1N68A

Copper bound to the multicopper oxidase cueo
Total Genus 132
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
132
sequence length
487
structure length
464
Chain Sequence
b'ERPTLPIPDLLTTDARNRIQLTIGAGQSTFGGKTATTWGYNGNLLGPAVKLQRGKAVTVDIYNQLTEETTLHWHGLEVPGEVDGGPQGIIPPGGKRSVTLNVDQPAATCWFHPHQHGKTGRQVAMGLAGLVVIEDDEILKLMLPKQWGIDDVPVIVQDKKFSADGQIDYQLDVMTAAVGWFGDTLLTNGAIYPQHAAPRGWLRLRLLNGCNARSLNFATSDNRPLYVIASDGGLLPEPVKVSELPVLMGERFEVLVEVNDNKPFDLVTLPVSQMGMAIAPFDKPHPVMRIQPIAISASGALPDTLSSLPALPSLEGLTVRKLQLSMDPMLDMMGMQMLMEKYGDQAMAGMDFHHANKINGQAFDMNKPMFAAAKGQYERWVISGVGDMMLHPFHIHGTQFRILSENGKPPAAHRAGWKDTVKVEGNVSEVLVKFNHDAPKEHAYMAHCHLLEHEDTGMMLGFTV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Blue copper oxidase cueO
molecule tags Oxidoreductase
source organism Escherichia coli
publication title A Labile Regulatory Copper Ion Lies Near the T1 Copper Site in the Multicopper Oxidase CueO.
pubmed doi rcsb
total genus 132
structure length 464
sequence length 487
ec nomenclature
pdb deposition date 2002-11-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00394 Cu-oxidase Multicopper oxidase
A PF07731 Cu-oxidase_2 Multicopper oxidase
A PF07732 Cu-oxidase_3 Multicopper oxidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 1n68A02
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 1n68A01
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 1n68A03
5I26A 3FSVA 1A4CA 1WAEA 1NIEA 3AG2B 3FU9A 3WNIA 2UX6A 2XV3A 2ZXWB 2VM4A 2EIJB 2HX7A 4GYBA 1CURA 3CVCA 3EH3B 2YAMA 1ZDSA 1SDDA 1MZYA 4RH4A 3RYMA 1WS7A 1BQRA 3NJNA 3QQXA 1AZCA 2I7SA 2P80D 2IDUA 2CBPA 3AW5A 3FU7B 5I5JA 3X1GA 1J9QA 4PAZA 2FWLB 3UAEA 3PXLA 4QKTA 4JKNA 3OMNB 3UADA 3NJFA 1KDJA 2VSKB 4CSPA 4DPBX 5EHFA 3IEAA 2BZCA 3JT2A 5F7BA 1KCWA 2BWIA 3UGEA 1OCCB 3EH4B 4PCYA 4KNSA 3QJVB 3OD3A 1KYAA 1NIFA 3FPXA 4AZUA 3SQRA 1ZIAA 3X1FA 2DYSB 2YQBA 7PAZA 4BWUA 3NJGA 3SBQA 3DIVA 1CYWA 1WA0X 2VSMB 2YARA 2YXVA 3TASA 2QT6A 3FQYA 1CUOA 2Y1AA 3DKHA 1SHWA 1PMYA 1GS7A 3AG1B 1R1CA 5D4JA 4FAAB 3HB3B 2FQFA 3FS9A 2BW4A 1IBYA 3ERXA 4BDVB 5B7MA 2EINB 1JZFA 1I53A 2AZAA 4ZK8A 5AFAA 3FSAA 1SF3A 5D4HA 1NZRA 1E30A 1L9OA 2VN3A 1QHQA 4A68A 4YSCA 2CALA 3UAAA 2EIMB 4F2FA 2CUAA 4BWWA 1E65A 2CCWA 1BQKA 1NTDA 1HFUA 1E5ZA 2I85A 1QLEB 3FU8A 2EILB 3PCYA 1GSKA 5IY5B 4W9ZA 4JHUA 1MDAA 2MTAA 3ABGA 2UXFA 2ZONA 4E9YA 3H4FA 2BO0A 3NP3A 5I6LA 1NIBA 5AKRA 4DPCX 2XXFA 1X9RA 1GS8A 1XB3A 4P5RA 1BYPA 2XLLA 3T6XA 2UXGA 2W8CA 2JXMA 2YAPA 3OMIB 1UATA 2IH8A 5D4IA 3TU6A 1TKWA 1ZV2A 2IWEA 1JZEA 2R7EB 3X2QB 2BZ7A 2FJSA 4KO6A 2XWZA 1AS8A 1IBZA 1M56B 4A2GA 5B7FA 3PAUA 2DV6A 2GB2A 1RKRA 4BXSV 3NSDA 4DP4X 4YSRA 4EF3A 6PAZA 1FA4A 2XXGA 2A3TA 3QJSB 4X4KA 5B7EA 4A2HA 1PNCA 2QPEB 4E9TA 3PLYA 2NRDA 1NWPA 1B3IA 3S8FB 4A2FA 3OQRA 1MG2C 1JXFA 2EIKB 2IWFA 2DWTA 1TU2A 2VW4A 3QJUB 4YSEA 3ASOB 2Q9OA 4KNUA 1OE1A 1V10A 2RACA 1PZCA 2YAOA 1SFDA 1XB6A 3FSZA 2PPEA 1L9RA 2FT8A 1J5CA 3L45A 4F2EA 2TSAA 1JZJA 3QPKA 2I7OA 1V55B 1F56A 1GYCA 1QNIA 2GC7C 2QDVA 1AG6A 2IAAC 1AQ8A 2DYRB 4N4YB 1RCYA 5TK2A 1KBWA 3WNJA 4KOBA 3FQ2A 3CZUB 3FQ1A 3KW8A 4YSPA 1MZZA 1EHKB 1A4BA 5B1KA 4NB7A 1AIZA 1ET7A 3GYRA 3IBOA 2DY2A 2FQDA 1JVOA 3PPSA 4HCFA 3WI9A 2PPCA 4G7QB 2BP0B 3TA4D 3HEIB 2WO3B 1L9TA 1AZBA 4KO9A 2VMJA 3CDZB 3ZIYA 1SJMA 9PCYA 4DP2X 1DYZA 3WG7B 2ZWNA 3UABA 4HCGA 1AZRA 2PP8A 1BYOA 1JERA 2CJ3A 1T5KA 5A7EA 1L9SA 4W1TA 3WKPA 3UACA 3AZUA 2OCCB 4UANA 2VW6A 5PCYA 5I28A 4DP6X 1SHXA 1NPJA 1BXVA 4G70B 1OCOB 2CAKA 2GBAA 4KO7A 4E9WA 1BXUA 1ADWA 1A8ZA 3NJKA 1OE2A 4N8UA 3IN0A 1NIDA 4BWTA 2XX0A 2B08A 3BQVA 5LDUA 1E5YA 4DP1X 3NJJA 4G7SB 1AANA 2OV0A 4GP5B 3QJTB 3FYEB 2VW7A 2UX7A 1FFTB 1L9PA 1JZIA 2GHZA 3FT0A 4GY4A 3NJHA 4DP8X 3U25A 4KO5A 2JKWA 1V54B 2GC4C 2MRYA 2XU9A 2HLEB 1ID2A 1CC3A 1GY2A 4GP4B 3GXUB 4TXVB 4A66A 5E9NA 1OOWA 1GY1A 2QPDB 4E9QA 3G5WA 1JOIA 4KOCA 5B1BB 2W88A 4DPAX 3S3DB 1E67A 2H47C 2UXVA 1XMEB 1CYXA 2X87A 8PAZA 1AS6A 1RZPA 4YSTA 1BQ5A 2XYBA 3JTBA 3H56A 6PCYA 1GW0A 3PAVA 2XVBA 2IWKA 4BDVA 5B1AB 1IUZA 3T6WA 3ABKB 1PAZA 3C75A 2OJ1A 4AKOA 3ABMB 3CDZA 5AZUA 3ZDWA 1IKOP 3S3CB 4A67A 3V9CA 3V9EA 2GSMB 2HRHA 3TBCA 2YXWA 1AZNA 3OMAB 1ASOA 4HZ1A 1AG0A 3EH5B 2XX1A 4KNTA 2HRGA 5I6OA 1ASQA 3QJRB 4YVNA 4AX3A 2J5WA 4DP0X 2J56A 1W6WA 3MX0B 5I5MA 2E86A 1L9QA 1PY0A 3CG8A 3KW7A 1AOZA 1NWOA 2BHFA 4YVUA 1NDTA 2PPFA 4UAHA 1ETJA 1JXDA 2H5UA 2QDWA 1PLAA 2PP9A 4JHVA 4FA7B 1ET5A 1PLBA 5B3SB 1MG3C 4E9VA 1NPNA 1N70A 2H3XC 4ENZA 2HXAA 1JZHA 5B1JA 3ZX1A 2PLTA 1X9UA 1JXGA 2Q5BA 2BW5A 1KDIA 3N2JA 4HHWA 7PCYA 2FTAA 3AY2A 2UXTA 4HAKA 1SNRA 2HZHA 3TBBA 1KGYE 1W8EA 1BXAA 5PAZA 1ZPUA 3NYKA 4M3HA 3FPYA 4NAJA 3N55A 2HX8A 3H4HA 3AG4B 1PNDA 3D12B 1WA2X 4E9RA 4BXVA 3T71A 3EF4A 3EHBB 2R7EA 3GDCA 2FT7A 3NJIA 4P5SA 1EZLA 2YAFA 4K9JA 2PP7A 2BP8B 1ASPA 4HCIA 1OCZB 4F7KA 1N68A 1HAUA 4YSDA 3X1BA 1OCRB 1JVLA 1DZ0A 3ASNB 5FC9A 1OF0A 3NSYA 2AVFA 1J5DA 2YAHA 3BVDB 1XB8A 4G72B 4A2DA 1PCSA 1SF5A 3FYIB 4YSAA 3NJLA 1ILSA 4BK5C 2AZUA 4QLWA 1ZIBA 2N0MA 4DP7X 1FWXA 1AACA 3NP4A 4AI7A 1SFHA 3QJQB 2YAQA 3DTUB 1GR7A 2GI0A 2WO2B 2JFCA 4NERA 3ABLB 1YLBB 4HHGA 1J9SA 2HX9A 2P80A 1AS7A 2DWSA 1URIA 3NSCA 1A4AA 2FQEA 1SDDB 1TEFA 2LLNA 1OE3A 4WTQA 5I5IA 5B1JC 2PCFA 3S3BB 3AG3B 3T6VA 5I6MA 1PZBA 4YL4A 3FU7A 4YSQA 2AFNA 2IDQA 2FNWA 2IDSA 1IC0A 4WKXA 4AKQA 3PAZA 3X1NA 3SBPA 4DP9X 3MBWB 2XUWA 3NJMA 2YAEA 3T9WA 4MFHA 1GS6X 1KBVA 2XV0A 4UF7C 3SBRA 4E9XA 1OV8A 2Y69B 3S8GB 5I6NA 5TK4A 3CVDA 2FT6A 4A2EA 1NINA 1AAJA 1KV7A 1M57B 3T6ZA 4HALA 1WS8A 2PPAA 2PPDA 5I6PA 2FQGA 3IN2A 2WSDA 4L0PB 2PCYA 2X88A 2BP0A 1VLXA 1ZDQA 1ILUA 1J9TA 2ZOOA 2AANA 2TSBA 4G71B 3FSWA 1HAWA 4YSOA 1A65A 1KCBA 3X1EA 1RZQA 4YSUA 4AKPA 1TEGA 2J57A 3WIAA 4YSSA 1PF3A 1BEXA 5F7AA 4G7RB 1NIAA 4GXFA 4Q89A 3OM3B 5I6KA 1NICA 2BP8A 4M4RB 2XV2A 3CVBA 3NSFA 3WKQA 4E9SA 1PLCA 3NT0A 1PZAA 2IDFA 1J9RA 1WA1X 2IDTA 1M9WA 3IE9A 2B3IA 4DP5X 1AR1B 4HIPA 1ET8A 2GIMA 1BAWA 5ANHA 1AZUA 1A3ZA 2J55A 2BWDA 1W6LA 4CSZA 2IH9A 1JZGA 3ZBMA 2VM3A 4Q8BA 4GP8B
chains in the Genus database with same CATH superfamily
3PV6B 2ED9A 4KAQH 4ONFL 1BIHA 3SN6N 3WNIA 1PEZA 3MNDA 4JFXB 4WIQA 3O0LA 4D7BA 2BIQA 3OKLB 4KJYA 2O5YL 1BX2A 4XNQA 2HX7A 3TWYA 4JJHA 5DJXA 2AJZB 2JCCE 3IFPA 2XXMB 1E27A 2AEPH 5IVXA 2AK4B 2AJSL 4YHML 1P5UA 3BZFB 5E5MB 4PTUA 4HAFA 3MGOA 1J5OL 2X0WA 1C5DA 3ALXA 4RLDA 4IIZA 4Z5RA 4FOMA 4W9FC 5L2KD 1GGIL 2WHVA 4YXKH 1IGJB 3P73B 4G6JL 4BSVA 4OJAA 2EDQA 4DO6A 1HXYB 3BFOA 3O81A 4PAZA 2YEZA 3V5HA 4NKQB 4JFQB 2ZG1A 1O7DC 5J13C 2DLFL 4N1EA 5EHFA 4DPBX 2J8UB 1F3JA 3TBSB 1Z3GH 3N41F 3TH3T 4JANB 1U2CA 2G4GA 1BZ8A 2ZKHL 3B2UC 4PCYA 3DVGA 3KXFD 3L3GB 5C07D 4YDMA 5AW7B 5GGQL 2AEPL 3HZKA 4XNXL 1DBJH 1TJHL 2J2ZA 2ZCLL 3DJSA 5SX4I 1ORSA 1TQBC 4CN1A 4UTBA 4JJOA 1A25A 4IRJB 4LLMA 1EEYA 3F7YB 4W68A 3PAYA 4HFUH 4I77L 4AQ1B 4OY9A 3CDYA 2J1XA 1A22B 5G5DA 3H3PH 2VLKD 4XX5A 5FA4B 1T2QH 3IJ8A 5FV2A 3HHSB 5GQBA 1ND0B 5EU7C 4RMRA 1MN4A 1U91A 3K8LA 5K5YA 3IETB 1AGDA 2AZAA 5E7BA 1Z9MA 3HG1A 4OFPA 1X5KA 3F7QA 2VN3A 4JW3A 4LHUD 2CRYA 4DQOH 4M9PA 3T0BA 4XAWH 1LYQA 2NT0A 4MRBA 4BFRA 4LSVH 5FYJH 4J3UA 1D9KD 5I76A 3UIZA 2ICWJ 4P5TD 4FRWA 4XCFL 1FYTA 4N8PA 4KZCA 2YN3A 1EAQA 5FYJE 3VI4B 2OZ4L 4D0CA 2B5IC 1R3JA 5A2JH 4DO5A 4PREB 4NDMA 4XBPA 3RP1A 5KEZA 5I82A 5AENA 4LNRA 4TSBH 3FB6B 5HY9A 5M95B 2ICCA 3ABGA 4Y4FD 4APQC 2H3NA 3QUYC 5D6CA 5ISZD 4GSRA 3D48R 5HJ3B 1WK0A 4WHCA 4PJ6A 4DPCX 5C2BH 1AGEB 2Q3XA 1GS8A 1R3KB 2EC9U 4XVSL 3IB4A 1A0QL 1KYOK 2VISA 1M6OB 4JAMB 2EE0A 3CPLA 3L2MA 3VW3L 2UY7A 1JWSB 1CXIA 4N2HA 3E2HC 5JDJA 5FPIA 1ZV2A 3QO1A 2AXJA 2K7PA 3ARFB 2FBJL 3M1BB 4OLEA 1DN2A 3PWLB 1MJ7H 3RDJA 1NSNH 2WVVA 3Q2NA 3L2NA 3QJZA 4J6RH 3MFFB 1M05B 4BXSV 4JRLA 3D0LA 4JKPH 5K93A 4YSRA 4D9QD 3S35L 2FZ3A 1Q9OA 3E38A 2IQAA 4G8FA 4AENA 2FO1A 1CMOA 3MCYA 4IHBA 4X7TA 3ECWA 3PNWA 2ALWA 1QSEB 4ONHB 3IJEA 1SHMA 1JNHA 3IVKB 2ZYSA 1YMME 2PWGA 4UDTB 3VTTA 4M00A 1JGDA 1F11A 3ILQD 1QNZL 5CBAB 4GPVA 1QZ1A 2YEZB 1HHIB 1Z0MA 3WIHA 3L1OH 3QJUB 4LIQL 5HHME 2VMDA 3A67H 2EVGA 2RACA 2RFXB 4M7JH 3NK3A 3ELAT 2WKOF 1TSHA 5DHDA 3B2VL 1BZOA 4JO1L 1I8KA 1RVFL 2IG2L 3AU1A 4MB4A 4PD4J 2HCZX 4ZFQA 3PL6D 4X99B 5GZNC 2GITA 1HNYA 4CAGA 3IFPB 1NBVH 2G75A 4UM9B 5A2IH 1NC2D 3RG1C 5A2KH 3ZDXB 3FQ2A 1S7WB 4JHAH 1UJ3B 4NP9A 1X5JA 2XI9A 1NCWL 1X5HA 4XGZB 1ET7A 1F8TL 4W93A 3VB9A 4IHOB 4NKIL 5CZRA 4JLRA 3MROB 3KWXA 2BVTA 3F7VA 2WNXA 4KKRA 1XX9C 3PWUA 2FJUB 4G6KL 2BP0B 1OM3L 1AE6L 1VA9A 5AB0A 3HEIB 3Q1SH 4M48H 2X70B 2V2XA 5MEND 4G7VH 1DP0A 2P26A 4DP2X 5CP3H 1CTNA 5B39G 5AD0B 4NNPH 3GFUA 3N91A 1J10A 4YHIA 2ZPKH 4MNHB 1T1WB 1T5KA 4NRXA 4F2MB 4F91B 3JBG7 3SD5A 3ISWA 5JXAL 1FNEB 2D7PA 3BDYL 4LHUB 4LVHB 3VXRB 1KXTB 1W72A 3MBXH 4QRPA 2B1AH 4LXFA 4XN1A 2AAAA 3AT0A 1G1CA 5AW3B 3LKSA 3KLHC 4JRXA 1N8ZB 2NX5D 3KYMA 4O58H 5IFHL 1GGCH 4FKEA 3GHBL 4HW6A 4KJQD 4R7DA 2BSRB 3FFCA 4N0UE 4C47A 1BXUA 2VXQH 4L4VA 4WRLA 5D7EA 4DZ8B 1OE2A 4N8UA 2JMRA 5CFHA 1OM3H 1NGXB 1RD6A 3CFQA 1RU9L 2KS0A 2HP4A 5B3JE 1JK9B 4R9HA 1EANA 4KKPA 3ZVVA 2WQAA 3UG5A 4WU7B 2KQNA 1FFPB 1FFTB 3E8VA 1L9PA 3GGWB 3U9PH 2VE6A 3LV3A 5TF0A 5JPNA 5CZXC 2D7TL 1NBYA 3DRQA 2P46B 3QYNA 4HUUB 4Q9BA 1L6XA 4J1UB 3V5DB 1XL4A 4YK4C 1VFAA 5IT2H 4D8PA 3NFNA 1UM6H 2FBJH 2H47C 2PMZA 5T3ZE 2I69A 4J4PA 4UCFA 4WFGE 1JPTL 3P0YH 4DEUA 2C4FT 4PRDB 2VXQL 5LWYH 4YSTA 1EMTH 5ALBH 3OX8A 2DF3A 3C6LC 1BG9A 2XVBA 1A4KB 2EICA 4MAUH 5KYWB 2Y6SD 1DE4A 4PJXF 3SQBB 2RQEA 2EE3A 4WJG3 3KDMB 3OKKB 1CFQB 4RGOL 1T5XB 1E0OB 2JWYA 4MDRA 3RAJL 2ENJA 1CFVH 5AL0A 3VFUB 1UURA 2C9RA 4R4ND 4NNYA 3QIWA 1O7VA 1AKJB 1U8NA 2A77L 3T0AA 3FO0H 5EU6A 3QXAA 2XZAL 1E2WA 1IKNC 1BMZA 2WCSA 5J0BA 2VT0A 4H13C 1W6WA 4E42B 4IYKA 3VQ2C 2LU5A 2NY1C 4G8IA 3VXQB 1X5LA 1KXVC 3O4OB 3NEEA 4HWUA 4JPIB 3SDAC 1E4WH 3VXOA 2BOBB 1A7QH 4MZ2A 1DQJB 4NFBA 4H25B 3KDMA 3OKKA 3KWVA 4JRYD 5HYQB 1U58B 2AKRB 3UZEA 3BUDA 1PLAA 2WXJA 5HVGB 5F1SA 2ITDA 1MCQA 4YMPA 5B3SB 4XZ4A 2XHNA 2O5XH 1IEBA 2ZCKL 1CZ8H 2AXFA 2ALAA 1XVSA 2OA9A 3O3DA 3PY9A 3CPUA 1ZT4B 1JZ4A 3EDEA 4M6MH 3U1SH 4RFEA 1U3HB 3SDDB 1A9BB 1T04A 3HAEB 3CC5B 4DN4H 5ILTH 3QFJE 4MCYA 4KBPA 3WBDA 3L4WA 4CGUB 4F20A 4DFIA 4K55A 4HAKA 1KF9B 1YPZE 1UC6A 1Y6NR 1BP3B 1HH9A 4WK2B 1MWAB 5D7IE 2ZE0A 4Q9CA 2W65B 1WP6A 4KH9A 1EGJL 2C1OB 4BFKA 3I75A 3B9KC 2HX8A 3H4HA 3G7TA 3QUXA 1UXWB 3DX8B 1ONQA 4E2OA 2NTSP 5HJGA 1KTDB 4HT1L 3IFNL 1V3KA 2VE6B 3LV3B 1P2CB 3I6KA 1FFPA 3L9BA 4PJIF 3WL9B 2WLIB 2OMUB 2J5LB 4XXWC 4OB5H 4OZGA 4K9JA 4NI6A 2IPTL 4AEIH 2ESVB 3HI6H 3R0MA 4WWKA 3UTSA 5E8PA 3K72A 1T6VN 1WZ1H 4ATTA 1GYUA 1I31A 4F37K 3EFOB 4KQ3H 4JRXB 4ACPA 1I9JH 1DZ0A 4O2FA 1L3WA 1U8PA 3GINA 2A4ZA 3VFSA 2DQUL 3OLIA 3VD0A 1OW0C 3DVIA 4TV3A 3MLVH 2FJFB 1WSST 3OKDA 4JO2H 3ARDB 1TJXA 1YMMD 2AERT 2O6EA 1JGVL 3AFLA 5FGCB 1ZSDB 4U1HA 2NR6D 3QXVA 4Y4KA 5BZWA 2Q8AL 2VDNB 3RWEB 3BLKA 3FQUB 1I3RB 3IRCA 1V8HA 3QJQB 3TNMB 4TSBL 4WLCA 3IE4A 5A40E 3UYPA 4KTGA 3MLYH 1TENA 3IJYA 1QFWL 8FABB 4AOFA 4BQ8A 4YZFE 4L9DA 4RMUA 3D33A 6FABH 4AT6B 1I7UA 3TJEL 4JLRB 2AGJL 4P2OD 4KKCC 3WJMB 2LVCA 3EHBC 1FL5A 4B41A 2P5EA 1RXLA 4OLVL 4FQIH 4NC1C 5CGTA 3O6LL 4E41E 4MVBC 2N59A 1E28B 4EVNB 5HHQA 3EGXA 1BLNB 4GW1B 5D5MB 4X6DE 2OR9L 1FZMB 2NXYD 4ZPTB 5IBUB 1Y6MR 3ZLQC 2HPOA 2XQBH 1H3GA 3EOTH 5K1VA 1OK0A 4JMXA 1T03L 2FECI 2N3JA 3ESVF 4APXA 5JPMA 3O2DH 3O2VL 1F2XK 1G9HA 2QKIB 1KC5L 3PJSB 3FFOA 5B3NA 1N7MH 2VN5A 3O6FD 2R8SH 3VFMB 5TE4H 2HJKA 2VNCA 3HNSH 2EDJA 2WXFA 2ZX6A 3DXAD 1A7QL 3QH3A 5DFWH 2XWJB 1IGML 1SY6H 3Q2WA 2FT6A 4G3YL 1F1AA 4XRCB 4N2NA 1WEJL 4HH9A 4HEPG 1M57B 1CD1B 4H40A 1I7ZB 2AJYH 3MXVL 3PF2A 3MRHB 1SZNA 2VWEE 2E27L 4L0PB 5AOMA 3UZVA 3T0EA 2PCYA 2NY2B 1ZDQA 2GI7A 4KI1A 5L4IA 3VXQA 1WIOA 1N9PA 2NXZB 3D25A 4L5FL 1QEWA 3QZNA 2VC2B 4F5CA 5IROA 1HAWA 3M1BA 3UEQA 1F6FB 3C09B 3LD8B 3V6BR 4AH2B 2ENPA 2J57A 1IAMA 3RZCC 4MB5A 4I88A 2X4PA 4GXFA 5TTRA 1KPUB 4JPVL 4DVRH 5FECB 4LEOB 1J1PL 3CK0L 1ZHNB 1FL6B 2KC0A 3KNBA 3GHEL 4EI6A 4L4VD 2Q2EB 3QB7C 3EKCA 2F74B 3L5XL 2K8MA 1YQVL 2AJUL 3P3TA 5IQNA 1JZ2A 1R3HB 2QMKA 2FEJA 4TLSA 5TDOA 1H9DA 2A6IB 4KXAA 4R4NC 3STLA 1DE4B 2J55A 1URZA 2YSTA 3AABA 4N2KA 4UT6H 1QX1A 3CCHA 1NMAL 1YNTF 1JZGA 3A3YB 4RDBA 4B3VA 2YUXA 5SWQB 5LXGH 3BKYH 3QZWA 1L9MA 1F45A 1Z9NA 4QHNA 1BF5A 5SV3A 4G43B 3BH4A 3LH2L 2DWYA 5DT1L 2BSTA 5JIKA 4LBAA 2VM4A 1E4JA 1KXHA 3S5LG 1MFDL 5IVNA 2WJ7A 2A5UA 3BO8B 3NPZB 1I7TA 4PGDA 3IT8D 4PEEA 2K4AA 4PJ5A 4GQZA 4KKQA 3K80A 2VLRB 4NKOA 3GD1C 2MOGA 2OZ4A 3HTLX 4RH4A 1MNUL 3VXSB 3BN9D 4MA1C 5KVGH 3NJNA 3GS0A 4XPGL 3KPNB 1AZCA 2H0JA 4KKAC 5HHNB 2DZEA 2CBPA 3F62A 4LLMB 5F7KC 3MODL 2OTWA 3KPOB 3EYQD 3F65A 4XCYB 3S4SA 3GSUB 4XMPH 4WFGD 5JIPA 4RX4D 4JKNA 4ODTH 3FOMA 2Y7MA 4P46A 1R24B 4NZJA 4JFDB 5F7BA 4ZUSB 1UENA 2H32H 2OCJA 3TA3C 1E6OL 1PCXA 3SKJH 4LPYA 3U9UA 4HWBA 4YN3A 5FHAL 3KBPA 2WZAA 3RWFA 3RIAK 1B0GA 1T1WA 2VXVH 2DYSB 4NRXB 4AYBA 3UPCA 4F2MA 2OL3H 1XZ0B 1CYWA 3DRTB 3O9WC 3IFOA 3FQYA 5FEBA 3EDKA 1FIGL 1IGJA 4IEFB 1DHKA 4X80H 3EDJA 1I1YA 1DSFL 1SHWA 3QR1A 3WKML 2A73A 1GS7A 1R1CA 1RK7A 2CSPA 2Z1KA 1LQSR 5FGRA 1UD5A 1YUHB 3BPOC 2X9WA 1JZFA 3QUZA 5AVVB 5DJ2B 3RTLA 2R1WB 5IESH 1Q0YH 1N0LB 2J6EA 2X2YA 3IGAA 3F8UB 4GG6E 4PCTA 5KBDA 5AAMC 3EUUA 4JG0H 4NM4H 3RVXD 1HHJB 4A68A 5JIQA 5KS9E 3GUTA 4UB0H 4IRSD 2XFXA 2RALA 3WTUA 2VDKL 3IS0X 3SO3C 3K81A 2OMWA 1CFNA 3QC6X 1JD7A 3PV7A 3IDMA 4JKMA 4N5ED 4XNYL 4Y4HC 4W9ZA 3DYPA 3W1ZA 4Z76B 2MTAA 1JTPA 4Q6KA 2B1HL 2R2HA 5ICYB 4NUMA 2DI9A 3GLEA 3VDBA 2WBJA 3BN3B 3HKFA 2AF2A 4GAAA 3WMPA 1XB3A 3PHQB 1MIML 2DKMA 4DKAA 3Q06A 3HN5A 4WWKD 1IL1A 3CXHK 1D5BA 4LL4A 1NCHA 3HG0A 4QTFA 1CXEA 4L3ED 2YC1B 4WHTA 5I9QB 4CVUA 2YBRA 4QRSB 3CU7A 3X2QB 4F9LC 2GABA 1BOGA 5HVWA 1N6QL 3EUDA 4LCWB 5DFVC 1E9OB 4A2GA 3ULSB 5TQ0L 4X9FA 1S7TA 4L29B 4A63A 4O4YH 2B4CH 4HISA 3S5LB 1BGXH 4GMTL 2AXGA 5EEUA 2RGSA 5C6WH 1BREA 2PWEA 1KXQA 1RURH 3CH8A 3ULVL 5IQOA 2LE9A 4XWGL 2NY7L 5DUMH 3EBHA 1W9XA 4PRNA 4G9FD 1JDDA 1M6OA 4JAMA 4FFYH 5EUOF 2UVFA 4TVPD 1CQKA 2NY3C 3HPJB 2AABL 3K0YA 3Q48A 4NEHB 4X5XA 5D70H 3TPUB 4AMWA 3LMJH 2C3XA 4HX1A 4YDIH 1OP3H 2MQCA 2CRMA 2P5ED 4C4BA 4FQ1L 1WZLA 1L7TL 2Y7QA 3N0PB 4H1LB 4P5MA 5LN8A 2FH8A 3MNMA 2D4DA 5DD6B 4BZ2H 4Y4HB 3KWWB 1AP2A 4S1QH 4XO3A 1R3JB 1S9WB 4N0UA 5T33L 4QGYA 2H26B 2MOVA 4L4TB 2MSPA 2Z31B 3K6NA 1RCYA 5LBSL 3RL2B 3CSFA 5EO9B 3KW8A 2ZUWA 5JW4R 5E2UL 4WUKL 1AHWC 4DWHA 5HI3D 3DTXA 4H0LC 5GISL 2Z35A 4AGOA 1SYSB 2DAVA 4IIQA 1KOAA 1JMXA 1YEIL 4N1HB 4NRYB 1JYXA 4TNWF 4PR5B 5CGMA 4XN5A 3K71B 1XF5B 2BMKB 4K5LA 1HYRC 2IF7A 1A02N 4JFEE 3MJ8A 3Q6FA 2UUDH 2QELA 4MJHA 3TFKC 3ZE0E 5H94A 4NOBA 3S5LA 1PX3A 4Y19A 3LPPA 3ARBA 4Z7VF 3HZKB 3B7RL 5ESVB 2XC8A 2V5TA 4HJ0D 4MJ2A 1BQHG 2P5EE 3NIGF 4OKVB 2L7EA 5E6IA 1B4TA 5CSBA 5J57B 15C8H 1NQBA 3G04B 2WOYA 4DT2A 2X6CA 3Q1EA 3SKMA 4F58H 3TYFA 5K33A 2Y6TE 3B2DC 3MRMA 4ELMF 1E5YA 4DP1X 1JNNL 1NOFA 3P69A 5ADOL 3B43A 2GYSA 4U1GC 1RHHA 3GTTA 3T77A 3H9SB 5IJBC 5I8CB 3PIQB 4PJ7F 5E4OA 1F58L 5JXED 4KO5A 3QUMH 1IGYB 5F89B 5EWIH 2FIKB 2HLEB 4M5YL 5J9PB 1SJHA 3R06B 1QKZL 5CCGE 1RIUL 5FW6A 1Q1JL 2WQVA 4HIJB 1KCSH 1GY1A 3PGCA 4N68A 3BE1H 3IDXL 3IKCB 4UYPA 1TTBA 2AJXL 2V3FA 4BQ6A 2CGRL 5DR5H 3HC2A 3O9WD 2O6CA 1HOCB 4AUYA 3K2KA 3OWEA 1T1YA 3G3LA 4OQTH 3L95A 2XVGA 1T6WA 5AVWB 4XP6H 4X6CF 2VDOB 1KCLA 4WI5A 5D1XD 3FOLB 4OV5B 1P53A 3QEHA 1A5FL 1N0XH 1CF1A 1FG2A 4JM2A 2ESVE 3RQ3A 4WCYL 4KUCD 3RJOA 2K1MA 5AW5B 5KBPA 5D96B 1PDKB 1G6RL 3L08A 1F4WH 1TOXA 1VEMA 4A67A 3BWZA 4IK6A 3E3QC 3ROOA 4PY7A 3TBCA 1BMGA 43CAB 3UPAA 1NBQA 4M43H 1K72A 2NY2D 4PB0H 4U1SB 4RX4A 1XIWD 3EH5B 3MRJB 3GBEA 3WN6A 3EO9H 1IARB 1Z6JT 4GKLA 3CFTA 4FDWA 4QCIA 3C09C 4FMFA 1LILA 2VMCA 1DQDH 1YPZB 4Y2DD 1Y1UA 2NXZC 5DURB 3QORC 4QYOB 1AOZA 1IKFH 2AK4D 3C2SA 2R23A 1BD2D 1NDTA 4YNYB 3BD4A 4WKZA 2KMWA 4O51A 1IQDB 4OZIF 1EWHA 2YK1H 3OB0H 2R0WL 3RY6A 3H3PL 5JW4M 1R0AH 3BEWB 3C6LD 4MA7L 2OR8A 4H20H 5AZ2L 3ZX1A 2BINA 2PLTA 3MUGB 1LK3L 4XPAH 3CN3A 1QO3A 2J8UF 4I2XB 4KDTA 1FO0H 2FTAA 4Y8AA 4NCC2 4O02L 1ZK9A 4JDTH 2H3KA 3L5WA 1H5BA 1KGYE 1QHOA 4DEWA 1R6VA 3V6FA 4B95C 3C9NB 3UP1A 4YX2H 4LASL 4MD4A 3VMPA 3OKOB 3WMSA 3T5WA 2UUDK 5SWQA 2DTSA 3T1FA 1A14L 3C5JB 5KZCB 1G6VK 1EHAA 2BOCA 1CFBA 5E5LA 1WCBA 2R29L 3MBWA 4F1SA 2BIHA 1U92B 3IU4H 4OGZA 5L2KA 3CDCA 1JGLL 4GW5A 4JFEA 4PJDE 4R0LA 4HULB 4Z3JA 3N42F 4EN3C 3ULUF 4YZFF 4AGLA 1DQIA 1OCZB 5C0EA 2D03H 1FV1B 2J6WA 3DK0A 1EAJA 3K2MC 3QK0A 3F85A 2O61B 3S2CA 5AYTA 2NT1A 3L3IB 3MZTA 3D69B 5DHVH 5I1EL 1KBPA 3T0EB 4HK0A 1I8IB 4AXWA 5KVEH 3O4LB 3BAWA 3ZYIA 3GXMA 2F8IA 4HJGB 5I17B 2PO6B 4L3CA 3V4PA 3V6OA 3TNNA 1ZKAA 2WAHA 4RMSA 1TZHA 4ZFOL 3U1PA 2YPLD 4UV4L 5IF0A 5MHSE 3EYVB 5GRJL 3HZ3A 1OSZA 3ABLB 5ID1B 1WBYB 2RD0A 3NJVA 3NSXA 4GO8A 1HK6A 3WFHB 2VYRE 1T7YA 3MYJB 1AS7A 1M3IA 2J5LC 4PS7A 4PJGE 3Q3GA 4LHQB 2E9GA 5DUJA 1EUTA 2I60L 1QTPA 4NWTL 4KVNH 4JO3H 4M7ZB 2O5YH 2YR3A 5F9JB 2EDYA 2CM6A 2EO7A 5ERWA 3UDWC 2XRAH 1IC0A 5I1IL 4KKZA 3H7BB 4DP9X 4RQQA 1IFGA 4XC3L 2VLKE 3GMRB 3W0WE 2ZT9C 3RVTC 5FLVA 1OCWL 1ZLUH 4O9HL 4HUKB 1BVKA 1AI1L 2WANA 3MAWA 4MYPA 3TO2A 5E6SB 4HC1L 5JYLA 4ZZKA 5EA0H 3TBVA 1DQDL 3EXJA 4Z0XA 3NDYE 1WZAA 5SX5K 4NQSA 3UMTA 1S3RA 2K6WA 2SEBB 5KBMA 4E9XA 4L2LA 2K8QA 2X6BA 5DO2C 1ZPLA 3Q5YA 3HRZC 1OWWA 3MLRH 1A7OL 4RMWA 2HTLD 4HALA 4PLJC 5EULV 1BM3H 4TSCL 1F0LA 3ARDA 3K6DA 2WW8A 1ZLDA 2QKSA 3EHBD 3SKUD 2FJFA 2YPKA 3O4OC 1EEZA 1MXGA 2R0ZL 3HS0A 2TSBA 3K1DA 5IMKA 4DKEL 2ADYA 1KCBA 4BE6A 1MCOH 3EJJX 1UXSA 3DSNA 4H8PA 4NQXA 5EO0A 2EXSA 1S6NA 4LLYA 4U1MA 1MKFA 1QVOB 1RIVH 3F84A 1OTSC 3K72B 3PDOA 5JQ6H 3A22A 1HHGB 5J4MA 3DX3A 1E9PB 3RWIA 4LLWB 4M4RB 4EUPH 1TTUA 3WKQA 3KVDD 1HI6B 3GZPA 1YNTA 4PJBB 5L4MA 1RPKA 2LHAA 1M9WA 2NLJA 3K2UL 1YMMB 1HKLH 2LQRA 2XTJC 1BAWA 1Q9WA 1HVXA 1NLBL 1JI1A 1RJYB 3FTUA 1QUNB 3DECA 4JY5H 5DTFA 1E4KC 3MXVH 2CMRH 2BNRD 3AU0A 2IALA 2XT1B 4OIBA 1VADA 3WJLA 4CSZA 3BGAA 4QYAA 1UZ8A 4X8GA 2NY4B 3BT2H 25C8H 3I75B 4JEGB 3V4UL 1G7LA 3GBMH 5FO8A 1XH3A 2W65A 1KPVB 1S4IA 2X12A 1UB5A 4ANWA 2AEIT 1A1NA 3T4YA 4X6FA 1U33A 4L5FE 3BVNA 4JPKH 1BVLB 3EOBA 1ZV5A 4FQPA 1G9NH 4Z78B 2PR9A 5HGAB 2AV7B 1E8ZA 4G7YH 4U1KB 3RYMA 1MFAH 3T65B 3QDMA 2JF1A 1LTXA 5FGBC 1YAZA 2D7NA 4DUXA 1C5CH 1C5CL 2KBGA 2JLPA 2YQGA 1RFDH 2FWLB 4N5EC 5CHNB 3F00A 3VRLE 1ZE3H 3PXLA 3LKRA 2JQMA 1P4BH 4FXKB 2OW7A 2ZAIA 1T2JA 5I1HH 1EBAA 1MRDL 1N10A 2P5WA 4H26B 1DVSA 5HPMB 1WWAX 2NX5A 3OKNA 3INOA 4CKQA 3F58L 4LVHC 2ZZUT 3EH1A 3HJ0A 4ORGB 4UILH 4WSJA 4CMMA 1W8OA 2VC2H 4HHAA 3G9VA 1XGTB 4LPTA 5ID1A 1WA0X 1UWXK 2A99A 1NL0L 3OAWA 3QQ4A 4PJCA 5IF0B 3Q8EA 4FABL 1QMUA 3ILEA 7CGTA 3KS0H 5IM7A 3LZFL 4CNIA 1FGNL 1NM9A 3HB3B 2IANE 4GS7B 4UNUA 5FFOA 3VB8A 1BYNA 1XZWA 2ODIA 1CICB 4HF5H 1I53A 1J05A 1GOFA 5DK0A 1ZLUK 2OK0H 2X6VA 2A0LD 1XD1A 4NT6B 2X9YA 3LXAA 4TUUA 4K94L 5D7SH 3E6HA 3H9ZA 1VKXB 4HS8L 2VDOL 2EEBA 3BDYH 5B39A 1E65A 3CFMA 1G7JA 1EDYA 2IANA 3VSVA 1HSAB 3T3MB 4NWUL 3FU8A 1UM4H 2VLME 2W95A 4KMTL 2PXYD 2VXQA 3RWHB 2JIXD 4GEJA 3WEXA 1HILA 1R5IB 2DJUA 1L7IH 1X7QA 4UDUA 3EAKA 3Q1SL 2QV2A 4M48L 4PV9B 4PY8I 3H4FA 1P7QA 2P7TA 4NZRH 4ELME 5H35B 5GHWH 2DQ6A 3C8HA 3EJYC 2VH5H 3GKZA 2BY0A 3N04A 3RILA 1G87A 1HCZA 4FYQA 2DYPB 1HSBA 4B0MM 4R7DB 1TJMA 5IHUH 3AITA 2WLLA 3SZ6A 1TXKA 3FUHA 5DGRA 2CXKA 5EU6D 3GBDA 1O9WA 3CHRA 1AS8A 3OAUH 5TE6L 1HEZB 2FATL 2DV6A 1OLLA 4LRIA 4F57L 4TOYH 3RI5F 5FX3A 4LEEA 3WO4B 3FXIC 4Q7DA 5F7NC 5F7UA 2E74C 3SPVB 4YPGA 1OB0A 3CXFA 3EYFA 4RWHA 1DBBH 4PJ8C 3ARFC 1P7QB 4IJ3B 5C0ND 3SYPA 3E2HB 5FKPA 5DO2D 1W72L 1NCUA 5J12C 1SLWA 2LGNA 3BAKA 3O41A 3BH8A 3QQ9C 4C56A 1VZGA 4ZX3A 2F54B 1YJDH 5F6IB 4IHOA 4Z7OF 2TAAA 1T20A 3JWOC 4I9WE 3BW9A 3C8KA 2A6DA 2WD0A 2YAOA 5GGTH 4OLVH 3UL4A 1VGEH 2ZF9A 3GRWL 5L7XH 1KJ3L 4M8VA 4JY6A 1K8IA 4JCLA 3ZN6A 4RRPM 4UM9A 2V17L 4LT7A 3LSOA 1CWVA 2B5IB 4GEIA 2YOAA 4PY7B 3TN0D 2YMTA 5C0CA 4XN9A 3P4NA 5E5UB 4X80L 2Y07L 2P44B 5TK2A 1NCAL 5D2LF 4NZTL 3V0IA 4N90E 4UIKH 2QHRH 4HPOH 1V7MH 5B8CC 1T0MB 4PVNA 1AGBB 6TAAA 3FUDA 1RJCA 1TJGH 1RK1B 3B8YA 3D4CA 3KPSB 1TQTA 3TN0B 4JHWL 4H8VA 2FQDA 1JVOA 3AM8A 4JDEA 5LQBH 2BFVH 1NL0H 3QNXA 4BQCA 4XP1H 2WO3B 1L9TA 5HBBA 4LL9A 3O4LE 3RE0A 3S2AA 3GIVB 4AQ1C 3GK8L 2ICWB 3WN5A 2ZWNA 4BUGA 2VXUL 3ARDD 1QRNE 1SJHB 3Q8FA 1BYOA 1E3XA 3D9AH 3PWJB 2H6PB 4DF9A 4A2LA 1RUKL 1SDAB 4W1TA 2A6JA 4FJYA 1YUKB 2K7QA 2PTTA 3LRSA 4UANA 3O6KL 4XMUA 1OK8A 4Y5YA 1K6QL 1OTUD 5FM4A 3IGLA 3NA9L 3EJZC 4WY7H 1NAMA 1N67A 1B2YA 3JWOH 2KERA 4KX7A 4QPEA 5E4EB 3IN0A 1NIDA 1BV8A 4X6CE 4PRAB 5LKNA 3D2UA 3QRGH 5MEQA 4QRQB 1M9SA 3HBQA 5BQ7B 3NJJA 5IJKA 4M6OH 2BNUB 1N5YL 1VZIA 3SE3C 1E9QB 1TZAA 2VW7A 1SEQH 4BFNA 3UBGA 3VTAA 4P2AA 4PWJA 4XNMB 1A1NB 4XVUC 1OAUH 2CU9A 4KMQA 4UT6L 3RGBA 1ID2A 2HH0L 2UY6A 1GY2A 1X6NA 2GTWA 1KN2H 4PP2A 5DC2A 2WZ5A 3CLFH 1HIMH 5CCJA 2Y06H 3CDGB 4B0MB 4I8DA 4TLUA 2UV3A 1QUNA 2X2HA 3TYGH 3S3DB 4RAVB 4AYEC 1I1CA 5C0JB 4KZEL 1IGCL 3L1FA 5D8JH 3VRLF 2O93L 5F6IC 1AS6A 4H1LG 3MRNA 5HYJB 1A0QH 1BQ5A 2ARJQ 4P4KA 1BZDA 4FFWD 3PAVA 2Q87A 5J12B 1SLUA 1GHFL 4ANKA 5MI0C 3MI6A 2FNBA 3C75A 4IJ3C 3O3EB 2UZYA 4PJ8B 5L9DH 2ATAA 2KUTA 1U36A 3CDZA 4OFIA 4F33A 2VWEC 4FS0A 3RGHA 4B5ZA 3AREA 4L8BA 1CXHA 3QR2A 1IBFA 4ZXBB 4AC2A 3A4EA 1DUZA 4GAGL 1D5MA 1P5UC 2XX1A 2E9IA 2P8LA 1OT1A 1EJ6A 4ZO9A 2NPLX 2IADA 5GJSL 4WJKB 3Q9PA 5DK2A 5DZOA 2DMHA 3OTTA 1E42A 2JQZA 2OQJB 4LF3B 4LSQL 4FC3E 1L0XA 3JTSA 5JIMA 1VFBA 5JLZB 1R17A 4Z0BL 2QPSA 4F15B 4J3OH 3NZ8A 4AIOA 2GJZA 4G1EA 1NFKA 1MJJB 1CLVA 3M7OA 5I1LB 2DOCA 2HAZA 1F5WA 2QDWA 3SDYL 3WTYA 3K4DA 3BUYB 3OWRA 3ATEA 4N87A 1UKTA 1NSNL 4DERA 1NPNA 3GMRA 4E9VA 2OMZA 1Z1WA 4P2YA 2HXAA 3O3AB 5B1JA 4PJAE 2DS4A 2XY2A 2ZOLB 3MRQA 1QKZH 3MRDB 1CU4L 5AW2B 3BP4A 4G1MB 2MIZA 2JV6A 1SOKA 5F7FA 3L5JA 2Y3AA 4OV6F 4TQPA 3RWGA 1SNRA 3KPTA 2HZHA 4OF3A 2G5RA 3QEGL 2DIJA 4TTDC 3WELA 3O6FB 5EUOA 5LBVA 1GMIA 4NN6C 1UOKA 3NK4A 2IAND 1IBBA 2IOMA 3N55A 4FQ2L 3RBGA 4PJ5D 2GK0A 1B4RA 2Y24A 2VB5A 4POZD 1BM7A 4GS7C 4E9RA 1M1SA 1EGJA 5D2NC 5F96L 1U8HB 5FCUH 2JCCA 3DUSB 5AVZB 3GDCA 3OR6B 1DJXA 3O4LA 5DQDL 1CFNB 4N0CC 4Z1PA 4UOQA 2V2WA 3VH8A 5I0DA 1ZA3A 5KJ7E 1N68A 3A21A 5EUOB 1OCRB 2O4EA 1I1AD 2APBA 1YEEL 2JJWA 4ONFH 4BKLA 5E00B 3VJ6A 4Z7UB 5BV7L 1T4WA 4FTVA 5AOKA 3LH2H 4OZHE 1DFBH 5GRVK 4MNQB 3SE4A 1JV5A 3D39D 2O26U 3CXHJ 4OFVA 5I1GH 3BJ91 2XKUA 3NEXA 3ZDXF 4YDKH 4JFEB 5KSAC 4EDWL 4XAKE 1DQQA 4OFKA 5DJ0A 4B9JA 3LQAL 4LSSH 2YEQA 5ICUA 3NCWA 5D93C 1FE8H 2IH1A 4GKOA 4AMKH 1XZ0A 2F7PA 3ARBC 1MY7A 3AMLA 4W9IC 4C56D 3VYNA 1UT1A 3EJCA 3MLUH 1X4ZA 3EBIA 3D18A 2Q7NA 2YD9A 5J6GB 1MEXL 1UKQA 3FN3A 4MMZA 5K9QG 2QR0A 3C9NA 1IGIL 2GCYA 3FZUD 3HHRB 1HINH 3RVUC 2A6KA 3SYOA 5I15L 4IRSA 5L9DL 1KZQA 2GJ6D 3FU0A 2R9HD 3KBFA 1QI5A 1UJTA 4MMZB 4TVUA 4WHYH 4M1GL 4IRZH 4PBDA 3GSUA 2YOCA 2FJGB 3KPOA 4YSQA 3KL5A 4NPKA 3QARA 4NO2B 4AKQA 3AS3A 3THMH 4DK6A 3WNOA 2JVUA 4FFVC 4U7MA 5C6TH 3FNKA 3X1NA 1J8RA 1AIFB 5KVDH 4IS6A 2XTJB 5BRPA 1TTGA 1GC1H 3P4OB 1NBCA 4P3DB 3EH2A 1ZLVH 3L3DB 4PGDB 4ELDA 1IE5A 4J3OG 4KKBC 4YDZA 5FUCC 1LGVA 1LO4H 3LPOA 4XWOD 5GRZA 2A77H 3HPLA 4ES9A 3CZGA 5IVZA 4LLQA 2BVUA 4HJEA 4CVZA 3H3BC 3P30H 1J0JA 1OT2A 4FQJH 4WEMB 4AM0B 4Y5VB 4OF5A 3U7YL 3H3KA 4I2XE 5EN3A 1AJ7L 4UOW0 4FG0A 3UXFA 4EIBA 4U6YB 4PFEA 3RVVD 3BX7C 4GQPH 1A7BA 1OGAD 4TULL 1SXZA 3EIFA 2DQJH 3FRUB 1T80A 5FYKH 4AKPA 2DQHL 3TJHC 4XNUL 3I2CH 1HYSD 4F7EB 5DHVB 5CEXA 1IEAA 2ZUTA 4JJ5B 3VI3A 2KZKA 4HHAB 4X6DA 5HHOA 4FNRA 3TFBA 1IRAY 4PTTB 2BM3A 1BG1A 1H3TA 2NW3A 4F8OA 1QFPA 4GKNA 1VZHA 4UOW1 4YC2B 3I9IA 2WC7A 2GIMA 5GS3A 4QRTA 4LLUB 1EMTL 5ALBL 1G7PA 4O5LH 5CHNA 5F7DB 4LOUC 4LSUL 4ZMWA 2VM9A 4PJCE 1EX0A 2H2PC 3OC8A 1KWGA 4FI6A 4PWGA 1EHLH 5H8DA 4TNVK 2YN5A 2EEXA 3FU9A 4K5NA 1W0WB 2D31B 3ARSA 4ZX5A 1KCRL 1XGQB 5I1LA 1ZVHA 4Y0GA 5E95B 2B15A 5JQ6L 1S7XB 3LNGA 4GKZA 4DCQA 2Y0SA 1UH3A 2KKQA 1OO2A 1SOQA 3CBJB 3F5WB 4YBQC 4G8GB 2OMBA 1LL1A 1HHHB 3FQXA 1G6RH 1JPFB 4DQOL 5DK2B 3ZJAA 2E7CA 3E7JA 3FUMA 4N9GA 4NNPL 1CR9L 1PY9A 3T0EC 1WTLA 2VQUA 1UZ8B 1A3LH 4EAEA 2I25N 2DKUA 3EO0A 1FSKC 3UADA 3VA2C 1WAAA 3BAIA 1AVAA 2NNAB 3IEAA 5EO1A 1QOKA 2CJSA 1F02I 1HIML 3MVSA 2EIEA 2I07A 4NQCE 4M3JA 2WCPA 1ZA6A 3HE7A 3QUHA 1XSOA 1DANT 3L9RB 3ARGD 3K6SA 4EN3B 3SBQA 3QIWC 1RERA 2VSMB 2QT6A 4OLYL 2OXHA 3IYLW 4M61B 2Y1AA 1IJ9A 2G3NA 5GJTH 2FL5A 3UC2A 4BK8A 1HL4A 1U8KA 3D30A 1IT9H 4W81A 4Y4HD 2FQFA 4MASA 4GXUM 4R5XA 5LO7A 1EEZB 1KXVA 4YBLC 5ADPH 2RR3A 1UADC 1WJ3A 4NO2A 1ZRUA 4MDJA 1ZHKA 4HT1H 1YHPA 1X5AA 4GXUN 4XVTL 1NZRA 4PW4A 2NDGA 3WSQL 3BPNB 4NUPA 3C60D 1FVDB 4HJIA 1QHQA 3MJ9L 4L9LC 5A3ID 2YXFA 3G6JF 4XNMA 3O0RL 3P9MB 1DLFL 4LQ1A 2XQ0A 5EC1B 2BH0A 2NYYD 5IMLA 3T2OA 4PJXA 4MA8H 3I9AA 4S1RH 2WCGA 3QT2A 3P2TA 4JFPA 5HYJD 2I85A 5IB5B 1MI5B 3G6DH 1S7UB 2MKWA 4PUBL 5D1XA 4MQXD 3CFCL 5H35A 5JHLA 4JHUA 4AY0A 1QBLL 3V0DA 2EDHA 2F7OA 3V2AR 2YRLA 4OFDA 4PQXA 3DUUB 4NENB 4A2MA 4L3EE 1JGEA 3DOSA 3CX5K 3MR9A 4RGNB 1OWRM 3NZHL 3S88H 1TQVA 4F1ZA 1BYPA 4PD4K 5EN2B 3EYSH 4QY8A 4D0BB 3NVQA 2IH8A 3QJFA 4NGHL 2FUQA 4ZW8A 3FT3B 3TU6A 4DK5A 1S7TB 3BP6B 4P57B 2R7EB 4UQEA 3BE1L 1AD0A 2NY3D 5GSRA 3NRFA 3B7SA 2FSEA 3EYOB 2F6AA 3VE0B 2A4EA 5TE4L 4QMEA 5HYSG 4KHTL 1E8XA 2IPKA 1WFIA 4TSAL 1EAPA 2CR6A 5F3HA 1HEHC 2X05A 3QCUH 4IBQA 1E43A 4U1NA 4XWOC 5I1CH 3S88L 3VQLA 3M86A 3NABL 3MUHL 3PL6C 5GZND 1Q72L 3IMRA 2WWMC 5D9SB 5GRWA 3TZVC 3WFDH 1XCQA 2VQ1A 2EXWC 3QNFA 1FYTE 3AXLA 2P5WB 1YN7A 4KUCF 5C09D 1CD8A 1BFOB 4MNGE 2XG5A 2EADA 2GJ6A 2A6DB 1OPGH 3FAXA 1NCGA 4ODSH 4HPHA 1ETZB 4WHDA 4HUXA 3TT3H 1UD8A 1V55B 1I8LA 4MMYA 1JUFA 3GMNB 5H37A 3STZB 4O4YL 3KXFA 4PMFA 1JF1A 5C07A 4EI5D 4DIXA 1JGEB 1S9KC 1KBBA 4C83B 1J0KA 1YUHA 3GNMH 3BKCL 4U1GB 4D9LH 3PP3K 2XA8H 1AIZA 2Z4TA 4HXBL 2VUYA 4NYLB 3WFEL 3FH5A 2BERA 2FJGA 2R27A 1QABA 4OJYA 2DY2A 3FL7A 3WI9A 1QQDA 3GXFA 4FADA 1FZJB 3CMOH 4Y2OA 3HMWL 3BQUC 5SWZE 2HJLA 3HFMH 3DJRA 3RNKB 3U9UB 1I9JL 1UFGA 3EO9L 3MJGX 4D9RE 1YRKA 4OCXL 1FH5L 1T3FB 4IDJL 3D18B 5FHAH 1KYOJ 4XH2A 2BHZA 4R26H 4ZJ9A 4U6XB 3MLPA 3UROR 1IM9D 1QASA 3C60B 1MRCH 1M7DA 4YGAB 5I74B 1FYTD 1BD2B 4HUNB 2EKSA 1U8KB 2A9DA 2H1PL 2OCCB 2FL5B 4KK5C 3U48A 4JFSA 3V4LA 4G7VL 1EIBA 2OXHB 4JE4B 4M61A 5A2CA 1EO8H 3BSZA 2LLLA 5IIEA 5HHOD 1EXUB 1XAKA 1FBIH 2Q3AA 2XX0A 4Y9FA 5KN5A 5EO0B 3OHXA 2Q86B 2GJ6B 4ZMZA 1ZTXL 1JZIA 2NNAA 2OFQA 4UQ9A 4OD1H 2OMVA 2E7MA 4PJEE 1ETA1 3I9PA 3R1GL 4FCAA 3TX4A 3RUGE 1KEML 1CLZL 5I18H 1CG9A 4GI8A 2DTML 4GNKB 3DTDA 4POUB 4NUGH 1MQ8A 4U6VL 3PGDA 4C54A 1JOIA 1C8PA 5BQDA 3GI9H 1RUQL 5HP5A 1FHGA 1AHWA 3PWVB 3UTSE 5LCVH 1E3FA 1RZPA 4ZMYA 3RL1B 3VG9C 1MIMH 1U95A 1MJ8L 4B3EA 5IJDC 3FONA 2AITA 4PJ9A 1Q38A 3BAXA 5GSRB 2ITEA 3DI2B 3OBAA 2XZAH 5KYXA 3LNEA 4F9PC 1ZVSA 5DUPL 4OI8A 5CU5A 2GSMB 4AV5A 3WEBA 4PB9H 3QZPA 3R06A 2ZOLA 4Z7WF 3KYNB 3P0GB 3SE8L 2CDEB 1MVYA 1JHLL 1K5NA 4KNTA 1K9TA 3UERA 2KHAA 4N2EA 3BZDA 5I6OA 1LK2A 3FQ4A 2ZUQB 1I7ZA 4XXWA 1IB5A 5E8EA 4N0FA 2IV8A 4LARL 5ES4B 3RY6C 2OMNA 3MX0B 1HL8A 3TYFB 1UT2A 4U1KA 1JGDB 3LEYH 5JO5A 5L0QC 2A9CA 3EDFA 3P77A 5L6YH 1T1ZB 3D50A 3FC8A 3AVEA 3QJOA 4LCIL 4P5TC 2VDRH 3WLWC 1NFDA 1EFXA 4G6AD 4IK7A 4YPJA 3LZFH 4JG1H 1RZ8B 5ESQB 3AUVA 4ZYKA 3STBA 2AQTA 4HJUA 3P4NB 3X12B 3CHOA 3SYQA 4NO0A 4KNQA 4HWEH 5E2TH 3OKEA 1ORQB 5DD3H 1LEKA 3AY2A 2EDFA 2VMFA 2X9ZA 4QRFA 1RJYA 4S2SB 3CFBA 5EORH 3QNZA 3U36A 1BF8A 2FECL 5KN5B 5HDOA 4IIQB 4NKDB 3N1FC 3D12B 1XGYL 4XP5L 3L4VA 3O41B 1A64A 2H2SC 4KMTH 4Y88A 3UJIH 2E7BA 1QYGH 5DVLA 2DMKA 2Z31D 1JMZA 3L54A 4PJFB 3T71A 1A9EA 1XCTB 2ETWA 4J27A 5GIRB 2BOCB 2C7FA 5KBNC 4JFZL 5EF2A 3O9WB 4RZCA 1IEHA 2BP8B 3V7MA 5DXWA 3H2QA 4MD4B 1TPXC 4KJWC 4LCUB 4HMEA 4OCMC 1JVLA 5T3ZH 5T3ZL 2X53A 3VM5A 5GS0C 3TBWA 1G9MH 2AMGA 1XR9B 1JPFA 1ZLVK 2WBJC 3LVTA 2OMTA 1OF0A 5FC9A 4B7IA 5C0NC 1IV8A 4M4PA 1IAIM 2YSSA 2ZYHA 2WLMA 1KTRL 3POCA 2MPVA 2KL6A 1NAMB 1PCSA 5LJYH 4AIZB 1ESOA 5T3XL 2IV9A 4J4PD 4FQXD 1J8SA 1IGFL 1Z3RA 1AACA 2CDFB 4OZFH 1SFHA 3K2UH 3P4LA 2CJUH 3FB7B 1PZ3A 4UNVA 3DHJA 1WZMA 1MCCA 2IJ0C 1V3LA 3U4BL 2JB6A 4M56A 5BJTB 3HOGA 3KYOB 3MV7B 3CGTA 1D5IL 3MV8E 5GZOC 2ZXDA 1UWYA 1FFOB 3QDME 1P84J 1QWUA 3QCVH 4QRAA 3ZDXE 3S8WA 3QNXB 1OGTA 1ZEAH 5T1LA 3UEZA 1X7SA 4XX1G 2QQLL 1HOEA 2HVBA 4FFZL 1VKXA 2PF6A 1KG0B 3CSTA 1IQWL 2VZVA 1X3DA 4IGBD 1OF2A 4BSVB 1QEXA 4ZTOH 5D71H 3I50L 5BS0A 2ZWYA 4NQEA 5CCKH 2QVFB 2JCCB 3DUSA 2P5WE 5K59F 2DJMA 2ZP8A 4JK0D 1AD9A 4AQAB 1PIGA 5JXEC 4HWNA 5I1JH 5DVMA 4J6RL 3H6JA 4IBZA 1HZHL 2H2PD 4PJCB 1QHPA 5T1DH 5T1DL 1FDLH 2DM3A 4Y1SA 3MLZH 4AEFA 1NBZB 5C08A 5L6YL 4LBEA 3BSZL 3RZCB 3MREB 1Z3GL 3N06B 2VZUA 2RA1A 3LD8C 4M8QA 4ZSOB 2IXQA 5TFSH 1P4UA 1SEQL 1WT5C 5CJQH 2Z8RA 4IMKA 1EO7A 4KMLB 3FT3A 4FQ2H 3LPGA 1IQWH 3DSFL 4F8LA 2R1WA 3SDAA 2DM4A 3ZDZE 1IGYA 2EAEA 4NUQA 5KVEE 3L3DA 1NJ9B 2NZ1A 3DURA 1L9NA 2MTPA 4PV1C 1A6PA 5TD4A 5F21B 1HJBC 2CDFA 1MNUH 3O6KH 4RMBA 1A21A 1FHNA 3FF7A 3ULVH 1NIAA 5INDB 2JKLA 3SBWC 12E8L 5D8JL 2P8MA 2VXSH 4TPRL 4RGNE 5D1XB 2BZDA 4K73A 5HGAA 4YIQB 3WFZA 3M1CA 3FT1A 4DP5X 3V6FB 4OAWA 1CE6B 2IADB 1H5BB 4QF1B 5TQ0H 4Y2OB 2XACC 2P8LB 4J6IA 3BRDA 3C08L 2CKNA 4XCYA 2Z4QB 4Y2LA 5I1GL 1UD6A 2DIAA 3OXRA 1CFTA 4GP8B 3Q6FB 3S36H 3D3VA 5IFAH 1CGSL 2XV3A 1AO7B 2F5BL 4DEPC 2ZXWB 1I3GH 1YMMA 3LZPA 4NKOB 1U42A 1HTYA 2K70A 4W9DC 1BFVH 1MCWM 1CURA 1ETZA 3IGFA 2IPTH 4AEIL 1CLCA 2NY1D 3BCDA 4LQFH 3RL2A 1UB6A 3CFEB 1FVEA 5E00A 3VJ6B 2Q76A 4P2OA 1ZT1A 4GOSA 2GTWB 2W0PA 4UB0L 5TPWL 3U7YH 5DK0B 2JXMB 4JM2C 3HS0C 2WLNA 3NJFA 3VNZA 3MRRA 1NC2B 5BO1H 3AC0A 3LS4H 1HU8A 3CZSA 3JT2A 4F3FB 2QADB 3V4VB 1KGUA 4HX1B 1FNGB 1KYAA 4UV4H 1F8TH 2Q20A 1FG2B 3KPSE 4AK1A 7PAZA 4BWUA 1KNOB 1EZSA 5EIIG 1RV6X 1JF6A 1VEOA 3EYOA 4I4WB 4M6ML 4N25A 2CK0H 4FGMA 4XXCC 4PP1D 2E9BA 3OQ3B 1T1YB 1SBSL 3LRSB 5DZPA 2OULB 4ZMVA 4GRMA 3RHWK 5DMYA 4I85A 1S7WA 2PXYC 2CDEA 5DEGB 4GB9A 3JYBA 2Q8BH 1Z9OA 5JW5B 1BHGA 3N40F 3B9KB 1ES0B 4R4BB 1SF3A 5E94B 5HHPB 1FLRH 2G3XA 3FTXA 1Z5HA 1G84A 5KYXB 1EV2E 2UYLA 4WUUA 5F1KC 3BWAB 2FDBP 5AOJA 3MU3A 4WHTB 1HNGA 2B0SL 5FYKD 1KENL 1CGTA 4IJTA 4QT5A 4TVSa 1T5WA 3KYKH 2FB4H 1QLEB 3PJSA 4PTTA 4F5CE 4H0IA 2YGNA 2IPUG 3PWVA 1OSZB 3TTSA 3E8UH 4MBRA 2ZONA 3HUJA 4EDWH 5E6IB 3LVEA 2WQXA 4UUJA 4JPSA 2WQRA 3PHOB 5I6LA 4JVPA 3ZR5A 1M2OA 4H20L 2OI9C 3LKQA 1SOXA 2D2CC 1X5XA 2JXMA 2YAPA 5IUSA 4WTZG 5C0DA 5MEPA 2OK0L 4EVNA 5IUCA 4WO4A 4AJYV 4Y16D 1G6RB 4L8BB 1CLYH 3WNMA 2I26N 2BZ7A 4BM7A 1UTDA 1OGSA 2FD6H 1BQUA 4I89A 4MB1A 4EDXA 2F54A 2WVUA 3HI6L 3QDHA 3S3SA 4U31A 4QHPA 1KCUH 1X9LA 1MCJA 6PAZA 1BIIA 5HGHA 4JGUA 2QPEB 3KS0J 3PLYA 5C0CE 3VFGL 3QNZB 4PJ7B 5JA9A 3QIBC 3FZUC 3PDGA 1M7DB 2B39A 1A6AA 4Q74A 4A7QA 3VFWA 4U3XA 4PGBA 3T3ME 1J0YA 2E8ZA 1SQMA 2ZYIA 3GXNA 4FTVE 3OXRB 3GZOA 4P9ML 3WUWB 2OI9B 4NBZB 4E0RA 1NKRA 5BRQA 4OJEH 4GFXA 5DD6A 4GQQA 4WDIA 5H4YA 4OCYH 4A6YH 3RFZB 4LO9A 4OM1H 1RZ8A 5CINL 5E6IC 3CHQA 4PN6A 4EMZA 1QQDB 2XWRA 4GKZB 4DCQB 4EBQH 4ADGA 3HE6C 1ULVA 1QO3B 2BIOA 3NUKA 3LAFA 3TBVB 1KBKA 3N3EA 2D31A 4ADJA 4WU5A 5GJTL 4KXCA 4BUHA 2ICEB 2NOYA 1OAYH 1X7QB 4UDUB 1EHKB 5JQHC 2VXTH 3MJ9A 5DC9B 3DGCR 5F97E 3KXFB 5C07B 1B2WL 3B56A 4PJGB 1UXWA 4JDZB 4JHZA 4HZLB 3VI4F 2E56A 3UDWA 3GZQA 4HIIB 4XXDB 1BA9A 3G5VA 4AM0Q 3W2DH 2PXYB 4YWGH 1WRFA 3ZRSA 3NG5A 1UH2A 1GZPB 2A9AA 3AXLB 3L3GA 3BRFA 5GJSH 1BOGB 1I75A 4GKNB 1FNLA 4JANA 3RB7A 4JG5A 2H9GA 4K5MA 2YRZA 3SDAD 2PP8A 4PUBH 3NACH 5IBTL 2J4WL 5CEXB 1SXBA 1UA7A 4K3HA 3OKMA 4N9OB 4ADIA 3PFUA 4MKTA 4PRBA 3S97C 1HJCA 5JHMA 4MXWH 2ORBL 5EUOE 5FDWA 2NUTA 1ODUA 3GSWA 4FG4A 2F08A 1BXVA 2WQUA 2GBAA 3F05A 5DFAA 3D69A 2ZWSA 2O6PA 5DWUH 3KLQA 2H9GB 1RLBA 1JK8A 1U3JA 2VRAA 3QFGA 2AJZA 3L7FA 2V5RA 3L95B 4WI3A 1AD0B 4NN7B 1KWKA 4P57A 4OTXL 2V6HA 3NIGB 4LCCB 4I1RA 3ZKNC 5IJVA 1UHVA 5FYLH 4GRWF 2JKWA 3QS2A 4U1JA 4CL7A 3PGCB 1UEMA 4FNTA 2C9PA 4ODXA 1Z9LA 2G2PA 2N7SA 5JW3H 2NNRA 4XNXH 4S10A 3FSOA 3MRQB 1KJ2B 3BKML 1H6FA 2WZPD 2FLBT 2AQRA 3EW3B 4N5UA 2QPDB 4PJFF 5K1JA 4DEPB 3WTSA 1A3QA 1WV7T 3D3VD 5TF1H 4O9HH 3SPIA 4NZUH 3QGVA 3I84A 4IBVA 1OAKH 2X87A 1AMYA 4G9FE 5GGTA 1J8HB 4Y5XB 3JTBA 5E56A 2GJZB 3GMOA 4N2AA 5F7MC 1B0GB 3QHFL 2YD0A 3PPEA 1H5BC 2AABH 5D70L 4Q9QL 2I60H 3Q0HA 3O6LH 2CIKA 4ZUSA 4RSVA 5I6XB 3HNVL 3V5DA 4X2UA 5EU4B 3X17A 5E4AA 1PL3A 2ENQA 1SRDA 3DRQB 2Z7YA 4R26L 3IAPA 3UBXB 3ZK0A 2CGZA 2QZQA 1YEGL 1QBMH 1DVQA 1U8JB 4HGKC 5DTFB 4CMHC 1Q9WB 4DVBA 4MYWB 3CJJA 1DLFH 1KT2A 3O3EA 2R23B 4YNYA 1H19A 3FH7A 4LRNL 3LZRA 2FO4B 3FFCB 4KJWD 2F19H 1L9QA 2B20A 3F12A 1P5VB 4QXUH 2AC0A 2OZNA 4LFHG 4XOCA 2XOTA 3DSNB 5JOEA 2BNRE 3JVGA 1K4CA 3ASWA 5D2LA 5FGSA 3RWDB 3H42L 4U1HB 4F24A 2X2JA 3CC1A 4B96A 4YEEA 1NMBL 3U2IA 2C26A 3UFIA 2UZPA 2OL3L 3CMGA 2JSFA 1NANI 1JXGA 2Q5BA 3HC0B 4TRPH 3II3A 3VU2A 3ULVC 2WINA 4KQ4L 3FBKA 1AC6A 1KDIA 3MV9A 1A1OA 1U8HA 5C0AB 5K9OA 3H0TA 4JY4A 3PQYD 4ISVA 3STLB 4QWWD 3BWSA 2DQJL 5TDOB 4X5WA 2J8HA 4OV5A 4JVUA 1IZJA 1CVSC 2ZKMX 4P4KC 1MELA 3MROA 4EN3D 1WBXA 2RIKA 4AYFA 2O6FA 4XGZA 2OMUA 3W5NA 2EYRA 4XP4H 5A6MA 4KI5C 4GUPB 2V3DA 2R7EA 3AY4C 1EJFA 2X1PA 4EJ1C 1ZLWK 5E94A 2XG4A 5JMRA 2YAFA 2HG5B 5KSAD 5C3TA 5KWYC 2CA3A 4IBTA 1I8LC 2BY2A 3ECBB 4YHMH 3AADB 2J1KA 4M5YH 1HH9B 4AQZA 5HHVL 4PWKA 5EOQH 3U4AA 4HFWB 3V5KB 3WTXA 3E6FA 3O2VH 1XGPA 4OTXH 2X1XR 4K9EL 4X42A 4JG9A 2P4AB 2RQ8A 2P47B 4JKWA 3ZO0A 1XWVA 3LNDA 3WFHA 4ZFGH 3BVDB 4KHXL 4MS6A 1QRNB 4JHWH 3NZ8B 4PJ9B 4HUWA 3D08A 3WDJA 4UDTA 1QW9A 3G04A 4DUVA 1TZHB 5ANME 2DEYX 2D03L 1NUNB 4LDOB 2WBJB 1BEYL 1S5IL 3FRUA 5IMLB 3FQTB 1IC5L 2WTRB 3V9FA 1YEFL 4LPCA 4HK0B 1HL5A 4GSXA 4DGVH 4FFVD 4Q9RL 3TV8A 2F53A 2WP3T 2ZJSH 3QFJD 4ODWA 4ZXBA 5H94B 3VGDA 1OB1B 3Q9QA 5HYSB 4M43L 3UTTA 2IO5A 4LLQB 2Y2WA 3KXFE 3E3QE 2DL9A 5C07E 4FNLL 1IC7L 4X4ME 1TG8A 2UY7B 4QKXB 1FH5H 5EU3B 5CWSB 2JCWA 1JE6A 1MFMA 4WTQA 3TCTA 3MNZB 2PCFA 5HYJA 2ROYA 4IIQC 2BDNL 4BRJA 2Z93B 1KGCD 2IDQA 3I3DA 1HH6B 4R7NA 4K5PA 2HYMA 4NN5C 1CCZA 3V6ZA 3MBWB 5E1IA 2DLTA 5EBWB 4XVUD 3SQBA 4NQXB 4OZHF 1A7OH 2JJTA 1BD2A 4X8JA 3T9WA 1KBVA 4U49A 1Z9PA 2N4IA 4TNVF 5IMKB 1CYGA 3DRTA 3H7LA 2QQNH 3BKYL 1AFVL 1MHHB 2VLLA 4PS8A 4ZSOE 2XZQL 2J72A 3CVDA 3FB8A 3QEUA 3U7WL 4QXUL 2GCYB 2R51A 5EG6C 4Q52A 2ZKXA 1NEZG 4C8XA 4BD4A 3TPUA 4JGNA 4XHJD 2HRPH 1OTSD 1E5UI 1VLXA 4LASH 1J9TA 4G59C 4NQSB 4HD9A 4EI5B 4IRJD 4BK4A 2BC4B 5GS1C 3CFCH 3ZYZA 4YDJB 2JB5H 4JMNA 1BEXA 4PPTA 1NJ9A 3G5XA 4R4FH 4I1NB 5IHLB 3STZA 2MNWA 4ERSH 4L29A 3NH7L 1QG3A 1F6LL 3GIVA 3R7RA 3GS4A 4Z7UA 3LKSB 1LWJA 4BKLB 2GEEA 2VJ8A 2CO2A 1X5FA 4S1SH 5FA3B 4R97B 2R0LH 5CJQL 4MCYB 1XCQB 4XVJL 3RIAF 5D9SA 5CCHE 5JR1H 3JUZA 5F3BB 3HG3A 1FCCA 1HCYA 4I0KA 1J05B 4JJ5A 3UP6A 3L3OB 4HCRH 5CILH 1A4CA 3HZVB 1AD9B 4G83A 2WP3O 3L4ZA 4V1DE 4EZKA 2ZNWA 2A74C 3AB0C 1KFAL 3LIZA 3NRPA 4DJMA 2HSIA 4YXLH 4QHMB 5AB1A 1ROCA 3CBKB 3UBFA 3OKLA 4KJYB 2ITCB 1X44A 2YAMA 4Y2DC 1FC1A 2OPCA 1H3XA 3INUL 3LPWA 4EIGB 3OZLA 4F7MB 1I8MA 3JZ7A 2WB7A 4OLWH 1KCVH 1IU1A 2CCLA 3PV6A 4FFZH 5HDWA 3W56A 4G1MA 3F64A 1UG9A 4ZS7H 3EZ8A 2V2TA 2QGEA 1G9NC 4PJXE 2GSIB 5KBLA 2HTKC 3AMKA 5I1EH 1BVNT 2AJVL 2GIXA 2YWYA 5I8CA 5ETUA 5JTWA 1KYUA 1ZXKA 5ANMA 3VGBA 3IFLH 5DJZB 5I74C 3C60C 3HI1A 4JN1L 1YMHA 3EJUA 4XN2A 3VGEA 5I30L 4I9XA 5KYWA 2W0LA 3VXNA 4XNAA 3QYMA 2HJKB 2BFVL 1DQMH 3QXDB 4U2ZA 2VQ4A 3ATBA 4JFPB 4JZNB 2YUWA 4NQDB 4RVBA 4UBDD 2ADJB 3C6SA 3AG1B 4G8FB 4YHLL 2IBBA 4XP9L 3X11A 4LRIC 4DO4A 3DA0A 1FVDA 1T83A 2P8PB 2ZSWA 4LP4A 5FO8B 4ZAKC 1RP8A 4HIEB 2WLHA 1O0VA 5M7QA 5EU5A 1TO4A 3RFRA 5D5MA 1J1XH 4ETYA 1AGCA 4U1LA 2YA0A 2EH7H 5AYQA 4F33B 2P43B 5EMYA 1MFUA 5JPNB 1QR1B 1E5AA 3OV6A 1BQSA 1JGLH 2CO6A 5DUML 5IQ7L 1VFMA 4NQCD 3RX7A 1YNTB 5IOKA 3MRFA 5EZLA 2YBGA 1QAWA 4KK8D 3CFBB 5ILTL 4K7PL 2Z91A 4LSVL 5FYJL 2R9HC 3VVVA 4ODBD 2QTVA 5KG9A 4YX2L 1B90A 3BI9X 2XXFA 1X9RA 3B9DA 2PUQT 5DD5L 3TZVB 2M2DA 4P5RA 3RGVD 2B59B 3CX5J 1NFAA 5DRZB 2BNRA 3BLPX 4I48A 4L1DA 3CXDH 4KO6A 5A6IA 2R69A 2BNUA 2UZIH 2V2XB 4R6UA 5AZ2H 2WWMD 1UM5L 3TZVD 3ATFA 4KZDL 2PR4L 3GZKA 2GB2A 1FL6A 2AK1H 2WNKA 2WM0A 4EI6B 3FK3A 1H3UA 5B4MD 5KYUB 4H8QA 2VUKA 5AYUH 3BHBB 3WXWL 3O6FA 4YFLF 4MZ3A 3SPGA 3RIFK 1WO2A 2VDNL 2BY1A 5DD5H 3BIKA 3LRGA 4JB9H 2XZCH 3B9KA 4R4BA 3N44F 2XIIA 5F7DA 3PWPD 5EDXA 4RGNC 4UNIA 3UMNA 5DJ6A 4Z95L 2P1YA 3SGEI 3PIQA 3QH3B 4LDLB 3RAJH 3BUYA 3I9GH 3T77B 4X7FC 4QHUA 3KGSA 3QPKA 4U05A 4XN8A 1DQVA 1QSFD 3MYJA 4RFEB 2BVOB 4N20A 2EP6A 3QDJE 3SDDA 3KCPA 4GSDH 2X4OB 1AR2A 1LO2H 2XN0A 1F86A 1AG6A 1F11B 3CN2A 1QLFA 3IDJA 3IPFA 4X6DB 1H8LA 4M7LT 3ZDYF 1MJ7L 3TVMD 3QRLA 2OQJA 3MGOB 4LF3A 1XH0A 5DEZA 3GXPA 1BFSA 5FYJU 3MLXH 4NB7A 1OW0A 3MV8B 3FBQA 2IALB 3PPSA 5DD0H 3DYOA 4G7QB 4YBLB 1K8IB 2R69L 1DSFH 5GGRB 1P4BL 2YHGA 4APQA 1CS6A 3CDZB 3ZIYA 1MVUB 1DYZA 2Z8SA 3X3FH 3K71A 4AT6A 3KYKL 4ELKA 4PJEF 1QACA 2DW5A 2HFFB 3QHZH 3VFUA 5ADOH 2ZWZA 4P2QD 5A7EA 4J5VA 1L9SA 5F9AC 2H1LM 2EEFA 1XQ4A 1J48A 3UZEC 1R47A 5HJ3A 3EYFB 3LKPB 1F3RB 2R29H 2I27N 5D6CB 3C5ZB 4XAWL 1L7TH 3A23A 1NUDA 1ZT7B 3CDGA 2YPKB 3BZ4A 3AROA 3FT2A 1MNNA 4HIHA 5AKSA 4JO2L 3KE0A 3EOAB 4DN3H 3C5JA 3AWEA 1QP1A 2WWOA 1AYRA 5DR5L 5LXGL 2ZXGA 3RNKA 3CMOL 5I76B 4U3HA 3RJQB 3GWJA 1VAHA 5ACMA 5CZKA 1ITBB 3U25A 5LVEA 4PJFE 5HYFA 2NXYB 3RWCB 1WZ1L 4LVOB 4BH8B 3HNTL 5K9JH 4OCRH 4OLUH 5FKAA 4OJFH 2Z0UA 3QULA 3VRJA 5IR1A 1RJLB 4CVXB 1R5IA 3MCKB 1I85A 5K59E 1YECL 4JL1A 1L6PA 1K3ZA 1FPTL 1C16B 4WU7A 3TM6A 1MHPL 1EEYB 1RZIA 1TQUA 1FAIL 2XTLA 1HL9A 4F8QA 3ULVD 3H56A 3KH3A 1Q9LB 2ZSWB 2DD8H 1OZUA 3X11B 1BFOA 3NH7H 5F9WC 5C71A 1E9OA 3GQFA 2E7LC 4Q2ZB 1RIVL 4YC2C 2L8AA 5FAAA 1U8IB 3WLWD 1SVZA 3IGKA 3TONA 1UUSA 3ETBF 4B9IA 4KGLA 3BEVB 2DYPD 4BSJA 5J11C 1BZ9B 2YA1A 4G3YH 4LIQH 2E0PA 1HCFX 2C9UA 4Y4KC 1NM4A 4QXVA 5IGXH 1EHLL 1M71A 5DMGD 4AX3A 3QDGB 3QIUA 1JYVA 5JORB 2F7IA 5F3HB 4QJ4B 4YBHA 1FAIH 1G9MC 3B7UX 3BVVA 3MSPA 1OGPA 5D1ZA 1OF2B 3FOLA 4QRRA 1A6TA 5HVHC 1JZ8A 4B5EA 1A3RL 2W9DH 4KK9C 1SXCA 3OHXC 2DLEA 3UTZA 1JVKA 2E47A 4U4BA 1CF8H 4FEIA 3A6CH 1IAOA 3GTVA 3UJTL 1BZ7B 1BZEA 2GITB 4P3WA 2JB6B 3WYRA 2KDGA 3O3AA 3QHTC 3QDMB 3HBPA 1E6JH 1BZQK 5DQ9B 2X1QA 4B27A 1LEGB 1K2DB 3N41B 4P4RA 2A83B 2YZ8A 4O02A 3U30C 3UPRB 2NY7H 4G1EB 3RWFB 2C3VB 3BVNB 4YFDB 4X6FB 1WHOA 3EF4A 2JELL 3BSZH 5HI5C 3AQYA 2HLFC 4FQCL 2RHEA 4TL5A 3NJIA 4J4PC 2GJ6E 3SOBH 5KS9B 3GKWL 2WXHA 1NBYB 4MGXA 5JW3L 3RGVA 4M9OA 3SDCA 3ARBB 5I8KL 1Y18B 1AXTH 2DTMH 1MAMH 5D93B 1MCPH 4H8WL 4BK5A 3IDNA 4K3JH 2X1WL 4OI9A 2CG9X 2VDML 3BUBA 4JPKL 4UT9L 3ZMRA 5KSAB 5L88H 1I3VA 5GZOD 1BD2E 2R1XB 2YEVB 3SGDH 1JD9A 4FN0A 1MW2A 1OY3B 2AJ3A 4PVLA 3ARBD 5DVOA 4NKDA 3FYIB 3CAFA 3CSYB 4M7KL 4L3FA 2VLJB 3UYPB 3JWDC 2AZUA 2Z35B 3ULUL 1MFVA 1FWXA 4KUZH 5SWSA 1OAYL 2BSTB 4QO1B 5E6ID 1NLBH 1HINL 2E5EA 2KDYA 4GBXB 4HP5A 4HCRA 3OPZL 1SM3L 1QSZA 5T5FL 2V8LA 3QVAA 1PD6A 4JO8A 1KLFA 3JWNC 3SE8H 5LGYA 5GGUA 3AS1A 3ARED 4B50A 4P05A 3AB0B 3LH8A 5J1AB 3RZWA 4WUUD 5IMOB 1HHHA 3FQXB 3K74B 3WJJC 5CINH 2ODHA 1MF2H 5D2NB 2EC9T 2LU7A 3H1ZA 1RUMH 1RQ5A 1TEFA 4L4TE 4FERA 4R7NB 1OE3A 1KLGB 5IESL 2NW2B 3T6VA 3OXSB 3V0GA 5C70A 1OHZA 4XB8A 4ZO8A 3RLSA 2YGVA 1BVKB 3K46A 4AL8L 5LGJB 3QG7L 2FHCA 2N56A 5CJBA 2LLGA 4PRHD 4AW4A 1ZGLM 2AV1B 5H37G 4X0KA 2KZWA 1MQKH 1OZTG 2GBTA 3IMBA 5F0JB 1TETL 2X40A 5KSBF 1XO8A 3JWDH 3KMDA 5F89A 1ORSB 3RX8A 5IREA 3SBRA 5LHDA 3FN0L 5E0QA 1OP9A 1L5GA 3IJHA 4OBSA 5KVDL 3CZKA 3TA3A 5JHBA 3U9PL 4FLHA 3UO8B 5KAQF 5MENA 2OSXA 3AWFA 1DBKH 2MHAA 2NQ3A 2PPAA 1E5CA 1QPKA 5I6PA 3VWJC 1YY8A 4W70A 2HFGL 2CO4A 1D5BB 3NMEA 5HXMA 3WEOA 2BDNH 1U95B 2O1AA 4F15C 1HXYA 2Y7NA 2MQ3A 2PYEA 2VSDA 1SXSA 3FSWA 3TNNB 3FO0L 4MZIA 1TO5A 4QRPD 3BUIA 3U2SA 2Y7LA 3IJHB 1PLGL 2X9XA 1CDBA 3GM8A 4Q89A 4K71C 3TGXA 4OGXL 4P23D 2BVEA 1AY1H 4ICWA 4MMXA 1OVZA 5KZCD 1CU4H 5F88A 2B8OT 2ZPKL 5AAMA 5DJXB 3KAAA 3B8SA 3WUZA 2B3IA 1XDTT 4FULA 4XB7A 1KGXA 5CEYA 4ICXA 5KTEL 1MCBA 5C8JB 4OIFA 4QIRA 4NNYB 5DA0B 3FCTB 2BNQA 1LO3H 3BW9B 3C8KB 2Q2LA 5TFSL 3ZBMA 3T0WA 4AYFB 2LU3A 1PVHA 4N3TA 4PJEB 3W82A 2Y5EA 3HMXA 1P4IL 5DHXB 1B0RA 4ABVA 5DJ2A 4EXPX 4X5WB 1AKJD 4Y9CA 1JN6B 3MLTB 4P5KA 3FSVA 3ULVE 2BVQA 1AIFA 3AG2B 4PCKA 2ADIB 1CXFA 2VLJE 3BKCH 3TNMA 2AXHA 1R3LA 3CFDA 1F58H 3GI8H 5J7CC 4I18A 4JQXA 1NAML 3UO1H 1S9WA 4N0UB 1KLFB 4PLKC 5E7FA 4HLJA 4H88H 5BW7C 4ZOCA 1SBBA 4PB0L 3HCVB 3P3UA 1MZYA 2WJ5A 5JXAH 1PQZB 3VFRB 4XPFL 1EZVX 2QR0B 1RPQA 1G7IB 3QUMB 2KLSA 4Z7QF 4KI5E 1FH2A 4ETQB 5K39B 1SYVA 2APSA 5I5JA 3SE4C 3GHBH 3BAEH 1O75A 3ARGC 2DYPA 4PJ9C 4P48A 1QFUL 2FO4A 2NSXA 1ND0A 3QIWD 2AGJH 4CSPA 4WTWA 4U6VH 1PS3A 5EBMB 1RSYA 2BWIA 3UGEA 1P2CA 1EDHA 5BCAA 4UTAA 1NEZB 3BP7B 3X1FA 5JOPD 5D7LA 1WZKA 4MMYB 2P42B 2YARA 1JGVH 2Z65C 3HFML 4JFED 1T7WA 4MXVE 4AGMA 3MFGB 3Q8AA 3G5YA 4FAAB 5FDYA 2C3VA 4GUOA 3FU3A 4XVJH 1P7BA 3PHQA 2CBMA 1ZCRA 3H9HB 5HDRA 3OC5A 1IKFL 3TN0C 1OGAE 4IBYA 5TPWH 1L9OA 3RURA 3IF1B 3WY2A 2P49B 2VRKA 3ROLA 4GINA 4S1DC 1VPOH 3V0WH 2WWKT 1ECZA 4JFZH 2PO6A 4L3CB 3Q2VA 5JNYB 4OJDH 1E5ZA 3IKKA 1JNLL 4H25A 4TNEA 5FO7B 2PWDA 2W9LA 5KW9H 2EIBA 3ZTJG 2Q10A 4KGJA 1MCOL 3R19A 1B4JH 4ZRGA 3VQMA 2VMEA 2V7HB 1WD9A 3JV4B 2C4XA 2D3LA 5BVJB 4XN7A 4B7LA 3AREC 4K15A 5D4QA 1TVDA 5AZEL 3CZLA 5D6DA 3U0WH 1N64L 1G7MB 1QEWB 1RMFL 1KTLB 3T6XA 1KIPA 4HLEA 3KGTA 3ARWA 5AL8A 4QTHA 1HDMB 3QO0A 4JCWA 2CLRA 5E2TL 1P1ZA 1TKWA 3H9SA 4HWBL 5L2KB 2YD8A 1CDYA 1G0YR 4CMHB 2PYEB 1NFDF 4I87A 4PJAF 1S3KL 1HHIA 5HDQH 3WEAA 3FRPA 3GMPA 1TNNA 4XXCA 3JTSB 4KX8A 3IJEB 2A3TA 1VGEL 4A2HA 1YEKL 4XNBA 4E9TA 3MRBA 4OKVA 4KH2A 4Z18A 1BXXA 3D05A 3NIDB 3UYOD 4DKDC 4I0PB 4NUJA 4MD0A 1VFAB 2L4OA 4JFOA 1DBMH 1TVHB 1G7LB 3APDA 4N22A 1ZHKB 5KVDE 1KGJA 4X8XA 5JHAA 1Y0LB 4GIOA 1A3LL 4ODUB 3PWLA 4IU3B 3QRBA 4F93B 4LAJH 4N2BA 3S96A 1UACL 4MXQD 4L1HA 1T66C 4YXKL 5HDBF 1ZSHA 2PNDA 4K94C 4PHXA 5T1MA 2TSAA 4FXTA 1JZJA 4WU5B 3K6OA 5CS7A 5D5ME 3RWJB 1J8KA 2BP3A 4EE2A 1FDLL 1JPGA 2HMID 3BO8A 2XJLA 2D4FA 1J8HD 1F56A 1GYCA 1UQSA 2N1KA 4EN3A 1HHGA 1AQ8A 1GHFH 4TF4A 1ZS8B 4PJHA 3B2MA 1GJWA 4YSPA 2AQNA 2R2EA 4LCCC 3C2AL 4ZNCD 3LIZH 1CGUA 5JHLH 4XP9H 1J9CT 4WDIB 4NN7C 5FS5A 5GGQH 5F44A 3SJVB