1N68A

Copper bound to the multicopper oxidase cueo
Total Genus 132
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
132
sequence length
487
structure length
464
Chain Sequence
ERPTLPIPDLLTTDARNRIQLTIGAGQSTFGGKTATTWGYNGNLLGPAVKLQRGKAVTVDIYNQLTEETTLHWHGLEVPGEVDGGPQGIIPPGGKRSVTLNVDQPAATCWFHPHQHGKTGRQVAMGLAGLVVIEDDEILKLMLPKQWGIDDVPVIVQDKKFSADGQIDYQLDVMTAAVGWFGDTLLTNGAIYPQHAAPRGWLRLRLLNGCNARSLNFATSDNRPLYVIASDGGLLPEPVKVSELPVLMGERFEVLVEVNDNKPFDLVTLPVSQMGMAIAPFDKPHPVMRIQPIAISASGALPDTLSSLPALPSLEGLTVRKLQLSMDPMLDMMGMQMLMEKYGDQAMAGMDFHHANKINGQAFDMNKPMFAAAKGQYERWVISGVGDMMLHPFHIHGTQFRILSENGKPPAAHRAGWKDTVKVEGNVSEVLVKFNHDAPKEHAYMAHCHLLEHEDTGMMLGFTV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Blue copper oxidase cueO
publication title A Labile Regulatory Copper Ion Lies Near the T1 Copper Site in the Multicopper Oxidase CueO.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Oxidoreductase
total genus 132
structure length 464
sequence length 487
ec nomenclature
pdb deposition date 2002-11-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00394 Cu-oxidase Multicopper oxidase
A PF07731 Cu-oxidase_2 Multicopper oxidase
A PF07732 Cu-oxidase_3 Multicopper oxidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 1n68A02
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 1n68A01
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 1n68A03
3TA4D 2YAQA 2XYBA 3FPYA 3QPKA 1KBWA 1PY0A 1OCCB 1NPJA 3AW5A 3H4FA 3OQRA 3OMIB 5I6LA 4GP5B 3TU6A 3GDCA 4P5SA 3KW8A 2I85A 2EIKB 2PP7A 1OV8A 2DWSA 2ZONA 4KOBA 2J57A 4ZK8A 2BP8B 2YAHA 2UXVA 3QJQB 1JVLA 1MG3C 4DP6X 1JZIA 2CALA 5B1BB 2IDFA 4YSUA 2MTAA 1AQ8A 1FFTB 2FQFA 4YL4A 4G7QB 3OMAB 1AZBA 2DYRB 1DZ0A 1M56B 3FYEB 3NJFA 3IE9A 1ET7A 1OE2A 3BQVA 1M57B 2FQGA 1E5ZA 4JKNA 3TBBA 3TASA 4BXVA 2XU9A 2HRHA 1B3IA 3T6VA 4X4KA 4YSAA 2IH9A 1CYXA 4W9ZA 5EHFA 4YSRA 1AOZA 1GS8A 1IC0A 2VMJA 2GHZA 1E5YA 2FTAA 3EHBB 1W6LA 3X1EA 3DKHA 4A2FA 2ZXWB 3PAZA 1RZQA 1NZRA 7PAZA 1TU2A 2JXMA 3ABKB 1J9QA 2UXTA 4CSZA 1IBYA 5ANHA 2HZHA 5I6MA 5AZUA 1AACA 2AANA 1WS8A 1OE1A 3ZBMA 1GW0A 2Q5BA 4AI7A 1J9RA 4E9SA 1OOWA 1SHWA 3FU7A 4E9RA 1AR1B 4YSPA 3HB3B 3ERXA 1L9QA 2YXVA 2BP0A 3QJUB 1JXFA 3EH3B 2X88A 2EILB 1SJMA 1J9TA 2JKWA 2OV0A 2QDVA 4DPAX 1PZAA 3JTBA 1IUZA 2DV6A 4UAHA 2UX6A 4GY4A 5I6PA 3FYIB 2NRDA 4KO6A 4M4RB 4A2GA 2P80D 1E30A 3FSAA 2H5UA 2GC4C 3GYRA 4TXVB 2IH8A 3C75A 1AS8A 1BQKA 1M9WA 3UGEA 2UXGA 4YVNA 4N4YB 1ILSA 3ASOB 3SBPA 1SF3A 1XMEB 3KW7A 2AZAA 3OD3A 3PAVA 3T6XA 4DP9X 4E9WA 2XWZA 2B08A 4G70B 3TBCA 3WIAA 4F2FA 2YQBA 3H56A 4G7SB 3X1FA 2FQEA 4E9QA 4DP4X 5B7EA 1BYPA 4N8UA 2XUWA 1OCRB 5B1JC 3SBQA 4RH4A 3V9EA 1AZCA 1SDDB 1KDIA 3WI9A 3FSWA 3FU7B 3PPSA 4YSSA 3FSVA 5TK2A 2I7OA 4AX3A 2BZ7A 6PAZA 5LDUA 4JHVA 3UACA 3QJVB 1MZYA 3FQ2A 5B3SB 4UF7C 3ZDWA 1X9UA 2PPEA 2VSKB 1WA0X 1PLBA 3AG1B 3NSDA 4G7RB 1URIA 1PZCA 4DPCX 1E65A 1FWXA 1HAUA 1AZRA 4E9TA 2PP9A 4HHGA 2I7SA 4BWUA 1BXVA 2XXGA 1JZFA 2W8CA 4YSTA 5F7BA 2WSDA 4DPBX 1ET5A 1I53A 1NIDA 4G72B 4Q89A 2W88A 3CVDA 3QJTB 4DP2X 3S8FB 2IDSA 2JFCA 3SBRA 4DP0X 1ASOA 3AZUA 1A4BA 3NJKA 2GSMB 2YAPA 5I6OA 1NIEA 2HX9A 5I5JA 4PAZA 1SFHA 1DYZA 1VLXA 5PAZA 1ADWA 4E9VA 2VM4A 3NYKA 3IEAA 4YSQA 4DP5X 1AIZA 1AG6A 2YARA 1MG2C 3D12B 4KNUA 1PCSA 1X9RA 3FU8A 1QNIA 3NJJA 3S3CB 1QHQA 2Y1AA 8PAZA 2QPDB 1SF5A 2ZWNA 1MZZA 1NPNA 1OF0A 3FT0A 3FU9A 3PLYA 3T6ZA 4EF3A 3SQRA 1R1CA 1BQ5A 2XLLA 1V55B 3ZX1A 1GS7A 2YAMA 1JOIA 1CC3A 3JT2A 3S3BB 3NSFA 3S3DB 3X1BA 4AKQA 1NINA 3V9CA 5B7FA 1SFDA 2WO2B 3X1NA 3X1GA 4F7KA 1SDDA 2YXWA 3IBOA 5TK4A 3EF4A 2QDWA 1AANA 2VN3A 2VW7A 4BK5C 2YAFA 4HALA 1BYOA 2BWIA 3AG3B 2FT6A 5D4JA 1NDTA 1A8ZA 1NICA 3QQXA 1CUOA 3CVCA 1SHXA 5AKRA 2H3XC 5I5IA 1TKWA 3CG8A 2VSMB 9PCYA 1XB3A 1GS6X 3DTUB 4BDVA 1NTDA 1L9RA 2DWTA 4G71B 3IN2A 7PCYA 5IY5B 2PP8A 1FA4A 3OM3B 5B1AB 1KCWA 2HX7A 2DYSB 1ILUA 2FQDA 3N2JA 1ETJA 1PAZA 2IWKA 3OMNB 5I6NA 2XX1A 3BVDB 4KNSA 4A2HA 3H4HA 1ZDQA 3WKQA 1AAJA 4KO5A 3MX0B 4BWWA 1PMYA 2X87A 3FSZA 3NJGA 3WNJA 2VW4A 4HCGA 4DP7X 1KV7A 4HIPA 1W6WA 2B3IA 4HCFA 4GXFA 1L9TA 3CVBA 1TEFA 5F7AA 2YAEA 1UATA 1F56A 1PLCA 2XV3A 2FNWA 4DP8X 2OCCB 1AZUA 3NSYA 1GY2A 3X2QB 3GXUB 1QLEB 3N55A 2QT6A 4BWTA 4CSPA 2GB2A 3AG4B 1N70A 2H47C 4NB7A 4A66A 4HAKA 3ABGA 4MFHA 1GR7A 2HLEB 2IDTA 3DIVA 4FAAB 1W8EA 1AZNA 1L9SA 1KBVA 2LLNA 2TSAA 2Y69B 1CURA 1J9SA 4BDVB 2J55A 1JZHA 2EIJB 2IDQA 1EHKB 2PPDA 1L9PA 4F2EA 4QLWA 1AS6A 2J56A 2AVFA 2CJ3A 2VM3A 2AFNA 4AKPA 2E86A 3UAEA 1V54B 3NT0A 1ZIBA 2XX0A 3EH5B 2R7EA 2WO3B 2QPEB 2BO0A 2N0MA 3FS9A 2FWLB 2XV0A 4A2EA 1A3ZA 2GC7C 3T6WA 3FQYA 1J5DA 1HFUA 4KOCA 2A3TA 4AZUA 5B7MA 3NJMA 1JERA 3AG2B 4WKXA 1NIFA 2FT7A 3PXLA 2UX7A 4QKTA 1XB8A 3WNIA 4ENZA 3G5WA 2MRYA 3HEIB 3NJHA 3UAAA 2PPCA 2ZOOA 5I28A 4P5RA 1N68A 2GIMA 1PF3A 1ET8A 3WKPA 3EH4B 2YAOA 4KNTA 5D4IA 1PNDA 5FC9A 4HZ1A 3NSCA 1L9OA 2AZUA 3NP4A 1J5CA 1AS7A 1NWOA 1RZPA 2UXFA 1WS7A 4NERA 1T5KA 1OE3A 3T71A 2PPAA 1A65A 1HAWA 3S8GB 3ASNB 1KGYE 3FPXA 4HHWA 1BXUA 1JZEA 3NP3A 2IAAC 4JHUA 1IBZA 1KYAA 2IDUA 1RCYA 1GY1A 1KCBA 1WA2X 2P80A 2PLTA 3CDZA 4M3HA 2BHFA 2R7EB 2RACA 1GSKA 3PCYA 3QJSB 3WG7B 2XXFA 4YSOA 1V10A 1NIAA 2CBPA 2BZCA 4YSDA 1ASPA 4UANA 5AFAA 4NAJA 4KO7A 4Q8BA 4WTQA 1CYWA 6PCYA 1MDAA 1AG0A 2HRGA 3ABMB 3U25A 2CAKA 4FA7B 2BW4A 2EIMB 2J5WA 1XB6A 1JZJA 1JVOA 3NJLA 2EINB 1ASQA 2GI0A 2PCYA 3IN0A 2PPFA 4GYBA 1BQRA 1JZGA 3PAUA 3NJNA 2OJ1A 2GBAA 4HCIA 4YVUA 1ZV2A 4E9YA 3RYMA 1TEGA 2CCWA 1BXAA 3QJRB 1RKRA 3UADA 4A2DA 3NJIA 2HXAA 2VW6A 4E9XA 4A67A 2BP8A 5D4HA 4AKOA 3UABA 1WAEA 4A68A 4L0PB 5B1KA 5I26A 3AY2A 2IWEA 1IKOP 2Q9OA 2BW5A 3CZUB 4KO9A 2BWDA 4K9JA 2XVBA 2HX8A 4YSCA 4GP4B 2FJSA 4YSEA 3L45A 1JXDA 5A7EA 1NIBA 1OCZB 5PCYA 2FT8A 2XV2A 3CDZB 1ZDSA 3FQ1A 1BEXA 1KDJA 1EZLA 5E9NA 2TSBA 1A4AA 1YLBB 4BXSV 4DP1X 5I5MA 1E67A 1ZIAA 2PCFA 1OCOB 2BP0B 2CUAA 1JXGA 1WA1X 1SNRA 3ABLB 1PNCA 2IWFA 4GP8B 5B1JA 1A4CA 4W1TA 4PCYA 1NWPA 1PZBA 1GYCA 1ID2A 5I6KA 1BAWA 2DY2A 3MBWB 1PLAA 1ZPUA 3ZIYA 3T9WA
chains in the Genus database with same CATH superfamily
5CNHA 2YAQA 2EDFA 4OZGF 3HE7D 5IVXE 1GJIA 1E43A 3TV8A 4WI4A 4ZXBB 5I6LA 2KYIA 3JWNH 5HJGA 2FB4L 1JBJA 1I8LA 2R4RH 3MROB 4FFVD 3ZK0A 5E2WL 2BP8B 3QJQB 3HMXA 2YKLH 4X8JB 4JFFE 2G9HA 1DP0A 1Q1PA 4H8WC 4YHIA 4PRDA 2NUTA 4OGQC 4KI5C 4KKCD 1KGWA 2XG4A 4L4TE 4FA6A 5F0JB 1FFTB 2RFXB 4GKNA 4LRIC 4ODWB 1FF5A 1NDGA 4MDIA 2D7TL 1BBJA 3QZNA 4OKVA 3WO4C 4KVCH 3O6MH 5D96C 4X9GA 4HOZA 3B2MA 1V3MA 1UC6A 2GBUA 1XGTA 5C07D 2E5EA 4A7SA 3CZSA 1GYUA 3I6GA 5JIIA 1FCGA 3VSQA 2P4AB 1W6LA 3TFKC 3QVAA 5D1ZI 3CHXA 1AOHA 4B0MM 3VD0A 3U36B 4ZW5A 4G6FD 1R5WB 1FFPA 3LPOA 4UT9A 5FKPB 4GT0A 4JRXB 1AACA 3QUYC 1AO7B 5D5ME 1OE1A 1JN6B 2WTRA 4U1SB 3IJ9A 4XMTA 1KTLB 4U6HB 2PXYB 2VLLB 4P4KB 5E8OB 2QMJA 1XTMA 4K7FB 4NP4H 4Y7OC 4BFIA 1FORL 3K71A 1I1AC 1TMCB 1RUQL 4GRMB 5DD3L 3TNMA 5IKCB 1TVDA 1ZXKA 4Y2DD 2A99A 4XCFH 3FB5B 4Y2OB 4R5TA 3TLRA 2BHYA 1U8NB 2IH3B 3B6SA 3PWPB 5E8EA 1PZ5A 4UUJA 1T83C 3H42L 1ZVSB 3C6LB 4NI6A 5C0GB 3GBNL 1SDAB 1R3JA 4U6YB 4F8TA 3MBWA 3EH1A 3KJ4B 3IB4A 2XWRA 1BVLB 4UAHA 1FGNH 2VXUH 5FKAA 1YY8B 4TF4A 4OM1L 3HC2A 3B8SA 4M43L 2EYTB 1BM3L 1D7FA 4XN1A 4KQ3L 4ONOA 3OZLA 3AAZA 3C75A 3WN5C 4HK0B 3HBPA 1OANA 1WITA 2VDOB 3C60C 2KLSA 5HYJB 3KL3A 2BHZA 4PGCA 4BZ1L 5FWRA 5GZNC 2MH4A 4Y4FB 4EBQL 2RB8A 2AK1L 4OU3A 1GRWA 1MVUA 3O3BA 4Z7OB 2PR9A 5AVQB 4N6QA 3KLHD 5TH2B 1F13A 3MJGX 4J3XA 3T6XA 1W16A 2ROXA 2QHLA 1J0KA 4L8BA 3PHOA 5DMIL 1NDMB 1LMKA 2V9UA 4JG0L 4PB0L 4HUCA 4DP4X 3V9EA 5C0IA 3T2PA 5DZAA 4BE5A 2QGBA 1WISA 4XBMA 5HDWA 3GK8L 3RWDB 4HQQL 4LSSH 3N44F 4UT7L 1Z5YD 1UWGH 3MV7B 1KN4H 1GKEA 3VRIA 5LDUA 3LN9A 4PJEB 5AAWC 5DYOB 4K7PX 3HRZA 1K72A 2K6ZA 1B2YA 4P2RA 2OMXB 3CIQA 5KSAC 2JWYA 2LOEA 1PZCA 4PJ7A 5FIEA 4CMHB 1QD0A 1XR9A 5F9OL 3LD8C 3V0EA 1GGUA 3BZFA 1DBJL 2P5EE 3VCLA 5IQNA 2G75A 1Q0EA 2AQTA 2GPZA 2W07B 3QA3A 1QLRA 3RKPA 5CEXB 1OAXH 4NM4H 3GBMH 4G72B 3SJVB 4HUNB 4JFDE 4H26B 5A43C 1GCYA 1AGEA 2GSGB 2GYSA 3PP3K 4FG6C 4CJ0A 2G3XA 3LVTA 3DX4A 3CFMA 1INQA 1CZ8L 1T0OA 1S9VB 3LXCA 3LB6D 2I07A 5PAZA 3MPCA 4FQCL 3HHSB 3VSTA 4Y1AE 4GJTB 1QFOA 3C12A 4JRXD 5I71B 1PJ9A 1UZ6F 3U7WL 2R39A 1ECZA 3BEVA 3MRLB 4Y1SA 2FBOJ 3CGTA 4IBUA 1KLGA 3O8XA 2O61A 3UL4A 4AE0A 5CN3A 2PXYD 5T5FH 4P4KD 2I25N 3KXFA 2ZWNA 3UPRA 2VITB 2ENYA 5AVSB 3ZQ9A 3AXHA 1T1WB 4H2CA 5I8KH 2DKSA 3LHPH 1KFAL 3SQRA 4WENB 4N8CH 3TPUA 4K3EL 3ZHNA 1ZTXL 3TNNA 3LKQA 3OLDA 4HEMA 4MNQA 1P5UB 4NM8H 4NZRH 1NCAL 5EBLB 4H8WL 5BUGA 1AH1A 1IQDA 3C6LD 1HNYA 4N9OB 4X80H 4EI0A 2F54A 3BAXA 4LVNB 3LZFH 4NHUB 3LKNB 4P8QA 3X1NA 3E8UH 4R97B 5TK4A 5LCVH 2GK2A 1HHGB 1NGQL 3KYMA 3WXVH 4FYTA 3SCMA 4LASH 1NBZB 4JPKL 1UA3A 3L3KB 2GT9A 5A40E 2DJMA 1ZHNB 3HC0A 2Q86A 1HH6B 3QUKB 1RZIA 1YNTF 3VW3H 3FTSA 4WU7A 3LVEA 3RDTA 5DJ0B 2NCEA 3IMUA 3M17A 1MCOL 3VD5A 1MIEL 4GSRA 4Y4FD 4LSVH 2P5WE 1NTDA 1KPVB 3KWVA 3Q5OA 1CI5A 2JKJA 5TQ2L 1KCKA 2E75C 2IAMD 1X5FA 2PTVA 3CCHA 4HX1B 2HPTA 1CQKA 1J1XL 1VFAB 3CAFA 1K2DA 1VFBA 3BPCA 3DMMB 3DBSA 3GXDA 3TCTA 2DIBA 5JHLH 5IFJA 1QW8A 3AFLA 3HG1B 4JPWH 1HT6A 4XZUA 3IRZA 4HS8L 4PRPB 2AEQL 4AMKH 2OBGA 2ZYHA 2HFFB 4CC4A 4PGBA 3MV7D 1JZ6A 2ZCZA 1RUKL 1Y0LB 4FADA 2D7MA 4DNLA 1QQDA 2CHNA 3AQXA 1KLFB 5DRZA 5M94B 4AK1A 3C5SA 5ADPL 2VW4A 3N06B 3WTXA 5L2KA 3BPOC 4HWBH 1CBVH 2BFVH 2D9QB 3K4DA 5F3HA 3JZYA 1WZ1H 2X7LA 1OP5K 4JDZA 4P23C 5FA4A 1KC5H 2ZKHH 1TITA 3SD5A 3TIDA 4Y7MA 3FU6A 1OB0A 3SJVD 5FA3B 5GS0C 5EUKA 1KSRA 5L2JB 5BS0B 3I6SA 5KYXB 4GAAA 2PCPB 1KMGA 3A6OA 3REVA 3GXPA 2EXTA 2NZ1A 4PS3A 2IV8A 4U1KA 3ZKQD 5A2BA 5FUZH 1KPRB 3CDGB 1AKPA 4X6DA 1BGXH 1ZWIA 3D05A 4WWID 4JGMA 5SWSE 4JG5A 1B0RA 3MKGA 3TO2A 3QEGL 4CN4A 3L3IB 4XN4A 5I0DA 1T5WB 3OAUL 1EXUA 2X4UA 1W0YT 3QIUD 4UTAL 1TFPA 1WFTA 2W0PA 2X89D 4O58L 2ZE0A 4X6BB 1VPOH 2XJKA 3LAFA 1UG9A 5JW3H 2HMIC 2GUOA 3UAEA 3UTZA 1BOYA 1ZIBA 4X0NA 2QPEB 3MNDA 3VFVA 3TT3H 4HETA 2NY6B 4F27A 3NFNA 4H88H 5TFSH 5DVOA 1X6NA 3A67H 4F5CE 1KTBA 2QEJA 4K5OA 4ZODA 6CGTA 2D73A 2E6PA 2HLAA 3CSBA 4IU2A 2WQWA 4MCZA 5JYMA 5HDQL 3FQNB 1W0WA 3UYOD 4XAKD 2WXOA 3RVWD 3DGDA 3OJDB 4P2OB 5L4FA 2F7RA 2FBRA 4LCCB 5ID0A 3HI6L 3JUZA 4OD1L 3DOSA 5GGUB 2HN7A 3CU1A 2GIMA 4Z78A 1ET8A 3GD1C 4X8XA 2H3NB 5E03A 4TULL 4UINL 5ESAA 1DL7H 5JR1L 5DD6B 1OAZH 1L9OA 3MCG1 2AZUA 2ZOUA 5K9OB 3Q3GB 1HEHC 2GQHA 4AV4A 2FX8L 2WTOA 3NK3A 4XH2A 2H9GA 4X8GA 3IK2A 3EG9B 4FQXC 5D1QE 1ML0A 4HXAH 1VFOA 1MFEL 4LOUC 2WBKA 1XGQB 1QSZA 2FVNA 5C3TA 1HAWA 4AQAB 3ES6B 1E27B 4MD0B 2JCCF 1S5HB 4NN5B 3TN0C 5L8JB 5A2KH 1YC8A 4M1GH 1BXUA 5JXEA 5F88A 1LO5A 5HXMA 4Y16C 1KTJA 3GS0A 3W39A 2QPFA 3HG1D 1XF3A 3LKOA 4C83A 2CPCA 4L1SA 4RMWA 4IOIB 4F80A 4PRPD 3UOAB 4AEHL 1C5BL 3K0YA 2AGJL 2QVKA 2R2HA 3L9YA 4Z0BL 2F53B 5DWUH 3IDNB 1L0YA 1RQ5A 4YSOA 3D6GA 4Y8DC 4Y9GA 4YHKL 1AYRA 5AFAA 5K1JA 1DBAL 2GJ6E 3L5IA 3GJFB 1XO8A 2BW4A 2XJLA 1JVOA 2NY1D 2UVEA 4YNYB 3CVIL 2B0SH 4F2MB 4G7VL 3IDJB 4KK9D 2Y9RT 3S97C 5BS0D 1IGJA 3ECBA 4I1PA 3MRBB 5DJ8A 4IDJL 4WFEE 3QJFA 3UADA 5HSFA 5JPNC 5DA4A 3J2PA 5KBNC 5IEHA 1CFSA 4YHZH 1UXSB 1G6RH 5E94B 2GY7B 3AQYA 3QFJA 4WAFA 2XN9B 3TWYA 2ZUYA 1P84K 5E8PA 4M56A 2BXYA 1SY6A 4LLWA 1T4KA 3D4GA 1EFXA 5LGJB 2NZ9D 5FCUL 4YSCA 4YSEA 2FSDA 1JNLH 3WO4B 4Q2ZB 4MGXA 5F9JA 5IJBC 2VXTL 3MV9B 4K3DH 5D96B 5L7XL 2Q7YB 3M8OL 5B22A 2F5AL 2VDRL 3CDZB 2NY6D 1X5MA 2QVTA 4IKJA 2PTUA 4OCSH 5AWNH 2EEBA 3APNA 1BEXA 3LXUX 3PV6A 4WW1B 3MRNB 3ESOA 1A4AA 1BZOA 1EGJH 4FNPA 3OXRA 4FTVA 5DEFB 4E41E 3F7YA 4YHPA 2CPUA 1KTKE 1JGEB 3QUYB 2CUAA 2FSEB 3G3LA 4AZ8B 5C0CE 3CFKB 1XFPA 2MWCA 1I1AB 1NSNL 4NQCA 3P3UA 3S4SA 4XCEB 1NLDH 1ODUA 4LLMB 1UQSA 1DVFD 3GRWH 1N64H 1PY4A 3H4FA 1HXMB 1L0PA 1FC2D 4KMLB 1FO0A 4WJ5B 5D72H 5EA0L 3KW8A 5DUBB 1U8IA 1OV8A 4G9FE 1TENA 2H1PL 3BLPX 4ZMOA 2DQUH 1IAKA 4PBXA 4LDOB 3JWDH 3GZQA 3T2NH 3OB0K 2A6IB 4XVUD 3N42B 4PQXA 3ISWA 3O11A 2IALA 3WN5B 3JBG7 4ZMLA 2N01B 3IFLL 1OE2A 4RRPM 3C60B 1A6UL 3QDJB 5EMYA 3NEXA 1LYQA 4PJBA 4X6DF 4LCIL 2OR9H 4MDRA 1YN6B 4X4KA 3AQZA 5JIPA 1D6VL 5HJBA 1CYXA 5F7YC 2IQ9L 2Y06H 1FNEA 2QTVA 1GS8A 1DHKA 1YJDL 3CFEA 3GSNL 1UACH 1TIUA 4GI8A 1GGYA 4OJFL 4QTIL 2YPLD 1CVSC 2VAAB 1G7JA 5AVVB 3PL6C 4XNMB 4PJDA 2ZQKA 4XPGH 2AVGA 3HLKA 4QYAA 5I76B 3GJEB 5F7HA 1A21A 1QZ1A 2VSCA 3BKYL 5DHDA 3ARYA 2HT3C 4XWGL 2BSED 1BFVH 2OW6A 4OJCA 1XH3B 3W9EB 5CAYB 1RULL 3GSVA 4F7CB 5I82A 4H2AA 4X98A 2Z31A 2IFFH 2DQDH 3PDOB 3MV11 4QXGH 5C08B 1WGVA 3ZT7A 4P9ML 3CX5J 4Z7WE 4OZIA 5E99L 4KI5D 5DUMH 3ZRCC 4YDKH 4ONGH 3RWEB 3RWGA 1JNHA 3FQTA 2CDGB 2XN9D 3HNSH 4PY7A 4IRSA 4JN2A 1YYCA 1J9TA 4PJGE 4QOKA 4APQC 2AI0L 5HYQA 1MVFA 2Z65C 3VG0L 5JHAA 5I1AB 3TZVC 1WIUA 4EJ1C 4IU3A 2X5PA 1HVXA 3EYSL 3MV9D 4Q7DA 3SY0B 4A2GA 1LE9A 3RVUC 4KVPA 4U4BA 4OFIA 4P3CH 1TJGL 3TFKD 3HZKB 4ZRGA 4ONFH 4QO1A 1G1OA 4Z7VB 2YJLA 3D08A 4NSKB 3QP3A 1NGXA 3LSOB 3ARPA 3QUYD 2IPKB 4PWHA 5SV3A 2BC4B 3NIGB 4JRWA 3GMOB 4NZJA 2IV9A 1A7PL 1D6EB 4JLRB 4QRPE 4UQ3B 3AABA 3PNRB 5J13C 2R4SL 2VLJA 3LIZA 4N0FB 4MA3B 1G6VK 1I1AD 3FB8A 3QFGA 5SX5K 2XI9A 2IPTL 4G7SB 3MNWA 4UQ9A 3ZDZF 2VKWA 4BKLA 4WFFE 3UJTH 3BUIA 2E76C 1NMBH 1LWHA 1XIWA 2JJUA 4RMQA 4GIPD 4KVNL 3ULSA 3IXAB 4UQ2B 1C5DA 4DVBB 2VXVH 5DHEA 5E8DH 3KEDA 3UP1A 3FQ2A 5AL8A 2OSXA 1YNKH 2R29H 1EANA 5HPMB 1X9UA 3EBGA 3RJQB 4ZUUB 3AG1B 5DJ6B 1RZFH 1VCBC 4G7RB 3X3GL 3NZ8B 3RNKB 3FB6B 4RGNE 4JZOB 3BSZA 2YPVH 3V0GA 4MXVE 1B9KA 5I66B 1FHGA 1KV3A 3KPRA 3QXDA 4AQZA 1JZFA 4F7EB 3C60D 1J48A 1XGUA 3GKZA 3PWVB 4Z3GA 3OAZH 3QDJD 4NAMA 3WNKA 1ZGLM 3SDYH 2WZ5A 5GZND 3OGCB 1J11A 2D3JA 4X6CF 2NT1A 4LAQL 4N2BA 4Q6IC 4G8GE 2GITB 3ATAA 4QNPF 4AV0A 1XF2A 1JI2A 1EO8L 1JMXA 3EBAA 3UH8A 3PWJB 2IO5A 2X4TA 4W9JC 2XDHA 2WKGA 2MNJB 2VE6B 5FR3A 3G5YA 3U1SH 3VQLA 3MV8D 3FOLB 4HJGB 4B53A 5LN8A 3QUXC 1YZZA 4GW5A 5F1IA 1QNIA 1J12A 4XOEA 1MAML 1QHQA 2UWEA 4XNQB 5E95B 3VGAC 1AFVH 1MZZA 4W6YB 4NKDB 1UYWH 5C08D 3FT0A 3UBXG 1JFHA 2NYKA 5KSAD 2R0KH 3BPOB 3RL2A 1M6UA 3T6ZA 3RGVC 4PW9A 5A16A 2OMVA 4IQHA 1D7BA 1R1CA 3PWNA 4L8DB 4I0PA 4I13B 5IMLA 2GKIA 3GF8A 4ZMXA 4P23B 4XVTL 3BAYA 1BCIA 3VSUA 2JJSC 2YWZA 3B7RL 3OG6B 3CK0H 3UDWA 4NT6A 5KVDL 2WO2B 4P2CG 1QATA 4B3EA 4DERA 1RK1A 2ZOWA 2C5DC 3ZZ1A 3EF4A 5I6XB 4FG6D 1Z0NA 4HKBB 4MMYA 3ILPA 3HZYA 3FT3B 3UO8B 4OUUB 1KUMA 3MO1B 4TTGA 3AM8C 2X6VA 3QH3A 2YMOA 2I32A 3X3FH 1FVCA 4YDJA 4OT1L 1CDYA 3BKCH 1A7QL 4Y4HA 5J6HA 1A6WH 5DHVB 1JHTA 2EDDA 1AJ7L 3A5VA 4NZFA 5FM4A 4K71C 1M2OA 3GNMH 5K9KA 4MAYA 1H6TA 4ZX5A 1KXHA 4S1DC 5D7HA 2V7HA 4XO9A 4NQDB 5E7BA 4O2EB 4W4NA 3SPHA 1J8HE 4N90D 1IEHA 3QUMA 3B2VH 2E0PA 3OC5A 5C0EA 3T2OA 4M62L 1WBXB 1QNZL 1IGFL 1U3ZA 1OAKH 1EHAA 1QSFB 2ZX5A 3DBXA 2W38A 4ZAKA 3TPKA 3UGXA 4ZFFB 2IWKA 3OMNB 4IK7A 5EDSA 3ECVA 1DVYA 4A2HA 1MF2H 4WUKH 2R9HC 3B3IA 4IOSA 1ZDQA 4ZNCD 4NNPL 3ZL2A 1Z2KA 5CR8A 2ZUQC 3SDCA 2BIPA 2WTPA 3HNTH 3KGRA 3GSNB 5E1GA 2P49B 3HUJE 3WNJA 1KPUB 2ESVA 3T4AC 3P9LA 1J1OL 3H9HA 3P73B 1MFCH 1OWWA 3HAEG 3RE0A 3OSKA 5BZDA 5L4IA 2LABA 2A77H 5J6GA 5GGTA 1MFAH 1DQJB 2CM5A 4XMPH 1ZLWK 1PLCA 2X9XA 5IESH 3HBQA 4OGYL 4XPBH 5DJZA 4JDTL 3QDMB 3T8VA 1X44A 1NLBH 1MCIA 1OAYH 2OQJA 3VXUB 1TUPA 2LT9A 4PG9A 5AVUB 2A6JB 2GB2A 1WD8A 2XWTA 3VFOA 4FQXB 3SKMA 4BQ8A 5J06A 1E8ZA 3TBTB 1Y7VA 3U46A 4IGBC 2KDGA 5D2NC 5HYFA 3EH2A 5CU9A 4PWJA 3TN0B 1CLYH 4RISH 1CXLA 3P4OB 4YO0A 2XBTA 1NA8A 4Y16B 3JV0A 2G2NA 2IDQA 3UGUA 1B0IA 1KCSH 3TV3L 3QQ4B 4LEOA 1T5XB 3LYRA 4G2AA 3RUGB 1TETL 3EADA 2Q8AL 1CTMA 4Z95L 3QULB 1ZMYA 2BO0A 3BP6A 3P9MA 4HMDA 2X6MA 4DJMA 2DJUA 3NZHH 4IBZA 5FHBH 1DE4A 3FQYA 4MXWL 3GKWH 3CXDH 2A3TA 4P23D 4OR1A 4BZYA 1J5IA 1UB5A 3L2MA 3QWNA 1OP4A 2WWKO 4FFZH 3G6AA 4MAUH 4MWFA 5BQ7A 5IJDC 3O4LB 4U1LA 4GUPB 4JFUA 5GS0D 1DANU 2JI3A 5IQ9B 2ZT9C 3CQFA 1ZANL 3DIFB 1LK2A 3HG4A 5JPNB 2VL5A 4WDIA 4WK4B 4XBEL 3WKNA 2W0LA 3MBEA 3UPAA 5GJSH 2FD6H 3ET9F 3I50H 3RWHB 4Q14A 3QPQC 3G08B 4OV6F 5CD3A 3G5ZB 2E4FA 2A83A 4BFRA 4YZFF 4F20A 4BHUI 4FNRA 1I8MB 2DQTL 2E3VA 1Z3GH 2BH0A 1QEXA 1RUAH 1A6TB 4NQDD 2YEZA 4X7TB 2HMID 3C2SA 4ZUWA 3ASNB 3ARGC 3ZE2B 1HEZB 5E9DE 1L7IH 2LHAA 4K73A 4ZDHB 1QSFD 2K4WA 4JHUA 1S5IL 3LJ3A 1T80A 4U6XA 3MZTA 5CILH 2Q10A 4A6YH 3WJMA 3LKSA 4X6FA 2OW7A 3BXNB 3CFTA 2OMYB 1JPEA 2C3HA 4L23A 2W0FA 1A64A 3D9AL 5KJ4A 2OJEB 4PD4K 2JB5L 1NL0H 3VGDA 3MYJA 3FN9A 3OKOA 4OTXH 3ESNA 3HJ0A 5CCKH 1UCBH 5KVGH 2YGVA 3ULUD 4GSDL 5CUSH 4JK0D 1ASQA 5DTFB 3KS0H 4GYBA 3PAUA 1LO0L 3V8CA 3VXUD 4NZTL 4QJ3B 1GZQA 2YD1A 1ZV2A 2HKHH 1EBPA 4FQXD 1I8KA 1MWAH 2ADIB 2AJXH 4LOUD 1UKQA 3H7LA 5INCA 4LCWE 3TN0D 1RURL 5GJTH 1NGWB 2HJKB 2QLVB 2HH0H 1JTPA 1CGTA 4Y16D 2XFXA 2I26N 3R0NA 4Y1TA 2WUCH 1VGEH 3QYCA 2RH0A 2X2UA 4EUPB 1BV8A 1TO4A 2XVBA 3QPXH 4K23L 3ARZA 4PYGA 1F6LL 1H3XA 1EHLH 5EZLB 4KQ4H 3V0JA 1A1NB 4XP5L 5MERB 2WLLB 4Y19B 1CXEA 5DQJA 1QABA 4AYSA 1BFOB 3OMZA 4HIQA 3WE1A 5EF0A 1TZAA 2Z8SA 4MRCA 4QIRA 3PL6B 3TVMA 1YPZB 2P8LA 3MJ6A 1XXDC 4NENA 3MTXA 2M2DA 2E7LC 5ECJE 4OZGE 3OKMB 2V9RA 3D0VB 2BP0B 1T22A 1EPFA 5J8OA 3SGJA 2FX9H 3ABLB 2J88H 1QBLL 4M7JL 3QI9A 4JFTA 1L5GB 5IW6B 2YD6A 3NDZE 3GMLB 4JM0A 3QZPA 2OL3L 4AIZA 1GYCA 2XG5B 5I6KA 1KJ2L 3CN1A 2HJLB 2C9XA 4FQ1H 1MCWW 4W4OA 1DSYA 1WFNA 5B38B 3MR9B 2Z4QA 4PV9A 3R4RA 5CIPA 4LEXH 1E8WA 3FPYA 3QPKA 2OTUB 5DEJA 1PSKH 1OCCB 1NPJA 3BP7A 4NDMA 1EJOL 4APQB 4AQ1C 2WWMC 3U2JA 4U1HA 4DGIH 3BWZA 4X4XB 5EWIH 3V4LA 4AXWB 3ARVA 4HBCL 3TZVB 3WFHB 4C4BA 2NLJB 3WFDL 4L5FH 1XL4A 4FQQA 3MLVL 2VDQH 4HLZG 4I1NB 1UT9A 5L6YH 3QXUA 4H20H 2MTAA 3QR1A 1A7OH 1QSEB 1U3HA 3ARRA 4NNYB 3E9TA 1SJXA 1VFUA 1YMHA 2EH7H 1PW3A 5CMAB 2ITEA 1ZHBB 5KG9A 1AI1H 1XH2A 1I7UB 3PGDB 2MJWA 1E5ZA 2BSRB 4NO3B 1F0LA 2BVTA 5LGYA 5DMYA 5IB3B 1KXTA 2J20A 1BPVA 1TT6A 5GRJL 3LRLA 1U8OB 5FO9A 1KN2H 5I30L 2PYFB 4JFPA 4Z7UF 1MCHA 4JPQA 5J13B 3BWAB 3GMNA 5C09B 4JFVA 4F58L 4ANKA 5CXPA 5BV7C 3QO0A 1T89C 1RZQA 4KMTL 1E4KA 1O7VA 4JPVH 5GSRB 2F58H 4QRSB 4Z0XA 1F45A 4QCIA 2XIBA 3V4VA 5D70L 5BW7C 2FR4B 2D7OA 1CWVA 1GW0A 3QEQB 1E9QA 3VI3A 4AI7A 3QXAB 4LDCA 4HWZB 2BIHA 5J89A 1QLEL 3O0LA 1N67A 5HGBA 3VFTB 5IB2B 4UIMA 3ESPA 4S0HA 4LB8A 3A6BH 1FNAA 1JPTL 3D34A 5AG8A 3F5WA 2PYEB 5AOKA 1P4LB 2YK1L 2Y36H 4FZ8L 2X28A 1PZ2A 1H0DB 4FEIA 4JW3A 1MFDL 1B0WA 1TYJA 2OV0A 4I3RL 4WWKA 4K3JH 1QX1A 4NBXB 1J8KA 5DFVC 1OW0C 2ATPA 4G43B 2QSCL 3WJJC 4PRIA 2Y0SA 2ZKMX 3DK0A 3IE4A 4GXVH 4Y19D 5HVWA 2YXMA 4Q6IB 3V10A 1CJYA 5EUOB 3C5JB 1I3GH 4P5TC 3P77A 1HH9A 5IBTH 3PL6D 1KCUH 3KVQA 3H0TA 2VZSA 4RFEA 1BQKA 3APCA 4KTEH 1EEZA 3K4AA 4WV1A 1ND0B 2XKSA 1XMWA 3D85A 1KJ3L 2ED7A 2A4EA 4RBPK 4LBEB 1MCWM 5IIEB 2HT3D 3QUXB 4CADA 3H54A 3KNBB 4X7EC 3T0BA 1A6ZB 1XMEB 5IHZA 1IV8A 3QDGB 3SKOB 1XGYH 2H0EA 3INUH 4N8VG 3CBRA 4KY1L 3QAQA 4HV8B 4I48B 3VGAB 1DBBH 1HI6B 4N2FA 3DTXA 2YQBA 5C0FA 1W91A 3RGVB 2KQMA 4HLJA 1JDAA 3O4OC 2NQ3A 3D3VA 4N1CA 4M3JA 4PJXA 1GMIA 1OAJA 3F7RA 1ZY9A 5E2UH 5TK2A 4APQD 3MCLH 3LEVH 4MMXA 43C9B 4OI8A 4C8XA 4LNRA 2DH2A 5JYLA 1MZYA 4MDJA 4AGQA 3MJ9L 1FNHA 2ZUTA 3TZVD 4LEBA 1PDKB 3BUDA 1BSIA 3WFBH 3T04D 1F4WH 5A2IH 1I4FA 1R5IA 3OTTA 4LF3A 3UZVB 3BAEL 3E6FB 3N43F 3QWOA 4KJPC 5EU5B 3RVUD 4N2HA 3BEWB 3V0VA 4AITA 4NOBA 1RIHH 4ZS7L 3TIEB 1TLKA 2F19L 4JO2H 4I8DA 3L5WB 4JM4H 2X4NB 2HKAA 5I6XC 1JGVL 2W8CA 4JFQA 2C1OA 4YSTA 1IIIA 4CAGA 4HU2A 1I53A 3F12B 4LK4A 4K71B 1XCTA 3MRPB 1UZ6E 1TNNA 3AGWA 3RPBA 3SPGA 4KPHH 4A63A 4BCZA 4DP2X 4BA0A 1KGIA 3QNZA 1U2HA 3RIFF 1G87A 2JLLA 5C0JA 2APXA 5C09D 4NFCA 2EVHA 4DK5A 1LTXA 3MLTA 3V4UL 4M8UA 3L3DA 1TJMA 2CIKB 3K2UH 3UTTE 5KN5B 5LB1A 3WIFA 2DQEL 2WZAA 3QSKB 4AYFB 4OFQA 1XF5B 1WFOA 1Q0YH 3E3QC 4ODHL 2YARA 2GFBB 2FUQA 4I85A 3QEQD 4KRNA 1X9RA 4DGYL 2ZUQB 1I8AA 4UOJA 4GKZA 5JNYB 5IB4A 1PD1A 2CUIA 4UCFA 4C56E 5J9PB 2W0KA 1MIMH 4NLAA 1CU4L 4OGZA 1CK0L 3JTSB 3M1BB 4KK5C 1F4HA 2ZJSL 5DRNA 1QRNA 5JPMA 1JYWA 1SY6H 3H7BA 3MRHA 4E9LA 5C7XL 4KUCD 3DO3A 3REWB 3ZX1A 2BVPB 2ZUSA 2A38A 3CE1A 2F08A 3LKRB 1JV2B 2Z1PA 1FZKA 4OF3A 2CBOA 2BOCA 2YRPA 4NO0A 2CZNA 2VIRB 1CVRA 1HL4A 1RIVL 4HH9B 1A6AA 1KJ2B 4TL4A 1XBRA 2QDWA 1NGZB 1BAFL 3CUPB 4S1QL 4Y5XA 5FW7A 3GM0A 3ETBJ 4JFXB 2ZUXA 2EVJA 4IGBB 3SYOA 4I2XA 1NDTA 3IFOA 5D2NB 3ARSA 3IJSB 1D7DA 3U83A 1NKOA 2OXGB 2NNRA 3FT4A 2X09A 2H3XC 4F33B 2IXQB 3BKJL 1X5KA 3MGAA 4NQXB 3NCJH 2B8OT 3QUXD 5BV7L 1ZT4A 2UZIL 4WY7H 4L3CB 3BZEB 4BQ9A 3BVTA 2GBVA 3STZB 3QDGD 4NJ9L 1AGFB 4R9HA 5DDHB 1TPXC 4M1DL 3TCLA 4DKEH 2OPCA 1CLOH 2GI7A 1F86A 3RGVD 1RLWA 1YRKA 1WPCA 2J4WH 2AHIA 3LRMA 3NFPB 4B96A 1SLXA 5KYYB 3T65A 2YMXH 3SDDA 4CGTA 4UTBH 2W81C 3IPBA 1QPKA 3KPSA 2YA2A 4HC1L 5GIRA 5HHXL 3VXTA 2XRAH 4S1SH 1IC4H 3ATDA 3WDHA 1F4YH 2BY1A 3FCSA 4I0KA 4LHUA 3D69A 3S98A 3JWOC 1TZGH 5GS2D 2X1WL 1PYWB 4FHJA 5HP5A 1W6WA 1RMFH 1NCDH 2ICWJ 4FKEA 3VI3F 2HLFC 2I5YL 3HLAB 4XRCA 4DZBB 1I7ZA 3O41B 3ARBC 4JVPA 1NAML 1M42A 1QLEB 2ICWB 4JRYA 1TQBC 5AYTA 3APDA 1BLIA 4YDVB 2BNQA 1NCIA 2CRIA 5ITBH 3LIUA 4TSAH 2AJVH 2XTLA 4HAKA 3RG1C 4LGPB 2O5ZL 4GQ9L 4S1DD 4QUOA 5IW1A 3SYQA 2HLEB 5AW8B 3MLSH 4KDWA 2J6EL 4XP1H 2LLNA 4TUUA 4QDGA 1J9SA 4O4YL 2PCXA 2FJUB 2Z9TA 5H2BB 3FO2B 1GOHA 5SWZE 2BNRA 2NUPA 4I88A 3ZDXB 2GJRA 3ME0B 1MJ8L 5FV2A 2R9HD 2WQUA 1AS6A 4AT6A 2AVFA 5I73C 3CFCH 5BRZB 1TXKA 3B2PA 3TCXA 4Z7NF 1QLFB 2J8UE 2CCVA 2QQQA 5E1AB 5JHDA 3NIDB 1UEYA 2CKBH 1UB6B 1I3RA 2WIIA 2IANB 4XTRC 4JM2C 1SQMA 3CZKA 4DTGH 4GG6B 2XV0A 4JX0A 4X42A 4XXCC 5TE6L 4HWNA 4P3DA 5JUEL 2UY6A 2RCSL 3T77A 4U3SA 3U6XS 1ZEAL 4HIHB 4MZRA 5B7MA 1TJIH 2FO4A 3ML8A 3KVPA 4JFHD 5FHAL 4LCVA 1P6FA 4LVEA 5HHNA 5I15H 1NIFA 2DQCL 4H13C 4ZS6C 4GW1B 1LP9B 3EFOA 2VKXA 4WJG3 4C58B 3F7VB 4ENZA 1I7TA 3MSPA 1HDMA 2I9TA 2DEXX 4HPYL 4UM8A 5EEZA 1J10A 1LQBC 1N68A 2JCCE 3K2KA 4IGBD 4P5KB 1IT9L 3CFBA 1P4IL 4IEFB 5T1LB 5C0AB 3TBYA 4MVBC 4QRUA 3QXTA 5IVXB 4EEEA 5IW3A 1EERB 2F0CA 1USQA 3CXHJ 5KVGE 1MREH 3ZXAC 1NWOA 4PJIA 5HGDA 4H40A 3VXNA 3V4PH 1UFUA 1U58A 3Q48A 4JFFB 5E5UB 1R33A 3S8GB 5D7EA 1HWHB 1QZNA 4JZNB 1OF2B 5K33A 2BSDA 4ODVL 1Q1JH 1SHMA 3R1GL 1DLHB 3JWNC 3BQUC 3Q0HA 3WE6B 4MD4B 4HUUA 3L08A 3ZTNH 5IZ7A 1TZHB 4L37A 4JFZH 5AKSA 3N40P 4TRPL 1MEXL 5DJYA 3AREA 4CGUB 1AP2A 4L9LC 5C3IA 4JFEE 4UANA 1RIUH 4PJ5A 2VWEC 3HZMB 4N28A 3HFFA 1IMHC 1X5YA 3PJNA 3NJVA 2ALAA 3ABMB 3GFUA 3ROOB 2HWZL 3L95B 5IJKC 5EPMB 3TJEL 5JW4M 1XGPA 3PJSA 3QPQD 4XVJH 5CJOL 5EO0B 3KYNA 5F7KC 2X4OB 1K6QL 3RU8H 2ATKB 3T1FA 1ONQB 1M4KA 4AQ1B 2WNWA 3F85A 5BZXA 5F9AC 3BRDA 3AWFA 1QA9B 3UBXA 3BVXA 1R19A 4H1LB 2Y7QA 3U7YH 2HRPH 2XN1A 3ARGD 2IQAA 1NCGA 5D4HA 3OQ3B 2BS9A 5EO9B 5G55A 3TTYA 2G5BA 5AAMC 2QQKH 3WV0A 1TJHL 2C9UA 3HZVB 2IWEA 5LQBH 1DTUA 4MBOA 2LLLA 2XZCL 3ZKMC 2VZ1A 3CZUB 3EF7A 4ZNEA 3U6RA 4WHTB 3QZWB 2R0ZL 4OFVA 5BRZD 3FRUB 1OCZB 1WBZA 4JHZA 2OJZL 2OK0H 1QFPA 3ARDA 3VXQA 3V6OC 2IAND 4UT6A 4D7BA 1FIGH 4L5FE 3S88H 3GSUA 1WH0A 3RAJL 3RVVC 2O5YL 3KPQA 1EZLA 3DX8B 4O02A 3NBNA 1IRAY 4AENB 4KXZH 1EJFA 6FABL 4JQIH 5BV7B 3ZTJH 1RFDH 3JWOL 5T3XD 3FULA 4BQCA 4U1JA 5D7IA 1PY9A 5IOPA 2JSFA 1MN4A 1EZUA 5DHMC 3V6BR 5HGAA 4ZFGL 4WWOA 1HKFA 3I75B 5IG7A 4ODSL 3V6ZB 5I8OH 3EFFA 2IH1A 5GS3A 3ROLA 3EGSB 1K4DA 4PJFA 5C0AD 1KB5B 3M45A 3T9WA 3EYUL 1LQSR 1P53A 1DN0B 3FO1B 2XYBA 5E6ZA 3QW9A 1JCVA 4LP4A 2YZ8A 2SEBA 4ZOBA 2VZUA 1LD9A 4QRRA 5AW9B 2AC0A 1FL3A 3DO4A 3EOTH 4JFFD 1UCTA 2ZONA 3IDUA 1J05A 3QHFL 4UV7L 1WWBX 3HAEA 4FQHA 3PDGA 2D3NA 2FO1A 5JORB 1HHJA 3OSVA 2BJML 4YSUA 1F3DH 1KBBA 1NAMB 1U8QB 3NZSA 2P5EB 1O0VA 1WBYA 5KBDA 3WNMA 2ZWKA 2FUTA 4P5TB 1Z1WA 2KBGA 4OKDA 3FQ4A 4B0MB 3BH8B 4JFDB 1M57B 2IGLA 2B2XH 2QVFB 1EVUA 1NCWH 1AQDA 1T0NA 2Z8VC 4WFHD 4MNHB 4G5AA 1IARB 3ABZA 3G5XA 4X7FC 4PTUB 2AKRA 5CLXA 3PF2A 4YR6A 5IFAL 5EHFA 4RZCA 4UILL 1CICC 3FTYA 5BXFA 1X9QA 1ZS8A 1NCOA 4MNGA 1BIIB 5INDA 7PAZA 5DC4B 2JXMA 4L3AA 4W9CC 3O4OB 4XNXH 2CD0A 5L8KB 4NJAL 3DJRA 1E4WH 5FGSA 1INDH 5E5LA 2FRGP 4LP8A 3MJ8B 2QZQA 4D0CA 3N6YA 3RTQC 3QWRD 1BD2B 4LCUB 1FFOA 4BA8A 2EDXA 4P5MB 2GTZB 4GI9A 1MNUL 3P9WB 4F8LA 4RWYL 3FQWB 4PJCF 4LNVA 5G5DB 1I9RH 3LN5A 3UX9B 2VO5A 5LBGA 1FDLH 2XA8L 2VDNH 4PWEA 3FW6A 4M5ZL 3DPBB 1DN2A 4YDIH 5JO5B 4WTZG 3ZL1A 2VZVA 4MB5A 3TT1H 3M7OA 1LEKB 4HWUA 4GUQA 1TO5A 1NJ9A 1THAA 1IM9B 3CSYB 4KJYB 3MRDB 4W70A 4M29A 3GBDA 4FXKA 1MQKH 3PHSA 4WZ9A 2YKLL 2EIEA 4OM0H 1G4RA 5MEPB 1PJWA 2VABA 3NIFF 4XT1C 1S4IA 1ORSB 3KPPA 3ZDZE 4Z7VF 4PW3A 3S35H 3DX9A 3HCVA 4GSQA 3P4MA 3WTYA 1H3PH 1HS6A 2I69A 4GAYB 4N4YB 2P5WB 2WLIB 1V05A 5DEGB 2ENSA 2IGFH 3NIGF 1IM3A 2EVGA 3ASOB 4PB9H 3QS3A 1SN0A 4ZZFA 1MHCB 1YVLA 3MA7A 2B08A 3HPLB 3O6ML 4KVCL 4YFLF 5LGKA 4YDMA 3DYPA 1SQ2N 3U1PA 2VYRE 3C5ZC 5IK3A 4QT5A 1I85A 1PD6A 4N20A 4NPJA 3ORJA 4MLSA 2ADJB 2YXFA 4BSWA 5DFVD 4I4WA 3ATBA 1NAKH 3JQOB 4ACPA 4UF7C 4BRJA 4Z1PA 4WTWA 1QR4A 3IF1B 4RMRA 4X6CE 4H8VA 4KFMA 2ZYIA 2WINA 2ITCB 2P5ED 1HAUA 4KKPA 4QNPE 4NP4L 4PRAB 2EAEA 1QRKA 4ZMYA 1ZHKA 2Z3FA 3FC8A 4P5TD 4Q0XH 5D6CB 2MCAA 4CA4A 1NFIB 3V0AC 1BXVA 5GXBB 2MNUA 1QI3A 4GEJA 1F11B 2XKNA 1WTGT 4B9ZA 4AQEB 3ARFA 1P7BA 2FJHB 1XAKA 3QG7H 4NQTA 3WFEH 3CX2A 1NIEA 2QELA 1FGNL 1TPXB 2VXUL 4AM0B 4HUXB 3UXFA 5DHYA 3OHMB 1ZRUA 3FU0A 4E9VA 4FL4C 4JVUA 7FABH 4BIKA 3RWFB 3NYKA 3VFRA 1V27A 1KZQA 4K3HA 4NRXB 1F3JB 3GIZH 4NRYA 1RAMA 1K5NB 1F02I 4OCXH 1WIPA 3BP4A 4ZMQA 2VQUA 3NACH 2N1KA 1BD2D 1PL3A 1XX9C 5D7IF 2XIDA 2XLLA 1V55B 2ICWI 4KJPD 1CG9B 2ICEA 2PUQT 2A6KA 3KPOB 1CC3A 5I8CB 4AKQA 1JGLH 4PY8J 3ARBB 2BK8A 4DEUA 3RWJA 1FL6A 3OAYH 1C7TA 3FT1A 1TQBB 3BIKB 1R17A 3V55A 1U8LB 2ZF8A 1VRSA 2BX5A 4WK0B 4L2LA 2DS4A 4LSSL 1VESA 4PRBA 1BF5A 1UWGL 1IM9D 1KN4L 1RXLA 5LG6A 1M7IA 4DETA 4MCYA 3WL9B 4F1ZA 3C6SA 3KL5A 4D8PB 1OY3B 1NCBH 1A8ZA 1M6OB 1UM5H 2QADB 1OGAB 3KDPB 3KWWA 3OR6B 3OWEA 1NICA 4HUVB 4HS3A 4PVBA 3VXPA 5CLTA 1LXMA 4O2CA 5ICXA 1C12B 5IB5A 1XQ4A 3GB7B 1I3UA 3DTUB 3QQ3B 4N2LA 3VE0B 5L9DH 1S7QB 1RJYA 5I73B 4OD2B 2YSSA 3BLBA 3IN2A 3TBWA 3IAGC 1OAXL 4NM4L 3GBML 5CIPH 5D7LA 1O5DT 1SJEB 3UP6A 1FGVH 3DGGB 3T3ME 1OB1B 4NWUH 4Y4KC 1Q94A 2B3RA 1MRFH 1J5HA 4KK5D 2WUBH 2OMZB 5CFAA 3RFZC 1Q9KB 2O6PA 1PGRB 1VENA 4OLEA 3QNXA 2CXKA 1KXQE 3BAWA 5E2JA 1K8DA 4KO5A 3V5KB 3O2WH 2VSDA 2F74A 4HKJB 1WF5A 1KBGH 4PJ9C 3OZKA 5DGQA 1ZT7B 3GZOA 5T5FL 1KY6A 3OLEA 4LU5H 2MKLC 4GS7C 1FYTA 3FT2A 5D2LF 5LGHH 4ADJA 4XCYB 5I8KL 3EXJA 3ULUF 5IF0A 3LHPL 1IC5L 3D39E 4X0KB 4ENEC 3HE6A 2NDFA 2J73A 3QEUB 1LE5B 4N8CL 2PWDA 1BOGA 1DBKH 4NZRL 4NM8L 5E5MB 1G7MB 1IL1A 4M8RA 4A66A 4X80L 3GS4A 4QWWC 3NG5A 2H32A 2ISDA 3R8QA 4BZ2H 4TKWA 3LZFL 1UFGA 3TEUA 4DUVA 1JZ8A 5C0RH 3E8UL 1W8EA 2ERJB 5H37H 1MPAL 1TKWB 3ILEA 5CZKA 3BUTA 3HRPA 4ILDA 3G6JA 1QHPA 5LCVL 4KKAC 3WXVL 2WCPA 3P54A 4BDVB 4AJYV 4EKJA 3KJ6H 4LASL 3LRSB 1KT2B 2Q87A 1L9PA 1IX2A 3C8KB 3BQUB 4KKZA 4BCYA 4I9WE 2J8OA 2YHGA 3O2DH 1P2CB 3VW3L 1XDTT 3HC4H 4WUUA 2AFNA 1VZHA 2MCPH 5FOBA 3X13A 4LSVL 1EV2E 4HUWA 5DCCA 4L9LB 4A2EA 1Y6KR 2EXYC 4GBXA 2GC7C 2X3BA 2L3BA 2OXHB 3ASWA 2J5LC 1CPUA 2HLFD 1IEBA 2OM5A 4E41B 5J7CC 1DEDA 5I16B 3ARBD 5JHLL 3ZE0F 1SRDA 2DWXA 1A7RH 2R59A 4HF5H 4NAQA 4JPWL 4NZDA 1R24A 5DZJA 3HR5A 4YZFE 5C0CB 4MD5B 4AMKL 1CGYA 1UJ3C 3HEIB 4PJAE 3EO9H 1K8IA 2A0LC 2A73B 3O81A 4N8VA 3WKML 4MQTB 2QR0B 4CJ1A 1EAJA 2F8IA 1OGAD 2NW2B 3D06A 4JDVA 3MRKA 3K74B 4HWBL 1CBVL 2CO7B 2BFVL 4YN3A 2Z7YA 4X4ME 1WZ1L 1U9KA 4LLQB 4HZLA 4NERA 1KC5L 4G9FB 5ISZA 1QASA 1TTFA 2ZKHL 3SDXF 5JW4Q 2OX5A 4DIXA 4K5NA 2KZ1B 5HBBA 1ZSDA 1YSOA 2VDML 4LESA 1QACA 4XO8A 2YLHA 1NCCH 3IGAB 5C07E 3TBSB 4OV5B 1FNGA 4XTRD 4JM2D 4XVOA 2OMWA 2FWOA 1IBZA 2VR5A 4J3SA 1RJLB 2TAAA 3VO0A 1AD9A 1U92B 1WA2X 4J3OG 5FUZL 3V5DB 1ADQH 1BGXL 3EO1A 4HYTB 3VXOA 4ZS6D 2BHUA 2VR9A 2QHRH 5IHLB 2KUTA 1H5BA 1V10A 4JDEA 2C3WA 4EDXA 4R26H 1IQWH 1CBJA 1X3DA 3ML9A 3B4NA 1VPOL 1TQWA 2WQSA 4IW4C 3ZR6A 5JW3L 3MOBH 3E6HB 1JWSA 3VH8B 4HIEB 4MVBD 3TT3L 2EINB 2H8PB 4H88L 3ZZQA 5TFSL 5HD8C 3X12B 3A67L 4AVHA 3K6DA 4RETB 3OKLB 1V5JA 3UAJC 4P4RA 1CZ8H 5K39A 5BUPA 3LZRA 5FV1L 4YPGA 1UM6H 1MJJB 3S6CA 1KFGA 4UM9B 3QXWA 3W3BA 4Z7WB 3NJIA 2HFGH 1MI5E 4XPFH 3S5LB 5HPOA 1AE6H 1NANI 5J0BA 4ZW7A 1GKOA 3GJFH 4NO2A 1ZTMA 1YHPA 1DO6A 4HIXH 5I26A 2Q9OA 2APSA 2EP6A 3M07A 3QO1B 5CKGA 3VXSA 4DT2A 2J2ZB 2V2WA 3MRFB 1ZT1B 1DL7L 4GP4B 4NUJA 2FJSA 3IFPA 1OAZL 2BNUB 4RAUB 1NIBA 1R3IH 3EAKA 4YLBA 4HGWA 3SKNA 5E7FA 4Q9RH 5CP3A 3FUHA 2V37A 5CCHE 1A4JA 4HXAL 1CICB 3E1F1 1T7XA 2Z93B 3AC0A 3BI9X 4HJJH 4WI3A 1WHOA 4M61B 2TSBA 4LVHC 5T1JA 3CZLA 4E41D 4M1GL 1KNOA 3KLSA 5AOLA 5GGRB 2DL9A 3SPJA 1CFTB 3BWUC 1QFUH 2GIYA 2BSTB 1XGZA 4J3WA 1T0MA 4QRPB 4IMLB 2H6UA 1AXIB 1KJVA 5IVZB 4CILA 3L3JA 4W1TA 3VTMA 2Y2TA 3RTQB 1CF8H 4PS8A 3K6NA 3HTLX 2D2CC 4FLQA 5DWUL 4AGLA 1BAWA 5EOTB 5BVJA 2AXGB 4LPUA 4AH2B 1PLAA 2ZAIA 4FTDA 4H25B 5IWLA 3IFNH 4X5XA 3L3GA 3K6SB 2CR0A 4B60A 4IBWA 3N85H 5F6IC 1DEEA 4QRQB 3ZKMD 3NGBC 4GP5B 4J6RH 1I75A 1J1XH 1IB5A 3GMRA 4U1MA 3TO4A 3VXRA 5ICZB 4U6VH 1A0QH 2B0SL 2X1XR 4N3TA 4QMEA 4WW2A 3LH2H 3J27A 5IB1A 3HKFA 3TTSA 3GMMA 2MHAA 1E4XH 4QRAA 4Z7UE 3RVVD 5I0WA 2QKIA 3DV6A 4KV5E 5SV4A 3WFCH 3KGUA 4YHZL 3DECA 4LPCA 1G6RL 1E2VA 2CIIB 4JRXE 5EH1A 3B5GA 3FMGL 1G9HA 2Z1KA 1BECA 3TBBA 4QHUB 5A3ID 1B3IA 1JTOA 4G8GB 3BRGC 1FBIH 3U82B 2X70A 4TUJA 1PVHA 3Q6FA 4EN2A 3WTTA 1U8PA 2C26A 2FTAA 1JNLL 4DW2H 3MRMA 2PCFB 2H6PB 1NZRA 1H15A 3FB7A 3W82A 2E74C 3C5ZB 4GO9A 4K15A 1A47A 3ABKB 3O45A 5AWNL 4OCSL 4J4PC 3WIHA 1A1MB 4HJ0C 3KLAB 2DZEA 5FECA 3ZBMA 3OHXC 2WBJA 1EGJL 2K7QA 1S7WB 4UM9D 5C0DB 3RB5A 2M1KA 3OAWA 5DJDB 4FHBD 4U1IB 2Q6WA 4BINA 4I18A 2XZZA 3FO9B 2MSPA 2Z0UA 4ZYKB 1P0SE 2YD9A 1BLNA 5DS8B 4AW4A 5HHQB 4HMCA 4IS6B 2KZWA 2EILB 3OF6D 4IHOB 1UH3A 1IAIM 1X9LA 5C86A 1QI5A 3IJHB 4D0BA 4PWIA 3EKCA 5MEOB 3GRWL 5AVTB 1N64L 2JF1A 1U21A 3IDXH 4KXAA 3SOTA 1VSCA 4Z7OE 2UYLB 2ADYA 5CD5C 5DVKA 4EOWH 4ZXBA 4IRJC 3H9SA 5D72L 2P80D 4UI2A 2JV6A 3LDBC 1CICD 3DX6B 2X4QB 3MROA 4B5EA 2GC4C 5HJ3A 4WWNA 2AQRA 1MVYA 1FRGH 4X8JA 4R96A 3ZL4H 3JWDL 3T2NL 3QCUH 4FL4B 2VDMB 1CS6A 1DQIA 4ODWA 4OZFG 3ZTDC 2KMWA 2W9LA 3KW7A 12E8H 3RTQD 4KGJA 2W60B 4F2FA 3B9KC 2OR9L 3AQDA 5HDOA 2IDCA 3H56A 1K85A 5K93A 4XNUH 2Y06L 4HIJA 4N8UA 4PHZA 5C9JA 2G3MA 5TDNB 4B97A 4YS4A 3L17A 1UACL 4FEMA 1SXBA 5CJQH 1XF4A 4QHNB 5TDOB 3WI9A 3ZSTA 5K69A 3QEHB 4XPGL 3QORA 4AGOA 3OLIA 1N19A 4HSCX 3UACA 2R2CA 2JKIS 3SJVE 3U36A 5BVPH 3GBLA 3KHOA 5FKPA 1IFHH 1EUTA 3QR0A 3P2DA 1ZGLB 1BFVL 1AO7A 2HUHA 1JN6A 4U1SA 4D9QE 3I3BA 3S96A 1B4JH 5B8CC 5IQLA 1I8LC 4U6HA 4UBDC 1REIA 2IBGA 1AZRA 2EO7A 2VLLA 5E8OA 2IFFL 2DQDL 4J3VA 4QXGL 5DFAA 2WLMA 4DWHA 2CO6B 3MCKB 4Z0BH 3O3EB 3LMJH 3VD1A 5DUML 4YDKL 4EDWH 4DPBX 4ONGL 2K8QA 2FEEL 4XXDB 4ZPVA 1U8NA 3D2UA 3HNSL 3PWPA 2VR7A 3KH4A 3QZBA 1EAPA 4WO4C 5D7KD 2IDSA 5EIVA 1KYOJ 3ZHKA 4G8GD 5CGMA 1ZVSA 2Z7ZA 3C6LA 5C0GA 4NUGL 3MFFB 2HVKA 5D8JH 2DIEA 5I5JA 1HIMH 3MACH 4MJHA 1XSJA 3UTSD 1YY8A 2FLRT 2JB6B 2Q7AA 1AIFA 3C5ZD 4UNIA 3FUIA 4L4VB 3MOAH 4AYMC 3RFZB 2OR7A 4P3CL 3LPWA 3BWSA 1CFQA 2VLRA 4OCYH 3L5HA 3D12B 3SE6A 4ONFL 4BFOA 5T3ZD 1M05B 1EAQA 4HK0A 5T8IA 4DVRH 2KI6A 4XAKE 1ZE3C 2NY7H 1MRDH 5HYJA 2WO4A 4W9FC 4JQXA 3EXLA 5F7MC 3QQDA 4PJ9B 4YBHA 4Y4FA 4HK3J 3U9PL 5TH2A 4JFYB 1RPKA 3DSFH 3R06A 4GS7B 3PUCA 4DSYA 3BD3A 1NDMA 4HIIB 3UJTL 3ESMA 1NMBL 4OZHA 2K3TA 1F41A 3NN8B 4L29B 1T03H 1D2PA 5BJTA 5CHNB 3DGCR 1HJBC 1E4HA 5EU6B 1O5PA 2MKWA 2F8OA 3MV7A 4GSXA 2VXVL 5E8DL 4PJEA 1PQZB 4O2FB 4BFFA 1TNMA 1UUSA 1YNKL 1OCWH 2EO9A 1U91B 4NZUH 4LL4A 4HG4J 3VRJB 1RZFL 2OMXA 2YQ3A 3BPLC 1AVAA 1HE8A 5AOMA 1XGRB 1QAWA 3HG1E 4JO3H 4QY8B 2YPVL 4LIQH 4TQIA 4F8NA 4I77H 1MW1A 2VLME 5IM7A 2H2SC 5GS0H 3ZE1F 1WEJH 5E8NA 2R1XB 5HY9B 1UM4H 1ZA6A 2W07A 1T7ZA 5CEXA 3SDYL 1RJZB 2E6QA 2BM3A 4ZJ9A 3WTUA 3VXMB 1JK8A 2CRZA 2NY4C 3F64A 2GSGA 1G6RB 4LSQH 1W0VB 3JV4B 4UB0H 3KBEA 2V5SA 3BH4A 5LAXB 2J5LB 1ODAA 4NWTH 2HT2C 2NNAB 1A4KB 1QBMH 3HHSA 4MJ6B 2EKJA 1PMYA 3CPLA 3U1SL 4IOFC 5G4OA 5ABAA 4DP7X 5BS0E 4GO6B 2P45B 4JY5H 1UJ3B 3MRLA 2X89A 3CIAA 1TQVA 2ZAGA 3CVHA 3WNPA 1TEFA 3IFLH 1JF5A 1E8YA 2P42B 3OPZH 4DP8X 3HRZC 1UYWL 3BFWA 5IQ7H 2R0KL 3CWGA 1NEPA 5F7FA 2CR6A 2XETA 3NSXA 1Z9SB 4DZ8B 1B0GB 5EB9A 4LLVB 2XFGB 5EBLA 43CAB 4LLYB 4QRTB 3CK0L 4H7VA 4Z7NE 4N2GA 4AV5A 1SDYA 2DPKA 4J8RB 4WHDA 4ZTEA 4O9HH 5DVPA 4J1UA 3BKYH 4Y4KD 2V5MA 3D52A 4L4VD 1HHGA 2J55A 4TUOB 5EU7E 3ULUH 5I1LB 1N5YH 3ZDXF 1NBZA 3B9AA 1ORQB 4QXTB 2EZ0C 1O7DE 3X3FL 1MLBA 1S9WB 3WENA 4WTZA 2J56A 3BKCL 4MZ3A 5EU4B 1A6WL 4PBVC 3S0PA 1Z3RA 2ZX8A 2XWBA 4OLXH 4B9PA 1BZ7A 3MCYA 4NQEB 1JWMB 3DO7B 5DJ0A 2R7EA 3GNML 4PJ9D 4RFOL 4DO5A 1NUDA 4Z7QB 3O8XC 2NX5A 3W0WA 2ZWLT 4HX1A 1NFDB 3B2VL 5D1XA 4EI6B 5HGHA 3AG2B 4HKXB 1RL1A 3T0EA 3DMMA 4ENED 1LLAA 1OAKL 2OZNA 2XC8A 3O6FA 2Y6TE 3QNFA 3WYRA 1E6OH 3OAZK 3MNZA 1MF2L 4WUKL 3UZQB 2P7TA 3G5WA 3CZFB 1TJGH 2AERT 4PRPA 3KWXA 4H5SB 4QWWD 5EU6D 2HFFA 3ISYA 3HNTL 5EZIH 4CU8A 1TTCA 4CBZA 3P4LA 5ACZB 1S7UA 3F84A 1QOKA 1LEGA 1MFCL 3IGLA 1GYAA 4NGHH 4PRNB 2Y5QA 4AMWA 3VTAA 4KKAD 3FU3A 1G7PA 1MFAL 4XMPL 3SCMC 4ERSH 1J5CA 4X8CA 2WXQA 5JW5B 5IESL 3I9IA 2WZ0A 3FFCB 4FXLA 3UERA 1T1YB 1N59B 4XPBL 3TEXA 3RWIA 5CZRA 1QBAA 1BDYA 3DI2B 1NLBL 1OAYL 3VD3A 3DUUB 3RDTC 4ZSOE 3O3AB 3VXMD 3IKKA 4KZEH 2O4EA 2EXYD 3MV01 3POHA 2YPLE 3ZDYF 4FQIH 3T2LA 1P7HL 1J0YA 4LVHB 3ZMRA 1CLYL 3CDGA 4RISL 1YYLH 3GSXB 4KTGA 3LN4A 1J5OH 2OS7A 1YEHH 4ZFOB 3L3IA 1KCSL 2X0WA 4PRHE 5CCJA 3WAJA 1HXYB 3FN0H 1G7HA 3GXTA 4J3TA 2A0LD 4XP4H 4CC4C 2C1PA 3BW9A 4MBRA 1SN2A 5EIIB 5KBKA 3HI1A 4X6BA 5AKTA 3NQIA 1HHKB 4L3EB 1A7BA 4XOBA 3U4EA 1JZJA 2NY3C 3RGBA 2G4EA 4BK4A 4E42A 3NZHL 3T0DA 2XN9E 2W9DH 1BQRA 1JZGA 4P0DA 5FHBL 4ZMTA 3EBHA 5FOJA 4BZ1A 3GKWL 3CXDL 5B39B 3NGBB 5DF0A 4YVUA 5ECGA 1EO8H 3Q13A 4LSPH 4RX4D 4MAUL 4FFZL 5ITFB 2NOYA 3MV9E 3L4YA 3VI4A 4WI9A 3GXNA 3H2WA 3OJDA 4P2OA 4LCCA 1AMXA 5AEAA 1F90H 5DURD 5GGUA 4NBYB 5ANME 1BFTA 5GJSL 3VGFA 2EXSA 1DDHA 2FD6L 3I50L 2H3NA 2YR3A 3BAIA 4GLRI 4NQED 4OCWH 3DVGB 4BD4A 3Q3GA 3IXTA 4OQ1A 1S9YB 5BO1H 1TVBA 2J1KA 2XV2A 3ECWA 4POUB 4UQDA 1Z3GL 3EG9A 4HW6A 3JYBA 5H4YA 4CKQA 1FG2B 5CBAA 3DUSB 2BIIA 4AQAA 3ES6A 1E27A 3I74A 1S5HA 4OIFA 2EE6A 5J57B 2FIKB 1L7IL 4S2SB 4QHMB 2P8PA 1PFOA 3EYFB 2A6DB 3N44B 5HD8D 4PH8A 3BUYB 1NOAA 5CILL 1SNRA 2WHVA 1NOLA 3UAJD 4A6YL 4ANWA 4IOIA 1OTTC 2HFEB 2WQRA 2BY2A 2DLTA 4PCYA 2BY0A 5LXGH 1NWPA 4NLHA 3MU3A 3US0A 3A23A 1TMQA 2F53A 3IDNA 3UC2A 1YEJH 3T6QC 3WSQH 1NL0L 3LPPA 2MPVA 3VU2A 4OTXL 4BV1A 1PKQB 3FFCD 4RMVA 5EDXA 5I2IB 5F9WC 5CCKL 4MQ7B 1UCBL 3UEZA 5KVGL 5DMKA 1HNGA 3QDJE 5CUSL 4M62H 2OSLB 2YUWA 1D7CA 3V0IA 4YNYA 3B9EA 5LJYH 1HKLH 4OJEH 3E9UA 2GK0A 4F2MA 1WP6A 1KCLA 2XWJB 2FLBT 4IRJB 1VZIA 2HKHL 5GGQH 1MNNA 1L4IA 2K0RA 3LDBB 1MWAL 2AJXL 5DZLA 2YD4A 3RGHA 1L0QA 4YDLC 3VX0A 3MC0A 2YO3A 2HH0L 1AQKH 1JUFB 4DN4H 3MV8E 4MJIA 5A2FA 5E94A 1H3GA 2VOTA 4P57B 2O30A 2HRHA 2YUVA 3RI5F 3KYKH 2WUCL 1RHFA 2BSSA 1VGEL 4OLUH 4YSAA 4W9ZA 1OOAA 4JFOB 1UXWB 1FV1A 4MA7H 4GAGH 3IU3A 4MSWB 1EHLL 1E5YA 1Y18B 5C08E 4KQ4L 5TD4A 3MXVH 3UTTB 4HCRH 4X5WA 3B9KB 4L3ED 4BHUA 3L54A 3BKMH 3L4XA 2YFOA 3L9EA 5ANHA 1U3JA 4PJCE 5AD0B 4OCLC 5GGSB 5HHOA 1RZKH 5E00B 3Q2WA 4WW1A 3TYGH 4QF1B 2X4PA 4J39A 4NC0B 5DEFA 1OXYA 4XMLH 2HA1A 2QGCA 4JKPH 4TPRH 1I3VA 4C55A 3WN6A 4BK8A 1SYSA 1PTZA 2FX9L 5KS9F 2J88L 5A2JH 4J3UA 5B8CB 2FSEA 5KSBA 3WTWA 4A04A 3IETB 4XMWA 3I9AA 2XTSA 3G5VB 4GKOA 4WI2A 1YNTB 3NIFE 2JKWA 1I1AA 4KMQA 4Z7VE 4Z95H 2NUTB 4XCEA 4LEXL 3L48A 2XG4B 4LLMA 1TQSA 5EG6C 1PSKL 4JMNA 3FYIB 4GKNB 4AYEC 1MCDA 2O5NA 3NIGE 4WO4B 5D7JD 3IJ8A 1NDGB 2Z91A 3JV6A 1FZJA 1O6SA 5F72S 1T83A 4M9OA 4DGIL 5EWIL 3FUKA 1BBJB 8FABA 3QNYB 4L5FL 3L4WA 2QJDA 2VDQL 5L6YL 4ZUVB 2BVOB 4H20L 5CBEA 3W2DH 1XGTB 2EIZA 1A1OA 1M9WA 4JCLA 4CNIA 1A7OL 3DTDA 3LH9A 4BYHA 3I6GB 4J4PD 3NRPA 4HJ0D 4FG2A 3WEAA 5HYSB 2EH7L 2BVEA 4GW4A 1MLCA 3K5RA 1AI1L 1PKOA 2FX7H 4LSTH 3C60A 4CRPA 1YAIA 1FFPB 3BZ5A 4G70B 2FEDC 5DO8A 2DYPA 5ESVB 1FFRA 2X2JA 1KN2L 1RZ8B 2ODHA 2F2HA 3FRPB 1E9PA 5EC2B 4BFIB 4URKA 1CGXA 2L0DA 5DLMH 1JJUA 4JPVL 3TNMB 4B6ZA 2WNKA 2F58L 2GCYA 4FMKA 1RVFH 4LPXA 2VN6A 3OKKB 1N3NB 5E8EB 1PZ5B 4ECNA 3OG4B 5CD5D 2WZPA 4UUJB 4IRJD 1R3JB 4YC2B 1I82A 2GG1A 4W9IC 3U48A 1QI4A 5DO2C 4PHXA 4HOXA 3ESVF 5FKAB 2I7SA 4HOWA 5BZWA 3A6BL 1CD8A 3BPLB 5F8RC 2KLTA 2WSDA 4Y9FA 5T1MA 1PG7H 2CKNA 2W88A 3AGVA 1BZQK 1P9MA 3FQXB 2JFCA 3MRJB 2EYRA 3AAZB 3B43A 4K3JL 4UAOC 1C5CH 1ES0A 4K94H 3BSGA 4PG2A 3JXAA 5I1AA 4GSDH 3A24A 4PGCB 3UTTD 1CLVA 3B9KD 2NY4B 2VM9A 1U4EA 4GXVL 3IMWA 1MVUB 4BFEA 2YS4A 4ETYA 3BAKA 4KXBA 5FEBA 4FG0A 1I3GL 3DOIA 4V1DA 4UU9A 1KB3A 4L8BB 4LFHD 3NJJA 1KCUL 4LIQE 5HI4C 1MOEA 3OXSB 1GGIH 4KTEL 8PAZA 3VUAA 3LV3A 1YEEH 5C0IB 3RJDA 3AB0B 2IPKA 1P4UA 3MJ7B 2XVLA 2RD0A 3GMOA 5E08H 3VRIB 5FGCB 4F3FB 1PS3A 1J0HA 1XGYL 3INUL 4JHWH 2Z31C 1DBBL 3HRZB 3L6FB 2X0UA 4A6YB 1BVNT 5AB0A 4P2RB 1CO1A 3UC0H 4TVPH 3UPCA 2PW1A 3ALWA 1WK0A 4QYOA 4E5XG 5C0NC 4PJ7B 1JS4A 2DM2A 1JSYA 1XR9B 1BM7A 2YXWA 3BPNC 1WO2A 4IRSC 3F65A 4WO4D 3VCLB 2WN3A 3NA4A 4QHKJ 2EQDA 2G75B 3MCLL 2JCCB 3LEVL 3AS2A 1XHHA 4GQRA 4NQDE 1QPPA 3MUGA 4DVBA 5EBMA 1NBQA 3QA3B 2WLJA 5EFIA 3KS0J 3WFBL 1F4WL 4ZUUA 1EO7A 1QSFE 4EAEA 1AGEB 3DJZA 1Q0XH 1JIBA 4HS6B 1QBLH 3FB6A 1AY1H 1RIHL 4JZOA 1OARH 3HN3A 4A7UA 4JO2L 4BRVA 5KSVA 2A7BA 3Q44A 4JM4L 2DKMA 2I07B 3S37X 3WUWG 5I66A 1MWAB 3EBIA 4F7EA 3CHOA 1UWEH 1TSRA 1EXGA 2P43B 3FO0H 4KPHL 1TF4A 4JM2F 1NCTA 1ILUA 3KGTA 4NZ8A 1G9NC 2L7JA 3I9GH 1PAZA 3O8XB 2O61B 1Q9OA 3G9VA 2C7UA 5D2LE 3KXFB 2G30A 2APFA 3UPRB 3ZHFA 2H41A 1XZ0A 3HG5A 1XTLA 1P7QB 4XCNA 3K2UL 3UAFA 2JKNA 3PWJA 3ULUE 1WAPA 3KGSA 4GRLC 2FIRT 3VWKA 4PN6A 1Q0YL 2DD8L 1MHHA 3RX8A 3TPUB 1XIWC 4Y5VA 1AGDB 4G80A 4JKLA 3TNNB 4MNQB 2H45A 2XT1B 1CMOA 4JJOA 1N0LB 2JQZA 3SO3C 4FXTA 3L5JA 1F56A 2XV3A 5J11B 4G8EA 1MIML 1UA7A 1MCLA 5TQ0H 1GY2A 2CQVA 4H1LG 4MS8C 1GPOL 3H53A 4PP1C 4FZEL 1SY6L 3VMOA 2AJUH 1Q9WB 3SCMB 3JTTB 2ADGA 4LAJH 3DYMA 4L8SA 4NB7A 4P23A 1JCKA 4YLCA 2H2SD 3HC0B 2Q86B 1JZ4A 4KMTH 3WKYA 1TTAA 4KKCC 5GS1A 2FEEI 1FCCA 3RDTB 3MLXL 3M17B 2O93L 3ECUA 4EXPX 2EJ1A 2NY4D 3MUY1 2CO4A 1IGMH 2DM4A 4IRZH 2VR6A 1S8DA 1UADC 3QDHA 3FHEA 1CFMA 1EHKB 4F2EA 4S1RH 3PWUB 1LDSA 1QHOA 2HT2D 2HSIA 1K2DB 1VFBB 3ZE0E 1YG9A 3BPCB 4Z5RA 4WHCA 5DEZA 3SPCA 3L3OB 5DHVA 4NUPA 2VRKA 3JZ7A 4PIBA 3NCJL 1N6UA 3EH5B 3N50A 4FZ8H 1Q72H 3QUZB 4IOFD 4YHLH 3Q8CA 5DQ9B 4XZUB 4HT1H 4WY7L 2XVKA 3FTGB 5E2VH 3QUHA 3T6WA 3NPSC 5DR5H 4ZQTA 1QQDB 1UD5A 3TA3B 5DRZB 4KOCA 1BZEA 4DKEL 3C5SB 1CLOL 3NJMA 2B5IC 4P2RD 4JGNA 4J6IA 1D5XA 2GTWB 2Q20A 3H3BC 2NY3B 2X2YA 3I3DA 2L8AA 2J4WL 1WBXA 4WI7A 2WXIA 2IOOA 2YD3A 5F3HB 2FHBA 2DF3A 2AS5M 1UENA 2OKMA 2ZSWB 2QLYA 3BMVA 2YMXL 4OZFA 4QKTA 4UTBL 1FFNA 3KPLA 1URLA 4Q4IA 5FA4B 5GRWA 3SDXE 2XRAL 3MI6A 4S1SL 1IC4L 2YN3A 3FT9A 3TIDB 3LEXA 1IEAB 1F4YL 3GSNA 2ZPKH 2AXHA 2EDTA 5DS2A 1YEKH 3ZE2E 3TESA 1UZ8A 1QW9A 1TZGL 3EDDA 4XI5C 5EUKB 3DI3B 4HPOH 2D0HA 3VNZA 4N0UE 1RMFL 1NCDL 4MB4A 4PGZA 5T3XH 1ESOA 4U1KB 2Y1VA 2CH8A 2WXHA 4ODUA 5KW9H 2EZ0D 3QQ9C 4WU5A 1UWFA 5AW0B 5MENA 4Z3TA 4X6DB 5JOFA 1TTRA 1ZWIB 4Y4HC 3QDMA 3K46A 1PG7W 3VXUA 1KGYE 4PJHF 4FJYA 4TSAL 2X4UB 2AJVL 3HC3H 1EIBA 4MAYC 1SM3H 3O8XD 4PFEA 4TNWK 1N2RA 1MRCH 3TBTA 3MLSL 3DJSA 2GUOB 3KXFD 4XP1L 4XGZA 4M3HA 3MDJA 3UTZB 2F7OA 3V8OA 4ZI8A 1P7QD 4IKLA 2B1HH 2WNGA 5DFWH 3LKPB 3P4OA 1XD0A 3JYCA 4ZAKC 1Q90A 2TRYA 3FFDB 1UD6A 4P07A 4MNQD 1L6ZA 3MBXH 5KJ7E 4JKMA 3SDCC 2HLAB 5JMRA 3CFCL 4MCZB 5TTRA 3RUGA 2F54D 3INOA 4LPVA 2JK5B 3TH2T 4NEHB 1CR9H 5E23A 2CKBL 4LDEB 2HTKC 3QULA 3QRBA 5FYKD 4DTGL 5KVDE 4GG8B 4DKAA 3SCMD 2KZKA 1J0IA 3DOSB 4OF8A 4Z78B 2X6CA 4B95C 3N40F 1TJIL 5F9WB 1HZKA 3RYMA 2ZXBA 5GZOA 3CSFA 4OFPA 5ESAB 1GGTA 3CD4A 1QYGH 1CXFA 4KITB 5I15L 4F8OA 2I60H 5E4OA 2HXAA 3RDTD 3O4LA 3NCXA 4XB7A 1J0ZA 4Y19E 4XH2B 3LRGA 2H9GB 1AD0B 1T3FB 3DIFA 2G2RB 3CHPA 4W6XB 5IFHH 4YDLB 3L9RB 2BWDA 4KO9A 5I75C 1R6VA 2HUEA 1AHMA 3L45A 3E0GA 1BZ8A 4HD9A 2X1PA 5C0BA 3W39B 3V4PL 3G08A 3VFNB 3CLEH 4C83B 1QFWH 2RJMA 1R47A 3LB6C 4LE8A 5DT1H 4KHTL 1EUUA 1I8MA 4WNSA 3LX9A 1A6TA 3ZDZB 3DHJA 3CN0A 2R2HB 4Q97A 2AXJA 2E27H 4BXSV 3VAEA 2NY3D 4ZDHA 3ZMEA 1Q1JL 1M71A 2MQCA 2LW3A 3EDJA 4G6KH 1F6FB 2N56A 3RNQA 4GP8B 3P4NB 2DW5A 1UXMA 3ZTNL 2F15A 3BXNA 4JFZL 1ID2A 3O3DA 2VUKA 1Q4NX 3WHXB 4JE0A 1BMZA 1V7MH 1TQUA 1WG3A 2X44D 4HSQA 4JY4A 1RIUL 3ECBB 3HMWH 4R7XA 3V5HB 3W9DA 3I85A 4WHYG 3T0XA 3L13A 3MBEC 3SE9H 3FQRA 3TP4A 4ZK8A 3L16A 2OMNA 4XVJL 2VZ3A 1KGUA 2XZAH 4OH2A 5LN4A 5E8PB 3LHAA 3D4YA 4LLWB 4QXUH 4HC1H 1EFXB 2WB7A 1KB5H 1ICTA 3WFZA 1KGXA 2DYRB 3U7YL 5F9JB 2HRPL 3MGTA 3N9GH 4JUSA 1NGWA 1KIPA 2QQKL 4QTHA 1MCKA 4BBWA 1JF1A 5LQBL 5IMKB 3U2IA 3GMQB 2XIIA 2IH9A 4FULA 4EUPA 1OTTD 1VF5C 4OF7A 3OXRB 1YEFH 3QIBC 1YDPA 4B5ZA 4JNXA 4YHPB 3PAZA 5DHXB 1A1NA 2OK0L 3FCTA 5MERA 4XMVA 1W9XA 1FIGL 2AK4A 2C7FA 3HS8A 3S88L 3IMBA 1CN4A 4UDTA 2R1WA 1BFOA 4FG4A 2EC9T 2O5ZH 5DVNA 3MRRA 2D4FA 4JQIL 1RFDL 1R3KB 3PL6A 1YPZA 2J6EH 1KIUB 4NQCB 4P49A 2QV2A 3S4SB 2F68X 2X2HA 5DZVA 4J12A 1UQSB 3IPFA 1UD3A 4OGAC 4WQOA 3OKMA 5JHBA 1KOAA 2BP0A 3BE1H 4HZAA 1VGKB 5I8OL 2XTJE 1L5GA 4X7DC 2VR4A 1U8IB 1HOCA 4FERA 1RSFA 1U3NA 4RIRB 3P2TA 1EMTH 5CJBA 2WXKA 2QQNH 3CXFA 2XG5A 2HJLA 1IAKB 4Y9EA 3MR9A 1IUZA 2V33A 3ETTA 1WZAA 2WVTA 1BWMA 3V0WH 2G5UA 1OT1A 5I1GH 1OL0A 1TZOA 3QDGE 4APQA 3EOTL 4UAOB 2Q76B 1RPUA 1P1ZA 4X4XA 1BBDH 2IH8A 1NEZB 2PTTA 3WFHA 3T1WA 2NLJA 1INEH 2CO3A 4FQJH 1FNLA 1VA9A 3O0RH 3HPJA 4O51A 5IROA 1QSEA 3L1FA 4XBGA 4NNYA 3TBVA 4YLQT 2D31B 1WUZA 1CE6B 1C08B 1G7JB 3NCMA 3TVMC 2AZAA 5CMAA 4FFYA 3HS0A 3HG3A 3ZZLA 2B2XL 1FAIH 1I7UA 3P0GB 4TV3A 5D9SB 5IB3A 1NCWL 5F1NB 2P5PA 3R18A 1NMCC 1DVXA 2YUXA 1OT2A 1X4YA 3SGJC 3SE3A 2RGSA 1U8OA 1LEIA 3GSVB 4X98B 5C09A 2Z31B 4POYA 5ACLA 2ZUWA 5EN2A 8CGTA 2KKQA 3VD7A 4GUCA 4AX3A 4W4OC 4XNXL 4G5ZH 4OZIB 4QRSA 3Q9PA 1AR1C 3LQZA 4O5LH 3DA0A 3RWGB 2YQGA 1RSYA 2CKBB 3BPNB 4L2YA 2CBQA 4QHKI 2A1WH 3QEQA 4IRSB 4JN2B 1URIA 2V7NA 4XXWA 1INDL 4AGNA 5JHMA 4U0QB 5D6DA 5HYQB 4HWZA 1EFXD 1ROWA 3D39B 4WK2B 4IU3B 3UCQA 3AUVA 4TRPH 4EZLA 5IB2A 4N2NA 1N8ZA 4R7VA 4LLUB 2PYEA 1P4LA 4TVPE 1VKXB 2WN2A 4FMFA 5JDSB 3C2AH 1U3HC 1I9RL 1WCBB 32C2A 1NM9A 5DS1A 5GPRA