AKJ A;  1B1Z A;  2BKR B;  4JV2 A;  2INC C;  5AUK A;  3I1Y A;  2DQN B;  2KTF A;  4DDG D;  3ZDD A;  2D10 A;  1L0X B;  5J2C A;  8ICT A;  3AV8 A;  3JVZ X;  4DXA B;  2W9C B;  1YJI A;  4B9K A;  5AI6 A;  1GO3 F;  5ALX A;  2PJH A;  3DWM A;  2IPK D;  2YEP B;  4F4Z A;  2WF5 A;  1F77 A;  2LZ6 A;  3QWZ B;  5AKH A;  1L3S A;  1ZXH A;  1JAL A;  3P42 A;  2PMZ C;  4JE3 B;  4FE3 A;  2A1A A;  4ZYN A;  2G5I B;  1L7Y A;  2C2E A;  4O3P A;  4P0Q A;  1TJE A;  4K4I A;  2VRR B;  4NLZ A;  2F1I A;  4ZHP A;  2KFK B;  3NVZ A;  2XBB C;  3F2C A;  3AU6 A;  1NJZ A;  1UGJ A;  1CUK A;  3JYU A;  1K52 A;  5DPS A;  2MP2 A;  4WJQ A;  1Z4O A;  2G3Q B;  4C4S A;  1ZQC A;  2BCR A;  1E0Z A;  2KEY A;  5CB1 A;  3WKD A;  1P0R A;  4ICA A;  4K3B A;  1WX9 A;  2JUO A;  4TUS A;  2ZTE A;  1ZQQ A;  5ALE A;  3A1Q B;  4J9R A;  4P4O A;  5EWF A;  1S10 A;  3I57 A;  1QIL A;  9ICG A;  2JZB B;  3A9K A;  1V8C A;  1SJE D;  2H3I A;  2G09 A;  3AB5 A;  2AGP A;  1WH3 A;  1UWX A;  3N1Z C;  1ZQL A;  3TEY A;  3ZJU A;  2DGZ A;  3PO4 A;  4B9M A;  4TMA B;  1G6J A;  5CWR A;  2WB1 C;  3SDL C;  4PL2 A;  2WLB A;  1SKS A;  3W5U B;  2FPK A;  1UGM A;  3T5K A;  2GO7 A;  4UB2 A;  3V61 A;  2RDH A;  3KZI U;  3VDZ A;  3NZU A;  2LM1 A;  4N59 A;  5J2G A;  4DS4 A;  3V6C B;  2D11 A;  2O6V D;  2WXL A;  4QIW F;  3P63 A;  2MRP A;  3QZ7 A;  4IR1 A;  4NNJ B;  2BPS A;  1KFD A;  5ALL A;  1MQ3 A;  2FCQ A;  2ALZ A;  1XC9 A;  1IUE A;  1TZO A;  1HEZ E;  2KFZ A;  3ZI4 A;  2E3T A;  1V49 A;  3DVN V;  4QWC A;  3AED B;  3KUZ A;  4P1C C;  3H0M B;  3N7R C;  1L3V A;  2ON8 A;  3IAM 1;  2LGX A;  2ZUC A;  2BPF A;  3AN1 A;  4J9P A;  2DNF A;  4O3O A;  1LB2 B;  2N4F A;  4I28 A;  1JQ4 A;  5J2A A;  4PK1 A;  2J4X A;  2F3N A;  4M8M A;  3RNE C;  3R2T A;  2FI1 A;  2BT6 A;  3K1Z A;  4F71 A;  4I2G A;  2XY6 A;  2FAZ A;  2N9X A;  3N30 A;  1KM7 A;  3N9Y C;  3KYC D;  3VTU A;  4KGR A;  4Q2J A;  1RYJ A;  4GLS C;  5J2H A;  2C9W B;  4ZH4 A;  4KX6 B;  1NK8 A;  4BJQ A;  2BQQ A;  3U2S C;  1TAU A;  5DKW A;  4KLD A;  1I4R A;  3NJT A;  2YN4 A;  5AK6 A;  3QC8 B;  2V4I B;  1MC8 A;  3ZD8 A;  4B9N A;  1S97 A;  4N9F 4;  1COO A;  4G3I A;  4YWG G;  2RRD A;  3RT3 B;  2GWS A;  2KNB A;  4US9 A;  4PYZ A;  4USA A;  2QCZ A;  4M0A A;  3UMG A;  5DDM A;  1IXR A;  3GIK A;  4BKS A;  1FXT B;  5DCN A;  1D9D A;  1GC7 A;  1HTO A;  1F0M A;  1N48 A;  2KK8 A;  3NRW A;  8ICR A;  3VR9 B;  1TE2 A;  2W03 A;  2PFN A;  2PI5 A;  2W8L A;  2PW9 A;  2DPI A;  2OJW A;  1SWV A;  2HDO A;  2XGQ A;  4CRX A;  1WMH A;  4XX5 A;  2AU0 A;  4YMO A;  2LFI A;  4C80 A;  4F5N A;  5BYS A;  5ALG A;  2W55 A;  3UXO A;  4C00 A;  4F4X A;  1EM7 A;  2QDF A;  3KHG A;  3DHG C;  3ETR A;  1SXD A;  2H5X A;  3THV A;  2LD9 A;  4E0D A;  4IQW A;  3MFI A;  2AYO B;  3WAP A;  2JZZ A;  2PE6 B;  3P4P B;  1KN5 A;  2KAJ A;  2IOH A;  4CO7 A;  4UQG A;  2WXH A;  4QWA A;  4HVB A;  2FDR A;  3ETL A;  2A4Z A;  2OXO A;  5KFA A;  4K1R B;  4UAU A;  5AKX A;  1ZQO A;  1Z19 A;  2KJ9 A;  1UT5 A;  3VAW A;  1XXG A;  3ABV B;  2EAN A;  2YTU A;  1S0N A;  4ELT A;  3TKA A;  4YTM B;  2YMQ A;  3RH4 A;  2OEH A;  3BYY B;  5J0X A;  3QU7 A;  1NI3 A;  2W04 A;  3TAN A;  4TUP A;  4GXK A;  4W9L A;  5KNI A;  1GNU A;  3T5H A;  4R8U A;  3GIL A;  3TCA A;  2BDU A;  3V62 A;  2KSO B;  3MR6 A;  3AEF B;  1S1Q B;  1FFU A;  4XA5 A;  3LWL A;  1HIW A;  4ECR A;  4HK2 A;  1WWT A;  1YQ4 B;  4M02 A;  4NM2 A;  3QAQ A;  3H8W A;  9ICH A;  1KTK A;  1RYS A;  3L5K A;  1HXY D;  3N97 B;  2ZIW A;  3V7K A;  1TY2 A;  4KN4 A;  3OGU A;  5DG8 A;  2FE8 A;  3PSE B;  4MGI E;  1EF5 A;  2WU2 B;  1ZQX A;  4BWM A;  7ICS A;  4O3S A;  1UA0 A;  1VZ6 A;  1I4X A;  1QQ7 A;  3HKZ C;  3C2L A;  4LNF A;  2JHD A;  1EXN A;  2BWF A;  4F93 B;  2BYE A;  3LB8 C;  4KKJ A;  3H9D A;  4HCN B;  4IL6 U;  5BMI A;  1OFF A;  4DF8 A;  3RFA A;  3V6H A;  3D32 A;  4C8O A;  3L0W B;  3B0Y A;  4MEY A;  2C7H A;  2GBJ A;  1WWU A;  3PR5 B;  2CRX A;  1UBI A;  4EX6 A;  3VH3 B;  4WAA A;  3ZUN A;  2LWP A;  3VRB B;  2A3V A;  4Y2V A;  4J9S A;  4OZB A;  1MHX A;  4M9G A;  3KOO A;  3RB3 A;  2ISP A;  2W9C A;  3UXN A;  3MGI A;  3OG5 A;  2WP9 B;  3UQB A;  2JMG A;  3DPD A;  2VJ4 A;  2KFJ A;  1SE9 A;  4ZRI A;  1ET6 A;  4BZA A;  1YZ7 A;  3HM6 X;  4KIT B;  5KFB A;  3WK7 A;  2QIE B;  4Y2S A;  2MJE A;  4MEM A;  2MH7 A;  4DQP A;  3C23 A;  1ZRN A;  4KX5 A;  1RZT A;  4KLQ A;  2JWZ A;  4JGH B;  5EE9 A;  2AXT U;  3SAG A;  3CNH A;  4WWO A;  2HBM A;  4RGN A;  5HNK A;  3OSP A;  2O6V A;  4JQW C;  5J17 A;  2HD5 B;  1ZQP A;  3Q8E A;  3FAH A;  2RGF A;  3RNF C;  4DL5 A;  3C19 A;  2GB1 A;  1VZ8 A;  5D94 A;  1X2I A;  1QCK A;  1MVK A;  5D3D A;  3J81 j;  2KTR A;  1FMA D;  5AK3 A;  4EEK A;  1KDH A;  4DSL A;  9ICX A;  3DBH I;  2IZV B;  2WWZ A;  4NXZ A;  2JZB A;  2E6X A;  3PRE A;  5KG7 A;  1TK0 A;  2KX3 A;  4NZL B;  3Q3N C;  4NV0 A;  5C1Z A;  1YD8 U;  4DXG A;  2MJD A;  2M4N A;  3PW5 A;  5K4L A;  1UUP A;  2HHX A;  1RAX A;  3V72 A;  2D6F C;  3IT6 B;  2LVP A;  4OJL A;  3V7L A;  5ALP A;  4TQR A;  3PW7 A;  1JRP A;  3JPQ A;  8ICL A;  1K51 A;  3ZTC A;  3L13 A;  3HK0 A;  3NZ3 A;  4RNM A;  4GSW A;  2J6T A;  1T0Y A;  3P4R B;  1P7E A;  1SKR A;  1ZXI A;  2KP7 A;  4IM0 A;  2KQS A;  3P4Q B;  2PTL A;  3MTN B;  2RPV A;  3GV8 B;  1F5S A;  1S0M A;  1ED1 A;  1H38 A;  4YMN A;  3T3N A;  2IOF K;  3ENE A;  3MC1 A;  3QX7 A;  4WH4 A;  4JWM A;  2X38 A;  1AAR A;  2J0M A;  1RG6 A;  3ONN A;  4OJP A;  1RFK A;  1UD7 A;  2ZW1 A;  3DBR B;  3N32 A;  3E58 A;  2DYM A;  2CS4 A;  5CHW A;  1UHU A;  4NQL B;  3TAC B;  3KHH A;  5KHQ A;  3EHV A;  9ICJ A;  1FO4 A;  5E6J A;  2WNM A;  2HHS A;  1NKC A;  2Y0S F;  1FEZ A;  3LYS A;  3IDW A;  1AN8 A;  2BB5 A;  3ZIM A;  2DZK A;  3KW5 B;  1URJ A;  2ASD A;  1U47 A;  1N56 A;  2DPJ A;  1GG3 A;  2L0T A;  3OAW A;  5HHI A;  4I2C A;  3W5V B;  4I6N B;  3TIX A;  3QZ8 A;  4R66 A;  3EGR A;  4UAS A;  1S0O A;  4B9U A;  4DSI A;  1WE6 A;  3AEE B;  4LNN A;  5C5J A;  5ALM A;  9ICE A;  2V9W A;  2NR2 A;  4BOZ B;  2WS3 B;  4EUT A;  1OW5 A;  3ICX A;  4BX9 C;  5DQI A;  4HKQ A;  5D3I B;  4B9S A;  3AQE A;  2I9G A;  4E3C A;  1L6U A;  5KAI U;  3PHX B;  3CSF A;  4KLG A;  5IIO A;  3NHE B;  4G9B A;  5DLG A;  2KJ8 A;  8ICY A;  4LZG A;  1ZQK A;  3R7R A;  3VR8 B;  2DFL A;  2JEF A;  4B9T A;  3NG0 A;  2VH2 A;  4OVZ A;  4RQ4 A;  5G2N A;  1M6Y A;  1C4P A;  4F3O A;  2JVC A;  4LZD A;  3BVM A;  1J7B A;  2JWU A;  1ZQU A;  2DUY A;  3QUB A;  4O5K A;  1AW7 A;  1ZQZ A;  2EKE C;  4RM9 A;  1ZD4 A;  3G6Y A;  1C4C A;  3M1Y A;  4DQS A;  4F8C B;  4B6W A;  3TEW A;  1QLB B;  3AMZ A;  3H0R B;  1R4N B;  2K6D B;  4LJO B;  3RNA C;  1QT9 A;  1S5L U;  3L10 B;  4KV2 A;  5C2T B;  2LYH A;  2ACZ B;  2NBU A;  2J6S A;  2FMS A;  3GE3 C;  3ZJV A;  2DYO A;  1J8C A;  4I2J A;  1MPE A;  1SZP A;  1JRO A;  2W43 A;  2OOB B;  4G11 A;  4CQN A;  3IM1 A;  1I4P A;  3OLM D;  2FJ6 A;  4I2B A;  2M0X A;  3CF6 E;  2XN9 C;  2JY6 A;  1E7U A;  4FBU A;  2QC8 A;  2CJN A;  1Q1O A;  4XWW A;  4OJ6 A;  5IOI A;  2NV3 A;  2KQ7 A;  1KLV A;  3GB1 A;  3RJK A;  2A1J B;  1F9J A;  8ICU A;  5KFY A;  1SJH D;  1FIQ A;  2MA1 A;  2V4L A;  3GZN I;  1ECW A;  3T5L A;  5J0Q A;  5FKA C;  2Y5P A;  5KFJ A;  4C8K A;  4LNK A;  5H8Y E;  4C4V B;  2KSO A;  3D2Q A;  2BW2 A;  8ICE A;  2QMT A;  3E2E A;  2IYD B;  4DSK A;  3T79 A;  2D5G A;  2DZJ A;  4QZ9 A;  5J0S A;  2KO3 A;  2IGH A;  1IP9 A;  2E8M A;  1RQL A;  1ROE A;  4BBN C;  1T0R C;  4IQV A;  4Q44 A;  1U9L A;  2IHN A;  1EWC A;  4WIP A;  1EWY C;  1L7O A;  1CRX A;  1ZUD 2;  1L7P A;  9ICB A;  3F53 A;  3DBS A;  3PZ8 A;  3WAO A;  3SD5 A;  1ZE3 D;  2HBL A;  1WUD A;  5HHH A;  3SEN A;  2N1W A;  4P0Q B;  4F92 B;  1X1M A;  2WXM A;  4QZF A;  2AHO B;  2FCM A;  4WJ3 B;  5DPW A;  2K6Q A;  1MHH E;  3GZF A;  2MP2 B;  5GTI U;  2W9M A;  5CHV C;  4WWM A;  1X66 A;  5AHX A;  3KTQ A;  3PX4 A;  4FJY A;  8ICV A;  2C22 A;  3KUD B;  4P0P A;  4N6E B;  5AZF A;  7ICL A;  3U7D A;  5JH5 C;  1L2N A;  2ZCB A;  5KFV A;  1UZX B;  2KIW A;  1UF0 A;  4W9D A;  2ZXH A;  1I4H A;  1X9X A;  2HHW A;  4HDQ A;  2AH5 A;  1BT0 A;  3NS1 A;  1DOY A;  3UGB B;  1BPZ A;  2C2D A;  1L4Z B;  3SMV A;  1NKB A;  1E8W A;  4B95 A;  5TIS U;  4FHJ A;  3L17 A;  2HHV A;  1MG8 A;  1JXL A;  4QZH A;  2LXC A;  5KT2 A;  3MC8 A;  2GBN A;  3PR4 A;  1KTQ A;  4R3D A;  4DEZ A;  4M9N A;  1SE3 A;  3RMK C;  1N2X A;  4DHJ B;  4ED7 A;  3OJS A;  2RMM A;  1JXE A;  3UQ0 A;  1SXE A;  4OZC A;  4ZRQ A;  4GXI A;  3RR7 A;  2M0N A;  4FBJ B;  2WAQ F;  1KH0 A;  2FUG 1;  3P1M A;  4LVS A;  3UM9 A;  2UU7 A;  7ICN A;  3VQI A;  1KLU D;  3HX0 A;  3BQ0 A;  1ZQJ A;  4PS8 A;  4FN2 A;  4C7Y A;  4CYE A;  2LHT A;  4GC7 A;  4DQR A;  2ZIU A;  4RNN A;  4O3R A;  1PFD A;  2KDI A;  1ZQW A;  3PLV A;  4ACF A;  1PK3 A;  3ED5 A;  2Y9U A;  2PVO D;  2WDR B;  4ASW C;  1NK9 A;  2KDB A;  2KD0 A;  2JEI A;  5KFG A;  5KL8 B;  2W9A A;  5KFN A;  2BKE A;  3OHB A;  1NK5 A;  2J52 A;  4J03 A;  4MFF A;  1GB4 A;  4IQU A;  2WDT B;  2HOQ A;  2J6U A;  2OJR A;  3BQ7 A;  4RCO A;  2LJ5 A;  3RH5 A;  5L1I A;  1XLN A;  3S6J A;  1YT3 A;  4A3P A;  5ALZ A;  4KMO B;  2ZJ8 A;  3LYY A;  1NEK B;  9ICT A;  2GMI C;  4DFK A;  3BS7 A;  4F50 A;  2KVC A;  4DFM A;  3ZW3 A;  3M6K A;  3PY8 A;  1U48 A;  2KWD A;  4F7Z A;  2BGW A;  1I35 A;  1XD3 B;  4XYC A;  1ZQM A;  1UQV A;  3DVG Y;  1TGZ B;  1NJW A;  1Q3V A;  2PMZ F;  3H0L B;  1PYW D;  1WJU A;  3OPX A;  1BVS A;  4IC9 A;  1V85 A;  3ZLZ A;  1B43 A;  1TIF A;  5HFY A;  4KZ0 A;  1WYW B;  2W7P A;  1WMH B;  4BVU C;  3NAS A;  2M9N A;  2ZIX A;  4MF8 A;  2VZK D;  2BS4 B;  1T8E A;  5AI8 A;  3FYH A;  2ZCC A;  1KBU A;  3EC8 A;  4AUQ C;  5L83 A;  2Y3A A;  9ICR A;  4IG7 B;  4YFK A;  3RBE A;  3JPO A;  1C79 A;  1V86 A;  1L6V A;  2KZZ A;  4OW0 A;  4C56 C;  3QUT A;  3QUQ A;  4U7C A;  1LGR A;  4WWN A;  3JPS A;  9ICL A;  2ZZP B;  4JV1 A;  2KWC A;  2KWU B;  2N9E B;  3Q8S B;  1X9W A;  4DQO C;  2K8H A;  2N0S B;  3IVF A;  1C9F A;  5B5E U;  1WG8 A;  2AQ0 A;  3RAX A;  1Q10 A;  2KHW B;  1VCB A;  2WB1 F;  3ZD9 A;  2J0K A;  2PFQ A;  4ANU A;  3RBD A;  2W3R A;  1P98 A;  4PGQ A;  5J8Y C;  5TZV A;  1VD2 A;  2KC2 A;  1I4Q A;  1RWS A;  2WHE A;  1WCN A;  1XSL A;  1D5X C;  1BPB A;  5FR3 A;  1TBE A;  2H3Q A;  4AJY B;  5AM3 A;  3MR3 A;  1TT5 B;  2ASL A;  3WAM A;  4R8U B;  1PGA A;  4EBE A;  1P1A A;  4P7I A;  2DWQ A;  2LGY A;  1ZQS A;  1V97 A;  4PZN A;  2BPC A;  1QLN A;  1SE2 A;  2LI6 A;  2ZJD A;  5JTI A;  4P16 A;  4UB4 A;  3CST A;  3QU2 A;  3BY4 B;  3QIJ A;  3MBY A;  2ZIW B;  3NY5 A;  4F5P A;  4YR2 A;  3JPR A;  1XS9 D;  1S8O A;  4FJV B;  2ES6 A;  2FPM A;  3Q8K A;  4A9A A;  4AP9 A;  2LRW A;  4I2F A;  2A1J A;  2GBR A;  5KAF U;  3RUI B;  1V5O A;  3R7Q A;  1LFD A;  2KT7 A;  2FE9 A;  2BQU A;  1RRB A;  5KFD A;  3I9V 1;  2P6R A;  7ICQ A;  1J2M A;  3Q69 A;  4Y2T A;  4OZA A;  2JSV X;  3AEB B;  1XCT L;  3ZNI D;  4C4V A;  1E7V A;  4NM1 A;  3RNG C;  4A3O A;  1KQQ A;  1SL0 A;  1F0Z A;  3C29 A;  5AM2 A;  3KFU F;  5H2F U;  3ZKJ C;  5CHG A;  3SQI A;  4JWS C;  4YT0 B;  2EAP A;  3EPI A;  4CDG A;  5AK5 A;  4DL3 A;  1VJK A;  1N63 A;  4UAR A;  1XO3 A;  2WQY B;  5E6P A;  4IW0 A;  1Z4N A;  2GOW A;  3SFE B;  1NOM A;  4CHK A;  4KLO A;  2VKQ A;  1E5W A;  3WA0 A;  2IO3 B;  4RZR A;  4FO6 A;  4ECT A;  1Y88 A;  1T0S C;  2RDG A;  2O6K A;  3KWV A;  1P7F A;  5LXI B;  2JEJ A;  3PW4 A;  1D8B A;  2Q4T A;  1Z3E B;  1V81 A;  1S77 D;  1ZQF A;  1SSN A;  2O6V B;  3OSN A;  2IBK A;  1NI2 A;  5KG1 A;  1TTN A;  2GBM A;  4AOF A;  4QW8 A;  4AWJ A;  4BKG A;  2B0C A;  3NUQ A;  1WFY A;  2K8C A;  3Q8P B;  4G50 A;  2IO2 B;  5KG4 A;  4KSL C;  4PGX A;  1RYU A;  3ZYY X;  1TFR A;  2IY0 B;  2KTR B;  3WCQ A;  5J29 A;  1V2Y A;  2K89 A;  4TV3 A;  2L8J A;  3RUL A;  5BMH A;  4NY8 A;  4YR0 A;  5ALJ A;  1TY0 A;  3DBL B;  4WUR A;  2DAF A;  2LYB A;  3Q3J A;  2LHE A;  3ECI A;  5KG0 A;  1TKY A;  2J53 A;  3A4S C;  4HRS A;  3ZXR A;  1T5X D;  5IIK A;  4K81 A;  1E9M A;  7ICO A;  1FD6 A;  1OXJ A;  2WYQ A;  1WZ3 A;  1SL2 A;  3DQV A;  2HW3 A;  3AEC B;  2VH1 A;  4IM3 A;  2HSZ A;  4A55 A;  4ANW A;  1TAM A;  3RB0 A;  5GXG B;  4QZD A;  2WXR A;  3V3X A;  2MAX A;  3BK2 A;  4DS5 A;  2XY7 A;  5J2F A;  4M04 A;  4DL4 A;  2JT4 B;  2MBQ A;  3AE3 B;  5CHF A;  2J42 A;  3ZTD A;  2ZVN A;  2L0F A;  1QZE A;  1VDV A;  1YMH E;  2BVC A;  1LM8 B;  3M8R A;  2V1Y A;  2N7E A;  2HCF A;  3H7S A;  1EUV B;  3TEX A;  3BQT A;  2IMW P;  2C5L C;  5L95 C;  1ZQH A;  4GIV A;  4HDO A;  2AQ4 A;  5BMG A;  1C77 A;  4WJO A;  4ECZ A;  5AEK B;  4W9I A;  4I2I A;  1D3Z A;  4MAC A;  1SBB B;  1Q5W B;  4IR9 A;  2KJH B;  4GXJ A;  2VIX A;  2BPG A;  2WU5 B;  5L9X A;  4GB9 A;  3IP4 B;  3A4R A;  3DDC B;  2V3S A;  4II2 B;  4RQM A;  3HKZ F;  3RB6 A;  1RQN A;  4YP3 A;  5CJ7 A;  4NL9 C;  2WDV B;  2KLG A;  4ELV A;  4UAZ A;  3W1S A;  3SAH A;  4Q43 A;  4ACO A;  2H88 B;  4EEN A;  3F5A A;  1BNO A;  1SF0 A;  2IGG A;  2L3Z A;  3ZO5 B;  2NCN A;  3MAB A;  1QOG A;  3JSV B;  1X9M A;  3MP9 A;  4ITK A;  3UMB A;  2OYY A;  3RAQ A;  1ZQA A;  1ZKH A;  2Y1J A;  9ICI A;  2AQ2 B;  3EA6 A;  9ICQ A;  1VR9 A;  5AI9 A;  3N3K B;  4OVV A;  5DG9 A;  2AQ1 B;  4UAY A;  1L5U A;  4NLK A;  2KD1 A;  3IG5 A;  3BII D;  3Q2A C;  3IG3 A;  4GGQ A;  5FK9 C;  1N62 A;  1SV0 C;  5KFK A;  2REX A;  4M9H A;  3H8H A;  4PT5 A;  4WQM A;  4ZRJ A;  2YX8 A;  1OQY A;  2L32 A;  5ALK A;  1WZ0 A;  5AUI A;  4MEX A;  2YMP A;  1FNU A;  3PZ7 A;  4M9J A;  2K8B B;  3BWU D;  5IIL A;  3W2D A;  1WJ6 A;  3I76 A;  4PHE A;  4J9Q A;  5GTH U;  1SL1 A;  5ALU A;  1WF9 A;  2BYV E;  4C8M A;  1KFS A;  5KFL A;  4M0W A;  2IBI B;  1LQB A;  4UB8 U;  2KKV A;  4IWP A;  3NGD A;  4KLJ A;  2HHU A;  4IWQ A;  1PGX A;  2BZF A;  3I3T B;  1ZW7 A;  5J2B A;  5D7G A;  1KF6 B;  1F44 A;  5EE0 A;  1JI7 A;  2WXI A;  2ZNV C;  4UBC A;  4IRC A;  2F76 X;  1L4D B;  3B0X A; 
#chains in the Genus database with same CATH homology
 5E6J A;  2WNM A;  1A70 A;  2JYE A;  3LXF A;  4REZ A;  1F2R I;  1L5P A;  5G5H A;  2DLB A;  5EE3 A;  1AN8 A;  2BB5 A;  1NEN B;  4RH6 A;  2BS2 B;  1GB1 A;  1LO5 D;  3T3O A;  1Y56 A;  1ZPS A;  1SIJ A;  3DWG C;  2LJI A;  1XF5 L;  4RGM A;  3W5V B;  1D6E C;  3EGR A;  2JQR B;  1EU3 A;  4HEA 1;  3AEE B;  1QOA A;  2R61 A;  4ZHO A;  4HKQ A;  1QKZ A;  2WS3 B;  2PIA A;  3NVV A;  2N7J A;  5D3I B;  4XWT A;  1BUI C;  1L6U A;  2PLP A;  4LK0 M;  3AE2 B;  5HI1 A;  3URY A;  2BB6 A;  1XLO A;  3VR8 B;  3U52 E;  1CQV A;  3GP7 A;  4OVZ A;  3RPF C;  1N61 A;  3MFG A;  1N5W A;  1C4P A;  4UDU C;  1XEE A;  5JXV A;  2W54 A;  3BVM A;  1J7B A;  2KMM A;  2JWU A;  2L1A A;  2N9L A;  2V0G A;  1AW7 A;  1WRI A;  2ICI A;  1C4C A;  3AH7 A;  1JWA D;  4RFB A;  1QLB B;  1E7P B;  3AMZ A;  5BYQ A;  3TEW A;  3IT4 B;  3AE4 B;  1HQR D;  1PDX A;  1QT9 A;  2IJ0 A;  4IOI E;  2I2Y A;  4MM3 B;  4C7Z A;  1SB3 C;  2ACZ B;  5C2T B;  1CK1 A;  3ZJV A;  2DYO A;  2JXT A;  4RF0 A;  1C76 A;  4EE2 A;  1MPE A;  1K53 A;  5I4D A;  1JRO A;  4CQN A;  2M0A A;  5G5G A;  1XCQ L;  2BS3 B;  1TYG B;  1I4P A;  1N5X A;  2XN9 C;  3P4S B;  4A6Q A;  2CJN A;  4YXD B;  2LMC A;  4NJC A;  4XWW A;  1FCL A;  2FBW B;  1ZP0 B;  4JWU C;  2SEB D;  2JYT A;  3KWL A;  4A8X C;  3AE7 B;  3GB1 A;  2QIL A;  3OWE B;  1SJH D;  1FIQ A;  3NVW A;  1QOB A;  1WSP A;  5FKA C;  2Y5P A;  3BZD B;  3C8Y A;  5H8Y E;  2BW2 A;  2QMT A;  1QQR A;  4HRO A;  2JU6 X;  4HKZ E;  2D5G A;  3AE1 B;  4NAW B;  3U7Z A;  2IGH A;  2SAK A;  3AE5 B;  4B0M A;  2EKI A;  1ROE A;  2OHF A;  2QJL A;  3SEB A;  1DOX A;  1YN4 A;  1EWC A;  2H89 B;  4WIP A;  1EWY C;  1JWU D;  1ZUD 2;  1FXA A;  1WYG A;  3J9C A;  4XDC A;  3E56 A;  4ARC A;  4GDL B;  3PZ8 A;  2AX5 A;  1AWD A;  4NAM A;  3SFD B;  1ZE3 D;  1FRR A;  4HJG E;  2KN4 A;  2QSD A;  2WXM A;  3B2G A;  4KGS A;  3U4E G;  4US8 A;  1CJE A;  1ZDX A;  1T6B X;  3KLS X;  2IGD A;  4L1B A;  1MHH E;  4OHJ A;  2QEJ C;  1KLG D;  1WGK A;  3PO0 A;  1N60 A;  1ENF A;  4WWM A;  1RM6 C;  1V1P A;  2V3P A;  3FIL B;  2V3N A;  4N6E B;  4YSX B;  1JCK B;  2AQ3 B;  1SEB D;  3NUH B;  4MT5 A;  1FNW A;  5LNK 1;  1D4B A;  1I4H A;  4YSY B;  1SXT A;  2KDM A;  2WXF A;  3NS1 A;  1IGD A;  3TUO A;  1DOY A;  1OQQ A;  1L4Z B;  4P6V F;  1L0V B;  1DYQ A;  1R7S A;  1I4G A;  2W82 A;  2WXO A;  4R3D A;  1SE3 A;  4XDD A;  1YQ3 B;  2RMM A;  3HVD A;  1B1Z A;  2NMQ A;  4IDI A;  5AUK A;  2OED A;  1FM0 D;  4OZC A;  4ZRQ A;  1SE4 A;  1L0X B;  3AV8 A;  1KH0 A;  2FUG 1;  3P1M A;  1YJI A;  3DWM A;  2IPK D;  3VQI A;  2YEP B;  1KLU D;  1F77 A;  1BML C;  3KQ4 A;  1FRD A;  1ZXH A;  2WXG A;  3V05 A;  4ZYS A;  1JAL A;  3P42 A;  4JE3 B;  2HDE A;  1VLB A;  4C7Y A;  1PFD A;  1TJE A;  4ZHP A;  3Q8F A;  1FFV A;  2PVO D;  3NVZ A;  2WDR B;  1UGJ A;  1K52 A;  5C3J B;  2J52 A;  1HA5 A;  1E0Z A;  1TS4 A;  1YN3 A;  1GB4 A;  1UNS A;  1T3Q A;  3FIL A;  3IAS 1;  3R2I A;  4RCO A;  1XLN A;  3I57 A;  1QIL A;  3LYY A;  1NEK B;  1V8C A;  1SJE D;  3BVG A;  3BK1 A;  3AB5 A;  5T8I A;  1UWX A;  2KWD A;  3TEY A;  3ZJU A;  3ZQ4 A;  4TMA B;  3EUB 2;  1V1O A;  2Z8L A;  1E6E B;  2WLB A;  2TSS A;  3W5U B;  1TKG A;  3ZJT A;  4YSZ B;  1PYW D;  2M56 B;  1DOI A;  2RDH A;  1DGJ A;  4N59 A;  2LGI A;  3Q8B A;  1YNT E;  2KAC A;  3W9C B;  2WXL A;  5HFY A;  1B9R A;  3E9S A;  3P63 A;  1ZDV A;  1IBX B;  1TS2 A;  1HZ5 A;  3NVY A;  3AEA B;  2VZK D;  1JWM D;  2BS4 B;  4JPS A;  1IUE A;  1TZO A;  2L83 A;  1CZP A;  1HEZ E;  3HUI A;  3HRD D;  2Q5W D;  4AQ7 A;  2E3T A;  2Y3A A;  3AED B;  4MH8 A;  2K5P A;  3AEG B;  1C79 A;  1L6V A;  4OW0 A;  2ON8 A;  3IAM 1;  4C56 C;  1J7C A;  1K50 A;  1F2R C;  2ZW0 A;  1FCC C;  3AN1 A;  2PVG C;  4DQO C;  4TQ0 A;  1JQ4 A;  5HG2 A;  2N0S B;  2N9K A;  4IKG A;  2J4X A;  3IXS A;  2WXK A;  1Q10 A;  1C9F A;  3R2T A;  2BT6 A;  2W3R A;  1IGC A;  1KRH A;  3AM9 A;  1UWM A;  1I4Q A;  1RWS A;  2K0P A;  3N9Y C;  1D5X C;  1D5M C;  1I7H A;  5FR3 A;  4KGR A;  4Q2J A;  4LTU A;  2WDQ B;  3Q8A A;  1RYJ A;  1YN5 A;  4GLS C;  4H2A A;  4KX6 B;  2L52 A;  3U2S C;  1JWB D;  2YEP F;  1PGA A;  1I4R A;  1VZ7 A;  1NVI D;  3MJ5 A;  2DWQ A;  2V4I B;  1V97 A;  2PKO A;  1SE2 A;  2WXQ A;  4RGT A;  4YWG G;  2IDY A;  3L4P A;  4US9 A;  4P16 A;  1GOZ A;  4USA A;  5MPO A;  3VR9 B;  4YTP B;  2PMV A;  3TEZ A;  4A9A A;  1KFY B;  2WXP A;  1JW9 D;  2PW9 A;  2BTE A;  1TS5 A;  1IBX A;  2LEK A;  1NYR A;  2LFI A;  3I9V 1;  4C80 A;  1JML A;  5BYS A;  4GDK B;  3Q69 A;  4L2Y A;  4OZA A;  2W55 A;  1TKE A;  2JSV X;  2HTM E;  3AEB B;  1XCT L;  4RNA A;  1MI0 A;  1EM7 A;  1NYQ A;  2G1E A;  5TSS A;  2INN E;  3ETR A;  3R8B A;  1F0Z A;  2LHD A;  2DBY A;  1AYF A;  3P4P B;  2KAJ A;  4JWS C;  4YT0 B;  1M4V A;  2WXH A;  1VJK A;  1N63 A;  1XO3 A;  1VRA B;  2Y5C A;  2WQY B;  1YJJ A;  4A90 A;  3SFE B;  3BVZ A;  1XXG A;  3ABV B;  3GS2 A;  2NTT A;  3NRZ A;  4YTM B;  3KWV A;  2RDG A;  1P7F A;  3BYY B;  4ZRP A;  4KGT A;  3AE9 B;  4YTN B;  1NI3 A;  1SSN A;  2WXN A;  3UI3 A;  2I38 A;  2VZK B;  2K9X A;  3AEF B;  1PUT A;  1D5Z C;  1FFU A;  3ZYY X;  4WAF A;  2WXJ A;  5H92 C;  4RF1 A;  3WCQ A;  1WWT A;  5BMH A;  1YQ4 B;  2GRI A;  1TY0 A;  4WUR A;  1FNV A;  1FEH A;  1KTK A;  1HXY D;  2LHE A;  1TY2 A;  1TKY A;  2J53 A;  4HRS A;  2FE8 A;  1T5X D;  1E9M A;  2WU2 B;  2W3S A;  3AE8 B;  1FD6 A;  1VZ6 A;  3ZGZ A;  1I4X A;  3AEC B;  3Q8C A;  2JZP A;  4A55 A;  4O1N A;  1WXQ A;  1HZ6 A;  3LB8 C;  2WXR A;  4KKJ A;  5GXG B;  3V3X A;  1QOF A;  5BMI A;  1OFF A;  1ET9 A;  3BK2 A;  1GAQ B;  1ESF A;  4FXC A;  3AE3 B;  4D2K A;  2J42 A;  1YMH E;  1VDV A;  3VRB B;  1V1P B;  4OZB A;  2MEK A;  1MHX A;  3BYT B;  3TEX A;  2WP9 B;  1PGB A;  2KQ4 X;  1STE A;  1ET6 A;  5BMG A;  4TQ1 A;  2M19 A;  1C77 A;  2QIE B;  2LUM A;  2BBC A;  2MJE A;  2MH7 A;  5EE1 A;  4MAC A;  1SBB B;  5HHD G;  3SR6 A;  2WU5 B;  3RFZ B;  5EE9 A;  1GPX A;  1JWS D;  2K22 A;  4RGN A;  3Q8E A;  3FAH A;  2WDV B;  2EEL A;  3W1S A;  4ZOH C;  2H88 B;  2GB1 A;  1VZ8 A;  1BXT A;  1MVK A;  5D3D A;  1SF0 A;  2IGG A;  2ONQ A;  1FMA D;  4AS1 A;  1QOG A;  3CIR B;  1XLQ A;  3MP9 A;  4ITK A;  1J7A A;  2JX5 A;  2E6X A;  3FC4 A;  1FXI A;  3EA6 A;  2AQ2 B;  1ZOY B;  4JX1 C;  5BYR A;  1VR9 A;  4NZL B;  2AQ1 B;  2XNA C;  4N58 A;  4DXG A;  2INP E;  2MJD A;  4LLG M;  1UUP A;  1E10 A;  3BII D;  1L0Y B;  5FK9 C;  1N62 A;  3B9J A;  3IT6 B;  3H8H A;  4WQM A;  4PT5 A;  4DXF A;  4J3O D;  2L32 A;  1JRP A;  1K51 A;  2K3U A;  3MHZ A;  5AUI A;  3NZ3 A;  2NTS A;  1TS3 A;  3O13 A;  1FNU A;  3PZ7 A;  3TSS A;  3VRA B;  2CU3 A;  3P4R B;  1P7E A;  1ZXI A;  3BWU D;  3W2D A;  3P4Q B;  1EU4 A;  2PTL A;  2RPV A;  4KKI A;  4RGO S;  4XE0 A;  3T3N A;  3HVZ A;  1C78 A;  4L23 A;  4WH4 A;  4M0W A;  2X38 A;  4TSS A;  2BYT A;  1ACC A;  1XLP A;  1C4A A;  2ZW1 A;  1RFK A;  2MJ3 A;  1OQR A;  2DYM A;  1PGX A;  3AE6 B;  3MC0 B;  1QF6 A;  4B0E A;  4ARI A;  5D7G A;  1KF6 B;  2G9H D;  2GI9 A;  2CJO A;  3B2F A;  5EE0 A;  2WXI A;  2B76 B;  1L4D B;  1FO4 A;  3CWI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...