1N68A

Copper bound to the multicopper oxidase cueo
Total Genus 132
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
132
sequence length
487
structure length
464
Chain Sequence
ERPTLPIPDLLTTDARNRIQLTIGAGQSTFGGKTATTWGYNGNLLGPAVKLQRGKAVTVDIYNQLTEETTLHWHGLEVPGEVDGGPQGIIPPGGKRSVTLNVDQPAATCWFHPHQHGKTGRQVAMGLAGLVVIEDDEILKLMLPKQWGIDDVPVIVQDKKFSADGQIDYQLDVMTAAVGWFGDTLLTNGAIYPQHAAPRGWLRLRLLNGCNARSLNFATSDNRPLYVIASDGGLLPEPVKVSELPVLMGERFEVLVEVNDNKPFDLVTLPVSQMGMAIAPFDKPHPVMRIQPIAISASGALPDTLSSLPALPSLEGLTVRKLQLSMDPMLDMMGMQMLMEKYGDQAMAGMDFHHANKINGQAFDMNKPMFAAAKGQYERWVISGVGDMMLHPFHIHGTQFRILSENGKPPAAHRAGWKDTVKVEGNVSEVLVKFNHDAPKEHAYMAHCHLLEHEDTGMMLGFTV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Blue copper oxidase cueO
publication title A Labile Regulatory Copper Ion Lies Near the T1 Copper Site in the Multicopper Oxidase CueO.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Oxidoreductase
total genus 132
structure length 464
sequence length 487
ec nomenclature
pdb deposition date 2002-11-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00394 Cu-oxidase Multicopper oxidase
A PF07731 Cu-oxidase_2 Multicopper oxidase
A PF07732 Cu-oxidase_3 Multicopper oxidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 1n68A02
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 1n68A01
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 1n68A03
3CVCA 4DP7X 2DV6A 1CURA 2P80D 5F7AA 3NSFA 1OV8A 1XB3A 2CBPA 2I85A 9PCYA 1NIAA 1NTDA 5FC9A 1OCCB 3NP3A 2YAPA 2PLTA 2IH8A 2EIJB 2R7EA 3NJNA 4HIPA 1NIDA 4A67A 4A2DA 1RZQA 1OCRB 2OCCB 2B08A 2FT7A 4MFHA 2CCWA 1SJMA 1SF5A 5I26A 5PCYA 3TBBA 4AKPA 3TU6A 1ZIBA 4DP4X 1ZPUA 3L45A 2J55A 3FU7A 3MX0B 1KDJA 5E9NA 1V54B 1W6LA 2EIMB 1J9QA 2PPCA 1BXUA 3S8FB 3NJFA 1J9SA 4JKNA 5I6PA 4W1TA 2XLLA 2IDSA 4HZ1A 3NJKA 5IY5B 1AS7A 4UF7C 1GYCA 2UXVA 4DP8X 4DP1X 1FWXA 2BWIA 4KNUA 3PLYA 1BEXA 7PAZA 2EINB 4BK5C 2CJ3A 3N2JA 7PCYA 1NIEA 5ANHA 1TKWA 3PAVA 2CUAA 2HLEB 3FPXA 1KYAA 1V55B 3D12B 2MTAA 5B1AB 3G5WA 2HRGA 2I7SA 1NDTA 2IDQA 2TSBA 2WO2B 2BW5A 1ADWA 2PP8A 1FA4A 3OQRA 2UXFA 3RYMA 1SHXA 2JFCA 1EHKB 4NERA 2Y69B 2WSDA 4YSUA 3OMIB 4FAAB 1PAZA 2FT6A 3FSVA 1SNRA 3NJGA 3ABMB 3QJRB 4BDVB 1KCWA 3GXUB 2VM3A 1NPNA 3WG7B 2YARA 2XV2A 1OE2A 4QLWA 1W8EA 2J5WA 2HX7A 2YQBA 2BP0B 2H47C 1HFUA 2DWTA 3IEAA 1X9RA 4G70B 4N8UA 1SDDB 1W6WA 2RACA 2VW7A 1AS8A 2ZXWB 3ZIYA 2BWDA 4ZK8A 3OD3A 3NT0A 4Q8BA 3T6VA 1JZIA 1EZLA 1WA1X 2EIKB 3QJQB 1IUZA 4PAZA 1AG0A 1BAWA 1GS8A 1RKRA 1XB8A 2VSMB 1SFDA 5D4IA 1AZCA 4G7QB 1ZDQA 2WO3B 1E65A 1KBWA 2XX1A 1MDAA 1E67A 2UXTA 2PPAA 3AG2B 3T6WA 1XB6A 1NIBA 4HHWA 4YSQA 1AQ8A 2TSAA 1J5CA 1J9TA 2IAAC 2QDWA 3OMNB 3PPSA 5AFAA 1JZGA 2PPEA 1JVOA 3JTBA 1NWOA 1ET8A 1NZRA 5F7BA 4GYBA 2FT8A 2GHZA 2PPDA 4UANA 2XV0A 3PXLA 1CYWA 3TASA 3NJJA 1OCOB 1F56A 3KW7A 3SBRA 4CSZA 4F2EA 5B1JA 2AZUA 1BQRA 2PP7A 1ET5A 4KO5A 3GDCA 1M9WA 1OF0A 3X1FA 2FTAA 3CVBA 4HAKA 2FQDA 2Y1AA 3FPYA 2MRYA 1A4BA 3EHBB 3CVDA 2YXWA 3SBQA 4YVNA 1JZFA 5I5MA 2UX6A 3QQXA 3NSCA 1QHQA 4FA7B 1ZV2A 4YSSA 4KNSA 2YAOA 2HXAA 3BVDB 1WA0X 1B3IA 4Q89A 1M56B 4G71B 2Q5BA 2VMJA 2ZOOA 5B3SB 1A65A 1T5KA 3IN0A 2HRHA 2BHFA 4KO6A 3X1EA 3WIAA 1PY0A 4BXSV 3FYEB 4X4KA 2IDTA 2FQGA 2YAMA 5D4JA 2CAKA 4YVUA 4YSAA 2A3TA 1ET7A 2GBAA 1XMEB 1R1CA 1PZCA 3AG1B 3V9CA 4BWUA 2PCYA 1MZYA 1SHWA 4G72B 2NRDA 1TEGA 3NJIA 4GP8B 1JZHA 1AZRA 2FJSA 2QT6A 1OOWA 1AANA 3WNIA 2FQEA 4A2FA 1AS6A 1J5DA 2XYBA 3N55A 3QJSB 2HX8A 3H4FA 3IN2A 4HCGA 1NWPA 3T6ZA 1OCZB 4DP9X 6PAZA 8PAZA 2UX7A 1WA2X 1PZBA 2ZWNA 3GYRA 1NIFA 2FWLB 2J56A 1RCYA 2XXFA 4RH4A 2OV0A 2BZ7A 4E9XA 2OJ1A 1BYOA 1BXVA 3BQVA 2HX9A 3MBWB 1MG2C 4M4RB 3CDZB 1PCSA 1PNDA 4BWTA 1JXFA 1HAWA 3JT2A 3AW5A 4DP0X 2W8CA 1AOZA 4BDVA 1BQ5A 4ENZA 2YAEA 2BP0A 2BW4A 1GR7A 2B3IA 2IWEA 5B7EA 4A2GA 3DIVA 3UACA 3X2QB 3ERXA 1AZNA 2H5UA 2X87A 3FQ1A 3NSYA 3EH3B 1PLBA 1SDDA 4P5SA 3FSZA 3NYKA 3QJVB 2YAQA 3FSWA 4KOBA 1GY2A 3ABKB 2AVFA 4A68A 1PNCA 3CG8A 1QNIA 4DP2X 2DYRB 3DTUB 2CALA 3OMAB 2XXGA 2Q9OA 1GS6X 1A4AA 1SF3A 4E9WA 4GY4A 2H3XC 3H4HA 2GC4C 2IH9A 3FYIB 1PZAA 3T6XA 3NJLA 1VLXA 1JXDA 1JZJA 1NINA 1CYXA 3AZUA 1KV7A 3X1GA 3ZX1A 2HZHA 2BP8A 1ILUA 3FT0A 4E9VA 2J57A 4EF3A 4DPBX 3QJUB 2FQFA 4PCYA 3NJMA 4WKXA 4HCFA 1ASPA 2XVBA 3ZDWA 1JZEA 4G7SB 1MZZA 2W88A 5PAZA 1BQKA 2DY2A 2VW4A 2YXVA 1AR1B 3ABGA 4YSTA 4DP6X 4JHUA 4M3HA 1J9RA 3WKQA 3CZUB 3X1BA 4NB7A 5A7EA 2ZONA 1E5ZA 4F7KA 5EHFA 3FQ2A 4E9YA 1GY1A 5B7FA 2VSKB 2YAHA 1IC0A 6PCYA 5B1BB 1WS8A 3ABLB 2VN3A 4AI7A 1L9TA 1TU2A 2QDVA 1QLEB 2VW6A 2R7EB 4YSRA 1JVLA 3PCYA 4N4YB 2JXMA 5I6MA 5AKRA 1A4CA 2N0MA 2VM4A 1BXAA 5I6LA 3WI9A 1M57B 4GP5B 1WAEA 4DPCX 1UATA 1A8ZA 3FU8A 5AZUA 4BWWA 1I53A 4BXVA 1JXGA 3FU7B 1L9SA 4E9RA 3S3DB 1CC3A 4KO7A 4E9QA 1ASQA 1PLAA 2UXGA 2XX0A 4P5RA 5I5IA 2GC7C 4KO9A 2IWFA 1IKOP 1HAUA 1RZPA 3PAZA 5I28A 1A3ZA 4F2FA 4G7RB 5LDUA 4UAHA 1NICA 1CUOA 2GB2A 2GSMB 3ZBMA 3UABA 1KDIA 3C75A 1KBVA 1PLCA 4TXVB 1OE3A 1KCBA 1E30A 5B7MA 2PCFA 3X1NA 4A2EA 4W9ZA 5TK2A 3WKPA 1SFHA 2DYSB 1L9OA 1ZDSA 2PPFA 2XU9A 3FU9A 4AKQA 3OM3B 1ASOA 1ID2A 3CDZA 1TEFA 2AFNA 4YSPA 4A2HA 3UADA 3U25A 4AKOA 4CSPA 4WTQA 1WS7A 1V10A 1FFTB 3S3BB 2EILB 1MG3C 1URIA 4QKTA 5I5JA 1GW0A 3TBCA 3S8GB 5D4HA 5I6KA 1AAJA 3AG4B 3FQYA 5TK4A 2X88A 4YL4A 3NSDA 1JOIA 1DZ0A 5B1KA 4AX3A 2LLNA 3T9WA 1PF3A 3DKHA 2GI0A 3HEIB 3S3CB 2FNWA 2QPEB 1IBZA 3EH5B 1X9UA 1AG6A 1OE1A 1IBYA 3AY2A 4HALA 4YSOA 1ILSA 4KOCA 4YSCA 3QPKA 1AZUA 4E9TA 2AZAA 3IBOA 3IE9A 4HHGA 5B1JC 3ASOB 1DYZA 3EF4A 4GXFA 4GP4B 2PP9A 3AG3B 2XWZA 2I7OA 2IDUA 4YSDA 4E9SA 5I6NA 1AIZA 3FSAA 1L9QA 3PAUA 4A66A 1N68A 3SQRA 2E86A 3QJTB 3NP4A 1ZIAA 1ETJA 1AACA 1KGYE 2XV3A 1AZBA 3UAAA 3FS9A 2AANA 1PMYA 3HB3B 4KNTA 3SBPA 3NJHA 1JERA 1GSKA 1BYPA 1GS7A 2XUWA 3T71A 2IWKA 3KW8A 4NAJA 2JKWA 4DP5X 1E5YA 1N70A 1YLBB 4HCIA 1NPJA 1L9RA 3EH4B 4AZUA 2GIMA 3UGEA 2IDFA 2BO0A 2BP8B 3UAEA 4DPAX 4JHVA 2BZCA 3WNJA 2DWSA 4YSEA 3V9EA 3H56A 2YAFA 4K9JA 3TA4D 1L9PA 2QPDB 4L0PB 3ASNB 5I6OA 2P80A
chains in the Genus database with same CATH superfamily
1U2CA 1M7UA 3JWNE 5JTWA 5KOVC 2GK0B 1H6TA 2DV6A 4EUPB 4M61A 1A7OH 1OM9A 1N3NB 5ITBH 3LRHA 3FT4A 2XC8A 3TBSA 4OQTL 3QZWG 4YFDB 5JXEC 1Y0LB 4JG9A 2DM7A 4PY7A 1DVUA 4G9FA 4WO4C 1AQDA 4MGXA 4LASL 3TH2T 5LXGH 3T0VA 2DM2A 4MFHA 1G1CA 3QRGL 4A2MA 1ETZA 4DO5A 5I26A 1U0QA 4HJIA 5TQ0H 1ZE3C 1KF9B 5CGBA 4K9EH 4DP4X 4KV5F 3KPPB 1ZTXL 4XPBH 2X4PA 1F4XH 1J1XH 2P4AB 1IC5H 3S3SA 3LXUX 4CVXB 3OHXC 5LGYA 3VM5A 4NXKA 1XL6A 2GIXA 1N9PA 3GSXB 2P8MB 4L4TB 4XBEL 5DD0L 4YC2B 4IOSA 2BJMH 3HBZA 1Q9OA 5F97E 3E38A 1YEEH 5EU3B 4HSCX 1F58H 1USZA 4DKEL 2Z8SA 1E5CA 1S7RB 1W9XA 4ACPA 3MRHB 1DLFH 4QGYA 5GGSY 1CTMA 2X1OA 4UF7C 4RBPK 3L9BA 2DI7A 3WY4A 2FAUA 15C8H 5C6PB 4O4YH 2MCPH 2EH8L 2NZ9D 4Y5VA 2XKSA 4BK5C 2MPAH 4W6WB 4XC1H 2QMKA 1EJ6A 4PR5B 4PBWD 3WXWH 1UFUA 1WC7A 4MX7B 2WYIA 1M9SA 1P7KA 4LVOB 2EDHA 5HJ3A 1EV2E 4MNGB 4WEBL 5HYSA 5FM4A 3UBXA 4R2GB 1OF2B 3UTQA 4LLVA 4Y16A 4UT9L 3NIGE 1DQML 2BC4B 1UENA 5T1DH 3MNMA 3HI5L 5BPPA 5EV7A 1NJ9A 4FNLL 5EUOA 1E27B 2CKBB 3B9VA 3QG7H 4K9EC 1NOAA 2Z8RA 4FNUA 1L0XA 1CL7I 1WK0A 4HD5A 3TBWA 1NGZB 5A2AA 2XY2A 3TCLA 3I50L 4LEXH 1R5VA 4LCUB 1P53A 2B20A 3TGXA 3ZHKA 2J4WH 1W6WA 4XPHL 5D2LB 2FVNA 2W0PA 3TJEL 4GKSB 2BWDA 5IWLA 2AJYH 2WO4A 4QTIL 3U1QA 1A7PL 3OGOE 3KVPA 4W9HC 3L3OC 3E8UL 3WKYA 1JCKA 2D7MA 4H5SB 5LKNA 1P1VA 1GS8A 1MI5A 4JO3L 4M5ZH 4QEGA 4JKKA 4CC4A 1L3NA 1KYUA 2RQ8A 1S78C 1DN0A 3DUHA 3L3IA 4QUOA 4XAKE 5JHAA 1AO7E 2ZNWA 3HG2A 4LLYA 5JYMA 2WO3B 3CN0A 4MZ3A 2QADC 3D9AH 3P4LA 1F8TH 2OTUB 4KTYA 5I73C 2MOQA 3GLDA 2ZXDA 3U0TB 4X6BA 43CAB 5IFHH 4KXCA 4YSQA 4RFOH 3PJSB 4HFUL 2IQ9L 3A24A 4QXTB 1DUZA 4Q9BA 4KFZC 4JO1H 1W8OA 1JZGA 2NMSA 5IQLA 5C0IA 4M6MH 4KUZL 3QW9A 5HGDA 2ZG1A 1UVQA 1KFAL 1I8IA 1R75A 4UCFA 5F7BA 1SBSH 5C0NC 2E8YA 1CD9B 1MRCH 3M7OA 2ICWJ 4MNQE 5HD8D 4AG4H 1M1SA 1AKJB 3FTXA 4QCIB 4YGVB 2W80C 1EMTL 5CUSL 4POYA 2XN9D 1NQBA 4J23A 5EORL 5B1JA 1U8PA 4Z0BL 2NR6D 1GTFA 4KY1L 2RIKA 4N8VA 4DZBA 4CU6A 3O11B 2H1PL 1QRND 4PJEB 5SX5H 1IFRA 2YZ8A 4E42B 5CIPH 5AAWC 3SE8H 3QAZC 1A6PA 2UZPA 3T0ED 3BUQA 3OPZL 3TNMA 1L4IA 1GC1L 4NCDA 4FQ1H 4RA0C 4B9KC 2IOMA 1PYWB 3FTYA 1K4CB 4MHHG 1CD8A 3EW3B 1A6AB 4WI5A 2I07B 1HHKB 4O5LH 3I84A 2CLZB 4PWJA 5CP3A 4F2MA 3WJMB 1IM3A 1ZS8B 4JFHE 4YHLH 3RY5A 2F7RA 3DYMA 2IAMD 1CD1A 4YHIA 2FJGB 5DWPA 2PW1B 4UTBH 2A0LC 1J05B 3A22A 4ZFOA 3D39E 1LK3L 1JNHB 2GBAA 5FYKH 3UG4A 1R1CA 3TJHD 1DDHA 5ENWA 5KYNA 3RZWA 3IU4L 4G2AA 5FV2A 4FTVB 2QL1A 4KAQL 4FXGB 2NRDA 3QZWB 4LKXB 4MNHB 4QRSA 2D4FA 1KGJA 2K4AA 2NYYC 4DVBA 5E2VL 3M88A 1RXLA 4LRNL 3WO4B 5DGRA 5EPMA 1S9VB 5HHPB 3NESA 4DF9A 3LZFL 1QSED 2LR4A 1I31A 3I02A 4FZ8L 3NDYE 3MLUH 4X8JB 2AK4D 1FZKB 1HDMB 4K5OA 3RDJA 2GSGB 5J57B 2WUBL 2ZF9A 4JO2H 1HE7A 4POUB 4XCYA 5LGJA 3CE1A 1UWFA 2X05A 5JHBA 1KB5H 3SGJC 4XNMB 3L7EB 2K70A 3G5XA 5DJCA 3QDJB 4M4RB 4OZIF 5E4IA 1CDIA 2AAVA 4FYQA 4TQEL 3T8MA 1AGDB 4OIFA 1AOZA 2QSTA 3CFJA 3ZHLA 4JZNA 3TTSA 1OT2A 3QA3A 1IC4H 3ETSA 4RDBA 4PB9L 2ZKMX 1WICA 3TO2B 1XZ0B 1N19A 1SXSA 1E6JL 4FNPA 2VLKE 3DIVA 3X2QB 1X6NA 3Q05A 1VA9A 3MLVL 2JKTM 1K4DA 4G8EA 1AE6L 3QQDA 1U8KA 3FNKA 3SY6A 1HXMB 4HA1A 4OAWB 2G75A 4UT6A 1FLRL 25C8L 2R2CA 5LCVH 3VD5A 1VZIA 4A68A 2EVJA 2J6EH 1QQDB 3S36L 3QPQD 3OMAB 2B5IC 3DX9B 1GS6X 1WSST 3V10A 4QXWA 1BZEA 5EB9A 4IM8A 4WY7L 4XVSL 2VC2H 4NN5C 4X5WA 5JQIB 4G59C 4DK5A 1U2YA 1DSFH 4JVPA 3BPLC 4D0CB 5BZWA 1Z9SA 4LLAA 2WD0A 3BWUF 4FABH 2EDDA 4B53A 1KLFA 3AZUA 4G42A 2HUEA 3KYNB 1J5OL 2CO7A 2VAAA 4HBCH 1G4MA 3BWAB 4IU3A 3MJ7B 1OGSA 4KRPB 4R8WH 1RUML 1P6WA 3U9PH 5EN2B 3ZZQA 1D9KD 1E8WA 4FNRA 1LO4H 2W88A 4LCWA 4WWPA 3G6JB 1G4RA 1J1PL 4M9PA 4TNVF 5D5ME 2YXVA 1S3KH 3ORJA 1H6FA 2ZG3A 1UEYA 2LU7A 2NTFB 3DSFL 2NXZC 1T5WB 3IS0X 3TH4T 2J1YA 5LBGA 3ZMNA 4YEFA 2HRPH 3QO1A 1WZ1H 2FX8H 5K93A 2Z1PA 2OSYA 1E2WA 1KJVB 2GAZB 3IJHA 4OLVH 2O5XL 5H8DA 3V4LA 5C08E 4QHLA 2EXWD 1JGVH 3TT3H 1CS6A 1AGBB 4XPGH 1HSBB 2YWYA 4EXPX 1CLVA 1S7XA 4G9DB 5DJXB 2WTRA 3HC4H 4YX2H 1ZAGA 3ESMA 1MCSA 1QBLL 4IEFA 4YDKL 3EGXB 1U8JA 5CCKH 4XNYL 1DJXA 2AQ1A 2N0MA 2W94A 5AW0B 5MERA 1E2ZA 2GJ6B 3QI9D 1BXAA 4ZSOA 2VLJA 3RBSA 2XZAL 3WHE1 3OR7B 3Q2LA 4HPHA 3MAWA 3DPDA 4OD2A 3EDKA 1CQYA 4JREC 1P7QB 5IEKB 2EP6A 1CC3A 1ZGLB 3QIWA 5C0JB 2UXGA 1KENL 2IANB 5L9DH 2X1WL 2GC7C 3FRUB 3N43B 5EZJB 1OD7A 2VDPL 4MD0B 3KXFA 4N20A 4XVUC 3FF7A 1AC0A 5F1IB 2ZX5A 3BESR 4Q6IA 3V6OA 2QKIA 1EDQA 1N59A 5IREA 2WQAA 1JGIA 1G7MA 2GB2A 3QUKA 4FQIL 3THMH 3SDCC 4AWJC 3WMPA 4WO4A 3EFOA 3WHXB 1UM4H 4M7JL 1W8NA 4HULB 3F12A 4EN3B 5E7BA 1IAOA 4XMPH 3VI3E 3M86A 5B7MA 3HBGA 2PO6C 2AKRB 4JO4H 4XVJL 3LMJH 4XX1G 1I4FA 3VVWA 2NSMA 4ZXBC 5IV2B 2F54B 1IAIL 3M1CA 4GAFB 2H2SC 1SDAB 3IJSA 2DDQH 2ADJB 4M02A 1J0ZA 1JPGB 1TZHB 3L5XL 1NDGB 3OHXA 1KSRA 3OM3B 4PI2A 5FPIA 4ABWA 1QVOA 1YEHL 4JFOA 3X3GL 1WZMA 2ZOKB 2YRPA 4NKQB 4BH8B 5IB5A 2IBZX 1OAXH 3PP3H 5HHOA 3FO9B 5T1LD 3S3BB 2EC8A 3O3DA 1URIA 1NOFA 4NAMA 4Q2ZA 2VXSL 4BSVB 1EBPA 1FNEB 2BVQA 5I6KA 2PWHA 4NI3A 4MCNA 2EYSA 4QT5A 4RAUB 1AQKL 4OZGA 3MOBL 1NCCL 3DKHA 1CE1H 4BK5A 3C9NA 5H4ZA 2QPEB 3AS1A 3TVMD 2CO1A 1BF2A 1UA6L 3WN5B 4B0MB 5CFHA 3MRGB 5FKAB 3BH9B 3DMMB 1I3GH 2R15A 3NIFF 3WS3A 4BCXA 4UT6L 2FX7H 4LIQL 2YBRA 4TSBH 5FWQA 5SX4H 3L81A 4PQXA 2YXFA 4OV5B 3HHMA 3VXSB 1A22B 4QYOB 4BH7A 3QS2A 4IKIA 5CJ5A 3WDIA 1DSWA 4PRHA 5DD5H 3HI6H 5KBLA 3HMXA 1N0XL 5EBMA 5JDJA 2GUOA 3NP4A 1SXNA 1N10A 1HYSC 2NXYD 2WPGA 2HT2D 1UWXH 4QTFA 4JHZA 3PWVA 5T3XD 2CXKA 4WU5B 2E4FA 1BBJB 1MIEH 1GSKA 2XPGA 2XUWA 1LNUA 3PWPA 3ZE2E 3DOSB 3GO1L 1E3ZA 4JANA 1K8DA 4PJIE 2XG5A 3QUYB 4FP8L 3FMGH 4MA7L 5E8PA 1QR4A 1QYGH 3WFDH 5TTRA 1BD2E 2ALAA 3QWOB 1AP2B 3NQIA 5I1AA 1TTCA 3LNIA 3SE3A 1VGEH 2LLLA 1P1ZB 1U92B 4LT7A 3X12A 3QXAA 3HFFA 1NPUA 2CO4A 5DJ6A 2YIHA 4N2FA 2WAQA 2R23A 1L6XA 2Z92A 4HK0B 5FV1L 2VLME 3L3OA 2DLFL 3NCEB 2YAFA 5B39G 1JGLH 3CVHA 3E1ZA 5TD4A 3HLKA 4RLDA 5JLZB 3WS6C 4JPKL 1KLGA 2Y5TA 5F7AA 4J6IA 5B8CC 4F7CB 2YXMA 2J88H 2VDOH 3TBYB 5KVGH 2BOBB 1HI6A 1CK0L 5I9QB 1IQDA 2P52A 1W0WA 2EIJB 4KI5F 3T0EA 4XCFH 5IOPB 3L3HB 4PB0H 3IJYB 5I0VA 1RJYB 5PCYA 2XWBB 3TU6A 1EVUA 3T2LA 5CJXA 3P2DA 1UWGL 2DW5A 3W0WA 5DHEA 4WI7A 4FYTA 5DS8A 2NOYA 4CSSA 4WI0B 3ULVC 2X2JA 1IM9B 2VWEE 3EKCA 4U33A 3FQRA 4Y1AA 1UXSA 1BXUA 1RUQL 3CFNA 3HS0C 4I0PD 2BP5M 4N2IA 3TA3C 3W1ZA 5A2FA 5LO7A 4UV4H 4Y4FD 1IBDA 1DVSA 3UPRB 3ET9F 1JNJA 3U7AA 1AMYA 3RY6C 3VWKD 1NOLA 2AQ3A 1TF4A 2QGCA 4GAAA 1GYCA 1TVBB 2UXVA 3FSOA 4TNWK 4YR6B 2ZCHL 5AOZA 1WT5C 4RX4D 2ZP0T 5AAWA 1VACA 4O02H 1LQBC 4FMVA 1Y1DA 1J5HA 3PWLB 1VFOA 5DI8B 5DUBA 3QISA 5DHYA 1KYAA 3D12B 4FL4B 1NC2B 1F13A 3ULSA 3WMSA 1Z32X 1OP3K 5TF1L 2HRGA 1RK7A 2EEDA 1XHHA 2B2XL 4P2RD 3BVNA 3OZ9L 1U8OA 4P23B 2BW5A 2N4IA 3MV8E 4JFQA 5CJOH 4HG4J 3LN5B 2G3XA 2RJMA 3RL1A 3IDYB 4KZ0A 3QCUH 2Z7UA 3I2CL 4X5RA 3P40A 1FZMB 3PV7A 4OLWH 4HIHB 5GJSH 1NAMA 2WY3B 4JPWL 3K5RA 3Q9QA 5I1DA 2DKUA 3VW3H 4TTDD 3BH8A 5DMGC 2XFXA 3KPSA 2WXGA 4TUOB 5E51A 3IEAA 1SLXA 2P5WD 4M5SA 5JORA 3NAAL 4IIQC 1X5FA 2BRRH 3A4DA 3WAJA 5BZZA 5AW1B 5K5YA 1TQWA 3CZSA 1P0SE 3QNZA 3ZK0A 4PHZA 1PDKB 1XF3B 2ZE0A 3CUPA 4PV8A 4WCYL 1JZIA 2Y6SC 1MDTA 3EJYD 5AD0A 5HSFA 4HF5H 4QRTB 3HMXL 4IW4C 1F11A 2CBOA 1A3RH 1BAWA 1JWUB 3SGJA 4S0HA 3IU3B 1DQKA 2OP4H 4OUUA 5LXGL 2EDRA 3VX0A 1B4JH 4ZAKD 1OSZA 2DM4A 3TYFA 5ANMB 1LXMA 4LFHG 1NEUA 3V6ZB 4K9EL 2EE9A 2WNXA 4HV8A 2VDMB 4GXUM 3G08B 2ORBH 3QNYB 3TBTA 5D8JL 4KI5D 2BNUB 2PTTA 2WZAA 2BJML 1OZUA 4JDEB 1IQWH 3D0AA 2PPEA 1YEEL 3ZT5A 2CR6A 4PRIB 1SYVA 3HE6C 3L3DA 3E2HB 3TBVA 4XP4L 2R0ZH 4XODA 5FO9B 1QKZH 1TTBA 3DUUB 5T1MB 1U93A 4Z5RB 5CEZH 2ZUQB 3DBSA 4PTTA 15C8L 4OLZH 5A16A 4O4YL 1N2RB 1HXYA 2NY1C 2V3FA 3QORB 4NS0A 3LNFA 4L1HA 4XC1L 2BXYA 5EZIL 2GJZA 4LE8A 1NGYA 2W38A 2J8UA 4H40A 2Y07H 3MRCA 3GJFH 4OJEH 1JYNA 3HG5A 4XX1E 1BLNB 3STLB 3FQWB 4EOWL 2XWCA 2O26U 2HVJA 3FO1B 2K6ZA 3DJRA 3MREA 5CWSA 3ZDZE 4PREB 5I0DA 3KCWA 5D7JC 5D7IF 4XWGH 1QHPA 2OMVA 5FR3A 3FT2B 1ZLDA 4PJBB 5DLLA 1Z9LA 3RLSA 4A1RA 2Q6WA 2BS9A 1ZTMA 1LEGB 1R3IL 3N1GC 3DV6A 1OGTA 4S2SB 3TZVC 5F7FA 1UHVA 2YD5A 5ICUA 4PVLA 1PD0A 1A25A 1MCEA 2WAHA 5HVHC 3IFPA 3CLFH 3NQKA 1QO3B 1MAJA 2X42A 4POZC 2Z8WC 4OZHE 4D7PA 1KG0A 4YHNB 3QRFM 4Q0XH 1VFMA 1DQJA 3DPBB 3O6FC 4DIXA 5T1JA 4OLEA 5IHLB 3HAEG 4OW6A 2X89D 4Y19A 3WNIA 1KPVA 1E7UA 3GB7A 4XE5B 2NDFA 4GXVL 3PIQB 4HMEA 4JFSA 4BKLB 4DP9X 5BVJA 3B43A 1OCZB 3BEWA 3MRRB 3QCVH 4H88H 3NZ8A 4TYUA 3GYRA 2J56A 3OJVC 4Z7UB 4K8RH 2FBOJ 3UTZA 2WYZA 3D9AL 2IXQA 5JZ7C 1E3XA 1GXEA 1SYSB 5J1SC 5DZLA 1SVCP 1BXVA 2F15A 3D09A 1B4TA 2AW2A 3BPOB 1PNDA 4MJID 2E9JA 4MQXD 5IFHL 4OZFH 3PHSA 4RFOL 3QEUB 3NGBC 3FZUD 2NUPB 3V4PA 1NAML 1KN2H 4MRCA 4JO1L 5DUMH 2E3VA 3U6XA 3NCYS 3NCJL 4Y2DC 4KJPD 3LNEA 4NRXA 4NJAL 1YUHB 1F90H 2B3IA 4QMEA 3VYOA 3A67L 3ERXA 5C71A 4AG4L 2WXFA 2EYRA 1PLBA 1A1NB 3EOYG 3GLEA 4V2CB 2OTWA 3OX8B 2PO6A 2YAQA 1CF8H 1BFOA 4L8BA 4ZXBA 1JD7A 3GMLA 3VSVA 3P3TA 3AY4A 3ZYJA 1ULVA 2IH3B 3AB0B 3JBG7 4PGBA 5EU4B 1AD0B 5E00A 1LO2L 4FMKA 4JFTA 3K71A 3SE8L 5F0PB 2VDLB 2G60H 5KN5B 3W9DA 2F74B 4ELMB 2ZJSH 4LVNB 5SWSE 3MRBB 2DIAA 2A83B 5C0CA 2EXSA 4FKKA 4KK5D 1H3WM 2OULB 4O5LL 4X7TB 1KXTB 3B8SA 5AZEL 3TT1L 1RUAH 4YHLL 4K8RC 2J57A 5KVMC 4NM4L 4OLUL 4JFXB 1U58B 5AOJA 4NQUA 1AJ7L 2JTDA 3ZDYB 4BCZA 2R29A 2EC9T 1JE6A 5PAZA 1FI8C 4MWFB 3CGTA 4NQEE 3SDXE 1MW3A 3MNWA 1MCWM 2XZZA 5G4MA 4ANKA 3DX4A 4DP6X 3O6KH 1YPZF 1J9RA 3H85A 3PUUA 3P4MB 4NQXA 4YPJA 4XXWC 3WNNA 2AXWA 1ECYA 4PPTA 2DS4A 4Z7VA 2EE6A 4UILH 2OSWA 4JAMB 3D06A 2WXLA 5ICZB 4LPWA 5IFJB 2LAGB 3KVDD 5BS0E 1GY1A 3INOA 2KDGA 3ISRA 4JFFE 4O58L 1YCSA 5BMFH 5J9PB 4RAVB 1X4YA 4JO2L 3CZGA 4RIRA 5D1QB 1K8IB 1Q0EA 4ZZFA 4N0FB 4N8PA 4PV9B 1GGIH 3VFOB 2N1TE 3F7LA 2DAVA 3GIVA 3QH3A 1KB5L 2DWEB 3GXTA 1ORSA 3ROOA 5IHUL 3DGGA 1NMBL 4S11A 2O5ZH 2RBLA 3NCWA 1ZHKA 1G1OA 3Q9PA 2AXGA 4DPCX 3WOVA 2AP2A 5DJ2B 4F7EA 5BRZE 2DQJL 3CMGA 1SJEA 5AB9A 2RQEA 3BQUB 3FQTA 5AVSB 3B2PA 4NN6C 1TMCB 1X7TA 2C9QA 3R8BB 1F6AB 4AQZA 1XBRA 4CDHA 2G5BB 1BAFH 2DQGH 3WS6A 5DRXA 2V5SA 5ECGA 1XGYL 2VMEA 5EA0L 4HWEH 5B8CA 3DHPA 5FLUA 4J3WA 4RMBA 2E7HA 1KY7A 4HWBH 1UJTA 3H0TA 3BHBA 4HX1A 4IBZA 3CXDL 1OAUH 4BM7A 2J6EL 1JHTB 5DRWA 2XQYG 4MZ2A 4HLJA 1GJIA 1UWEH 1DUYB 3APNA 2A99A 3OQ3B 3UJJH 1N12A 1U91A 5DMKA 1T5XA 3ATEA 4ZUTB 1PZ3A 4AEIL 3BAEH 3Q3GA 4LVEA 2C7FA 3MRQA 1A4KB 4FABL 1ID2A 3QE5A 2AFNA 2AEPL 3HS0A 4HBCL 3TA3A 2ZXGA 2LTQC 1HL8A 2XG4A 3HG1B 2A6IA 1OAKH 1E4KC 3PWNB 5CHNA 3RY6A 4D9RD 4G1MA 5BJTA 5I5JA 1IGYA 1IIIA 1OTUC 3BN9D 5HTSA 4ZMPA 1WT5A 3MZTA 3JVGC 2FWOA 2CIKA 4XGZB 3V4VH 1S3KL 2VZTA 2GI0A 3MUGA 5D7HA 1DVFC 1FC1A 3ARFB 3TO4D 2ESVB 1KV3A 2BNQB 4NQDE 1IRAY 1T20A 2HRPL 1ZLWK 4K3EL 2FX8L 4TOYL 2WLZA 3VXUB 3P4NB 1HHGA 2C34A 3EF4A 4OLVL 2Y7SA 3MGAA 2XXCB 3F62A 3KNBB 3TT3L 4OTXH 2EYTA 5I8CB 2VDRL 4PY8J 4XPGL 3T8XA 2ITEA 4J3OF 3WKMH 3SQRA 5HPMA 2E86A 5SWZB 3SJVE 1NGQH 3SKOA 3VYNA 4F8LA 5C97A 5KOMC 3HC4L 1T66D 4YPGB 5D7SL 3VUAA 2CU9A 1JNNH 1BQHG 3L54A 3T2NH 4DKTA 2XNAB 4MB5A 5KSVB 1MCHA 4XMKH 3EDJA 1INEL 3NJHA 1JERA 1XH3B 1BYPA 4F1ZA 3MRLA 1HXKA 2WGXA 2HJFB 2VH5H 3PGDB 3BKMH 5GS2H 3GXDA 4JKPH 4LMQI 3KG5A 3D85D 5HHMD 4QRRA 1MFCH 3V5DA 4G6MH 1JZ2A 4I3SH 4IIQA 1LEIB 2NY4B 1S5IH 4XTRD 4AVJA 3V0EA 1NGXA 2HFGH 4JUTA 1ETA1 3ARDB 3S88H 4LB8A 3RNQA 1XR8B 2QR0B 2X9YA 5F7DB 2YMOA 4AGLA 5C0DB 5KUKA 5DGQA 1P4LA 4WHTB 2R9HC 3ARUA 1F4AA 4J3UA 1N0LB 5E8EA 4AXWB 2GBUA 3SDAD 1A4JB 4IJ3B 3EHBD 4JO4L 3AT9A 3LMJL 1WBXB 3QQNA 5DZNA 1CGTA 3RG1C 2Q3XA 5ISZB 2AXFA 3UTTA 4ODUA 1QI5A 2IH8A 3NJNA 5TDOB 3NACH 2XDHA 3E6HB 4W93A 1RZQA 3DTXB 1Q1JH 2XV6B 4KK6C 5JPNA 4QWWC 1SF5A 4P4RA 4D9LH 1IKNC 3EYVB 3PP4L 4IS6A 1G0DA 2QVKA 2ROXA 3F6IA 5C09D 2C4XA 2WWKO 3HE6A 5HJBA 1OAXL 3MX0B 4WHCA 1HZLA 3CVIL 5HP5A 1EZUA 3VI4F 3C87A 4HH9A 3ARTA 1ND0B 4FEMA 5DA4A 1XGQB 4WV1C 1CE1L 1YQVH 3HC0B 1XF5B 4I7ZC 3CZNA 2I9TA 4CBPA 3RVVC 5EU6A 1MHPH 5I5RA 3OKLA 2ZP8A 4DP8X 4Z23A 1I3GL 2A9AA 3DIDA 3MJ9H 3Q5YA 5DC2A 5DHVA 4GNKB 4K71C 2PTUA 4XNDA 5DSCA 2HN7A 5D7JA 3DO7B 3LYRA 3Q44A 4ZW7A 3HI6L 1E4XI 3GUTB 1ZA3B 3C5SB 4YNYB 3HLAB 5IUCA 12E8H 5AVVB 4JM2F 4P4KD 4GRWB 1PG7X 2ZUVA 5IQ7L 5CJQL 1AGFB 3CXHJ 4PJ8D 3ZLQC 3ULVL 3L9EA 3VMNA 1MIEL 4U6HA 1YNTA 1U95A 4J12A 5DF0A 3VXRD 4D0DA 1FSKC 2Z31B 4N90E 4X0NA 5E4EB 3TEWA 3MNVB 4RMRA 5EDXA 4JRYE 5HXMA 2CQVA 3C5ZA 4PGEB 1HEHC 1SEQH 1VB9A 5E8OA 1YDPA 3C5JA 5FYKE 3H9SB 3W82A 4BK4A 3WTWA 2B0SL 2K7PA 4XH2A 4NAQA 4GUPB 4I3RH 4EXKA 3I6KB 5LNEA 1ERNA 5A2BA 2VM3A 1VGEL 1HH9B 1L9NA 1OSEA 4JQIA 3UAJC 4EQ2A 4QLWA 1K3ZA 2YQBA 2BIPA 3FB5A 4ZO6A 3N1MC 2AV1B 3GSQA 3EXJA 4BA0A 5L8JB 4MS8D 5FOBB 2CDGA 2RACA 3GKWH 2B39A 1MFUA 5KEZA 4YWGH 3P9LB 3NT0A 4Q8BA 3MRPB 1BCIA 3O41A 1TJHH 5HGBB 1QBML 2P47B 3GJFA 4OJAA 1BGXH 4PAZA 1WUZA 3T0XA 2F53D 3UIYA 2E7LC 1D5RA 1ZLVK 1FIGH 2Y36H 5F93C 1GL4B 3OMZA 1WITA 4XCFL 3X13A 3K6SA 1Z7JA 1LO5B 3LKSB 4PB0L 3IFNH 3SDYL 4IMLA 1IIKA 3ZGIA 3MGTA 6FABL 2L7QA 1MDAA 1U2HA 3ZDXE 5JIIA 4Y2DA 4JFVA 4E36A 4QXGH 2HH0H 1NCUA 4Q4IA 3ZZSA 4JHAH 2CLVB 4NQCD 1NBYB 4FQCL 3S8WA 2J5LB 4U1NB 4G82A 1AR1D 4M1CD 4PJ9C 4ZO9A 5J5EA 3W37A 4UV4L 1T0NB 1T83A 3DTDA 3L2LA 2R4RH 3LKQB 3EGDB 4HPOH 1U3HD 4CW1A 1BVLB 4D9QE 4ORGB 3IKCB 4UANA 4YIQB 4JZOA 3P0YH 5DZ9A 5AYQA 2ADGA 3R19A 2CCVA 3SBRA 1TO5A 1JIBA 3VXMD 2APBA 3HZYA 4O02L 5EOTB 4K73A 3CSPA 2I60L 4CBZA 2H9GA 2LV4A 2B1AL 3Q06A 3IWVA 3CQPA 4NHCH 3UO8B 3LEVL 1TNNA 3GJFK 1BZ9A 1FVDA 5DO2C 2C7UB 2RA1A 4J8RA 3V0GA 4CC0A 4HWZB 4GS7B 4JM2B 2UX6A 4DUWA 1RPKA 2YJLA 1X5GA 4IRSC 3B3IB 1JDDA 3BP7A 3QCUL 1E28A 1B3IA 4K3JL 5IW1A 4Q9QL 3B4NA 4JHWH 2VMJA 1F6LL 5E0FA 3SPVA 1YMMA 4PJXB 5K9OB 1I7RA 3AGVA 3P9MB 2R51A 2E8ZA 1BREA 3ZKMC 3QDMB 1UACL 3NIDB 5I74C 3NEXA 1KCKA 2Q87A 2OYPA 2F7OA 4XXWA 3FYEB 5IHWA 2YAMA 1XEDA 4EVNA 3NIGF 1HX0A 3H8NA 3HZVA 2AITA 2VR3A 3LNDA 4J2QA 4N0CD 2BRRL 4NSKA 3NJIA 2V5MA 5FHBH 2VDKH 3OB0K 3G9AB 2P8PA 2AJXL 4NHUB 5D6CA 5EO1A 4LAQH 4GO9A 3VD9A 2BVPB 3N55A 4PJAE 5TE6L 6PAZA 3ZL2A 3EJTA 2XWJA 1A3RL 4W6XB 3T6ZA 5GRJH 4NEHB 1B2WH 1TLKA 2BIHA 2LE9A 1OM3H 4OSUH 2A9MH 4TLTA 1B4JL 2FWLB 1AHKA 5L2KB 4FCAA 1EZVY 4Z0XB 1MUJA 2XXFA 5LAPA 3RE0A 2BZ7A 3WIHH 1R0AH 3MBWB 3QEQD 4AQEB 1R47A 3EGSB 2E9BA 1IC7L 1FO0H 4LHQB 5IHZA 2EDXA 3INUL 3KBEA 5D7LE 1IQWL 3MZGB 4ANUA 4PRBA 1CL7H 1Q9LA 4QO1B 3OG4B 3SO3B 4Z3TA 3GI9H 3EOBA 2W92A 1YVLA 4J4PD 5DQ9B 4HJJL 4ALAH 1A02N 5IBTL 1YN7A 3T6QC 1JZ4A 1VADA 2DQDH 3DX7A 2VT0A 5IW6B 4GRLD 2ADIA 1G7HB 3OKEA 4HIXH 4LF3A 3RGHA 2O72A 1ICTA 4N2KA 5K69A 2FIKA 2VUKA 3D08A 2P24A 3QJOA 4U3HA 2Z8VC 3ARGB 2EACA 3N06B 3UTSE 4L4VA 2P5EE 1KLUA 4OH2A 1N18A 1ED3B 1Q8MA 4PV1C 1FL5B 3VE0A 3ARPA 4MMZB 3Q8FA 4I2XE 5C3LD 4R90L 4DGIH 4I89A 3X1GA 1D7BA 4Z7QB 1CBVH 1UT1A 4EI5B 5E2JA 5CSZB 2Q7AA 3FT0A 1DBKL 5HI5D 1IAKA 1IGTB 1KC5H 3JVGA 5KWYC 4FD0A 3B9KB 1OP9A 2C9AA 1DVFA 3GIZH 3TS8A 2C4FU 2F5BL 1KIPB 1ROCA 4ZTPH 5CF3A 4P5TA 4N2BA 3K4ZA 4G7SB 3VFUB 1NBZA 1K3IA 5GRVK 3CLFL 1QHOA 1S9YA 3DV4A 1FNGB 4LHUG 4NKDB 1W72H 2JNZA 2Q2EB 5CINL 1T7YA 1JS4A 1JYWA 1F41A 2P42B 5EO0B 5MEPA 2NZ9C 1BJ1J 2WMPA 4M56A 2UWEA 4NZUH 1XGRB 4G6KH 4LOUC 1D5MA 2WGNB 1J8HA 2V2WB 3BGMA 2EH7H 4GSDH 3A47A 5ETUB 4AMKL 1IC0A 2C3VB 4H88L 3T1FA 5MEQB 3VB8A 5G4OA 4X9IA 3ABLB 1I8MB 3DOHA 4K8RL 1L9TA 4UM8A 4JG1H 1I8LA 4RGNC 4QRQA 2MWCA 3B2DC 3BKJH 1R19A 4MA8H 4P3DA 1C5CL 2JXMA 2R27A 4D8PB 2OI9C 1EFXD 2R1XA 1KEML 1T4WA 5TDPB 4WFHD 4BZ2H 5KTEL 3T3PF 1C1EH 2DMCA 4FHBD 1W16A 1KY6A 2HUHA 1DBMH 2LAAA 5ERWA 1T7VA 5C0EB 5E24E 1QR1B 1KN2L 1NFAA 1TEYA 2YFOA 3P69A 5FGBA 1F42A 5DUML 1A9BB 3B6SB 3CFEB 3LRMA 4KO7A 4LNRB 3I9PA 1F90L 4F3FA 4PIBA 2VDQL 4JLRB 3VNYA 4XAKD 4L5FH 3GBMH 1D5BA 4OFIA 4RWYL 1NICA 4TTGA 1KTRL 4GW4A 2BY1A 3GSWA 5KVGE 5AW4B 1QEWB 2A6KB 1MN4A 4APQB 3LY6A 1QFWM 5L2JA 3Q2CA 3QK0A 1KCUH 1IKNA 2G60L 4F33A 1YNKL 3FFDB 4NO3B 4R2GD 2G5UA 4W9IC 4P4KA 3O0RH 2WW8A 4RFEB 4PRPA 4XB8A 4PJ8A 3UADA 1PL3A 4LU5H 3WENA 1OGAB 2AMUA 2YGNA 1RUAL 4AKOA 3QJHB 1FYTE 4GAYA 2WVSA 5GRVL 3TBCA 4FLRA 3F7QA 1PY4A 3NBNA 1AAJA 4KVPA 3WYRA 3T4AB 5I15H 2Y24A 4PJDE 2VXVL 3QWRA 4RETB 2R1WA 4XO3A 3VQ2C 3U30B 2ERJC 3AT0A 3PY9A 3DK2A 2DKMA 3GTTA 3DVIA 5KBDA 3AY2A 4OFPA 4M5YH 1J88A 1ILSA 4JM4H 1FE8L 3CWGA 2ATKB 3QPKA 2KS0A 5AWNH 1AZUA 4UILL 4JE0A 3LSOB 1EBAA 1MPAL 3SPIA 4NZFA 5D5MF 2IDUA 5E5UB 2OXHB 5E1AA 4WFGE 1CXIA 2CUIA 4A66A 3LS4L 3EO1B 5B38A 5BMFL 1EEYB 5IB1B 2ADFH 1L6PA 5KJ4A 1NCWH 1MQKH 3AQXA 1RZKC 3D39D 1GOFA 3VXQB 1Z5HA 2Q8BH 1U30A 5DLMH 3RBGA 4GUOA 5I71C 4XN7A 1FDLH 2PW2A 4AW7A 4XMXA 3BAKA 3Q1SH 4UIMA 4JQXA 3OKMB 3TIDB 3PV6A 4DOHE 3MFGB 3UJTL 1OOAA 3CU1A 3T3PB 2V9RA 3C8KB 1LWHA 3ZHNA 1NCBH 1AKJD 4XWOD 2BFVL 3GSVA 2IOOA 2J25A 4JHVA 5GGRA 5T8IA 4Y2LA 1MXDA 3OLGA 1BAFL 2DQGL 5BO1H 2ITDA 1XD0A 4YO0A 3PQYD 5L0QC 1XO8A 1BVZA 5A2LH 3RWDB 2R8SL 2XWRA 1XF4B 3AQDA 4HWBL 2EZ0C 4NZRH 4Y5YC 1PEWA 4DGYL 3GMRA 3IXTB 2E7LA 5LB1A 3LKOB 4DP7X 1OAUL 5F8RC 1LDPH 4FLOA 1TJGH 1IGJB 1YY8B 1Y07A 3QS3A 4BD4A 1WIUA 1M2VB 2R7EA 2VJXA 3OSVA 3MXVL 2JCCE 1M71A 2VLKD 4MAYB 3TBBA 4AKPA 2LFGA 2I24N 4PJ7E 1E4XL 4PJ9A 3VI3F 3UH8A 3ZTDC 5E2UH 4AGMA 2I5YH 2ID5A 1WBYB 3AABA 2Q76A 1E8YA 2CK2A 1COBA 4JRXB 4UQ9A 5CEZE 4YAQA 1H6EA 2DQCH 3J7HA 4HIJB 4KQ3H 4C4UA 1UB5A 3V4VL 5IY5B 1JYVA 1PQZA 3OKNA 5IT2H 5D2NB 4FFVD 5H2BA 5C0BB 1UGKA 3H7LA 4KKBC 4OBRA 4UM9D 4ELKA 5HYSG 3UBXG 3QG6B 4NO2B 3MLXH 4X5PA 3D0VA 4M1DL 5DJYA 2CR3A 1KIQB 4Y4KB 3QPQC 4KXZI 2VZOA 3ZMEA 1JGDA 1D6EB 3KGRA 2ATPA 3BAWA 4UT7H 4X7CC 3WKML 5HDQL 3CMOH 1NGQL 2OTPA 4L3EB 1SRDA 1G7LA 1I3RA 3TL5A 5IGXH 1QWHA 4MLSA 4AE1A 2VCOA 1JNNL 3T2NL 5DYOA 2YUWA 5FOJA 4UQCA 3RUGE 1CU4L 4F80A 2NY0C 5HJDA 1OL0A 3HE7A 2XTJB 3QXVA 4UMGA 2EUXA 2F8VA 3RWCA 4PJCA 2DEXX 2ARJA 1I7ZB 1SOKA 3D4ZA 2WCPA 4P57A 5C08B 2D3JA 1EHKB 4F24A 2VH5L 1TR7A 3QDGE 1PY9A 2DQFB 1G7QB 2WIIA 1PVHA 3QIBA 4LSRH 4PJ5E 5KSBB 4X5XB 2NW3A 4G6ML 1D9KC 4U6XA 3NJGA 3MJGX 1XSJA 2HFGL 2K6YA 4U6TA 5IR1A 3CD4A 3LRSA 3C8HA 3OHMB 3VGAB 4JFYA 2BP0B 3S88L 2M8XA 2PYFB 3ZE2F 5GGUA 1J0YA 3G6DH 4PJIF 3WHE0 5I1EH 4BKTC 3NTCH 5LWYL 3WLBB 1QSFA 2AQ2A 3AREB 2AS5M 2BVOA 3ARBD 4EZJA 3WAKA 3FU0A 2V5RA 5IB4A 2EXWC 3RP1A 1ES0A 4GRLA 3LZLA 1DJZA 5I1JH 2VUYA 2IH1A 4I9WD 4KQ4H 1SXZA 4X98A 4NNPL 1KBPA 1JF1B 3CLEH 4X6CE 3GMQA 3GRWH 1XMWA 3NACL 3QXDA 3VFRA 3C09B 1CT8A 1O9VA 3LRGA 1NC4B 2GEEA 3EJQA 3L08A 2CMRL 2GYSA 4D9LL 3FC8A 1N67A 4HS6B 3HUJE 4R96A 2CK0H 2BP3A 3EOTH 2ZSWB 4FG6D 2CWRA 3PFUA 3T6WA 2WUCH 4XN1A 5E9DB 2TSAA 5HYJB 4MQTB 5E1IA 4N8VG 4LBEB 4LLMA 3H1ZA 1DDTA 1SHSA 4FERA 4M6NH 4OJYA 4D0BA 4IBYA 3FUKA 4JPSA 4XHJD 1YECH 2F61A 4P2YA 2PPDA 5DRZA 3ZTNL 2FLMA 2OYKA 4YXHL 3EFFB 2C3HA 2ODIA 2AEOA 5T3ZE 3MJ9L 1JWMA 3IXTA 2RGSA 2GK0A 4P46C 4ODVH 3HZMA 4EUPA 2PP7A 2E7DA 4CRPA 3OC8A 1OF0A 2WV3A 1KYDA 4HT1H 5T3XH 5IMLA 2PN5A 5IVXB 3FTGB 2B9BA 4FQ2L 4Z7NE 12E8L 3UDWA 1JTOA 2Y7LA 2PYEE 1CDHA 2E6QA 2W9DL 3FUDA 1HIMH 3CZFB 1JN6B 3DGCR 4JK0D 1G0YR 3KPPA 5MENE 2WKOA 3NSCA 3FT4B 4LSQH 3TBSB 1AY1H 4YK4B 1M56B 3HMWL 4G71B 4G9FB 3ABZA 3GSXA 3QFGA 4L4TA 5DJAA 3UOAB 1K85A 4A7GA 3LNHA 4YHKH 2IAND 2QGEA 2EEBA 3BWUC 3FW6A 4RMTA 4I3RL 4N26A 3QUXC 5F9OH 2BSED 1EK3A 2NNXA 4R7VA 1KELL 2JVUA 2A74C 1PZCA 5HVGB 4QY8B 3RDTB 1MJ7H 5IMMB 2PCYA 2KKQA 3KCPA 4G72B 1NAKH 5C0AA 4GB9A 3MBEC 1Q9OB 3SYCA 3GNMH 1REIA 4XR8C 4EN3D 2F8XC 1U9KA 2O5NA 1DBAH 3SY0B 1ZHNA 2MTPA 1ZVNA 5FYLL 2F54D 5E70A 5GSVB 2VRQA 4MVBC 4U1JB 1KGCD 3IN2A 1MJUL 2F7PA 4QF1B 1NWPA 1CDBA 1YC7A 2NXYC 1B0IA 3ARXA 1I1RA 1BD2D 4XRCB 2Y36L 2HT2C 5H4YA 2GHWB 2Q8AL 1OF2A 2NCMA 4K07A 4LBAA 4RISL 1IAMA 4FGMA 3GHPA 2BC4A 4PG2A 4PVNA 1MRFH 4WTWA 3QEHA 2OSLB 2NY3B 1KCLA 1T7ZA 4QXGL 1D7DA 4IRJB 4WUUE 2XETA 1RU9H 2F5AH 5HYSB 2PR4L 2RH0A 3H9HA 3S5LB 1OB0A 3UTQB 2D7TL 2DBLL 4Y16B 1NGZA 4MDIB 1OKEA 2E4TA 2LW3A 2R4RL 4MDRA 4MDJB 1GR7A 4P2OC 2Q86B 2IJ0C 3DMMD 2D2CC 3UACA 4ZMAT 2X4UA 2OJZL 3HN3A 1NJ9B 4XOCA 1E0OB 2BFGA 5D2LA 3VXSD 3P4OB 3UPCA 4H8HA 2P48B 3TBWB 1EPFA 3TCLB 1EEQA 4H5SA 5I8EA 1IT9H 1TOXA 4U1GC 4ZQTA 2E7CA 2CRMA 1J1OH 3BJ91 3D3VB 2Q3AA 3IB4A 3LKNA 2XBDA 4E0RB 4OI7A 2OTUA 3LHAA 4TMPA 3F00A 5L7XH 2MFNA 1TNMA 3QJFA 3OLDA 3DDGA 2AC0A 3FTWA 2V17L 3PJSA 1X4XA 3SPJA 4CMHB 2E0PA 3IDMB 4IDJL 3L3IB 1RVFH 3LHPL 4JHWL 4QXTA 3NABL 3BLKA 4U0RC 4LLYB 3ZDZF 3QO0B 1IEBB 3NJMA 1HWHB 1FBIL 4R4FL 1KULA 2R0KH 1EAOA 4Y4FC 1AR2A 2E6PA 5JYLA 5J12B 1JZEA 2FD6H 4KFMA 3VWKC 3NJXA 5G2NA 4RA3A 2WXNA 1FVCB 1RIVH 3O8XD 3ABGA 4YGVA 3TFKD 3WV0A 1UYWH 2C5DC 3RI5K 4YE4H 2VDKL 4NB7A 5DTFA 1BECA 4FN0A 3SGKA 5HGDB 3UTOA 4UV7H 1UVQB 3O11A 2ZCZA 5D1ZC 5AEAA 4XNUH 1BQUA 3CHOA 3UL4A 3I3DA 4E42A 5L4FA 5EUOE 1QNZH 1JRHI 3DXAA 2XTSA 3TPUA 2UZIH 3J07A 5GRJL 2H0EA 1B2WL 4ORZC 4OZHF 4TV3A 4WHYH 5FF6B 1OM3L 2F8IA 1PYWA 1W2KT 4X5LA 4HZLA 1K4CA 1A6AA 3ZSTA 2I07A 1HHKA 4KJWD 3UTPD 4ONFL 2MNJB 1MVUA 3IK2A 2IPTH 3WXVL 1IM9D 3NSXA 2FJGA 4UUJB 1NDMB 3SE9L 3EYFB 3TEUA 1J05A 1FFQA 3BIKB 4TUJA 3X17A 5IESL 3HFMH 3RB7A 1EHLL 5GRZA 1JNHA 2QJDA 1CICB 4TTDC 5E2TH 3UC2A 4BUHA 1MI5E 4Y5YA 4ONHA 4FTVA 5GRXG 5MI0C 1IKOP 3PHOB 4FXGA 5I28A 4C56A 1A3ZA 1E9QA 4LKXA 4MNHA 1CD1B 3P11L 2ZXBA 3VQMA 1H3TA 2MCG1 3B7SA 2ATAA 4W4OA 3ECBA 2ISDA 2K78A 1CUOA 1MCNA 2YPLB 2Y9RT 3P0GB 1DDHB 5ENWB 2VDPB 4X8JA 5E94B 5CKGA 1FZKA 3FUIA 4UU9B 3R1GL 3VQLA 1KEGL 5T33H 3SPHA 1TKWB 1GGUA 1JXKA 4PVBA 2AQTA 4IOFC 2XU9A 3AXHA 5B3NA 3O9WD 4XNMA 3L7EA 4DGIL 4P5MA 3QDJA 4JN1H 1LD9B 4NWUH 1BFTA 1LJMA 4XT1C 4MYWB 1L0PA 2HLFC 1AGDA 4KI5C 1FFPA 1KC5L 3KJ4B 1XTLA 2LOEA 1K6QL 4LAJH 5A3ID 5D4QA 5AKSA 5G4NA 4QKTA 3RX9A 1GW0A 4ZTPL 2OXGA 3TO2A 1XZ0A 3MLPA 3ETBF 1FNAA 2AJUH 3G5XB 1SJVA 1Z0NA 1DZ0A 4A55A 4XBPB 2DKSA 4C59B 3I6LD 3CFJB 5I1IH 4AYFB 1OE1A 3OBAA 1HCFX 2KHAA 5A2JH 1U6AL 2N7AA 2YA1A 4R7LA 5IJDC 1YEWA 5KVFE 4F2ME 1QQDA 2R83A 3MV7B 3SDXF 4AGQA 4DN3H 1D5ZA 1K4DB 4G8EB 3V4UL 2EH7L 1HL9A 4L05A 3QQDB 4A6YH 4PP2A 1CPUA 4D0CA 1LMKA 1ETJA 1T2JA 2PR9A 4EZKA 1A6TB 4KHTL 2Z34A 4KUCD 2XBZA 3BKJL 3N44F 1DO6A 2AANA 1RP8A 2K7QA 3BWAA 2KYIA 2P5PA 3HB3B 1PKQA 4XZ4A 2DD8H 3OAYK 1S2EA 1CF1A 3ZIMA 3GXFA 3U6XS 3K1KC 1WFMA 3IDUA 1DJIA 1DBML 4X6DE 1XGTB 2D03L 4IBWA 1BM7A 1UM6L 4AJYV 1KLFB 4G42B 1Q0YL 3G6JA 5DFVD 4IU3B 3FF8A 3RZCC 2E75C 2FGWL 1WCQA 1E5BA 1KXVC 2ALWA 4GKLA 2NTFA 4MA1C 4E41A 1T5WA 2F7QA 3KGTA 5GGSB 2WQUA 3QORD 2DWSA 3GBML 4B3EA 3BZFA 1NBQA 2J43A 4WU7B 4D8OA 4K9JA 1I7TA 3MNZA 1KJVA 3F04A 1YEJL 4LCWB 4L0PB 1NL0H 4KX9A 5F21B 4DKFL 3SCMD 3L3KB 3K74B 2OMXB 4HBQA 1AGBA 5IKCB 1RZKL 4WHDA 5HI3C 4EDXA 1TCMA 4G9DA 5DJXA 4LEEA 3HKZA 1I9IL 3BPCB 3BP4A 4R7DB 3IDXH 3R06B 2AEIT 4HYTB 4X0KB 1QMUA 5CCGE 3PNWB 4NZTL 1RJCA 5KS9B 3P3YA 2OCCB 3DYOA 4DZ8B 2GJ6A 2JV6A 5LJYH 3RVUD 1HEZB 2XVKA 1ZIBA 4L1SA 1ZPUA 4GSRA 3OR7A 4JGMA 1S7XB 4G6JH 4BRJA 3FZUC 1ZRUA 4PWKA 5C6TL 1P7QA 2VLRE 1OWWA 4IHOB 2O1AA 1DE4B 3FQNA 1QFWH 5C0JA 1FH2A 2IANA 3BSZH 1RZ8B 3FRUA 4OF5A 3D18B 5DRNB 5EZJA 4K3HA 5I15L 4ZSOB 5IIEA 2EE2A 2J2ZB 3H55A 1TFPA 3KHOA 5SWSB 5L6YH 4NC1E 2BSEA 4N2CA 2VQ4A 3D7PA 4P46A 4XB7A 2MCAA 1XAKA 3M45A 4L2LA 1HYRC 3KYKH 2HTKD 4N25A 3QNFA 4JM4L 5HDBE 5HY9A 4M93C 4BRVA 3QIWB 3WHXA 1PCXA 5IBUB 2JIXB 4EN3A 3KXFB 3AJ7A 1UH3A 2AKRA 2CRZA 4PS4H 5AKVA 3FPXA 4Q14A 1QA9A 4XXDB 2ADJA 2JK5B 1JPGA 4AQAB 1J0KA 1TZHA 3M8OH 4HWUA 1NDGA 2GY7B 4N0UE 2H26B 1NCWL 1JPEA 4V1DA 3T77B 5BOJA 3A6OA 4NQED 4WO4B 5E6UB 2MIZA 3F12B 4KK5C 4HG4K 2FEEL 4N8CH 4TQPA 5DLML 2R39A 2YD8A 2X70A 3GF8A 4BH8A 4WF7A 4WWNA 3QUXA 3SQOH 2V6HA 3FO9A 3Q1SL 3NCBB 2JFCA 3ME0A 2BNRB 2EICA 2A74A 3OHXB 3D1MC 1HT6A 4WAFA 5E5LA 4RAUA 1XCQA 3FSVA 1NCBL 3QUZC 4OGAC 4JFOB 3MBEA 5BS0D 4PY8I 3SGEI 3FB7B 3FRPA 2YARA 3IYLW 4JFFD 1TCRA 1MAKA 2FYYB 3WN5A 4K15A 2H47C 5FKAA 4WJ5B 3O3DB 4Z95L 4EI6B 5HHXH 4OLXH 3ZO0A 3B5GA 4NZRL 4OV5A 1OVZA 1UADC 2WBWB 3D2UD 3ETTA 2VLJE 4OZGB 3VXSA 3EXLA 3ZIYA 1OAQL 4QYOA 4UTAH 2H32A 3BVTA 1KN4L 4R4NC 1Z9NA 1LDPL 1NCHA 1TJGL 1I85C 5DEFA 4HKJB 1C8QA 3REWA 1AHWC 2N0KA 2W60A 5BRZD 1RKRA 5D4IA 3SGDI 3EZ8A 4GKZA 4G7QB 4WU5A 2KZWA 1BZ7B 5F3FA 1BBJA 1ZK9A 2XX1A 3A6CL 3V6OE 2XYCA 3MCLH 4R26H 3DOSA 4WDIB 5INCB 2GUOB 1WEJH 2YO3A 3QUYA 1LEKB 2K6WA 1RK0B 4P2OA 1AQ8A 1X5ZA 5E8DL 3K72B 4LOVA 1ZXQA 2CHWA 1AP2A 4JKMA 4ZS7H 5C9JB 2QVIA 3ZT7A 1FGNH 4NFDA 2XPGB 4HH8A 3EYQC 3VXPB 5F2FA 1BOGB 3EJUA 3OAWA 4AYSA 5E8PB 5EF1A 4WJG3 4EI0A 2WP3T 3AUVA 4GPVA 3V5KB 4LFHD 5JLZA 3VMOA 3MLXL 4LCVA 3IDIB 5I1AB 4ECNA 2ENQA 1NANI 4RGOL 1VFBA 4UDTA 1R9FA 2VMCA 4F7CA 2MQ0A 2KZ1B 5HHOE 5IROD 1OAYH 3TBYA 4LKCA 4FLQA 5D1QD 2BOBA 2Z92B 1MFVA 4QRPB 4U7KA 3L3OB 4UQIM 1IBGH 1WHPA 1A0QH 3CSYA 1NKGA 4IIZA 3BKYH 5IGXL 2CUHA 1DSYA 3CBRA 3L3HA 4MMXC 5F8QC 5I1CH 5K9JL 1NFIB 2YRBA 3B1TA 4DQAA 1KLGB 2VABB 5LBSH 4XNQA 2QADB 2ZT9C 4ELDA 1ZV2A 5I73B 2PWEA 4YLCA 3QULA 4NQDD 4LCIL 1TVDA 1WF5A 4I0CC 1W0WB 4ANWA 2R2EA 1IGIL 2HRHA 2DQEH 3BN9C 3UPRA 4F9LA 4R6UA 2JJWA 3SJVD 3SKJH 4H1LH 5D1ZA 4YR6A 1AIFA 3TO4C 3G6DL 4G5ZL 5I1EL 4Y1AB 2DLHA 1GZHC 2WP3O 1N7MH 3EYSH 5GS0C 2EDKA 3RIKA 3EADA 4X4ZA 4HU8A 2FJSA 3EG9B 2QT6A 2XQBH 5DI8A 4K55A 3PWPE 2XJLA 4R97C 1WWAX 1R17A 3VQ1C 1NC2A 1AS6A 1BDYA 3JTTA 4JDVA 3VRLF 5I1JL 1TFHA 4Y9GA 2HX8A 1IBHA 4ES9A 3QAZB 4P23A 2PCFB 5DC4B 3LN5A 4WJKB 4YHPB 5B22A 1T89C 3CN3A 3B7YA 1RMFH 4JJOA 2CK0L 2OJ1A 3L48A 4N9GB 1RHFA 2V8LA 3ULSB 1F0LA 4HIHA 2CH8A 1B90A 4PRNA 3JV5A 2WUCL 4WGVB 2WXOA 1GJUA 1EERB 4JFQB 3RL1B 1JWSB 3BH4A 2FGZA 1LP9F 1QRNE 8CGTA 1DTUA 3ARFD 1GHFH 5HYIA 4LSTL 4L5FE 1GOGA 2ESVD 5LQBH 4TUOA 1ZGLM 4R5TA 3ZDXF 3IKKA 2PXYC 1I9EA 4LEBA 3T0EE 2NY4C 4RRPA 3VXUD 3ETBJ 1NAMB 5J13C 2JJTC 1RSFA 5I1DB 1BXXA 1PDKA 5A2IH 1TQTA 1XF3A 3W0WE 3BH8B 5F6IC 3QUMH 4KOBA 3S37X 3QXWA 3MLTA 4PYGA 2YEVB 1EAQA 4QRTA 5T5FH 4HT1L 4OD3L 5T3XL 3SDAC 4C58B 5JORB 5FLVA 3DTUB 1AZVA 2XT1B 3IU3A 4K3GA 3V0WH 1E4WH 3ZN6A 4J3OH 2Q20A 4JG0L 3QNZB 4X6FB 4S1SH 5ANMA 4B7IA 4PV8B 1FC2D 4XMZA 2DMKA 3NZUA 1JZJA 5AD0B 4XP1L 1CYXA 4PWIA 1FG2A 1TZIA 3G08A 4EIUA 4L18A 2DLIA 1F11B 4LSQL 3QNYA 2BP8A 2ZKHH 4RSVA 1ILUA 1GTNA 1V7ML 5CM1A 2O5YH 4JDEA 1OSZB 1JG9A 2OZ4A 2FQFA 5CZVH 1O9ZA 3BN3B 2XKUA 3ARDD 4PRIA 3ZDWA 4LLUB 2Y6TE 5FO9A 3DUUA 5CAYB 2EDWA 2XN2A 3LNGA 4Z5RA 1II4E 2JB5H 2W65B 4OF8A 1YNLL 1MCOH 2FH6A 4L3FA 4NT6B 3TBTB 1BJ1H 1ODUA 1UA7A 2PTTB 2WLJA 3VA2C 1N2RA 3GNML 2XWEA 2BIOA 2MEJB 2PABA 1SYVB 5HI4D 3K4DA 4Z7OF 5E56A 4FFTA 4NBZB 2R59A 3FQWA 3MPCA 4JRYD 5B7FA 4BYHA 2MOVA 4PREA 5A16B 2B5IB 3C08H 2CJUH 3RWJA 4PJGB 1HXYB 2Q1EA 1F4WH 5AVQB 1V5JA 3FT2A 4NN5B 2VN3A 3KPSE 2ZAGA 3AXIA 1NGYB 3MRCB 4AITA 3BPLB 4XP5H 3FT1A 1LEGA 3T3ME 4J3OC 1JMZA 1YEFH 4FFWD 3U4EB 3ZKXC 2YD6A 3UEZA 5I1KH 3GMMB 4H20H 4IRZA 3MREB 2X6UA 4EO5A 1NGPH 4GP5B 3RZCA 5DURB 1KXVA 3MCYA 2F5AL 5M95B 5JXAH 1KB5B 2Q6WB 3U36A 5DMIL 1LP9B 1HKLH 1HAUA 1RZPA 3DV6B 5AVYB 4QJ4B 2YUVA 4FXLA 1OGTB 4JVUA 4YQXH 3ZDXB 4HGKC 3DOIA 4YHNA 2AVGA 4MS8C 2NXZB 2H0PA 3IRCA 4NUQA 3FONA 3IAQA 1XWVA 2HVKB 43C9B 4ADJA 4U6VH 3ZRFC 2BK8A 3PIQA 3RTQB 1HH6B 3CBJB 1RL1A 3CZEA 3MRRA 4AMWA 1IT9L 1E30A 5CD5D 4MTMA 2JKIS 1KG0B 5TK2A 3G5YB 1DQJB 1J1OL 1VENA 4PLJC 1EXUA 4ZPTA 4Y4HD 4DETA 2ZXCA 4Y9EA 3RWIB 2Z31D 4EDWL 3B2UD 1U33A 4FMFA 4MD4B 4D9QD 4FZEH 1WGOA 1Q9KB 3QEUA 2FO1A 2K0RA 3NZ8B 4NIYE 2NUPA 4Y9BA 1AH1A 3WNLA 2VC2B 1JF6A 2HMIC 3QQ9C 2J8UE 2ZF8A 5SWQB 4OCXH 5D71H 1YUHA 4JREB 3QHTC 3FQYA 2B77A 4BE6A 4F57H 5IEHA 3TN0D 5JMRA 3MACH 1A1NA 4L1DA 4UIKL 1S7VB 1UYWL 5LLIC 2DI8A 2WZ6A 1XEUA 3EDDA 1NGWA 4NRXB 4UV7L 2QSCL 2BY0A 2IH3A 5EEUA 3ZYZA 3US1A 3EIFA 1OCWH 4HHGA 4OB5H 3SDCB 2A9NH 1QNZL 4Z7OB 2EYRB 3V5HB 4QIRA 5C7XH 2OTWB 2UZIL 3AWFA 3PAUA 4YDMA 2PO6B 4ELMA 3SDDD 5DUPH 2Y5QA 4ZXBB 3MRBA 5EIQA 1ZIAA 4F91B 4JY6A 2Y25A 2F2HA 3RA7H 3JWNH 4OM0L 4X7TA 1KXTA 3V6BR 3UC0H 2IPTL 3BXNA 2J7LA 3OF6D 3IGFA 3QUZA 3W9DB 2DQIH 1U58A 4YUEH 3RB5A 4XPAH 4LPTA 3L1OL 1NPJA 3EH4B 1V3JA 1A7RL 4Y19E 2GT9B 3RHWK 2GIMA 3UBHA 3UGEA 3HFML 1EXGA 2FIRT 1CDYA 2QZ5A 4YHZH 4ZW3A 4FI6A 1L0QA 2GUYA 4WI9A 3BSGA 3MCG1 5EOQL 2ZTBA 1SHMA 3P4MA 1MHCB 3FFCA 4FULA 3KPMA 5F1NB 4MRBA 1S9XB 1WTGT 1I85A 4JAMA 4LRIA 5ACMA 1AHWA 3IGAA 3DRQA 5EWIL 5ICZA 1NCDL 3CVCA 2OM5A 5IFJA 1B4RA 4M3KB 3NOIA 3H9YA 3ES6B 4MAZA 1BEYH 1KFGA 2R1YA 1AI1H 1GYWA 4J3TA 1FG9C 5T33L 5J9PA 4Z9KB 1ZSHA 2I85A 1N26A 5AYUL 3O2WH 5FC9A 4Z7VB 3NP3A 2EUZA 4PP1C 3DHUA 4HIPA 4BFBD 2DWEA 1CR9H 5IJBC 2B08A 5MHSD 3CK0H 4KJQC 4NDMB 2HPOA 5DDHB 4XOAA 1FLTX 4N0RA 2NDGA 4EBQH 4UTCA 4RIRB 1VRSA 2UY7A 4QOKA 1OP4A 2NUTB 3BQUA 3JWNC 4HLZG 1MRDH 4GUCA 2AJUL 4CMMB 2N59A 3L5HA 1F6AA 1WD8A 3GINA 2G5BA 2P5ED 2BXZA 3QB7C 1AS7A 4M6AA 4PJFE 2Z64C 2R0WH 5C0CE 1SJEB 1QLRB 1AYOA 4KPHL 3OAZK 4Q6YA 1U41A 2HFEB 1TETL 4NRZB 4PJDF 4X2UA 4DN3L 1I9JL 1DUYA 3B9DA 5DRXB 4RVBA 3N9GL 4ZUTA 5FUOH 2W0KA 5B1AB 3BHBB 3HNTL 1A4KA 1EWHA 4P9HH 4PYHA 3E6FB 1HL5A 3ECUA 1I1YA 3CXHK 5G55A 3MDJA 4CN1A 2CBTA 3OQRA 4JQVA 4IGBD 2ZWLT 4Y9FA 2BCMA 3VYPA 2CA3A 3HG1A 3WNMA 5HYQB 3SOBH 5DFWH 1A7QH 4NO0D 3PWNA 3REVB 2WSDA 5IBLC 1IEAB 1IKFL 3E8VA 2YSTA 4KKLC 1AGEA 1JGUH 3W5MA 3HS0B 3ABMB 4N1HB 4U1SA 3TA3B 1EHAA 3BCFA 3U1SH 3GBLA 4ZS6C 2XG4B 3IFLL 4JFZH 4RGMC 4N2OA 1M05B 2A6IB 1GYVA 2BNQA 2W9LA 5F1OB 1VHPA 5CHNB 1OP5H 3RKDD 3T8VA 3U4BH 4G1MB 5BOPA 2D7QA 2HTLC 3P4NA 3Q2NA 4G70B 1DBJL 4FS0A 1NL0L 3KNBA 1FAIH 2ED9A 5H94B 2BDNL 2MNWA 5EU5B 3SIKA 5I8CA 3MUGB 1FFNB 2DL2A 5SWZA 1JTPA 1T89A 2FATH 5FYJE 4JHBA 4DVRH 1YEGL 2NY2D 5DJZB 4YPGA 1CGYA 3GHBH 2VSMB 3FCBA 3GUFA 3IAPA 1HHGB 4XE0A 2XNAA 1D5XA 4LNVA 1MAMH 3S5ZA 5GZOA 4PMEA 4GH7B 2F58L 2WBJD 1E65A 4NC0B 1OLLA 2EYTB 5F6HI 5TJWK 3T8XB 3WU1A 1U8NA 2VDOB 1DCEA 3B9KD 5HPMB 2HJFA 4N3UA 3WJLC 4G6JL 3PGDA 5BOZG 4P9HC 5LNGA 1KB9K 1T1YB 2UVEA 5GGTA 4YH6A 2OCJA 1LEIA 1QFWL 1H9DA 3QUGA 4B9ZA 3BSZL 3KWUA 5ILTH 3Q8CA 2JCCF 1JJUA 2FECL 2CLRA 3B9AA 4Z3FA 5L6YL 3MRLB 4PJ7F 1KTJA 1XR8A 2QR0A 5E0QA 2FJHB 4ZOEA 2VAJA 3SQBA 5F7DA 3DX2A 2A1WL 3KYKL 4D2NA 1OLZA 2X2IA 4WW2F 3L16A 3V5DB 4IIQB 1CB4A 3ILPB 1SEBA 3FUFA 1EGJA 1R3LA 4AM0Q 1NFDE 1NGXB 4BFIB 4OD1H 4AXWA 2DQUH 1A4JA 4ZUVA 4B95C 2EXYC 3K8KA 4QAMB 1WAAA 4KVCH 5ISZA 3OJDA 4APQC 1I1AD 3HN8A 2XZCH 3FHAA 1P4LB 1NMAL 2CM5A 3M8OL 3E6HA 1YAZA 3DTXA 4O2CB 5TDOA 4O02B 4G7YH 4KROD 2YXWA 3CH1A 3EYVA 1U8IB 2WNGA 2JJSC 2YGPA 2V2XB 4ZX3A 2HXAA 3F5WA 3MX0A 3O45B 3K6OA 4Q89A 3UTTB 4PGCB 1I8KB 4WNSA 2G3MA 2IFFL 1S3RA 4WI4A 3DNKA 3F6JA 4LARH 3KH3A 3RUGF 1XF5A 3OR6B 1UUSA 3QAQA 3SZKC 3QRBA 3NFPB 4DNLA 3LXCA 4ETQB 3PL6D 2FO8A 3HE6B 2E56A 3ARVA 5FUZH 1E4HA 1X7SA 1GA2A 4HOZA 4WWID 4HH9B 4OLXL 4GP8B 4ES8A 3HG4A 3TWCH 3W81A 3JYBA 3Q2WA 4BV1A 4Z7AA 4UTAL 3DO7A 1P9MA 4P49A 3GUTA 2I9TB 3C5SA 4YNYA 1PG7H 4PJHF 3HLAA 2DF3A 3OKLB 4QRRE 3ILEA 3ZL1A 5CZKA 4PRDA 4Z1PA 4QXUL 1PD6A 4YFLF 1AGFA 3ZT6A 2H41A 4XPTL 4JS7A 4KKAC 3VXOB 2HN7B 4AEEA 1YYCA 5AVXB 32C2A 5JW4R 1OGAD 1RUPH 4M7LL 1CFVH 3WTSA 3JV6A 4JRFA 3MCLL 4R26L 3QXUA 3ZJAA 2WNKA 5J6SA 4ZZKA 2VZSA 1PZUB 4PGEA 3T08A 3H9SA 3AS0A 4LPCA 4X6CF 3GBEA 5D1XB 1UKTA 3VFGL 3UJIL 4GUPA 3I6KA 4HVBA 5GS0L 2L4OA 1FORH 1HH9A 4U6HB 3TZVB 4F5CA 1YNTB 4D0DB 2FLBT 1BFSA 5B3JE 1EO8L 4I87A 1QPPA 2IWEA 2AV1A 1YZZA 4GKOA 4CNIB 1CCZA 5HVHB 3WSQL 1T1ZA 3C5JB 5FOBA 4HEMA 5JIKA 2FBJL 3MLSL 2YOCA 3B56A 1ZLSH 3P9LA 1KTKE 4J3SA 3MRPA 5HGBA 3ULUD 3O6FB 4ZO8A 5KYUB 3EFDH 4FE9A 4KC3B 4PU2A 1G9NH 4JDZB 2VR9A 1A0QL 1RIHL 3NRQA 4WFFD 2HVBA 6CGTA 3U4AA 2H3XC 5JIDA 1LO5A 3LKSA 1RSYA 3QUHA 5FECB 5I1CL 3AACA 2DPKA 4XNAA 2QHRH 3O41B 3D51A 4KWUA 2XWXA 3GJFB 3TIEB 5EU6E 4XO5A 1XH2A 2X40A 3DARA 5E6ZA 1UG9A 4LGPB 4LSVH 1U3YA 2X9WA 4L9LC 3HC3L 2WZPA 1RJLB 1TTGA 4B9YA 1NBYA 4Z7NF 1FH5L 4KK9D 3X13B 3K6SB 2Y1VA 4EIZC 3NGBB 4AENA 4PCYA 1RZJH 1T0NA 4IMLB 4WFEE 4JFEB 4YHMH 3FB8B 2ZYIA 3EGDA 2G30A 3MA9H 5F7WC 3RRQA 4S1DD 3IKCA 4Y2DB 4YIQA 3N04A 4KVNL 1OALA 3NN8B 3GC3A 1JHKH 4JY5L 4JG5A 3EYSL 3F7YB 3OTTA 3X1BA 5EOTA 1EGJL 4XMTA 1BF8A 2CCLA 4R0LC 4CW1B 3QCTH 4N1EA 4FNTA 3F85A 5TE4H 1RK1B 3O3BB 4M3JA 2ADGB 4WZ9A 2C7UA 3BD3A 3BUIA 5AUMB 4PJHB 3VFTA 5EFIB 2V3DA 4MAYD 4ZG1A 4MBRA 4JM2A 1ML0A 2O61B 3RTLA 2V9QA 5KVEL 2W0FB 4LHUD 5E1GA 2G3ZA 1BVNP 3B3IA 4N3TA 5I66A 3QR0A 2H9GB 4JFDA 3MRMA 5FGRA 3RPKA 5K9OA 1KYOJ 2ILLA 4PJXA 1N6VA 4LEOB 4JRXD 5AOMA 3WI9A 1FVDB 3QDMA 4M1GL 3AFLA 1P4IH 1T0OA 4KXDA 4AOFA 2H6PB 2QEJA 4QYAA 1E28B 5IW1B 4Q9RH 3IM1A 4P5RA 5C0BD 5J3HD 1YMMB 2VZVA 5CBAA 3I85A 1IL1A 3KL5A 4GAGH 4QJ3B 1MEXL 1JI1A 5IJCC 2ZUUA 4GG6E 3ARBC 2CZNA 3MV9B 2AJVH 5J6GB 4OJFH 3MTRA 2BVPA 2DTMH 2VDQB 4L3ED 5DFAA 4L48A 3TX4A 1PLCA 3CPLB 2IGFH 1E4WL 4HOXA 4PS3A 4XN8A 4Q9CA 5L2KA 5H37A 4S1SL 2X44D 2VXUL 4Z0XA 3FAWA 3UPAA 5EO1B 4MB1A 1VKXB 3MBWA 1OGPA 4L23A 5KSAD 3FUHA 3EGSA 3ML9A 2ZKHL 1MFDL 5T3ZD 1ZXKA 3VJ6A 2N3JA 3BYYA 3MU3A 4CDGC 5BV7C 1S7WB 2R69A 2OAAA 1V10A 1MUJB 4PGZA 4HCRA 3IMUA 1I9RL 4QO1A 3ZE1B 4KH9A 4WUKH 4XHJC 5E2WH 1JVKA 4A63A 2HFTA 5B38G 1QLFB 4NN6B 5IMKB 2FJUB 5DJDA 3HEIB 1WHOA 4QLRA 3GLAA 1OW0C 2F1EA 1IBZA 1LWJA 3IGLA 1L9MA 4FQJH 4Q74A 2NQCA 4PRBB 1G7HA 1HZKA 1JV5B 2ENPA 3FBKA 1ZEAH 4XBMA 2X4TA 2PP9A 3ARGA 1P5VB 3B2MA 5EH1A 1GIGL 4WWKD 3C2SA 1ED3A 1FL5A 4OFYD 1VADB 4MMZA 1F4WL 4HFWA 4KKQA 2ADIB 3IMRA 1WFTA 3OKEB 4JPVL 4LF3B 3OKKB 3IJEB 4EJ1C 4XP5L 4EI5A 4U1LB 3C6LC 1QFUL 2FIKB 3IE4A 5AZ2H 1IGFH 1XF2B 1UXWA 5E9DD 2QQLH 3MLYH 5EUOF 1IGTA 3RKPA 5HYJD 5I1KL 3ZW3A 5F9JB 4OCYH 3DECA 2LTQB 3SO5A 2HCZX 3VE0B 3NVQA 1KIPA 1RZGB 3U9UB 5LUMA 1IVLA 5JOFA 1H3VA 2X4NB 5DVMA 5JXAL 4PFEA 2IDFA 2K8QA 2BHZA 4NKDA 1IAKB 2EQDA 3BLPX 1HKLL 3MRFB 4RQQA 1TQCC 5EO0A 4YQXL 4I1PA 1DVFB 1XXFC 1X5IA 1QFHA 4PRAB 4YSEA 3ZYIA 2CA4A 3SHSA 3RDTC 1XGRA 2QPDB 4CC1A 3ASNB 2P80A 4RZCA 3DV4B 2V2WA 3CIAA 2WN2A 4P06A 1JRHH 1N6UA 1NMCC 5ETUA 5MEQA 1J8KA 1WYJA 5F88A 4D9RE 3S96A 3Q6GL 1IGCH 3S48A 3CN2A 4D8PA 1G9MC 2I25N 5C2BH 3KLHD 3GSOA 4LGRB 1LO0H 3BGMB 3FHQA 4G9FD 5TDPA 4FZEL 3U0PB 3EO9L 1NBVH 4U05A 2D3LA 3T4YA 3ZZ1A 1GGTA 3T0AA 2QMJA 3LJ3A 4O9HL 3QEGH 4W9CC 2J1KA 3DHJA 1A9BA 4TS6A 3B6SA 3CFEA 4J3BA 4LNRA 1AO7A 4XC3H 4P2QB 5FS5A 3S8FB 4IRJC 4MJ5A 4ENEC 3E9TA 4L4VE 2BS8A 3ZTJG 1AFVL 3A23A 5M94B 1WFJA 4IOSD 4XPFH 3MACL 1RP9A 4HXBH 1S7QA 5HDLA 1T21A 4JB9H 4U2ZA 3EYUH 3GSNA 4X4YB 2JI1A 1JYXA 1J18A 5I2IB 2BWIA 1QEWA 2A6KA 4APQA 1BEXA 3LQAH 7PAZA 4F3FB 4C4BA 4Q52A 3V4VB 4JCLA 3ZVVA 1A9EB 1JPSL 4FQLH 1A5FH 3VGBA 1ZANL 5C7XL 5TH2B 4BFRA 1ZLUH 5LAXA 2JJSA 1UB6A 1WV7T 3FFDA 3L9RA 2VWEC 4GFXA 4R84A 3DURA 4GBXB 1FNSH 2IG2H 2MTAA 3DVNB 4NWTH 4S10A 3RU8H 4RFEA 3R0MA 4O2EB 2NY3D 1USQA 5L2JB 2APFA 2MNUA 2EUWA 1NFKA 5DVKA 1BZ8A 4H4NA 3UC0L 1KJ3H 1XSIA 2IDCA 4PLKD 4YN3A 1QFPA 2JLLA 3RYMA 1VESA 2QSQA 3KLSA 3VWJC 4NQVA 2UWEE 4XPAL 4Y16D 4YGAB 1TSRA 1BWWA 2BX5A 2R69L 1QBAA 3QIUC 2W91A 4DFIA 5L4JA 3CJJA 1PAZA 1J8HE 2X53A 4PRPB 2FT6A 3KJ6L 3OXSA 4Y8DC 2JQZA 3T4AA 4B6ZA 1LO3L 2E59A 3D87B 1KGUA 3LZOA 4WV1B 3TFKC 1PX3A 2DQTL 2O6EA 1ADQH 4N2HA 5B1CA 2DWTA 2P7TA 2A73B 2ZWKA 4X6DF 3ZUCA 2ATKA 3PE9A 3LSOA 2APVA 3OLEA 4Z7IA 4K71B 1BVKB 2APSA 1JSYA 2WSPA 3US9A 4CN6A 2EEFA 1Q72L 1CI5A 2FEDD 1EEYA 5GGVH 2APWA 3T1WA 3MUJA 2EO7A 4XMLL 2PETA 3EUDA 3O2WL 2EABA 2VXQH 3LQAC 1X3DA 5DD1H 4L4JA 1MI5D 2WVUA 2B4CC 1W0YT 3CK0L 5E1AB 5GS1C 3RJQB 1D2OA 2CRYA 3LRKA 5FA3B 3OKMA 5B38B 1F86A 2E9GA 2N56A 2MQGA 1FSKB 1BP3B 4NBXB 3C8KA 4PVMA 5E4OA 4EUPG 3QFJB 4JL2A 5ICYA 1KXQA 1MRDL 2CIIB 3HKFA 1BZDA 1ID5I 1G0XA 1MH5A 4QHKI 1XGZA 2PW2B 3ZE0E 4Z3EA 1ESOA 1NZRA 3BAYA 4L8SC 4UIMB 5EEWA 3PV6B 2FT8A 3GTNA 1X5KA 2X2HA 3P77A 2EKSB 4BHUI 1XF4A 3L7FB 2R0WL 2ZOLB 3K2KA 3NCFB 3A4FA 5KG9A 3LKOA 5ALBH 5JQHC 1ITBB 1EDHA 5JUEH 4QPEA 5GGRB 3MRNB 3SKNA 4U3XA 2VDMH 1IGJA 1H3GA 1M9WA 4HQQL 3L1EA 1YY8A 4YO0B 2AJSH 3O6MH 2FQDA 2WKLA 3QDAA 2JKRM 1M2VA 3VD4A 2EJ1A 5F7EH 5HDBF 4L9LA 3GMRB 4P9HL 4Q56A 5FUCC 4AVKA 3O9WC 4FHKA 1JNLL 1OEZW 2HKHH 4XO8A 3BRFA 3DETD 3RGVC 4OQTA 4DUXA 5CGYC 4GRMB 3PREA 4KZEH 1A7QL 3DHMA 5AOLA 3MLZH 1CD0A 3VD1A 1C5DB 2MQ3A 3FB6B 4G8GB 3NPSB 1CICD 4DUVA 2ZOOA 5TQ2H 2W9EL 1IM3D 2X38A 1I3VA 4Z6AT 1INQB 3OPUA 4HIJA 1L0YA 2VDNH 4PJ9B 3SODB