1N6IA

Crystal structure of human rab5a a30p mutant complex with gdp
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
167
structure length
167
Chain Sequence
GNKICQFKLVLLGESPVGKSSLVLRFVKGQFHEFQESTIGAAFLTQTVCLDDTTVKFEIWDTAGQERYHSLAPMYYRGAQAAIVVYDITNEESFARAKNWVKELQRQASPNIVIALSGNKADLANKRAVDFQEAQSYADDNSLLFMETSAKTSMNVNEIFMAIAKKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title High Resolution Crystal Structures of Human Rab5a and Five Mutants with Substitutions in the Catalytically Important Phosphate-Binding Loop
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein transport
molecule keywords Ras-related protein Rab-5A
total genus 58
structure length 167
sequence length 167
ec nomenclature
pdb deposition date 2002-11-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1n6iA00
4AI6A 3BH6A 4RFSA 4GZLA 1SZPA 4NCIA 5FOVA 5FUYA 2EFGA 3QJYA 4K46A 3QENA 1YZKA 2DYKA 1ZM3A 3Q3JB 2GAAA 1KKLA 3RNLA 4EIWA 1AS3A 2ZJ5A 3LX5A 4LX0A 3BBPA 3T34A 2JLRA 1A2BA 2O8EA 1VMAA 3I8SA 3ZD6A 3VNVA 3CM0A 2OM2A 3SHWA 3PFIA 3WRYC 2WWWA 5AWFC 4ITRC 2AKAB 1ZW6A 2QPAA 1D2NA 3I1FA 1N5KA 2A3RA 1LVGA 1DAGA 2ZRLA 5FUWA 3FGNA 3MGCA 2XB4A 3LX8A 5KUTA 2W2XA 1P9RA 4DEYA 1XRJA 2BHRA 2JDID 3U4QA 1CU1A 1XEWY 2B21A 3AVOA 4BLTA 1G6HA 5KHOC 3TLXA 1G6OA 1LFDB 4Q1BA 2WMOB 4GDFA 1XTIA 3ZDQA 4IDPA 3FOZA 1JNYA 2JATA 2O0JA 2FGKA 2ZJZA 2FPMA 3QKRA 4XTCS 3QXSA 3SS8A 1GL6A 3B13B 3MUFA 1N0VC 4HDOB 3W90A 4GT1A 2AX4A 2ZRHA 1GTVA 2I1QA 3QBVA 1FMJA 3KJHA 3A36A 1Q1BA 1IJEA 3U44A 3ZZ0A 4LDJA 4DWJA 2CMKA 4IOKA 4LJ7A 5FTJA 1XPRA 4MYCA 5KSPA 1AS0A 1KYIA 1Z6TA 4URZR 5LD2C 5HCNA 1D9ZA 2G77B 4BEJA 3K9NA 3O8BA 4GPTA 3WP0A 1QHHA 2XEXA 4I81A 3EPJA 2IWRA 1FQJA 3UWOA 2ORWA 1F6BA 2VLIA 3M4YA 2ZSEA 3NKVA 4DLRA 2ZRIA 2J0SA 2N1BA 5KSZA 2CLSA 2I1VB 2BOVA 3O47A 2G9NA 3PUZA 1E9SA 3T61A 3THXA 3ICQB 3B1YA 4OHWA 3NG1A 1GNRA 3MG9A 5BN5A 1SXJB 2BIFA 3W6OA 4DC9A 3KQHA 1SVMA 5JI3E 3HU1A 5EE9A 1XXHA 4IRUB 1KSGA 2XOKA 3CUEF 1UPTA 1CR1A 3ZZTA 3PITA 1MKYA 2X77A 4DDVA 1KAGA 1GKYA 1P4SA 1PVOA 2DFNA 4DDUA 2GEDA 3L0IB 1Q22A 5FTNA 4MKHA 1OIVA 3RABA 1OLOA 1JEEA 1LS6A 1DG1G 2D7CA 2QY9A 3AP1A 1YZTA 4QGGA 4P31A 3VTKA 5L3VA 2ZSFA 1NG9A 4XOIA 3QI2A 1KK3A 3Q5EA 5FBLB 3FVQA 3WMGA 2V1UA 3ECCA 2FE4A 4EPRA 4NCKA 1YZGA 5H68A 4MYUA 4P33A 1YR8A 2ZJ8A 3T5DA 1LF5A 2BEJA 2BMEA 3KJEA 3SOPA 5GJVC 2NPFA 1LY1A 1OXSC 1XU4A 1J8YF 2IW3A 3FTQA 5DYIA 2F9MA 2F9LA 2WKQA 4DLZA 1P73A 1YR7A 2W6JD 4M1OA 4A6XA 4TWZA 1IHUA 1U9IA 4US1R 1P62B 4Q66C 1L2TA 4URXR 1XMVA 3ZD7A 3K53A 2H7VA 1YHNA 1KO7A 4LOAA 4EQ6B 2F1RA 1Z0FA 3VX3A 3GJ8A 1G1MA 2VIIA 4R2IA 1E4VA 2IUSA 2ZSBA 1NN3A 5CB6A 2AHOA 1KMHB 3AKCA 4A4DA 4HB2A 4WAUA 3OIYA 5TB5A 1DPFA 1KY2A 2C77A 1US8B 4E03A 1TF7A 1G4UR 3UANA 2ZANA 4LHZA 1Z6YA 4O25A 4W5JA 2QAJA 1G7RA 2ZTSA 5A4JA 1MOZA 2XITA 4MKIA 2FSFA 5KPJA 2WTUA 2ZRNA 4QM7A 1E3MA 4BECA 4ZDIA 2GZDA 5H1YA 3H1TA 1MR3F 3KKOA 5A5GA 4JS0A 4Z54A 4HAXA 2QQ0A 1IM2A 4TL9A 1NP6A 4YLGA 1W36B 4UQOA 3VHLB 4P0TA 1VIYA 3U44B 4QBGB 4BFSA 3NEJA 2JLVA 1R5BA 3P32A 4FCTA 4Q1AA 1OXUA 2CDNA 3THWA 1DO0A 2DY1A 2W58A 3GLHB 5AUPB 1ONBA 2R6DA 3DKPA 3I92A 4CGZA 3EZ9A 1WRBA 4EJSC 2GNOA 2ZI3A 1K5DA 1ZU4A 4M9XA 3BH7A 4EFLA 2QROA 3V4RA 1WBBA 1D9XA 1E9FA 5JI2E 3AF2A 1VCIA 4W9MC 3L8YA 3KTAB 2P2LA 3BB1A 2ZITA 2CHVA 1W0JD 2IT1A 2J0UB 2QM8A 1TAGA 3A8TA 4X8LA 3WYFA 3KQKA 1KNQA 1E0AA 1D5CA 3C41J 4TQAA 3MLEA 1KI4A 3SDZA 2BM1A 1Z08A 4J0QA 1DG3A 3QVUA 5UKDA 3QF7A 3NTUA 4PAOA 3MWYW 3NIBA 4MRRA 2ZI6A 3LDAA 1DTSA 1T8UA 2B7BA 4JT2A 2QU8A 1UKVY 4AKEA 1G5PA 3K0SA 1M74A 1Z28A 2I3BA 1NY5A 5J5CA 1NRJB 2VYFA 4AYXA 1E0KA 3LBNA 5CLLA 4BEBA 3KJIA 1LNZA 1Y63A 3EZ6A 4I99A 4N0DA 1GNQA 4B2IA 1FOEB 3K70D 3A58B 5C4GB 2G6BA 2XAUA 2ERXA 3PENA 1IOZA 1IY2A 3TUJC 4CIDA 5K8UA 3VR4A 2F3TA 4B3CA 2QSZA 4NPHA 1E94E 2WMNB 4LGMA 4PO1A 2ZE6A 1IQPA 3HR7A 5F9FA 4GZMA 5HZKA 3X1ZA 4GOKA 2B7CA 4FCVA 1AGPA 3P4XA 1BMFD 4KITB 1T91A 1RJ9B 2YNMA 2ZEJA 3QOFA 4RSGA 2WBLC 3FPAA 5BYKA 3N2EA 2QAGA 2RGCA 3GD7A 4WZBE 4WBSA 4TLCA 2ZSAA 3RRMA 1JXOA 2K5UA 4AYTA 3U7HB 1GP2A 1ZBDA 2GF9A 4WA7A 3FKSA 4B33A 3VR2A 3W3ZB 4ARZA 2GVZC 1RIFA 1HY3A 4URWR 4FMDB 1K5GA 3NH6A 5DH9A 5EE0A 5SZJA 3UWKA 1P2SA 4QHSA 2G3YA 3LW8A 3WNDA 2CVHA 1T3SA 2N42A 3AP3A 4NMMA 5FPYA 3OFNA 4RZ2A 4JVSB 1FPMA 3WYAA 2OLKA 3J81k 1TPZA 4YXWD 3KXIA 2QA5A 4RCYA 3LQQA 1KI9A 1EXMA 2Z83A 5FI1B 4NYIR 4BPBA 3BD9A 4WXPA 4YQFA 1Z6AA 2D74A 2UZ3A 2Z4SA 3H4MA 2EYUA 3GQBA 3F0TA 2BKUA 3RHFA 4HLCA 3EPLA 1DARA 3QBTA 4H1VA 4HI0E 5TV2A 3H2YA 5E95A 3T5GA 4W5HA 5JS7A 1MO4A 3LY5A 4URUR 1QHNA 721PA 3BB3A 1NJGA 2A5JA 4KFUA 3A6PC 3EXAA 1XCPA 2ZJYA 4PPGA 5E7MA 2HCJB 2J41A 3GMTA 1TUEA 1X6VA 4Q9IA 1GAJA 1PZNA 2XB2A 4LUCA 3SQWA 3B1XA 1UBEA 3AUXA 1KO1A 4RFVA 3X1WA 1VCNA 3A4NA 1KI2A 4TZ0A 4IVPA 1KKMA 3TR0A 4A6PA 4P4TA 1A1VA 3OEED 4KFSA 2O8FA 4B3XA 1OYWA 2HJVA 2FDCA 1N6PA 4OQFA 1XWIA 2FFAA 2WVJA 3DHWC 5FOWA 1RKBA 4JT4A 1FX0B 5KPDA 1KGDA 1LW7A 5JJLA 1A2KC 4BZXA 1SVWA 5GJWC 3MAAC 1EFCA 2AL7A 4TSFA 3SYKA 3PUYA 2C8VA 3M1IA 2QPOA 2VBCA 3ASYA 3UMRA 3QPVA 1JAIA 3PJRA 1SULA 1S4QA 1UBCA 2FF7A 3R9IA 3VR6A 5EE5B 4PXAA 3TNFA 2AWNA 5J47A 3KL4A 3O8RA 4I1UA 4EPXA 3I4LA 3CKLA 1J2JA 1KIMA 2NO0A 3KQLA 2PBRA 5F2EA 2OCPA 1K8RA 2A7QA 1FW6A 2GWHA 1XXHB 5HZHA 4E07A 2C96A 2GF0A 1JXMA 5LB2A 2ZS9A 2IYXA 4Q48A 1JR3D 2R44A 3KKMA 2RB4A 2RHMA 2VP6A 3GJ7A 2B8TA 4RKFA 5GVRA 5SZIA 1N3BA 5JRJA 3QQ5A 3U3JA 4DUGA 5LDDC 1NMZA 1HURA 4G5SA 5K8IA 5FTKA 5AR1A 4Q4HA 3K9HA 1JI0A 4Q01A 1EFRD 1S3GA 4P4SB 4HYYA 4XD7A 1YRBA 4B2LA 1W4CA 1GZSA 2GA8A 1FQKA 3IGFA 1YR6A 1NBMA 1T3LA 1ZNWA 4R98A 3QF4A 3BK7A 4UJ5A 1CEEA 1E9RA 5JSZA 1UDWA 2YOHA 1XPOA 4B73A 1C1YA 1M6NA 2GXQA 4ZCIA 2ZU0C 1KO5A 4PPFA 1JB1A 3VHXA 3RS4A 2PMDA 2ZYWX 4DBLC 1OIWA 1KSFX 1DE0A 2IHBA 1COWA 5AJYA 3L8ZA 4ERNA 1WA5A 1NLZA 3B6EA 4G1UC 3UXMA 4LSGA 4LC1A 4JJKA 1E2DA 3EZ7A 5A0FA 3SJCA 4DJTA 1DS6A 1US8A 1HQCA 2R62A 1G3MA 1OFHA 3HR8A 2GK6A 3DDCA 1N6OA 2HYIC 4IOLA 3KQUA 3ZVNA 1SXJD 4NCHA 1E1RD 4JIMA 4D26A 4HLDA 1VCOA 1NLFA 4F4IA 2Q9BA 4NP6A 4FMBB 4IJMA 3GJ6A 4G5OA 1G8FA 4M1TA 4OQLA 1R7RA 3FMOB 4TL6A 1Z0AA 2Q9CA 4JBYA 2NIPA 2VP5A 1AN0A 2ODEA 4JJZA 1GKIA 5CK5A 2J3EA 2JLZA 2D7DA 3WRXC 3IEVA 1JQJC 3K0CC 1ZNYA 1LS1A 2YZ2A 1Q3HA 1NIPA 4A0RA 5FPSA 5JFGA 1II8A 5C18A 3IPXA 3V4FA 4Y0VA 3LRPA 1TUIA 3D31A 1NN0A 1YE8A 5J4HA 3LW7A 1RRGA 2RCNA 4QC2A 1WBDA 1Q3TA 2IK8A 4KODA 3GPLA 4RD4A 4QOSA 5JJKA 4JZKA 3PEUA 2GCNA 4F4CA 1R5OA 4RZUA 3QXHA 1H8EA 2XZLA 4BE7B 4ILEA 5KSOA 2W2VA 1VG1A 3L82B 4U5XA 1TEXA 2D3WA 4Q00A 1TMKA 2HT6A 2WZQA 3R7WB 1JR6A 4IW3B 3RWOA 3WNBA 1Z0JA 2ZYVX 2EVWX 1HUQA 5HKKA 3WMFA 1E2KA 4U7DA 3LBHA 2FSGA 4FMCB 4MRSA 1JJ7A 2D4HA 3EA0A 1KDRA 1ZM7A 4DEXA 5DN6D 2DHRA 5CDFE 4DIEA 1YRAA 1DAFA 1ZCAA 2GJ9A 3MWLA 4PANA 4C7OA 1IN7A 3QKSB 5CYPA 3AVPA 4Q02A 1N6IA 2C98A 1D8TA 4GMDA 3VU9A 3IBGA 3CNLA 3TVTA 4V0LA 4UXJA 4ACBA 1NY6A 2GEVA 1S1CA 4XIGS 3MMPA 2IUUA 4D0GA 4O2LA 3ZH9B 5EXTA 4DDTA 1ZD9A 2PX3A 1NVWQ 2OFWA 5L3SB 4BLOA 5E3HA 2XZPA 2E1RA 1XTRA 5GVSA 1EK0A 4FXPA 2V4ZA 3QXXA 2ODBA 5E7IA 4V0NA 5IF9A 3N5CA 5HKKD 1KI6B 2IBMA 2QMEA 4I4LA 2YOFA 3I3SR 4EPYA 1KI7A 3U4QB 4BGDA 3GCGA 1HV8A 3MCAA 2GTPA 2ERYA 1GWNA 3AV0B 2EQBA 1FFHA 3UMSA 2BCJQ 2CE2X 2AFIE 2CE7A 1E2MA 1MT0A 1SVKA 4L4UA 4FWTA 1E0SA 2ONKA 1XTJA 1C4OA 2FOLA 4M1KA 4RD2A 4WZAE 4II7A 1CTQA 2CJWA 4YMVA 4CEJA 1VHLA 5D3MB 4PC7A 1RRCA 2ZJBA 3D6TB 1Z07A 1TQ6A 4TYWA 5ELXA 1OIXA 1GKUB 1RRFA 1NI3A 4Q7LA 1KI3A 2ECKA 4Q4AA 1ZJ6A 1KI8A 1QHHB 1VPLA 2ODWA 2QG6A 3C4JA 5FTLA 2R9VA 4F7WA 1T0HB 5TY0A 4HATA 1SVOA 1TADA 2O0HA 5FL3A 2ONJA 4G3XA 4F38A 4EJSA 1HE8B 1SHZA 2CK3A 1W7AA 1SXJA 1AS2A 2Q6TA 1Z6XA 3RS0A 4EUNA 1EFTA 2FFQA 4JYBA 4URYR 2RGDA 1UAAA 5CJ2A 2YYZA 1AM4D 2G88A 2QI9C 4DLUA 3IO5A 3R8CA 4QRHA 2IF0A 4B3GA 3TAUA 1XMIA 5EUMA 2RAPA 1R10A 1G3QA 3PEYA 1QG2A 2ZVQX 1A7JA 3ZVRA 1BMFA 3VQTA 3GJXC 4ZDJA 2GXAA 3QKTA 2O8FB 4C0KA 5FBVB 1YJ5A 3CB4A 4G0NA 1MABB 3AVVA 2HF9A 2VH5R 2X2FA 4TT3A 5AK0A 1T0JB 1X8JA 4QL3A 1U81A 3RS3A 3U7FB 4GL2A 2NMVA 1NKTA 2IXEA 3KZ1E 2QMOA 2OE2A 1XXHE 1DELA 3WHKA 4B71A 4DB4A 1GILA 2HDNB 2ZUCA 4XD7D 3UG7A 2YJTD 4LYAA 1AIPA 2BJWA 4L9SA 4L9WA 3W5IA 4IFBA 4D82A 2B8WA 2XNSA 4OK5A 2PZEA 2FWRA 3HWSA 3BERA 3SJBA 2XOKD 4QG7A 2JLYA 2XJ9A 1ZNXA 2QQEA 3KXKA 3CLVA 1SVLA 4B74A 4CEIA 3CPEA 3OHMA 3RRNA 4DSOA 3A4LA 1KMHA 2RKOA 2WJVA 2IA5A 3QEOA 4M53A 4NZYA 1OE0A 2J7PD 4QXAA 4KCGA 1JBKA 2H92A 1X1SA 1T6NA 4PPQA 4XSHA 3EAQA 3PEVA 3ZLJA 1CKEA 4UXHA 4HAYA 4AKIA 2BCGY 2WJHA 3A1WA 4IDNA 4B3BA 2QAGC 5KYKA 1DVRA 1HH4A 4PQYA 2RGXA 1NF3A 2W83A 3TK1A 4OQNA 5EQTA 3W9YA 2GHIA 2YHSA 4P32A 4OI0A 2IXFA 1KSHA 4QBIA 1AJEA 4KFTA 4QBHA 4Q9JA 5F3WB 1HEIA 5DYGA 2ANBA 3NWJA 1KZGB 3B60A 3VKWA 1QZXA 2FN4A 3MFYA 4DRZA 4DLVA 1LV7A 2QE7A 3DOEA 1XTSA 2OAQ1 2WHXA 5CK4A 3QXJA 4IEEA 1HYQA 2OXCA 3GLGE 4OHVA 3OEEA 4DXAA 3GLHA 2WOJA 1W0KA 4LWZA 1Q1ZA 4A8JC 2OZEA 1NJFA 2JJ1A 1IY0A 2LKCA 5CJPA 5FOSA 4ZCLA 4M9QA 4AK9A 1WF3A 3SFZA 5FPHA 1U98A 1X1RA 2BDTA 2P0EA 1A82A 4GP6A 2HJGA 4O0MA 1YZNA 4AG6A 1GIAA 2WPDD 1E9DA 3KTAA 4R9UC 1QHXA 2JCSA 5EZ5A 5AJXA 4BFTA 3GEEA 1MV5A 1T9HA 3FYHA 4M0LA 5JHGB 2YWEA 2ZI9A 3AGPA 1W0JA 1YZLA 4NYJQ 3NBXX 1G21E 2V54A 3BGWA 1VTKA 1OXVA 3UATA 4RFSB 3H84A 1R4AA 1GSIA 1H65A 3QPWA 3OESA 2OXRA 4NTZA 3ZIAA 2GJ8A 2ZRCA 2AN9A 1E79D 3WNCA 4BZQA 2C2HA 3CF0A 4XVRA 2UVQA 1KDOA 1NN1A 4D0LB 4IDHA 4HAWA 1QHGA 3IBYA 5J4VA 3THXB 1EGAA 1GFIA 1KHTA 4LBVA 3LLUA 4AIIA 4FMDF 4QJ4A 3EWSA 3QVVA 3OIWA 2W0MA 1TQ4A 4DSTA 3AH8A 4V03A 2ZI4A 4Q5IA 4ZKEA 4MGYR 3AF1A 1TX4B 1OH7A 4YONB 1W48A 4YC7A 3CRW1 4OQXA 4GNKA 2CLDX 1KSJA 1S1MA 2OUKA 2PT7A 1XCGB 3VR3A 4LHXA 2PH1A 2YVUA 2R2AA 3ZVLA 5BN4A 4ZDKA 2BV3A 3T35A 4F91B 1J99A 1RJ9A 2IYLD 3BOSA 4DSNA 3CX8A 1G9XA 3K0FA 3B1ZA 2GZAA 4BQSA 5DISB 2EFHB 3CH4B 1K6MA 3L43A 4LYHA 1EWQA 2CL6X 4G5GA 4B6FA 3QKUA 2OFXA 2W0SA 4US0R 2J0QA 3TBKA 1KO4A 1N5LA 3NXSA 1G3IA 2HEIA 1I2MA 1BO6A 4LJ9A 3NHAA 4LJYA 3OF5A 4B47A 2QP4A 5SZKB 4JLNA 2EFCB 5KNCA 1FP7A 2BBOA 1BYIA 2CL0X 3KUCA 3LBIA 1QHSA 5EP3A 1II9A 2R6AA 4RKEA 3BS4A 4JBWA 2P6RA 3P4YA 1OSNA 3AVTA 2GJAA 1SHKA 2ANCA 2WSSA 2CNWA 2ZQ5A 1RPZA 1VHTA 2YKGA 4PFSA 3WY9A 1G18A 4LPKA 4G01B 4QJ3A 4FN5A 1G8GA 3FMIA 4NDZA 4W7SA 1ZUNB 1PJRA 2G0NA 2A5YB 4MITA 3M0EA 2H1LA 1WMSA 4LV5B 3CZPA 5KDOA 2IYWA 4NCJA 3IQWA 5J4KA 1WP9A 5AJVB 5JRZA 2AXPA 1JJVA 2OG2A 5KNDA 3OFND 3R9WA 2JA1A 2MMGA 1XD2B 1E2LA 3DOFA 4M8NE 4PC6A 3HYRA 4TYPA 5C46F 4RY2A 3CONA 1ZRHA 3CZQA 4TMTA 4AD8A 3EWAA 1RE0A 3THWB 2HXSA 1U8ZA 2VL7A 1I2DA 4P3YA 3T12A 5JEDA 3K9LA 3CBQA 3FWYA 3K0EA 2QTVB 3OAAD 1NSTA 2GEUA 2ZRJA 3G82C 1Z8FA 2MSDB 1S9HA 1LF0A 3Q9LA 4Q7MB 1GITA 4JL8A 2PLRA 1S3SA 1VIAA 1R6BX 1E2FA 3P1JA 4GP7A 2HCBA 2WWYA 2GILA 1S8FA 2J9RA 2F43B 4A2QA 4LJ6A 3B9QA 4K8OA 3B5JA 3KJGA 4OI2A 3N70A 2OBLA 3SE0A 2ORIA 1P72A 2J1LA 4EDHA 4XVUA 5L3SA 1SKYB 4P4UA 4DDWA 2J45A 3KKNA 521PA 1E4YA 4C0BA 3L0PA 1G17A 5JWRA 2BKEA 4MYHA 2ZE5A 2X19A 1ZIOA 4MA4A 1AZSC 4JKYA 2MSEB 3FMFA 1GRNA 3BFKA 1U99A 2FU5C 1XJCA 3U3RA 4PQRA 3CR7A 1KK0A 1RRPA 3BWDD 5CYOA 4KHZA 4P4SA 1GNPA 4POAA 1Z0DA 2W00A 2FMXA 4U00A 3B78A 4B48A 3AVQA 4Q4JA 2KB0A 4NYJR 4A0FA 2CLCX 3F5FA 2X1VA 1Q21A 2LKDA 5FH9A 5FUVA 4PO9A 3VX4A 2QENA 4GFDA 5FOXA 1VCMA 4EPWA 4YDSA 5JLJA 1DAHA 2WWFA 4LZZA 2ASEA 1D2MA 3I5YA 1U0JA 5EE1A 3TGPA 4ESVA 3DVLA 3LNCA 1R0ZA 4A0HA 4B34A 2DFKB 5CB8A 2VHUA 1RFLA 1VDZA 3P20A 4I1VA 3K70C 3R8FA 2OEPA 3KXLA 2JEOA 2O8BB 2JJ2D 2AXNA 2NZJA 3BORA 1IY1A 1AKYA 1E0JA 2FEOA 3B2EA 4H9GA 3IO3A 5G3ZA 1P75A 5EP1A 4D81A 1G8PA 4ZIRB 1E2IA 1E99A 4EJSB 4HUTA 2AK3A 1MO6A 2Q3HA 3U2QA 3QUSA 3PCRB 3ETLA 4LC0A 2YOGA 1QF9A 3DL0A 1FL9A 1O3YA 3OEHD 4MGKR 1ZCBA 2DPXA 3W34A 2IYRA 3VAAA 1EWRA 2C03A 2W6ID 4FMCF 2OO7A 1CRPA 2R6FA 2RHDA 3FDIA 4DCTA 3NEYA 3GFPA 1UF9A 4BFUA 4QM6A 1OYYA 4D80A 1XD9A 2GCOA 3O8DA 4PX9A 2BBWA 4B3FX 4FIDA 3S1AA 1OJLA 2QSYA 2XNDD 2EWVA 2Z4RA 3A1VA 2F7SA 5B30A 1YKSA 3PVSA 3WHLA 4DLYA 2G0TA 1CR2A 3I8XA 4GOXA 4L8GA 4TQ9A 1IN5A 4TYYA 3U3KA 1M1YE 4HAZA 4OK6A 3MWJA 4KV9A 1X3SA 5HTKA 2VPPA 3SI7A 4Z1MD 2DBYA 4HUQB 3DEFA 2BBSA 2GBLC 5IK2A 3T1TA 3MD0A 3OAAA 4PO8A 1JQLB 1CXZA 4CW7A 3FE2A 3JVVA 4PQFA 3NDBB 4DLXA 4ZO4A 2PLFA 1UEJA 1E2QA 3C8UA 1XEXB 4Q7KA 5JHHB 3U60B 1OT3A 3ZQ6A 2GJKA 4LHVA 4C0LA 4DUGD 5FI0B 2P67A 5FTMA 3KB1A 5JWHA 4DCVA 3NC1C 1WB9A 1UKEA 3BC1A 2IYSA 2H8KA 3AF3A 3A4MA 1AGRA 4HB4A 1SKQA 3QG5A 1UBGA 5FOUA 1F3OA 3WXMA 2J7KA 1BIFA 1SQ5A 2ZRAA 4Q47A 1U8YA 2OCYC 2H5EA 2BVNA 4UKDA 3PIRA 3SC3A 1NN5A 1E69A 5L8VA 3EZ2A 1FTSA 1ESMA 1F5NA 2UZIR 5H8WA 4GMXA 5IHPA 2PT5A 1Q12A 3ZVMA 3MSXA 1KI6A 3C15C 5ANRB 3LA6A 4L15A 4ZV4A 4FINA 2WSSD 1TU3A 2IXGA 2ZREA 3LLMA 2ZROA 4NBSA 3AF0A 4JVNA 5DHFA 4TL8A 5DN6A 4IOJA 1GM5A 4ON9A 1UFQA 2C78A 1HT1E 3LXRA 1IN6A 3REFA 3IQXA 5D3QA 3TR5A 1VECA 3MJHA 1XF9A 1W36C 5E7JA 2MMCA 1B23P 3E70C 1QVAA 1KZ7B 2E87A 2QTHA 4GI7A 4JL6A 4KXFB 4TMXA 2QP9X 4DB2A 1SXJC 5KDDA 1CJKC 3DMDA 2YV5A 1RZ3A 3CPJB 4K81B 3LVQE 1N0WA 2YWHA 3AF4A 3HU3A 2F1HA 4F92B 3JZMA 3BFXA 1G19A 1E2NA 5TARA 1XZPA 3LFUA 3WP1B 1HA3A 4ZCMA 1ZM9A 1HT2E 2Q0HA 2C99A 5AJZA 3RAPR 3AKDA 4KI0A 3X2SA 2A5GA 5JECA 3TMKA 4BFVA 3D7MA 2GCOB 3GLIA 1TF5A 5KDLA 1NLYA 3Q72A 2QMUA 1E96A 4CDGA 4Q1EA 1QG4A 4LV8B 1GRRA 1PV4A 4HB3A 4NH0A 1YZQA 2FFHA 4KO8A 2GZHA 4JLAA 3OIUA 4LJ5A 4Q7JB 4YMUA 1KI1A 2QRZA 4OI4A 3LO5A 5GJBA 2FZLA 3UG6A 2DB3A 2L0XA 3O8CA 5BW8A 1G5RA 1Z6GA 1XD2A 5IT5A 2VHTA 1ZNZA 1CR0A 1II8B 4PHHA 4PSVA 2WWHA 3ICEA 1MABA 3R20A 4PR0A 1F2UB 1J90A 1ZYUA 4MUBA 4I1SA 2R6GA 4RZXA 5FFMA 3CX7A 2GAOA 1E98A 2ZS8A 4M1SA 3SQXA 1Q57A 3RWMB 1ZC4A 4GSYA 1B0UA 2QUZA 2WPDA 4M1YA 4PHFA 1ZU5A 2WJGA 2ZYUX 4PTLA 4R71A 1CBUA 1OPXA 4HZUA 4LV6A 1JPNA 1T4GA 5DSZA 3DM5A 4E5UA 2ATVA 1GL7A 2ZRPA 4PC3A 2C95A 2F1IA 5HR5A 2ZRDA 1OW3B 2F43A 1P60A 5GJCA 4D0NA 2GKSA 4X8MA 3ADDA 1RYHA 2VEDA 3RRZA 3U6KA 2NG1A 3ZS9A 2QM7A 3CRMA 2I4IA 4ARZB 3SNHA 3EW9A 2O8CA 4TT3D 2JJ2A 3C14C 1H8ED 2QRNA 4A9AA 1PLKA 2VSOA 3Q7PA 4TMVA 4ZI2A 5CM9C 4OQMA 4YMSA 2R65A 5E4FA 4O3MA 1VG9B 2Q3MA 1WXQA 2AK2A 1E9AA 2EYQA 2VTKA 3KKQA 4JSYA 5JEEA 2OCAA 2A2ZA 4B75A 4LCBA 4I1OA 4DLSA 2XTMA 1EESA 4TTQA 3H86A 2OBNA 4M9SA 4IXNA 1R5NA 2JGNA 3HYTA 3NH9A 4NU0A 1AZTA 2GVDC 4KFRA 3U5ZB 4XWOA 2IX3A 3D3QA 3AQ4A 1ELOA 4BWYA 1M34E 2ODNA 4M2LA 5HE8A 1T5LA 2CCJA 4MUAA 1D2EA 3GFTA 1JEDA 2WWGA 1KAOA 1XDBA 2FA9A 4HDCA 2RGBA 5EXSA 4LY6A 3EPHA 5BWMA 1KNXA 4QFMA 3NC0C 2P3SA 3WYGA 2VHCA 3TJZA 2V1XA 5DI3B 4WXRA 1P9WA 5CLQA 3QY0A 5AJWA 4DT1B 4EFNA 1CJUC 4O2RA 2VHQA 4A8JB 1QVRA 5B58C 4AYWA 1BYUA 3T1OA 3BE4A 4B76A 3LD9A 3IUYA 3AVWA 3UIEA 4IVQA 5EXPA 3X1DA 2FPKA 2IYTA 5BN3A 4RD3A 4Q9HA 2PZGA 4QKQA 4FD2A 4NKRA 4MGIR 4M9ZA 2YC4C 2NTYC 4AWXA 2ZAMA 1ZM4A 3EG5A 3IIMA 4DKXA 2WWIA 3I62A 4C7OB 3C5HA 3CX6A 5BYJA 4C0HA 5HPYB 1Q44A 2NZ8A 1W2GA 2EU8A 2HXYA 4GOJA 4MDEA 3VNUA 1F48A 1UADA 1W4BA 1ZIPA 1VYTA 5J4LA 4OL0A 3RC8A 1II0A 4A0GA 1ZC3A 1LB1B 2JLQA 4OYHA 2A5DA 5FBQB 2QZ4A 4OKSA 4BLQA 5JS8A 3TSWA 2NQ2C 1MRNA 1S2MA 4Q18A 4Q9LA 5FBRB 4BZPA 1U9IC 4D4MA 4HEJA 4CT5A 4M4SA 4JLBA 1E1RA 4LBZA 4BASA 4Q4JB 3SBEA 3I32A 4NCNA 4NL4H 4TLBA 4YXWA 3FHTA 3AVUA 1XMSA 5LPNA 1NVVQ 4B32A 2CHQA 4MRVA 3GJ0A 1MRSA 4EPVA 1T5IA 3SN6A 3JVUA 2YC2C 4EKDA 3Q5DA 4HAUA 3RSOA 1L7VC 3E2IA 3RSLA 1NL3A 2A5FA 1XB2A 1N5JA 1IXSB 4UNQA 2PEZA 5EZ6B 5L3RA 3AVXA 1CR4A 4BUJA 1YZUA 4D4JA 1AA9A 5KU1A 3H0KA 3ADBA 4N1AA 1TNDA 2DFTA 3CR8A 3PUVA 2WAYA 2JIZD 4AG5A 3N2IA 2OESA 3IKJA 5AUQA 3ZQJA 5EP4A 4A2PA 4CZ2A 3QSYA 5SZHB 3TUZC 1OKKD 4TLDA 4FW9A 2F1JA 2CJWB 1W2HA 4D4KA 4CEJB 3ND8A 3BB4A 3V00A 2PX0A 4KU4A 4ACAA 1OF1A 4KSBA 2NPIA 4NYMQ 3THOA 2CCKA 4ZI3A 1N6HA 3A1TA 3K1JA 2XTNA 4URVR 2CXXA 3PUXA 2ZUDA 3UKDA 1HTWA 1IAQA 3AP2A 2FSIA 5JCPA 1NKSA 3W3AA 4IKEA 1ZAKA 1CJTC 1ZMXA 1KDTA 2WJYA 2ZI5A 3KQNA 4TTPA 3U7GA 4ZKDA 3DO6A 2KE5A 4BFYA 4D4LA 2OILA 3VR5A 5C4MA 3SFVA 2IYYA 1F2TA 2ZM5A 4HDQB 2W6JA 1ESNA 2VHJA 4ABYA 4MH0R 4BFXA 4DLTA 4DSUA 2ZRMA 4PHTA 1QDEA 1Z0KA 2HV8A 1Z47A 1N2CE 3L2OB 4M1WA 2XX3A 2PL3A 4WZ6A 1S9DA 4PZYA 3KDSE 1ZVQA 3VKHA 4WW0A 1J7KA 1W4RA 2C5LA 2C9CA 2J0UA 3CWQA 4D25A 2ZRBA 1AKEA 2C04A 4BRUA 1BKDR 3RS5A 2QMHA 4N3NA 5KOYA 4FWIB 2GRJA 1OFTA 2F55A 1IXZA 5CIQA 1RVDA 2QBYA 2J46A 3QG1A 4S35A 3QE0A 1GG2A 2IS6A 1VKJA 2VSXA 3KFVA 5G40A 1BH2A 2JDIA 1KOFA 2QL6A 1LTQA 1YU9A 2FJUA 1AK2A 2F3RA 2XGJA 5GADl 4V0ME 1XD8A 4M1MA 3FKSD 3IIJA 4A2WA 3T1VA 3BRWD 1DBSA 2XTZA 1IJFA 1SKYE 4XWAA 1SXJE 3X1YA 2QT1A 2O8EB 1JECA 1GDDA 1ZINA 3PQCA 3PUWA 3C16C 2RGGA 5FPKA 3SJZA 3AKEA 1NVUQ 3Q8XB 3QPUA 5F9HA 4XH9B 3NBZC 4WIAA 5C2JB 1IXRC 3ZGXA 3IEUA 4IEIA 3QKSA 2ZJOA 4QNMA 4TMZA 2XXAA 1J70A 1NMXA 5AUOB 3OZXA 1T3HA 4BRWA 2O8DB 3FHCB 2TMKA 2QN6A 3ZIAD 4BFWA 1Y3AA 5FOTA 3PG5A 1N0UA 1OHHD 1R2QA 1XBTA 3OE7D 1OKKA 421PA 2KBEA 4HB0A 2ZJAA 1XTKA 1P2TA 1EFRA 4US2R 3K9GA 1MO5A 4QHTA 2QE7D 3K8YA 3SU8A 3PV0A 2BM0A 2EFDB 1TU4A 2WM9B 2QORA 4ZDWA 1L8QA 4PZZA 8OHMA 1PUJA 5C1BA 5JWOA 1W47A 5DGXA 1UDXA 1QHYA 1R0YA 2IYUA 4Z8XA 2QTFA 4HLQB 4JLKA 3GLGB 2C9OA 4XTRA 2KWIA 2AD1A 2JJ1D 5HE9A 1ETUA 2PCJA 2AFHE 3GP8A 3I61A 3EX7C 821PA 2JLXA 1JALA 4BLPA 5F98A 4Q1DA 4EAQA 2O8BA 4QBFA 2ZI7A 3KUDA 1CULC 1OHHA 3OE7A 1T8TA 1UJ2A 4KAXA 2E9SA 4S2EA 2P6NA 3GLFB 4JLOA 1X8KA 1NBMD 4ZIRA 5CDFA 2OSBA 2OT3B 3MJRA 2BWJA 5JBQA 2AWOA 2G83A 3B7GA 4IFEA 3EA5A 1W36D 2JASA 5D3MA 1UEIA 4W5WA 2J0VA 3R9XA 1JR3E 3TUIC 1N25A 4LJ4A 4KYIB 3RS2A 4FCWA 4C4PA 4EFMA 2V6JA 1RW4A 2PMKA 3CRVA 2X2EA 1GOTA 1TF2A 3VMFA 1XX6A 5G53C 2ZRKA 5LD2B 3SR0A 1EG7A 2KI5A 3QXCA 2LWIA 5CM8B 1XEFA 2VP2A 1P2UA 1E9CA 2QBYB 4OBEA 1E1QD 4B3DA 3HPRA 3HJNA 5J4YA 5JMTA 1VYUA 1GVNB 1Z29A 4HZIA 4RZ3A 3BXZA 1XCMA 3VFDA 3L0OA 1XJ0A 2XNDA 4NYMR 3TH5A 2WV9A 2ZPTX 5G3YA 2DCUA 1TQ2A 4KLZA 3HU2A 2R6CA 1OH5A 1W49A 3EIQA 2BEKA 3LVRE 2C9YA 5KSYA 2P65A 1FTNA 4GBMA 2FGJA 4F93B 4PPNA 1U2RA 2H18A 2NO7A 4HLUA 1Z5ZA 5DI9A 3ZZUA 3IHLA 4B43A 4A36A 3SHFA 5IK2D 1CRQA 5JCZA 1XEXA 1G291 2VF7A 1W44A 2WKRA 5DIFA 2ZAOA 1N6NA 3GJ3A 2GCPA 2V55B 2WJJA 5H70A 3A37A 2ZXUA 1R8SA 2DWOA 3KKPA 1P61B 3LQRA 2B6HA 2ZETA 3SJAA 1P3JA 3IHWA 4TZ6A 1UM8A 3U61B 4XWKA 3UMFA 2V7QA 1PLLA 1A4RA 4RJLA 3ZS8A 4OHXA 2ZIAA 4Q19A 2BBTA 1DAIA 3B1WA 4CEIB 2BMDA 3T1QA 2IS2A 3IDQA 2VO1A 1DO2A 1M2OB 2H57A 4KBFA 2HT1A 1VG0B 1KO8A 4TYQA 4CT4B 3ZYCA 4OK3A 3BIFA 4PAQA 2J59A 1W5TA 2VP0A 3NBFA 1S0UA 3CF6R 4WVFA 1OB2A 2WIAA 2KBFA 2QGNA 1EX6A 4TSFD 4E22A 1KTVA 1IN4A 4N0EA 1BOFA 1NBME 3TW4A 4LPSA 1E79A 4C0JA 1BS1A 2D2EA 2EW1A 5LBIA 1TL7C 2KJQA 5FR2A 4D6PA 4QHYA 3SEAA 2JJ8A 4NYIQ 4KSCA 4DT1A 3I72A 2PJZA 4LHYA 4PSAA 1YVDA 1OFIA 4JVLA 5DHAA 3F3YA 3AEZA 3NVAA 3EARA 1WQ1R 3LAWA 3B82A 1G3RA 4RVCA 1WCV1 3THYB 1FMLA 1OV4A 4KVAA 4TMWA 2XZOA 1YQTA 2GESA 3Q7QA 4C2UA 1Q1QA 3ADCA 5CITA 5K8LA 4CEHA 2QP3A 1G64A 2P5SA 4JLDA 4QGHA 4HSEA 3GEIA 3JZAA 3U3MA 4PC2A 3UK6A 2D62A 3W8RA 5FUXA 1N6RA 4QNRA 1DAMA 2Q21A 6Q21A 1ZUIA 2OBMA 3W6NA 3CRRA 4PAMA 3G5UA 5IDVA 2CEAA 1Q20A 4Q9KA 4X8HA 5CIWA 3RYTC 4CVNA 3FHOA 1XMJA 4KLNA 2RGAA 4HAVA 4L16A 4D2IA 2V7QD 1PUIA 1ODFA 4BLRA 4MQBA 4BFZA 5B57C 5BXQC 2Y8EA 3DZDA 1G7SA 4PC1A 1CLUA 1EFHA 3TIFA 4PZLA 2KSQA 621PA 2ORVA 4L5BA 2Z6VA 4OJKA 4LYFA 3K09C 3PR1A 3SYLA 4ASUA 4QGFA 1F60A 2ZVPX 3S1AB 2V9PA 5KNBA 1OXXK 3CH5A 2UKDA 4MDFA 3MRSA 4X8OA 2VA8A 4TLEA 3IILA 4XSGA 3NBYC 1KMQA 1IONA 2IS1A 3SYNA 3OEHA 4LHWA 4R2HA 2OFOA 4JL5A 2FZ4A 1FNMA 3TW8B 3C5CA 1KY3A 4MRPA 3EASA 4NHOA 1XTQA 2ZYTX 5DE3A 3WBJA 4C3ZA 1G4AE 1Z63A 3GJ5A 5BQ5A 3OIVA 3WBKA 2GXUA 1N6LA 4YMWA 4IOMA 1S96A 4LJAA 1R0WA 3CNOA 1E6CA 1CP2A 2ZE8A 4UNSA 4NE2A 1V5WA 2IF2A 2AD5A 5LB4A 2AR7A 4TLAA 4RD1A 1G7TA 4ASUD 1E2GA 5FR1A 1G7CA 4AURA 1UKYA 3EIEA 1XEWX 4B6EA 3CPHA 1CS4C 1I4TD 4MGZR 3U6BA 2OAP1 2JLSA 4RCZA 2GBLA 3PEWA 4JMPA 1F2TB 4KVGA 4Q4HB 1RYFA 1EFUA 4R7ZA 4F4JA 2VRWA 1M8PA 3DPUA 4LRWA 1FUKA 2VP4A 3ONWA 2FG5A 5AUNB 4QGAA 2Q9AA 3KX2A 2YWGA 1AQYA 1U0HC 1OB5A 4DLWA 1KJWA 4M22A 2YINC 3VKGA 4A15A 4Z8YA 1P9NA 4C9BA 1P2VA 4UJ3A 3DM9B 2HF8A 4IDOA 4MRNA 3RC3A 3W8NA 2JLWA 3TVDA 3EC2A 4DIDA 3AVYA 5TDHA 1NNEA 2GXSA 2WSMA 2ZE7A 3D8BA 1GUAA 3BH0A 4EPTA 1RC8A 4GRAA 3K70B 4CEHB 1E2HA 1U8AA 1M7HA 2ZS7A 3AUYA 3LV8A 1XP8A 5JZVA 2D2FA 4G5RA 3W6PA 2NO1A 4DCUA 2A78A 1KK2A 4CYMA 3QNUA 2FEMA 4HUQA 4IDQA 1OXTA 3WMEA 1JPJA 2OLJA 3GLIE 4AY2A 3Q85A 2IHYA 1PLJA 4QJ5A 4XVQA 3B9PA 3LH5A 4UNPA 4CF7A 1KDPA 3FFBA 4JLJA 2EFEB 3MWKA 2FPLA 4MKGA 2IYQA 3VR1A 2ZUBA 1QHIA 1UBFA 4AC9A 3TAHA 1ZD1A 1ZM2A 2REOA 2BMJA 3GLIB 2J7PA 1E32A 4TMKA 4LK2A 2WJIA 1C9KA 2IL1A 2J5XA 3RRYA 1EX7A 2JIZA 2HLDA 3A1UA 3T15A 1NVVR 1X8LA 5B64A 1H8HD 3X1XA 2QEQA 5EJEA 4LBWA 5TXGA 1WE2A 2EWWA 2RGNA 3QF4B 3K0CA 3RANA 1Z3IX 4OJQA 5J40A 1OH8A 1X86B 1G16A 5JSZB 2XSZA 221PA 3QEJA 4PSKA 1P6XA 1TEVA 3U3OA 3CW2A 4LYJA 3CNNA 3K09A 2Q3FA 2A9KA 3QIAA 3IIKA 4OHZA 4C0QC 3AGQA 4UNRA 3TE6A 1Q1EA 3HP1A 3W5JA 4Q1CA 1G8HA 5IRCD 1Z83A 3DZ8A 1ZUHA 3RVBA 4AKGA 3TSOA 2PCLA 4DCSA 1Z06A 4IHQA 4JLMA 4ZPXA 2G1JA 3TQFA 2NGRA 3QKRB 2ZR7A 2OV2A 2CK3D 3CIOA 5EE3A 2VQSA 3GFOA 1J8MF 1L4UA 1P5ZB 4HZUB 4DHEA 1NG1A 4JYCA 1FNNA 5TMPA 2V3CC 3DMNA 3GJ4A 1I4LD 2AKYA 2QNRA 2H17A 2OHFA 4RD0A 4EQ6A 3UPUA 1W5SA 2J87A 2QPTA 5DNYB 3I5XA 2REXB 4OI1A 2BJVA 4G5QA 3E5HA 3U7EB 2OCBA 1FP6A 4TL7A 5TVKA 4A92A 4C2TA 2ZRGA 1A5TA 4TYNA 3HDTA 5G41A 3CO5A 2P5TB 1M7BA 1NIJA 1OFUX 2O52A 2WICA 1YR9A 3GLFE 1E2JA 3ADKA 1CF4A 2A30A 4KBGA 2IEYA 3K0AB 5EXXA 1L4YA 1M7GA 1D6JA 1SVIA 2B92A 1N6KA 3RDPA 1W46A 1Q0UA 4H1UA 2FV8A 2BC9A 1KJYA 1GRQA 3F8TA 2RH5A 4UXIA 3GLHE 3TKLA 2DFLA 2RGEA 4RD6A 1E1QA 2ZSDA 3CWZA 3REGA 4JLVA 1ANKA 2R8RA 5FL7D 3BJIC 1WDTA 4A1FA 2HLDD 1VG8A 4Y0AA 3G0HA 2V8OA 5L3QA 5M04A 2RMKA 2ZR0A 1GL9B 2XJ4A 3FKQA 5K8TA 1CJVC 2IYZA 2WKPA 3ND9A 1SVSA 2IWHA 4BLSA 1Z22A 1DAKA 1FX0A 2V6IA 1HE1C 2QT0A 4Q03A 1U90A 2GK7A 4CRWB 4B2PA 2HUPA 1XFAA 3NDPA 3A1SA 4DCNA 2GETA 3B85A 1G20E 1TQDA 3CF2A 2LCFA 1ZP6A 4JLPA 4AKHA 5DI3A 2VP9A 4JSTA 3BFVA 5JJIA 2Z0MA 2IEZA 1KJZA 2CL7X 4V02A 3VU9B 1G8YA 4B44A 4NONA 3ZJYA 3TQCA 1U94A 3NHBA 2WIBA 3ASZA 1DAEA 1Z0IA 1VYVA 3B8HA 3FB4A 5FL7A 1U0LA 3RS7A 1CIPA 3P27A 2NOAA 2W6IA 3M6AA 5EUQB 1FUUA 2FH5B 2ZR9A 1DEKA 1XJQA 3SZRA 1G41A 1COWD 4Q4LA 1G5TA 3GEHA 4PHGA 2O8CB 1W0KD 1G3UA 1IBRA 2WWXA 2NO6A 3CRQA 2QGZA 4A82A 4JBXA 2HYDA 2O8DA 1Z2AA 3KB2A 4LI0A 2XXAB 1H8HA 1NSFA 3PXGA 3AKYA 3T06B 1NVXQ 1E9EA 2GJSA 3K0FB 2ZU6A 3TRFA 4UNNA 2DR3A 1AQUA 2ZRFA 2PEYA 1SGWA 4DZZA 4OHYA 1XZQA 4XJXA 3I73A 2YWFA 2X8AA 2MSCB 2SHKA 2FSHA 1UKZA 4Z51A 3LWNA 5FBWB 2D06A 2N46A 4C0SA 4LJ8A 2Z5FA 1W1WA 2H16A 1TTTA 3GLGA 1O87A 2ATXA 2VF8A 3EPKA 4Q1FA 2PZFA 1JAHA 1JR3A 2FNAA 4E09A 3P26A 2G1KA 2Z43A 3L0SA 2JLUA 2O5VA 3THYA 1QRAA 4Q21A 2WAXA 5DLQC 3KFXA 2PJRA 2QAGB 4JKIA 4V0MA 1MO3A 4Q4AB 1QBKC 1ZD8A 4V0KA 5B2ZA 2FFBA 1E2EA 2IC5A 3EC1A 3EIHA 1Z2CA 2IS4A 4IVRA 2DWQA 2NO9A 3AB3A 2BMFA 3DKVA 4A8JA 4DVGA 3K0AA 3GLFA 3HPQA 4MKFA 4U02A 3IPYA 1HQYE 2DWPA 5P21A 3EZFA 3C7KA 2P6UA 121PA 1XPUA 1P7CA 4C30A 2JAQA 4TTRA 5FPTA 3LXXA 2O0KA 4ESHA 1R8QA 2W2TA 2FX3A 4FI3C 4V0OA 4YMTA 4M21A 3TSZA 2RGNC 4JVMA 2IYVA 1DADA 1I4DD 1FZQA 2CHGA 4KYUA 5L3QB 4TN1A 1E9BA 5HCIA 1E2PA 4HLUC 2IUTA 1V43A 3FFAA 4IXMA 3BAFA 3AM1A 4KJZA 4MYTA 1CJMA 3V9PA 2F6RA 4B35A 1N5IA 2ZJ2A 2CVFA 2GDJA 1MH1A 2CCGA 2XSZD 4LBYA 2VSFA 1XNJA 1W4AA 5KTYA 3E1SA 4Z1MA 1IN8A 1KK1A 2CBZA 3SBDA 5EP2A 4TQUS 2WOOA 5KO2A 4C0AC 1NMYA 1DOAA 4WOPA 1OH6A 3B1VA 3R7WA 2CNWD 1F2UA 1R0XA 3RLFA 5DO9A 4YDHB 2REBA 3FMPB
chains in the Genus database with same CATH superfamily
2WD8A 3PVCA 5CLJA 3I0NA 4I2NA 1K7XB 1SZPA 2BR5A 4LECA 5FOVA 1JKJA 5THQA 3GDWA 3EULA 4WD3A 5U1PA 3N8KA 4Y2RA 1SU4A 5BNFA 2GAAA 3ND5A 2ZJ5A 1RRMA 5KINB 5TGTA 4KQIA 3L0CA 2QUBA 4CKEB 4KUEA 2RGWA 3LUJA 1A2BA 3UW1A 3VNVA 3FSRA 1W87A 1ZKDA 2V5UA 3OZDA 4QULA 5AW3A 2ZUEA 3ASVA 3NVKI 3SHWA 4BBZA 4WASA 2F8TA 1EA5A 3ILSA 1RQXA 1AURA 2GN9A 2NW6A 2WWWA 4W6QA 1F9EA 5BT9A 3PGKA 3VKFA 2E4UA 3HXPA 4ITRC 3ZWAA 3G0DA 1DAGA 2YV3A 5FUWA 3ULKA 3FGNA 4G4SO 4Y18A 1N3LA 1UWLA 1FS4A 2WIJA 1N2SA 2W2XA 1P9RA 3UUWA 3OJEA 2BHRA 4B9EA 3TJRA 4D3FA 1FSGA 1V47A 3BULA 2B21A 4MV3A 5DFAA 3AR5A 2WZCA 1G6HA 1PQWA 4Q1BA 1JEJA 2R7AA 1UANA 1W5EA 4A10A 3UXEA 1TLTA 4BCCA 2DHDA 3VGPA 2O0JA 2ZJZA 3I01M 1KQ3A 2BYTA 1QG6A 1TO6A 1GL6A 3NV9A 1N0VC 1QGYA 4CMJA 3FYTA 3LWZA 3LF2A 4OQQA 5M29A 2AX4A 1EP3B 1V1RB 4FDVA 4GPEA 3SSMA 4MVYA 1QGUB 1Q0RA 3IDSA 4EG6A 3U44A 1KMMA 2ASVA 4NJEB 4E2YA 3D6AA 4ZZ1A 4LJ7A 1Z5PA 5MN5A 1SELA 1B8OA 4YRKA 4URZR 5J58A 5LD2C 1NP3A 3K71B 3AG5A 3UGQA 3WHPA 4P9NA 1L5QA 2SICE 3E9ZA 4RKWA 4YP0A 2VJMB 2EZ9A 3FSGD 4ZOBA 1QGOA 1QHHA 4B7XA 5AOAA 1EGVB 5JVDB 3ZU6A 4DIMA 1F6BA 4K87A 3DBVO 4YRNA 2HCRA 2RKBA 2ZSEA 2AE1A 3AR9A 4FFBB 4DLRA 5KJCA 2XUGA 2OSVA 2ZRIA 2J0SA 5DB4A 1YBHA 2N1BA 4UHFA 5IARA 3H9EO 1P1KA 5ALYA 2FJPA 4EWLA 5TF0A 2ZJ0A 2G9NA 2BLLA 3T61A 1E9SA 3ICQB 9MHTA 1C7FA 1H0KA 2CXOA 3B1YA 1PJSA 5IC5A 5H9VA 1GNRA 4F4DA 4RL4A 4ZA2A 4DC9A 3KQHA 5JI3E 3UM9A 3V5NA 3CX4A 1PV1A 1XXHA 2NXEA 4IRUB 5JXJA 3OCXA 3QX8A 3ZZTA 2DVMA 1XZCA 4DDVA 1KAGA 1GKYA 2XAAA 2DFNA 3MELA 1SCNE 4EELA 2PV0A 1JKMA 2PXCA 3CZ4A 3JQ6A 1BN7A 1OTXA 4YFYA 5FTNA 3RABA 4QAJA 3VDNB 4EI9A 4CQNA 3HZRA 2JIDA 3BMQA 3QVSA 4B40A 1DG1G 2WWTA 1DRVA 3IJ5A 5AQEA 3TIIA 1DKLA 5I48A 1YZTA 2VKTA 3VTKA 4D4GA 5L3VA 5CURA 5G4KA 4UASA 4HV4A 3QI2A 3Q5EA 1F6DA 5CFRA 3BF7A 2QJOA 1I2BA 2FE4A 5AM0A 5E9WA 1I7QB 4EPRA 1W5AA 3F3KA 3G59A 3QTLA 4NCKA 2ZJ8A 4P33A 2B2CA 2BEJA 1ZRSA 3HV2A 3KJEA 3A9UA 3M82A 5GJVC 1LY1A 4EY3A 2UYOA 1I2CA 5B5SA 1J8YF 2ISCA 2IW3A 2TYSB 2WUFA 1VGVA 4YJ3A 2Q0QA 2QLTA 3SQLA 2ZJ3A 1G21B 2BEWB 2F9MA 1ZD2P 2QM0A 2WKQA 3T5PA 1G0OA 4WDQA 4REMA 5EMNA 3DAPA 3SBOA 3ZGNA 2DECA 1L2TA 3FGOA 3K53A 3WDMA 4QGSA 3TQSA 4EQ6B 3MAJA 3S40A 2VF5X 1HOTA 1QM5A 1RXUA 3GJ8A 4R2IA 4ERXA 5DPMA 2BGNA 2Q8PA 5CB6A 2ZIEA 3EVCA 5M7EA 4X1YB 4WAUA 1WSBA 1WHTB 3OIYA 1DPFA 2FR0A 2ZKLA 1US8B 4E03A 5IZ4A 3NFYA 1NX6A 3HFSA 3ZTYA 4KR6A 1G4UR 2ZANA 4F06A 1VLVA 1B41A 4P86A 4P58A 2A0FA 1G7RA 2XKKA 3KBBA 2Q2VA 1A9YA 1IEVA 2O3JA 1GTZA 1JQEA 2YMQA 3BMNA 4OV6B 3LUFA 1LLCA 2FVXA 1QGED 1UR5A 3SSNA 6NULA 1FDSA 4QM7A 3EFOB 4P6VF 2I0FA 4IX9A 1B0ZA 2PL9A 3H1TA 1D0IA 4QPPA 2J3LA 3WB2A 3KKOA 4MQMA 4RNDB 4AP6A 4DTCA 5JH7F 2OZKA 5AW0A 2GVNA 3L0ZA 2YCBA 3IERA 5AVRA 1TIKA 4NNOA 1KEUA 3CA8A 4M1QA 4MLZA 2QB5A 2KLBA 3H16A 1D5WA 2EZTA 3VHLB 4P0TA 1VIYA 4QBGB 1K98A 3NEJA 3F67A 1Z4IA 2M6LA 1JSZA 3BD7A 4FDTA 1J00A 4ZAFA 4Q1AA 3RF6A 3OM0A 3TLAA 5DLYA 3TQQA 1JMVA 2Q3BA 1DO0A 2DY1A 2W58A 3GLHB 4MW4A 5ERGB 4QT4A 4BFCA 1C9MA 1FMCA 2DHQA 1DEXA 3PHHA 3I92A 4NCXA 5IYZA 1UOEA 1NM5A 3DOIA 1WRBA 2P27A 1DG9A 1WR8A 2AMLA 2GNOA 3O1IC 1Z35A 2ZI3A 3P0HA 3V4OA 1K5DA 3F4BA 4M9XA 3OHSX 4W9MC 2CD7A 2GKGA 1JEYA 2Y27A 2W2KA 3M1YA 3WLNA 4OD0A 3IP9A 3TZ6A 1HDXA 1HYGA 5AI6A 5C81A 3L8YA 4ENQA 4B3JA 2P2LA 4F2WA 4DAEA 3F74A 4IIJF 3MF4A 2CHVA 1W0JD 2IT1A 2J0UB 2C57A 2VYCA 3A8TA 4YDRA 3UB4A 1MXHA 1KNQA 1TD9A 2CLIB 2GZ3A 3ND7A 3C41J 3D2CA 3MCZA 3OLCX 2ZIXA 2Y4OA 1ES9A 5I8ZA 5H9WA 1ZIDA 1Z08A 5IU6A 1DG3A 3QVUA 3HB9A 5K6TA 2VNIA 2WYVA 3NTUA 3QK7A 3M3PA 5LQAA 2ON6A 4ND3A 2ZI6A 5I7VA 4CKZA 1T8UA 4G0YA 2QU8A 1T5SA 1XE3A 4CMIB 4CODB 1XT6A 5C1DA 1YQDA 2I55A 1NY5A 5IULC 5CNKA 1NRJB 2VYFA 5J5CA 1NNI1 1O0BA 2Q6VA 2UYCA 1E0KA 4FZ3A 2PVPA 2DJ5A 4DCSA 2WIGA 2XGSA 4WZBA 3BWXA 1Y1LA 2YX1A 1E6LA 5K3DA 2W8BB 3PENA 1NNUA 2ERXA 4IJ6A 1IOZA 4UFPA 2XI4A 3VR4A 4BO9A 2F3TA 2WDPA 3GCDA 3ESYA 2QSZA 4B83A 4FLEA 1CEYA 4QQFA 1CS0A 1E94E 1YU6A 2WMNB 2C4MA 4YRGA 1OWLA 4K9PA 3Q8LA 4QUEA 4HXFB 5LXTB 4F97A 3X1ZA 1G2PA 4GOKA 4R1OA 4II3A 4GLJA 3P4XA 4D9FA 4FZ5A 1NT4A 1T91A 3HJCA 1RJ9B 2YW9A 3L4BA 4ZICA 3W3AD 1V35A 2GRAA 4PAGA 3IT3A 4XDZA 2C8LA 4ZRNA 5I7UA 2XHEA 2QAGA 3HBLA 2AG0A 2RGCA 1Z17A 2Y05A 3GD7A 2AZXA 2NVWA 1LPBB 4XRGA 4B33A 1JAYA 3VR2A 4CLHA 5CDUA 7ADHA 2VCEA 1YI8A 5DH9A 4RH1A 5IBRA 1K5GA 4EVSA 2GEJA 3B6MA 2G3YA 3WNDA 3DNMA 1RP7A 2CVHA 4KZPA 1L1FA 1C41A 2C1XA 3AONB 4NMMA 1VLZA 2DTEA 1QFXA 2D7JA 2XGOA 3AB7A 1FPMA 1G20A 3PRKE 4H7EA 5BY2A 4WEOA 3WMXA 1ISPA 4MV4A 1ND5A 4R1LA 1TVMA 2ZAGA 3BD9A 2UXDB 3M49A 4EYQA 1Z6AA 4JJGA 2UZ3A 4YQFA 1EK2A 4L3WA 4QSHA 5DSTA 2EYUA 4F46A 5A9TA 4XEUA 5BUZA 1UPXA 3OPYB 3QBTA 4HI0E 5DZSA 1FFSA 1HYHA 1K5HA 2G25A 2Q6KA 1IDN1 5AI5A 4I4TF 3T5GA 3LY5A 1PT7A 1QHNA 5CNIA 4BKPA 2X40A 9GPBA 4RTJA 1KH1A 4U7HA 4BTLA 2GPSA 1WMDA 2MINA 1MOPA 2AG6A 4GZ6A 2RHLA 2J41A 4NENA 1PZFA 3UAXA 3SKYA 4Q9IA 4BXOB 3F7NA 3GPCA 1IJBA 1PL8A 2QVGA 5D01A 3AUXA 4DM4A 1NVAA 4KGZA 4EY6A 3X1WA 2V7VA 1VCNA 4HEA1 2BL4A 3T9CA 4AMGA 1KKMA 3WL3A 3NIDB 4P4TA 2DG2A 4GXNA 1OYWA 2Q7DA 4DFDA 1N6PA 2PH3A 4OQFA 2WTBA 4BO0A 4YUAA 2FDCA 1ZH0A 3N6XA 2WVJA 1Z18A 3DHWC 1ZVVA 2HSZA 4GVLA 4CM8B 2Q4RA 4DA6A 5DLPA 4UTNA 1LW7A 1SVWA 2XDAA 3PLRA 2VJBA 3G0OA 3G88A 3PUYA 4J9VA 3W78A 3ZLVA 5HUJA 2QM3A 3QPVA 1JAIA 2P1RA 2B9EA 2AUNA 3CLRD 3VR4H 3WXBA 4IDBA 2FF7A 3NDIA 1RHMA 1TRKA 1FK8A 3S5JA 4RIHA 1OMOA 3IVRA 4KX5A 3UJBA 4OTZA 3O8RA 3EXHC 3B89A 3IODA 1I7PA 3ROZA 1YVPA 2I3DA 2QRGA 1J2JA 1KIMA 3H4IA 3LNTA 4CKEA 1DX6A 5HK9A 1ISSA 4WBNF 2IODA 5F7ZA 1ILWA 2A7QA 1NNEA 4KEAA 1YC2A 2X0NA 1XXHB 3TL6A 3DTVB 1N9GA 5K09A 1BE0A 1EDZA 6ABPA 3HMKA 1E77A 2YYYA 1JR3D 2VDLB 2Y0BA 1S2IA 2B1JA 2XT0A 2YUTA 2RHMA 1WMBA 3A1FA 4YT4A 2B8TA 3BDVA 4OUDA 5AVJA 4B8YA 4L27A 5JRJA 3QQ5A 2GNPA 2YVLA 4DUGA 4YCDA 5K3FB 3ZHQA 5K8IA 1L7QA 3BDIA 3DYBA 4Q4HA 1FDWA 3PR2B 3TLCA 3D4BA 1EFRD 3AHEA 2PGDA 3OZTA 1Y5NA 4KQEA 3L77A 4NZPA 1QVVA 3DJFA 2GA8A 3EVAA 2HMAA 1JAZA 1KORA 1HRKA 1T3LA 4G41A 1QYXA 4U6NA 1XZDA 4MVJF 3DDZX 3HVHA 4Y1RB 3SG0A 1CEEA 3RWBA 2LP4Y 4Y7CA 2VUSA 1T15A 1VM6A 2YOHA 3MINA 3NAQA 4YAEA 1DT5A 3VPGA 1D2HA 4NE7A 3PC2A 4FTWA 5LXTF 1HGXA 1KO5A 3ZW7A 3RV4A 1KSFX 3ZE2B 1GDTA 3CUUA 4ERNA 2O8VA 1ORIA 1E5QA 3ZU5A 2JA2A 4EA8A 1E2DA 5K03A 1UDCA 3SJCA 4DJTA 5H16A 2M1ZA 1TYDE 5CX4A 5D87A 1US8A 3QWAA 2VJPA 1JR2A 1HDOA 4O29A 1RAFA 2NV0A 3MMXA 3IXQA 3EQ9A 4BVAA 1UMBA 2ZB7A 2GRUA 3RSCA 4TLLB 3RAFC 1L7MA 2YFHA 4HS4A 1SXJD 1FDUA 3PKIA 5CVJA 4MVJE 4JQOA 2B0CA 3JATA 5GIOE 5ADWA 1A95A 2O2SA 2WQ7A 2Q9BA 4PNZA 4NP6A 1CVLA 1VLLA 2VNSA 3GJ6A 4IJMA 5A4FS 4M1TA 4OQLA 4ZVVA 4HQ0A 1U7ZA 4TL6A 1VGQA 5TRTA 2Q9CA 3GAAA 4JBYA 1N2BA 1L7XA 1USKA 2VP5A 1CPYA 2ODEA 7YASA 3AKZA 1GKIA 3DZJA 3FA2A 3LC0A 3WRXC 2D7DA 3IEVA 3HUEA 1S2GA 3ITNA 3LSYA 4REQB 4A0RA 3K2QA 4GQAA 1T8RA 5JFGA 1A9SA 3ZBPA 3LO8A 5EL0A 3IPXA 4MXDA 3AJ9A 3V4FA 4E08A 1FNSA 1JDZA 1P1RA 1P6QA 5AVWA 3D31A 4H0FA 5J4HA 4LDQA 5CYFA 2ISSD 3ZW8A 4RD4A 1COZA 2P8SA 3PEUA 1ICEA 2UUOA 3UY4A 5ISMA 2ZBPA 4RZUA 1H8EA 5KQMA 4BE7B 1Z4NA 3H5NA 1U0OC 4YJ3B 5KSOA 1F0NA 2CWWA 1HZJA 4J29A 5B55A 1Y33E 1JEYB 3NC4A 3GP5A 1QBGA 5HBGA 2D3WA 1PG5A 4Q00A 3ZKWA 3D3WB 1OD6A 2XA2A 3U3XA 2I6UA 1ZX1A 2GF2A 2WZQA 4IH4A 4Q24A 4IW3B 3RWOA 4U2GA 5HZMA 4GRIA 1P7WA 1JIXA 4FYXA 4MVWA 4MLPA 1YRHA 2RB5A 4PYQA 1WXXA 2IPMA 3GLVA 4MQLA 4DBLE 4GOMD 1E66A 1U8TA 2YYSA 1JJ7A 1TB4A 2YIVX 1HLPA 4N7BA 4AN1A 1P0QA 3E81A 1PE0A 2AOXA 2HA6A 3R77A 4J0IA 1ML3A 3K0KA 3MWLA 2GJ9A 3B70A 4PANA 4DWOA 4C7OA 2D2VA 3JWIA 3E3OA 4CU5A 3C1UA 1EA7A 5BMVF 2C98A 2X4LA 1J49A 1D8TA 2GLUA 4NOJA 4QFDA 1RBMA 1BXGB 4FOTA 4P82A 4XUCA 3T3HA 4RZQA 2YWXA 4HDKB 3N0VA 1A72A 2EG5A 5B6IA 3P94A 2GEBA 3ZH9B 4G26A 1Z6QA 2X41A 2HU5A 2ZVDA 1GT91 2OFWA 4X0EA 5JNVA 4JR0A 6AT1A 4ZI5A 2BGLA 4EKYA 2ODPA 1XTRA 1NC1A 2PSHA 4OMUA 5ENVA 1IOWA 5CA1A 2GOYA 2ODBA 2V0CA 2K2WA 4NXMB 5IF9A 5HKKD 4UHCA 2H9YA 4KDFA 3NDJA 3H99A 4G1BA 4KXQA 1SU7A 3AHCA 4RK0A 5IC6A 3I3SR 4PZUA 3T7SA 2OGUA 5JFTA 2DUMA 3F7OA 3KZXA 3IQDB 4BGDA 1HV8A 5LQUA 4TSRA 2HPVA 3MCAA 2GTPA 2ERYA 2P3QA 2X0KA 4NJOA 4WFIA 3V2GA 5I7FA 4IIDA 2A94A 4R1SA 3ZGVA 2WUWE 4IO0A 4N5HX 4HH3C 4H6PA 3LYUA 4NULA 3QMPA 3ZWPA 4UTZA 1FFHA 4KDEA 1I32A 3HADA 5EIBC 2AFIE 3EUWA 4AO7A 3KSRA 2EL7A 2P9ZA 3ZXXA 2DR0A 2X8WA 3N2NA 4NZOA 3CGGA 3WDSA 4G37A 5EWJB 1C4OA 2VUIB 2GO1A 3HRIA 5K2MA 4NZZA 1V96A 1TQ8A 2JFXA 3AFNA 4OJNA 4II7A 4PU0A 3NRBA 4P7FA 2PVCA 4X7MA 5CH8A 1CTQA 1T0UA 5KNLA 3AYZB 2DFDA 1Q0LA 3L4JA 1RRCA 1XEAA 1IHDA 3AOEA 1GZ6A 2HADA 2PRSA 3JX9A 4RE5A 1ZXXA 4J4TA 4ALIA 3QU4A 2H2FA 2WD7A 3OLYA 5ELXA 4TYWA 1J1IA 1FFDA 1GKUB 1ZK1A 2VJLA 4V38A 1U2EA 1KYQA 1KI8A 1VPLA 4MVJM 4Z9FA 3KVVA 4ATNA 1EINA 1Z4PX 1GPBA 2WK1A 2XDYA 2J4DA 5TY0A 2FW7A 3OX3A 3NBUA 5DJ5A 1L4EA 5DWQA 2IZ7A 1TYBE 3HACA 1LRJA 1RAHA 2VPQA 5FL3A 5GWXA 1SN7A 3RR2A 4G3XA 5M34A 3T1YB 3H2GA 3RUIA 5F35A 2BONA 3OLWA 3AHIA 1WXDA 4C21A 4ZVPA 2Q6TA 1Z6XA 1O4WA 4FLFA 4TV9B 5FRDA 1YUMA 4YCJA 2KX7A 4DMLA 2RGDA 1MVNA 2QUJA 5J2UB 2V59A 2VK1A 3KSDO 4S2UA 5JTTA 4YVFA 1H4SA 2PT6A 5E6RA 1D07A 5JYBA 3CUTA 2AN1A 1Y3FE 3H5OA 3DMRA 1HOXA 1F20A 1IUPA 3TZBA 1BN6A 4Y98A 1G3QA 2CLLB 4FYKA 4FHFA 3F6RA 3ZVRA 2PQ2A 3ZHOA 4ID9A 4DLPA 3HZZA 2GXAA 3ZXYA 2O57A 3NRCA 1V8PA 4HPXB 3C5EA 4C0KA 3KFLA 5JAMA 4G0NA 5AKJA 5H5JA 4TROA 1JEQA 3WZMA 3S55A 4I0WB 2NMVA 3M81A 1T4CB 1U81A 1XZLA 2HSEA 4GL2A 2C2WA 2H1IA 2VDUE 3UWMA 5ADUS 4RTMA 3DSRA 1V2GA 1UQUA 2QMOA 1Y1TA 1XXHE 3RC9A 2HDNB 1GAQA 1WPRA 1GT6A 2YJTD 4LYAA 3SEFA 3RSFA 5AVTA 4I4IA 3RYFB 4ARVA 3EEOA 2LR0A 3PE3A 4IFBA 3KQYA 3HBAA 2XNSA 5TIIA 2FWRA 3AW9A 1WLSA 3DLPX 2XOKD 2VZ9A 5JD5A 1G20B 3EXIB 4LFCB 4FEGA 1YF3A 2JL1A 1HL7A 1WIWA 2FPXA 1QPGA 3KXKA 1SVLA 1VE6A 3ZWWA 1PVOA 4UVGA 2L82A 1FSSA 2A3NA 1EFAA 2RKOA 3GBSA 2NO4A 3W5SA 1GSOA 1EBBA 1SCDA 4NZYA 2J7PD 4YAFA 5D5HA 3TXAA 5IFLA 5BN1A 1K6IA 3UXHA 3WGTA 4DGQA 4F3NA 4XWWA 4P5DA 1CVRA 2DAPA 3ENKA 1P9LA 1C7ZA 1YQ9A 3JWPA 3K4HA 1CKEA 3PEVA 4TWIA 3OCUA 4AKIA 5ALIA 4LC9A 2BCGY 2WJHA 3ORQA 2OYCA 4B3BA 2QAGC 2QVZX 3AB8A 5FEUA 4PQYA 4ZALA 2RGXA 1NF3A 2VSNA 1QZZA 4YT5A 1OASA 2BF7A 4ZT6A 1RPNA 4RV5A 1PZMA 1U9YA 2XCIA 4OSOA 4UVDA 5HS4A 2PSSA 4KPYA 1XQ9A 1MX9A 1Z6ZA 2QRPA 5AXAA 2JCBA 4GOOD 4QLBA 4KFTA 3O3NB 1PS0A 3JRXA 1KZGB 3S2EA 4MP6A 1GFSA 4A8HA 3GG2A 4DLVA 1LV7A 3PFWO 3VU3A 3MINB 1BVHA 4QU8A 2BUAA 2R68A 1QR6A 1X92A 3SXPA 3EODA 5B3KA 3OEEA 1HLDA 4O4LA 1M34B 2B99A 2PKXA 3H7AA 2HI0A 3GFQA 4RHYA 1EFVA 3L1VA 2BGGA 4A8JC 3VTZA 4NAVA 4NG5A 4OGWA 1K3TA 2XVMA 2OCIA 3LKVA 2JJ1A 1IY0A 4ZCLA 5FOSA 3CCBA 5J1SB 1WF3A 1WXWA 5H82A 5BQFA 2WIKA 4IZHA 3SFZA 3DEAA 3ROEA 1B7GO 2WMDA 2P0EA 3Q9UA 3H9UA 4ZZIA 1J23A 1T6XA 2HJGA 5DU2A 5IM4A 2X15A 4Y0NA 5ALZA 4N8EA 1E9DA 3KTAA 1GAXA 3NEPX 1NLUA 5EZ5A 4ER6A 1T9GS 2Z04A 4REOA 3PXXA 1YDWA 4L5CA 1T9HA 3VZSA 2VXYA 3VDMA 4B4VA 5I4BA 3PC8C 1EBFA 1NVEA 3V1NA 4IQGA 3NBXX 1Y6RA 3LZDA 1PFVA 3F49S 1XR3A 2OCKA 3H84A 2ENWA 4Q05A 4ZK2A 1H65A 1XVAA 3LC1O 2OXRA 1R18A 2O48X 3PBKA 5DBFA 4FHCA 4QBKA 1E79D 2HRRA 1BAPA 4HGPA 4YT8A 3DLHA 2CLEB 4UBMA 3N59A 4E46A 2YHUA 1U1DA 2Q8QA 3O4RA 4Z4CA 5ECWA 4IDHA 5BSWA 2H7XA 4B4KA 2D0OB 5J4VA 2IKQA 2J6HA 1EGAA 3GZ4A 1U3DA 5EGNA 3R0VA 3W8FA 1JHXA 2QZPA 4HGRA 5E9AA 1NVKA 2ROQA 4H27A 4EFDA 1KWKA 2W0MA 1ULHA 3HYNA 3PU6A 2C4NA 4DSTA 3AH8A 4NFYA 3TRHA 3PT9A 1X87A 1OH7A 2Q3DA 1W48A 3KKEA 1CZNA 3D6HA 4YC7A 5KNCD 3TLJA 1F8XA 1H69A 2Q3EA 3IJEB 3FFXA 4N03A 5D3KA 3IA7A 4AU1A 4S05A 2OP1A 5EJ7A 3MWFA 4IKPA 4CMEC 3TYXA 3AJRA 3PEEA 2R2AA 2NTJA 1SEVA 4JFRA 1DRKA 1PX0A 3OWXA 4KUGA 4RM2A 4EW1A 3ZVLA 3C6XA 3FUCA 4GNRA 1DX9A 2BV3A 4ZDKA 3EVZA 2RHCA 2JFQA 1J99A 4CLOA 4U6SA 4UE6A 4DSNA 4RIFA 5JAOA 1EE9A 1G9XA 1MB2A 2GZAA 1XKXA 1QR2A 1T10A 2BUBA 2XDQB 3N74A 3U3ZA 3VO9A 3BCRA 1T0BA 3L43A 4N7JA 1EWQA 4G5GA 4B6FA 1J22A 4BP1A 2OFXA 4PRKA 5LZ4A 1BWRA 2IXTA 4HQFA 2Q5EA 2IZ6A 1UMBB 3CUYA 4K9OA 3JQGB 3WO1A 2J0QA 1TAUA 1M1ZA 2FQYA 3TBKA 3QP9A 4AWBA 2HLHA 2H2IA 1BGXT 4J2TA 1BO6A 1LI5A 4J1QA 4O2AB 3GFRA 3K5HA 1YVEI 2H29A 3REOA 1DP4A 5JAQA 2X76A 5AMXA 4BNIA 5BNTA 1BYIA 4ZVQA 4IWNA 4UU8A 1QHSA 4G1FA 3KVRA 4QJBA 1A7AA 1OSNA 2GJAA 2WSSA 5I7EA 3DDNA 1I3OA 3UB3A 5FIUA 3OO0A 1VHTA 1CUWA 1UJCA 4P54A 4EBFA 4LPKA 5ESWA 2VNAA 4QJ3A 4Y2PA 1G8GA 3FMIA 3B12A 1YQXA 4GW3A 1ZUNB 2ABWA 1H2ZA 1DUIA 3TM5A 2G0NA 4Z6KA 4MITA 3KKZA 4KO3S 2G80A 2H1LA 2RARA 3F5SA 3OU7A 2IEDA 4RMIA 4WOJA 3T41A 1E60A 1KXZA 3VKVA 1WP9A 1CWUA 3DBRB 3D1JA 2XWQA 2GZ2A 1MXFA 1DL5A 1ZJYA 1WU8A 2EX4A 4WBNB 2AXPA 1JJVA 5HW0A 3M89A 1CFZA 2JA1A 2QLJA 3CVJA 3G8BA 4KPGA 4MEJA 1JYFA 2OZLB 5ALJA 1E2LA 1SB9A 4M8NE 2Z95A 3TGWA 4TYPA 5C46F 4V2UA 2E2WA 4HWKA 3FYUC 4AD8A 3C8MA 1VPDA 2ZKIA 2CXPA 3B38A 4UZSA 5DGIA 4A8PA 5BR7A 3THWB 3FWHA 2VL7A 2OHJA 4DSZA 1AOXA 4JWKA 4H1WA 1LZLA 3Q9NA 5F1OA 3CBQA 5LYJB 1NSTA 2GEUA 1U1EA 3RK0A 3DLTA 1AU9A 1S9HA 1YQGA 1Z8FA 2MSDB 3G82C 3O4GA 3FLEA 4JL8A 4P80A 3ZY5A 5D3ZA 4P0PB 5GZ1A 4EKGA 3P2IA 2WU8A 4A6DA 1H2FA 3HUDA 4K9DA 4AX8A 3RBVA 3HJTA 5J59A 1FFWA 2GFHA 2VNJA 3FZEA 1PJAA 2J9RA 5EMJA 4O5AA 3MT0A 3KVYA 5FUBA 2ESRA 3EXG2 4YRCA 3B5JA 2LCIA 2OBLA 4KBYA 2ORIA 4L6CA 1P72A 2J1LA 3FWPA 4TV8B 3M6UA 1F8FA 2QN8A 4XVUA 2G9VA 1O54A 3GRVA 4G8BA 4B6JA 2J45A 521PA 1OLSB 4UUBA 3VSAA 2AUTA 2NU7A 4DDWA 3L0PA 3EUFA 1H5QA 2FDRA 3RTAA 3U80A 1GA4A 2BKEA 2ZE5A 1KZ1A 1DRJA 1TCUA 2JAPA 2SECE 3QE9Y 1D4OA 4X3PA 3R7AA 1UM9B 3Q2OA 5EKSA 2FU5C 4MW9A 1J8FA 3A28A 3ZZ1A 1DHTA 1GR1A 4X94A 1RRPA 3BWDD 4CIAA 3G8DA 3FAKA 4B45A 3LMKA 4HSGA 5JIBA 1ESZA 5CNJA 1XJWA 1DCKA 4R05A 4DREA 1QGZA 1WD5A 4Q4JA 5CXQA 3B7PA 3M1LA 3OZFA 2JK1A 4HP8A 2IH2A 4C78A 1Q21A 4PW0A 4OXYA 5JO0A 4L4XA 4K6MA 2IYAA 2VDOB 5EHIA 5F4BA 1FA9A 2QLBA 2NP6A 4ZAGA 4GFDA 5FOXA 3D81A 1ZZEA 1N9KA 1P2GA 1FSZA 2WWFA 3IJPA 3DV2A 2GD2A 3SYTA 2RONA 1AO3A 2ASEA 3RJTA 4FPXA 1A97A 2XPCA 5EE1A 3H2HA 4ZCRA 5BSGA 2BZ1A 2M6RA 2XCOA 4OHKA 4XIFA 5G0TA 4ESVA 4JHXA 2VHUA 1PD0A 1RFLA 3G3EA 3RHTA 3HBFA 5KTSA 5CX1B 2B5VA 3MM4A 5GONA 3ER8A 2GPAA 4DUYB 2FW0A 2TMYA 4P3KA 1CRWG 2D0DA 3BORA 1IY1A 3JQFC 5FWDA 1RWKA 4NBTA 3H83A 1IPHA 1P75A 3PHCA 3Q2KA 4D81A 1BH6A 1M2GA 3QFSA 1O9BA 1QFJA 2E82A 2X8JA 4YJ3F 2Y68A 2FMHA 4HUTA 5A4AA 4HNVA 1NDHA 3HCPA 1DIHA 1M1NB 2VJQA 3I04M 3ETLA 4LC0A 3DL0A 4D9IA 1QDUA 4MGKR 2Y77A 2DPXA 3DVAB 4NOMA 3WGHA 1XYGA 4EOGA 2J5BA 5BUQA 4H3KB 1MAHA 1EXDA 3FNEA 3Q6NA 5JVDA 1EWRA 3GQBB 2AQIA 4FMCF 2R6FA 2O5EA 1TXGA 3U7IA 1F0PA 1YB2A 4E94A 2YY5A 3PSAA 2Y1WA 3H1BA 2FI1A 5LDHA 1W88A 1ORVA 4OHBA 4YHBA 2A84A 2BD0A 2SKCA 3R76A 1KBOA 3S1AA 1OJLA 2QSYA 1J5PA 1OXKB 2HKIA 3LYHA 3SIRA 1R0CA 4OKNA 4U2FA 2EWVA 5JD6A 5LOVF 3HJFA 4FKZA 3DE4X 3ROFA 2FN3A 1SAYA 3WHLA 1QKKA 4ND8A 1ABBA 1NR1A 4A3SA 5GM1A 3I8XA 4TQ9A 1C50A 4B3MB 3B8EA 5ERYA 5DMXA 1TM4E 4PN3A 4EKEA 3W2FA 1VLHA 2NYVA 3MWJA 3ENQA 4KV9A 3TW8A 5JXGA 3QV2A 2R1VB 3M5PA 3DEFA 4Y2GA 5JQGB 1GA1A 2Q1YA 3GT4A 3OAAA 4PO8A 4BZWA 2YASA 1XRMA 3UJ8A 3I9V6 1PGNA 1QH0A 5EZYF 5ALNA 3DMYA 1J1UA 5CBPA 2CYBA 3C8UA 3DZHA 5EJMA 4Q7KA 5ED4A 2M6KA 2GJKA 2XYRA 1LVUA 5FI0B 3L8MA 2PN1A 3L5OA 1AXGA 4IHJB 4RF3A 3U1TA 3F3MA 5JWHA 4ZYVA 2HUNA 1L3BA 1M8JA 4H4CA 1Y9JA 5FWAA 3GZTB 3FNBA 3A4MA 1AGRA 4HB4A 1DAOA 2J6BA 2QTAA 3CWCA 3ZUGA 1MORA 4AJJA 5FOUA 1F3OA 5EMLA 2OQRA 1HEYA 3IHKA 4LK3A 4MTCA 1VE9A 2G40A 1NE7A 3EPRA 3WGGA 1RWBA 4WEQA 1U8YA 4BUCA 2IOQA 2WC1A 4UDXX 5BV8A 3WL6A 1DWPA 1E69A 3Q1KA 2CXUA 2CVQA 4GC9A 4EZIA 1ESMA 2HWYA 3E15A 4GMXA 3TN7A 3IE1A 4E2XA 3C97A 5ANRB 4WXMA 4P22A 4UE2A 1TU3A 1NZFA 1YCHA 2Z5GA 2IXGA 3D1LA 2ZREA 4NBUA 5IAEA 2PWAA 3LLMA 2E4VA 1BSVA 1ATZA 1M34A 3BWEA 1VMDA 2NU9A 1HEUA 4NBSA 4TL8A 4WCFB 4ARAA 2BFDA 3RU3A 4BP8A 5K6AA 4GR4A 3L7LA 1UFQA 5AK5A 3SZ3A 2FWAA 4P1ZA 2NYAA 3PPWA 3LA8A 1NUTA 4QDXA 4OXXA 5BRJA 2I5PO 1B23P 3E6AA 2IPAB 3RBZA 2DFVA 1KZ7B 2BKAA 1HC7A 3FNIA 2E87A 3FIJA 3M33A 2QTHA 3R23A 1ULSA 4TMXA 4RBNA 4H0NA 1LPMA 1ZVMA 1CJKC 1G0NA 3BRQA 3KLMX 3IIEA 4O2AA 3LVQE 3ESQA 4HRAA 1P74A 2YWHA 3HU3A 5HILA 1LPAB 1M2FA 3BFXA 1BDMA 5DM1A 4G1CA 1E2NA 3GFGA 4JGIA 4CM5A 4RTSA 1LDMA 4BO8A 4ZCMA 1TC1A 4ENPA 1F7UA 1SK8A 2Q0HA 1CQPA 3BG5A 1DFHA 1CNEA 2XUDA 3STTA 4NPCA 3AKDA 2BDEA 3UOWA 1B76A 4BE9A 3MHPA 1TW2A 4M0DA 5JECA 3BTUA 3D7MA 1DBQA 2GCOB 3DB2A 1E8DA 1G9SA 3DUFA 2G6TA 1TF5A 1C0PA 3M9WA 3MGKA 3TEMA 4D45A 4N41A 5EJFA 2Y66A 4CDGA 3RB8A 4DDKA 5I7AA 5TC4A 1PV4A 3AL2A 4AQYB 1QCZA 4HB3A 4Y2TA 4JLAA 3OIUA 5FWYB 4YMUA 4NBNA 3OTGA 1TKRA 3BKXA 1W75A 4G36A 1JFSA 1KY5A 3LO5A 3GGSA 4XR4A 4Q12A 4FR2A 2DB3A 2L0XA 2ZFUA 3S2UA 4H4EA 4DR2B 4ZJZA 1V1MA 3KQVA 2BLNA 1EKXA 3NALA 1MJFA 4FS3A 1OU0A 2XKBA 4E1BA 5IT5A 3U4MA 1ZCZA 2EC5A 1II8B 3LY8A 2H00A 1XKTA 2UV8A 3G1UA 3B48A 1MABA 4GX0A 5H0IA 4LCEA 2KMLA 1O94C 1E98A 4M1SA 2PY6A 4KB5A 3VGJA 2APJA 5BWBA 2MJLA 4GOLD 1ZC4A 3DZFA 4GSYA 2QYHA 2QUZA 2W8BA 4TWBA 5DTQA 5BPHA 2VOEA 2ZYUX 5GPBA 2AR9A 3ZDYB 1OPXA 3RVQA 1AZWA 1NLMA 4IJQA 2AJLI 3ZJ5A 1JPNA 3DM5A 4HN4B 1CS0B 4RQUA 1IQ0A 1B8PA 3BXEA 5CB0A 3P2KA 1VJGA 3H5TA 1KGSA 1RFGE 4JB8A 3ZCTA 2WSBA 4D0NA 3ESXA 3IXLA 1IVNA 1ISJA 1FDTA 3G2LA 4DIUA 3TQOA 1QV9A 2FP3A 4X97A 1A9QA 3KOZA 2VEDA 2X86A 4R0VA 4C5BA 1LNSA 5AJTA 1OLUA 2Q27A 3QPBA 4RPLA 1VKHA 4M49A 5IJ9A 3LQFA 3AY0A 1C8BA 3CRMA 1BCRB 4RX1A 1GV1A 4QDJA 3LP6A 1A76A 4RYDA 4N4AA 1AA6A 3MCTA 2QGFA 5CGQB 4F71A 2JJ2A 4E30A 1H8ED 1GCAA 4TMVA 1R15A 3Q7PA 3DEKA 5THKA 4HXEB 5IHXA 4O3MA 5TNXA 1HNNA 1LI7A 1WXQA 1JS1X 1MGPA 1VSBA 1T9CA 2AK2A 3EOAI 1VBKA 4FHDA 4RJIA 2A2ZA 4UBJA 1TUGA 1DC5A 1ZHFA 4TN5A 2XTMA 1J97A 5T3YA 1EESA 3BL6A 4M9SA 5FCDA 4MQ6A 4Q9DA 1R5NA 3RKRA 1Z6PA 2A8YA 2OZLA 1AZTA 2GVDC 4KFRA 3UMCA 4XWOA 1RQNA 2IIPA 3U5ZB 3HKCA 1M34E 4FYPA 4DV2B 4PPYA 2J5KA 4OBBA 4I55F 1NHWA 3T3EA 4M2LA 1MBZA 2LUOA 3L01A 1U28C 3OHPA 2G72A 4MUAA 4O63O 4EHFA 4YAUA 1NAIA 1ILEA 3HXKA 2O3UA 5B1EA 1L5OA 3KXDA 4XLLA 2J09A 4LY6A 5ES3A 4HNAB 4I8XA 3SS9X 2VHEA 1P4GA 1RWXA 5BWMA 1H4QA 3ROQA 4Y67A 5CMLA 1ZMOA 1XUOA 4CKXA 3TJZA 1I3MA 1O8BA 3IC5A 2V1XA 2O0MA 4H35A 2VTEA 3IELA 1E0DA 1P9WA 1UIMA 4WXRA 4MVJP 5CLQA 5JDCC