1N6IA

Crystal structure of human rab5a a30p mutant complex with gdp
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
167
structure length
167
Chain Sequence
GNKICQFKLVLLGESPVGKSSLVLRFVKGQFHEFQESTIGAAFLTQTVCLDDTTVKFEIWDTAGQERYHSLAPMYYRGAQAAIVVYDITNEESFARAKNWVKELQRQASPNIVIALSGNKADLANKRAVDFQEAQSYADDNSLLFMETSAKTSMNVNEIFMAIAKKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title High Resolution Crystal Structures of Human Rab5a and Five Mutants with Substitutions in the Catalytically Important Phosphate-Binding Loop
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein transport
molecule keywords Ras-related protein Rab-5A
total genus 58
structure length 167
sequence length 167
ec nomenclature
pdb deposition date 2002-11-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1n6iA00
2ZRMA 4EKDA 1TU4A 1ZBDA 2EFDB 3VR6A 1G41A 2AN9A 2MMGA 1JAIA 4IEIA 1TX4B 2GZDA 4HUQA 1MABA 4IVRA 4O2LA 4Q5IA 4O3MA 4CEIB 1L7VC 2HJGA 4KFUA 4A8JA 4QFMA 3HDTA 4ACBA 3CR8A 3NBZC 4AKEA 2R6GA 5AUPB 2WPDD 1NVVQ 1Z2AA 1X1SA 4TYYA 2RH5A 3C41J 1JEDA 4JLDA 4ESVA 4LYFA 1WF3A 1Q12A 1G8FA 4A1FA 3IEUA 2V55B 4QKQA 1XD8A 2VHJA 4ZCMA 2JJ2A 5CB6A 1XB2A 4HLQB 3TW8B 1C9KA 4G01B 2P5TB 4M22A 5D3QA 2A5FA 2IW3A 3D8BA 4M9SA 4WA7A 4N3NA 3TQCA 3EZ2A 4D81A 3I5XA 1SKYB 1E69A 5P21A 2WWGA 3SBDA 1Z63A 2QI9C 5FR2A 1CTQA 1Z3IX 4CEHB 2Z4RA 3MLEA 1NKSA 1S3SA 4M1MA 3B9QA 1KDPA 4PC7A 3GFOA 3KQHA 3K09C 5FOTA 5J40A 2PEYA 3U7HB 3KX2A 4HZUA 2H17A 2JATA 1VCNA 3TIFA 5FUYA 5G41A 1COWA 1SQ5A 5EP1A 4KI0A 2DYKA 1Q3HA 2CL6X 2KSQA 1ZM3A 4TT3D 4TZ6A 3PUVA 5KNCA 2NO0A 4QJ5A 1YR6A 3R7WB 3VX4A 3QI2A 1CIPA 1XJCA 2BBOA 2G88A 4MKIA 4Z8XA 2HLDA 2OAP1 5E7MA 2WOJA 3GEHA 4I4LA 5GJWC 5GJCA 1DPFA 4TQAA 2NPFA 4O2RA 2QT0A 1Z08A 1GKIA 4AI6A 4Q03A 2RGCA 4B75A 1Z0DA 4JLBA 1DARA 4QNMA 3QG1A 5D3MB 4HDQB 1UBFA 2XSZA 1E96A 1XCPA 2D2FA 2PJRA 4WBSA 1F2UB 3QY0A 1GITA 1ZM2A 1LW7A 3LA6A 3LD9A 3Q85A 1AIPA 4Q66C 4DUGD 1Y63A 3UKDA 3EZ9A 1E99A 2QQ0A 3OESA 3RS4A 1NJGA 2W6ID 4B35A 4RFVA 3AB3A 2A5YB 1G5RA 3AF2A 5F3WB 4I1VA 5KTYA 4TL6A 4BZQA 1U2RA 5H68A 1LY1A 2EFGA 2KE5A 1E2FA 2W6JD 4GNKA 2BKEA 1NBMA 2BV3A 2Q9CA 3BK7A 2CL0X 3PR1A 2DWQA 2YJTD 2XAUA 1FUUA 3OEED 2WICA 4QOSA 4YMWA 2IF0A 1KSGA 2CBZA 4RSGA 2ZU0C 3S1AB 1XCGB 2O52A 1EGAA 5C46F 1VG9B 1JXOA 2FZLA 4LJ8A 2OLJA 4XVUA 3LBIA 5KHOC 3QKSA 5KSOA 2F9LA 1XD2A 3KJIA 3BB1A 1BO6A 2G9NA 4D0GA 4JMPA 3T61A 2AXPA 1J2JA 1D8TA 3DHWC 1P2UA 4MUBA 4A8JB 1SXJE 3QE0A 4RD3A 2NO1A 4ZIRB 4MDEA 2BKUA 1KDOA 1XEWX 3HU1A 4TYWA 1E9DA 2PLRA 4C7OB 3FHTA 2ZETA 1RPZA 2NTYC 3UANA 5JI3E 4QGGA 2ASEA 2QEQA 1ZM7A 4BLRA 1R0ZA 2R6CA 4NDZA 4V0ME 1IXRC 3CZPA 4IW3B 4PPQA 4B48A 2XGJA 2J0SA 1R10A 3HR7A 2RHMA 1MV5A 1LF0A 3JVVA 3R9WA 4GSYA 3ZD7A 3QKSB 4MA4A 4MRVA 1QHNA 3LVRE 3KTAB 4OJQA 4ZI3A 2YWGA 2JAQA 5FUVA 3PEVA 2E1RA 1OPXA 2WSSD 1W48A 1IY0A 2DBYA 4RD6A 2ZANA 1NRJB 3DDCA 1NBME 4DLWA 4GP7A 3N2EA 4I99A 3SJCA 5ANRB 4LJ6A 5IK2D 4XTRA 1E9FA 2YC2C 4G3XA 2GAAA 4PO9A 3TAUA 5LD2B 2F1IA 1KO7A 2ZS7A 3RLFA 5C2JB 3L8ZA 1ZRHA 1II8A 1ZC4A 4XJXA 3PJRA 4P4UA 1F5NA 3B7GA 4KFRA 2XZOA 4IDNA 5FTKA 4B33A 4LJ7A 1OB2A 2CCJA 2WWWA 4GOKA 4B43A 4DDTA 5J4YA 5G3YA 3RS2A 3I8SA 4KFTA 3AGQA 1CJTC 3N5CA 121PA 2KBFA 5CIWA 4DCTA 1ZD1A 4JLMA 4TN1A 1L2TA 2QRZA 5GJBA 3A4MA 1KAOA 2J0UA 2OCYC 5B2ZA 1G20E 4W9MC 2OEPA 3HR8A 4UNNA 4AWXA 2WMNB 3WYFA 3EZ7A 1GM5A 1VIAA 4KV9A 4C4PA 4Q4AA 1U8ZA 1S96A 5TDHA 4HLUC 4LBVA 4LV8B 3EASA 3LLUA 4WIAA 1SVOA 4MITA 2ONJA 1SZPA 2GCNA 3PEYA 4FMDB 3BFXA 4PHFA 3UATA 1YZTA 3QENA 2QRNA 4R98A 2JDID 2H18A 2ERXA 2GVZC 1U0HC 1J7KA 2AK3A 1Y3AA 2ZUDA 1CF4A 2YNMA 2ZE6A 2JJ1D 1VG1A 4LHZA 1W5TA 4M1TA 1KI2A 1CU1A 4LRWA 3LX8A 3T1QA 2QENA 1G7CA 4DDVA 2BMFA 4DIDA 1N5IA 1U8AA 1MOZA 1O87A 2AR7A 4TLEA 5DLQC 2O8BA 2VEDA 1CJUC 2HYIC 1RIFA 3ZIAA 1TTTA 4TL8A 2YWEA 1QHYA 3NDPA 4X8MA 3U4QA 3A1SA 3T06B 1T3HA 3LV8A 2VL7A 2D62A 2O8CA 2X77A 1ONBA 3WP1B 2IUUA 4NKRA 4LUCA 2EQBA 1S9HA 1I2MA 1VKJA 4MRSA 1L4YA 2UZIR 1BKDR 2MSDB 1M74A 5EE0A 1VYVA 4N0DA 3RRMA 1VIYA 1GZSA 3LWNA 2FSGA 2GWHA 3C15C 4C9BA 4A2PA 1RW4A 4BRUA 1RRPA 1OSNA 3W90A 3GLIE 4A0RA 1RYFA 2ZRFA 2ZREA 3JZAA 5E4FA 5EZ6B 1MO4A 3ADDA 5AR1A 1TF7A 1YR9A 2RKOA 4XSHA 1GWNA 3KQKA 4BLQA 4MYUA 2CHQA 5JEDA 1EESA 1XJ0A 4CEIA 3PCRB 1PLLA 4XD7A 2OLKA 2DY1A 2QSYA 4I81A 2V4ZA 1IY2A 4EFMA 2J45A 2VHTA 1KJWA 1VG0B 4O25A 4PPFA 5FH9A 1VCMA 4P33A 3IBYA 2JLZA 3QKRA 2ZRPA 1KZ7B 4PC2A 4TT3A 5DI3B 1VHLA 2B8TA 3DM5A 1GVNB 3AKYA 4V02A 5JCZA 5JFGA 2ZSFA 2BVNA 3FDIA 1R8QA 4A82A 2QMOA 4DZZA 3OIYA 2O0JA 2GJSA 1YZKA 4G1UC 1ZCAA 3LRPA 3ZYCA 2C96A 3GLGE 1F48A 4HB0A 5F9HA 1JB1A 1G7TA 4G5SA 1K5DA 4NCIA 3VKWA 4DLSA 5FOXA 2IYZA 3BORA 5BWMA 1JI0A 3CX7A 2YOHA 4RCZA 3Q3JB 2IT1A 1U90A 1QVAA 1FX0A 2GESA 2ZRNA 3MGCA 2EFHB 2EW1A 3PUXA 621PA 3M4YA 1HH4A 3ND9A 1E2EA 2J7PD 4YONB 3NIBA 2J59A 1IXSB 2FSHA 1FP6A 4E5UA 2Z0MA 5C18A 4OQNA 1Q22A 2DFTA 5DH9A 3B82A 4URUR 1WRBA 1KY3A 4EQ6A 4JLJA 1XX6A 3NHBA 4CT5A 3AKCA 4BFUA 3WYAA 4UJ3A 4A92A 4BE7B 4E07A 4D82A 1EFRD 1G7SA 2FWRA 3GJ7A 4A9AA 4FMCF 4GFDA 1RKBA 1J8MF 5HCIA 1DAKA 3RS5A 1FW6A 4JSTA 2IYWA 4ZCIA 4G5QA 3RS7A 3SNHA 2W2VA 4MYCA 4ZCLA 4Q02A 2BIFA 4NYIQ 2W0SA 3GQBA 1E1QD 5FPHA 1G18A 2FZ4A 4KVAA 2MSCB 4DLZA 4OYHA 4PFSA 2WJGA 4XH9B 4TLCA 5TY0A 2NO6A 3EPHA 3W3AA 1KSJA 1OXSC 2H16A 4JLOA 5DI9A 2EFEB 3ADKA 4YDHB 3GMTA 3DEFA 3QKTA 3AQ4A 4LCBA 4K46A 4F92B 4JVSB 4C0SA 1CP2A 2GXUA 4H1VA 4V0OA 5HR5A 1S1MA 4R7ZA 2HCBA 1RRGA 2QPTA 4DRZA 1ESMA 2PBRA 3BBPA 3F0TA 1MRNA 1OFHA 3JVUA 1J8YF 2IYTA 1U9IA 1XMJA 3IIKA 1JALA 3L2OB 1RFLA 5G3ZA 3TUIC 4LHWA 3ZDQA 3MSXA 1P5ZB 3U44A 3ZGXA 4PANA 2W6IA 1U8YA 4A2QA 3FB4A 4V03A 2JIZA 4KBGA 4LYHA 3V9PA 4DB2A 2D7DA 2C98A 5EE5B 1W2HA 1VYUA 4GPTA 1UFQA 4JBWA 2IYSA 3NHAA 4B34A 1FMLA 4EFNA 1Z2CA 5CM8B 3QKRB 4D0LB 3SR0A 1OIVA 4JL6A 1E4YA 5JSZB 1F60A 1KGDA 2GRJA 2WKQA 3K0CA 1DE0A 2G3YA 2VQSA 2ZSAA 4R2HA 4ACAA 2WAXA 4QXAA 3U2QA 1KO4A 2ZRKA 3IO3A 5FOUA 1Q57A 3T35A 1VTKA 5HE8A 4BRWA 4POAA 1EX7A 3BERA 2PMDA 3LY5A 4GI7A 4O0MA 3K1JA 5BN4A 2Z6VA 1P9NA 3BB3A 5AJVB 3K9LA 1Z06A 2C99A 1HQYE 4M21A 1T4GA 5EP4A 4BEJA 2BWJA 3QXXA 1PJRA 2PX3A 3W5IA 1OFUX 2WJIA 1E9SA 4LV6A 4PHTA 4D4JA 1M34E 1YZQA 4KSBA 4FWIB 4BFYA 5A4JA 1JJ7A 4EUNA 2RGGA 1KI7A 5JSZA 4OQLA 2CLDX 3BH6A 1OXVA 1E2GA 4HEJA 3AVTA 1E1RD 5FUWA 1VG8A 4IDQA 4TLAA 3UMFA 1IN6A 3ZH9B 5AWFC 1U94A 2JLUA 2AXNA 2LKCA 4Q4LA 4PAMA 4BQSA 2XOKD 5L3SA 1W36B 2IYQA 2P6NA 2FGJA 2JCSA 2IEZA 2YWHA 2IS4A 2QAGB 4C0BA 1DOAA 1FFHA 3CO5A 4LI0A 4URYR 1Z47A 3CRMA 3BH7A 1D2MA 1YJ5A 3NBXX 5FL7D 4DLUA 4ZI2A 1S9DA 3DVLA 2FNAA 2BMEA 1Z0AA 1XBTA 3PUZA 2RB4A 3RS3A 3B1XA 4JLNA 3C16C 4PZLA 1Z83A 4PSAA 2ZM5A 4IXNA 2TMKA 1XD9A 1N6HA 2A2ZA 5TXGA 2IYYA 3SJAA 1PV4A 1R6BX 4HDOB 4N0EA 2HT1A 1ZNXA 1SHZA 1KK2A 3EPJA 3MWYW 1GL9B 3TKLA 1QF9A 1T0JB 2ZAOA 5DGXA 4IXMA 2ATXA 5FPSA 2VA8A 3GJXC 1DVRA 5EJEA 4Q4AB 2YWFA 3ICQB 4TSFA 1DO2A 2IX3A 5TVKA 2SHKA 2GZHA 4TMZA 5JLJA 2O8CB 2QQEA 1GNRA 721PA 1Z0KA 2CEAA 4US2R 4C0LA 4CZ2A 2ZRLA 2B92A 2PZGA 1OKKD 4BZXA 4F7WA 3RS0A 3A36A 3NWJA 4E09A 4Z1MA 5FI0B 5JWOA 1XTJA 2XJ9A 3CONA 3QVVA 2MMCA 2WOOA 4EQ6B 1WXQA 3RDPA 3CWZA 1TNDA 5DISB 3IPYA 3KXLA 3K0CC 2ZIAA 4DC9A 5M04A 2G83A 1WA5A 4QNRA 2OFWA 1E4VA 5FPTA 2J3EA 1E94E 4DDUA 5HE9A 1EWQA 2WBLC 3CIOA 1NP6A 2QUZA 1N6LA 4KLNA 1N3BA 2HV8A 2JDIA 2N42A 3EAQA 3PFIA 4RKEA 5DHAA 5GADl 1FX0B 1KMQA 3D7MA 2R2AA 4NPHA 3ZJYA 2O8FA 1ETUA 1QHHB 4ARZA 4HB4A 1HEIA 2PL3A 2WJVA 1KY2A 3OE7A 1G8YA 4JBYA 1UAAA 1SVMA 3VU9A 1NLFA 5HZKA 5CLQA 1N6OA 3E5HA 3LXXA 4CEJA 4WZAE 2AL7A 3KKQA 1QHSA 2OV2A 4IOLA 4D4LA 8OHMA 2REXB 2ZRJA 1SXJB 1R0XA 1Z0IA 4G5RA 2VPPA 5EE3A 1NY6A 4FXPA 4R2IA 1K6MA 2QN6A 3R8CA 3L8YA 4B3FX 1UDWA 4EPXA 4BLSA 4ITRC 2WPDA 2RGNC 3RSOA 1XPRA 3QEOA 5FBLB 3PG5A 2QY9A 4QBIA 1U0JA 2J0UB 2NIPA 5JRJA 2CXXA 1KAGA 4S35A 2GJ8A 2V8OA 3KZ1E 1QG4A 1W44A 4PC3A 4W5JA 5E7IA 1T8UA 1M8PA 4JSYA 3REFA 1VCOA 4YXWD 3NC1C 1QVRA 3TAHA 1K5GA 1M6NA 2FOLA 1N0UA 2GKSA 1R5OA 1KIMA 5EE1A 1GTVA 1IY1A 1FTSA 3EIEA 4OI2A 4J0QA 2NGRA 4QGHA 2OCBA 3H2YA 2F1HA 1G64A 2FF7A 1DO0A 4KBFA 3TUJC 3DOFA 4LSGA 3LO5A 1IHUA 4JJZA 4JLPA 3H86A 4GDFA 3X1WA 3U6KA 1E1QA 2HF9A 4LHYA 2RGNA 1P9WA 4ILEA 5EUQB 3PQCA 3PUYA 1OFIA 2D74A 3A37A 1UADA 4OHYA 2O8DA 2ZRGA 2FPLA 3AF3A 4AY2A 2EWVA 3K70D 4FCWA 1N0VC 4P4SA 3UWOA 5LDDC 4FMDF 4QL3A 5EXTA 4LBZA 4DCVA 1DAMA 4JS0A 4JVMA 1VHTA 1TUEA 1DAEA 4DEXA 3SE0A 1AJEA 4JL5A 1G9XA 5FOVA 2XSZD 5J5CA 1UDXA 4QHYA 3LW8A 5J4LA 5KSZA 3CNLA 1G3MA 2C04A 1AN0A 5B58C 4DLVA 1WBDA 3ASZA 4H1UA 5BN3A 1G8GA 2ORIA 1GILA 1YZGA 1D2NA 2VH5R 4TL9A 1L8QA 3TRFA 1X8LA 3R7WA 1N6KA 4B2IA 3DZDA 4B3XA 3LX5A 1EFRA 3V4RA 2ZYVX 1G17A 4MUAA 2YVUA 4NL4H 3UMRA 2ZRDA 4LY6A 3TSZA 4EIWA 1JEEA 1U99A 3IIMA 1UKYA 1ZJ6A 2W6JA 4DWJA 2C2HA 2REBA 2EYQA 4QBFA 5AJXA 3SI7A 2PZEA 2RAPA 4IFBA 2BMJA 1NSTA 1QHXA 2GVDC 2ODWA 1F2UA 1M2OB 2CE7A 2GXSA 3P32A 4F4JA 3NEJA 1XWIA 4UNPA 2XXAB 2KBEA 4M1WA 1II9A 5DIFA 4C2UA 2UKDA 2CJWA 1LFDB 1AM4D 4PPNA 4C30A 4DLXA 3FMIA 4DT1A 2XZLA 1E2HA 2VP0A 2IYXA 1ZNYA 5DN6A 1IN4A 1AQUA 3SYNA 1NJFA 1KSFX 4LPKA 2ZJBA 1A2KC 2J41A 4XOIA 2ZSDA 2VP9A 3A1WA 3GLHA 2PMKA 3PIRA 5L3RA 3K0EA 3T34A 2GJ9A 1JAHA 4YMTA 2HUPA 4DLRA 2F6RA 4RD4A 2CCKA 2OSBA 1RJ9A 3JZMA 4Q00A 5JHHB 1GRQA 2QORA 5LB2A 5J4VA 2Y8EA 1W47A 4FIDA 1LV7A 2WWFA 4MGYR 5KDLA 4P0TA 4OQFA 3SJZA 1DELA 1R4AA 2ECKA 4U00A 2VSXA 1CR1A 4AYWA 1XCMA 2ODNA 1W0JA 4L9SA 1PUIA 4II7A 5FBRB 1X6VA 2GK7A 1I4TD 1XMIA 1XTKA 5GJVC 3K9GA 4WVFA 1ZINA 1ZM4A 4BLTA 1W1WA 1FTNA 4Q21A 3IPXA 4EFLA 4JLKA 2Q9AA 5BQ5A 3I3SR 4MRPA 1A4RA 1IN5A 2OCPA 3OHMA 1MO6A 1KO5A 3SHWA 3W5JA 4DDWA 2OXRA 4HAYA 3Q7QA 1B0UA 4QBHA 2WJJA 5CK4A 2J0QA 4BFVA 3OEHA 5SZKB 1MKYA 1XDBA 1IN7A 2QGZA 2WWXA 1G1MA 4HAVA 3AH8A 3K53A 1JQJC 2HYDA 5FTLA 4L16A 3ZZ0A 1XMVA 3OFND 2FPMA 2Q0HA 2JLSA 2R6DA 3ZZUA 4AD8A 3J81k 5FBVB 3WRYC 3CBQA 1AQYA 3E2IA 1QDEA 5AJZA 2YINC 2P3SA 3OIVA 4LYAA 2IK8A 4QC2A 1CR2A 1YE8A 1W4AA 1G3UA 4XSGA 3SYKA 2ZR7A 4URXR 1II0A 3QPWA 2D2EA 2IF2A 4MH0R 3KQUA 4ERNA 1MRSA 4XVRA 2ZRCA 1NVXQ 3CH5A 2FGKA 2V1XA 3R9XA 4PQFA 4ZO4A 4UNRA 5JBQA 3GLFB 2C9CA 4EPYA 5FTNA 2GXAA 2VRWA 2I4IA 3RABA 5JJIA 5FUXA 1J70A 2HXYA 1TPZA 1OHHD 2BM1A 1IJEA 1KI6A 4R71A 1IN8A 2ZJYA 3RRNA 3VHXA 2ZRHA 4DEYA 3I72A 4PHHA 2CK3D 1RYHA 2GETA 3TSWA 2ZROA 3L0SA 1KYIA 1T91A 2B8WA 3U5ZB 1OH5A 2H92A 5CJPA 2H7VA 1RC8A 2GZAA 4QHSA 2GEUA 4V0KA 4IOJA 4UXJA 5EXSA 4PC1A 5FPYA 5IHPA 3EWSA 2BCGY 2J87A 5CB8A 3P20A 1FPMA 1T6NA 4E22A 4LX0A 1RVDA 4DCNA 1D9XA 1YR7A 2X1VA 4HDCA 4LV5B 4TTQA 5J4HA 1CKEA 1Z6GA 2AKAB 4PZZA 2IEYA 3GJ4A 4HI0E 3CRQA 1CRPA 1SGWA 2QNRA 4FMCB 2QROA 1LVGA 3FTQA 2ZJOA 3O8RA 2A5GA 1NMYA 3WNDA 1ZD9A 4TZ0A 1E2MA 3RWMB 3SYLA 4NYMR 1VCIA 2H8KA 2A5JA 3M0EA 1FNMA 3REGA 2X2EA 1A82A 1E9EA 1SXJD 1ZD8A 3CUEF 3VR2A 2CMKA 2GEVA 3VR4A 4OK5A 1Q3TA 4K81B 3KB2A 2DCUA 3SFVA 4TLDA 4DIEA 4GL2A 4Q9KA 1DEKA 2XJ4A 1ZMXA 2QMHA 2X19A 2XTZA 5FL3A 2FU5C 3LXRA 2VTKA 2AK2A 2X8AA 4BZPA 1BS1A 3OE7D 4NMMA 4M9ZA 1G21E 1KK3A 5JHGB 2IS2A 1CJMA 2QU8A 4G0NA 2J9RA 2WKPA 2V6JA 3CLVA 4ASUD 4XD7D 4AKHA 2IYLD 4LK2A 3NC0C 3DMDA 3THYA 1HE1C 1CXZA 1BYIA 4RD1A 1HTWA 3TUZC 1VMAA 2ORWA 4DHEA 1T5IA 1YQTA 4P32A 4B44A 4QM7A 2QTFA 4NP6A 3GFTA 4ZV4A 1BMFD 3EXAA 1M7BA 1I4LD 4Q4JB 3G0HA 4NCNA 5IRCD 2N1BA 1NIPA 2C77A 4GOJA 5K8LA 2C9YA 5CM9C 4IDHA 2R62A 1QG2A 4NCKA 1P7CA 5HZHA 2ZVPX 5AJWA 2FA9A 2QAGA 4W5HA 3SQXA 1Q44A 3SQWA 5C4GB 4DUGA 2FG5A 2JJ8A 3KQLA 1P2SA 4QGFA 1E2KA 3FMPB 1EWRA 1G8PA 1SVLA 4D25A 3QPUA 3PEUA 1FQKA 1LNZA 5JCPA 1JR6A 4LJ9A 3RRZA 2JASA 2RGBA 1E6CA 2XZPA 3QBVA 1XNJA 5HKKA 1N25A 4CT4B 2Q3HA 4Q4HB 5SZIA 3QF7A 5JS8A 2JLQA 2Z5FA 2JLXA 1GOTA 1WE2A 3QEJA 4FWTA 2AWOA 1P2VA 1S4QA 5G53C 3TK1A 1ZU5A 2AKYA 5FBWB 3BRWD 2R6FA 1KMHB 3GEEA 2OXCA 3OEEA 4XTCS 2IWHA 3LBHA 1CS4C 3MRSA 4CW7A 2V54A 3AVPA 2D3WA 1NIJA 3L82B 1TF2A 4PSVA 3EWAA 3H1TA 2J1LA 1OH8A 5L8VA 1XEWY 3BIFA 5A0FA 4CIDA 1N2CE 4DJTA 2BBWA 1YZLA 2RGDA 1SVKA 4Q9HA 5EXPA 3SBEA 4ON9A 1IBRA 3QUSA 1XZPA 1MABB 1F6BA 2H57A 1GFIA 3ASYA 1ZNZA 3QXJA 4B2LA 3IDQA 3THOA 2J5XA 1NY5A 5TARA 3WP0A 3D6TB 1UKVY 4GMXA 3W6OA 4IKEA 3HP1A 4US1R 3NBYC 4B47A 2GAOA 1EK0A 3EW9A 2AD5A 1AK2A 2QBYA 4ZDIA 3ZVMA 4V0LA 1EFUA 4LOAA 2IS1A 4X8HA 3BE4A 4NH0A 4KYUA 3HU3A 4A6XA 4A36A 3VQTA 1YVDA 1TQ4A 4IOMA 2OESA 5KSYA 4QRHA 3CF0A 1TQ2A 1US8B 2OHFA 2GA8A 1XP8A 4HUTA 5EE9A 2OE2A 5L3QB 3AP1A 1DAHA 5KOYA 1P73A 1AZTA 1KI4A 5CDFE 3ADCA 3ONWA 4XIGS 4XWAA 2YC4C 3PEWA 1VYTA 2WJYA 2OBNA 4Q7JB 2NQ2C 3ZS8A 3AKEA 4CYMA 5SZJA 1Z6YA 2ZQ5A 1UF9A 5J47A 4IDOA 5G40A 1FMJA 2BJWA 1YU9A 1WQ1R 1GP2A 1H8ED 1E9AA 4M1YA 3WNCA 4YC7A 1SVWA 3IILA 4HATA 4Z51A 1KI3A 4N1AA 4RZXA 4B6FA 2IHYA 4IVQA 1AA9A 2NOAA 4DXAA 2WTUA 3I32A 1LS1A 3MWLA 5GVRA 3Q9LA 4FCTA 5H8WA 4F91B 4JLAA 5EXXA 3VX3A 3KFXA 1Q1BA 2E87A 3U4QB 2ZJAA 4P3YA 4BFTA 2ODBA 2AHOA 4FD2A 2XTMA 4M0LA 2F3TA 1X8JA 4OK3A 2AWNA 4TMVA 3SN6A 3RAPR 1BOFA 3WMGA 3FKQA 3HYRA 1Z5ZA 2CNWA 1KK0A 4GZMA 2IUSA 1DG3A 2A78A 3TBKA 3A4LA 1G8HA 1Z0FA 5FL7A 1G4AE 421PA 2JJ1A 4DBLC 3RC8A 3K0AA 4Q9IA 2QSZA 2RGAA 4QHTA 1G16A 2CCGA 3MJRA 4TMWA 4A0GA 1XPUA 1T5LA 5L3VA 4OHVA 1N5JA 1SVSA 2H1LA 3AGPA 4R9UC 1P61B 5FOWA 2CK3A 1N6PA 4IHQA 3VNVA 3OZXA 4URWR 3HWSA 5E7JA 2XTNA 4HSEA 1DTSA 2I1VB 3W3ZB 4MYTA 1D2EA 4L5BA 2NMVA 1ZU4A 2PLFA 1XF9A 4OQXA 3TVTA 3SOPA 2WWIA 1XRJA 3ZS9A 4MKGA 1Z6XA 1JPJA 4RJLA 1TQ6A 2MSEB 2FMXA 2B7CA 3FHCB 2JLYA 4IJMA 2JLRA 1A2BA 4A8JC 3SC3A 1IXZA 2GK6A 3CRW1 3MG9A 3KXKA 4P4SB 3U3JA 2FV8A 3A8TA 2PCJA 2QM7A 2IUTA 1E32A 1W2GA 4GRAA 5CYPA 1XTIA 4AYXA 3C14C 2XB2A 4A0FA 3B60A 4OK6A 5JJKA 4NE2A 1KJZA 1AKYA 2A30A 3H84A 1MH1A 1AS3A 1UJ2A 3IQXA 2ANCA 3QNUA 4QGAA 4C0AC 3GFPA 1ANKA 2WWHA 5KNDA 5KYKA 2GNOA 3Q5EA 1N6IA 4WW0A 4ASUA 4TYQA 3IEVA 1TUIA 1XXHB 1AS0A 2A7QA 1B23P 4PPGA 4NCJA 1KI1A 1WP9A 2W58A 1Z0JA 3M1IA 4AG5A 5J4KA 3GJ3A 2WM9B 4Q7KA 4KJZA 1X3SA 3GP8A 2PJZA 4IFEA 3WRXC 4DT1B 1U9IC 3A1UA 2BBSA 3HPQA 1XTQA 4U02A 4Q1AA 5A5GA 3R8FA 3HYTA 2IXFA 3T1OA 4PAOA 2ZJZA 2OUKA 1E2JA 4PC6A 3CPHA 3VKHA 2R8RA 4LWZA 5JEEA 4AC9A 1E79A 4QM6A 4LHXA 1R5BA 1U98A 5AUQA 2CVHA 3OF5A 2CDNA 2GCPA 3QOFA 1SXJA 2VBCA 2O8EB 3VNUA 3TGPA 4KVGA 3KTAA 3NKVA 3G5UA 3FPAA 5KDOA 4G5GA 3W8RA 1EG7A 2EU8A 3P4YA 2VP2A 4M9XA 3BB4A 1NN1A 1CBUA 2DWOA 4QBGB 4TMXA 4PQRA 2D7CA 3AF1A 4JIMA 1ESNA 2QG6A 2NZ8A 4NHOA 4B6EA 2NO7A 1YKSA 2R6AA 4NYJR 2XNDD 3ETLA 2IWRA 2HEIA 3H4MA 4CEHA 3ICEA 4YXWA 3KJGA 1P3JA 2QPOA 3O8BA 4DLTA 1XZQA 3WMFA 5HPYB 4D4KA 3AP3A 4PXAA 1G19A 2JGNA 1COWD 1FNNA 3W6NA 1HE8B 2OFOA 3KQNA 3ZQ6A 1CR0A 5EP3A 5KUTA 2OZEA 4NONA 1SULA 1BMFA 2C5LA 2R44A 2JLVA 3BWDD 3QKUA 4HYYA 3RHFA 3T1TA 3IIJA 4JL8A 4YLGA 2BBTA 4UNQA 4KYIB 3D3QA 3MWJA 3MFYA 1RE0A 1IQPA 4B74A 1XXHA 2CHGA 5KNBA 1AGPA 3E70C 3ZVRA 2QMEA 3GLGB 5HTKA 3UPUA 5K8UA 2JEOA 1G6HA 1ZUNB 2C78A 1NVWQ 2UVQA 4WZ6A 2F43B 2ZR9A 2W0MA 1FL9A 5CITA 1ZAKA 3SFZA 3VR1A 3KKNA 1OXTA 3LNCA 1UEJA 2BEKA 5JZVA 1PUJA 1JR3A 4B3CA 5HKKD 3RSLA 3BGWA 3I5YA 3BS4A 4PO8A 3BAFA 1P4SA 3DKVA 3IGFA 1KI9A 2G0NA 2QAJA 2JLWA 4F4CA 2KI5A 2QP3A 3CX6A 1XFAA 3EPKA 2ZI9A 5BXQC 2PH1A 4PX9A 4V0MA 1S2MA 5FFMA 1MO5A 1TMKA 4JT2A 2WIBA 2E9SA 2QTVB 3EZ6A 1W36C 1KTVA 2GJKA 1EFCA 1FOEB 1DS6A 3ZQJA 2ZI5A 1BH2A 3L43A 4UNSA 4WZBE 2ZSEA 5CLLA 1ZUIA 3OAAA 1ZNWA 4GZLA 3NVAA 5JECA 4HZIA 1QHHA 1OXUA 1KSHA 5L3SB 3AVWA 4LJAA 1N6NA 1US8A 4NZYA 4IVPA 3P26A 1XJQA 3WHKA 2FFAA 2QP4A 1NN3A 4LGMA 3ZLJA 2P65A 3B5JA 1R0YA 4XWKA 4DCSA 3K70B 2HF8A 2QP9X 1KNXA 3DM9B 1GDDA 4HZUB 4UXHA 1HYQA 1KMHA 3AVUA 1UBEA 3S1AA 4TYNA 5DN6D 1E0JA 2A3RA 3VU9B 4NU0A 1KK1A 4I1OA 1KO8A 1WCV1 2IYRA 1KI6B 1JR3E 4Q18A 2ZI6A 3CF6R 1P6XA 2GF9A 1IONA 2G77B 4BFZA 2GJAA 4OL0A 2GF0A 2ZUCA 1S8FA 3MCAA 4TMKA 3MJHA 1SVIA 1T3SA 2ZYUX 3A1VA 3KXIA 3BC1A 2R9VA 3CWQA 3U61B 3EC1A 3FGNA 5TB5A 4EDHA 1SKYE 1W0JD 1N5LA 4UQOA 3TSOA 2P0EA 4LBYA 5FOSA 2GCOB 2OBMA 5GVSA 2CLSA 2F7SA 2P5SA 3K70C 2WKRA 3I1FA 1W36D 1XD2B 1E2PA 2ZRBA 2PCLA 5BN5A 4D80A 3SU8A 4LPSA 1AS2A 1Q0UA 1T8TA 2B21A 2VHCA 4LJ4A 4TSFD 5BYJA 4ZDJA 5FPKA 3EZFA 2XB4A 1UKEA 2J46A 1GG2A 1UPTA 2QA5A 4KCGA 1J99A 3QIAA 2OO7A 3CPJB 1YR8A 3H0KA 3NH9A 4I1UA 3B9PA 1KDTA 3A58B 1SHKA 1W0KD 2QE7A 4MKHA 3B85A 3EIQA 3CRRA 4Q19A 4DSOA 3VAAA 1UEIA 3WBJA 2EFCB 4Q48A 2DHRA 4EJSA 2O5VA 1H65A 4X8OA 4B3DA 5F9FA 2REOA 3D31A 2BMDA 5FI1B 1W4RA 3RVBA 4OI0A 5JWHA 4XVQA 4EAQA 3K09A 3OIWA 1GNQA 4JZKA 4YMVA 3THXA 3DMNA 2J0VA 3IO5A 4OQMA 5KSPA 1Z29A 1KKMA 3TJZA 1NN5A 3IQWA 2O8BB 1W49A 2P67A 5L3QA 2F55A 4M53A 4D6PA 4HUQB 2ATVA 4DVGA 4US0R 2YKGA 3HJNA 1VPLA 1GSIA 2D4HA 3P1JA 5LBIA 5BYKA 3CM0A 2YOFA 3KDSE 5HCNA 3RWOA 3NTUA 3FFBA 3FFAA 3KKPA 3VHLB 4D26A 3A6PC 3V4FA 2ZS8A 4P4TA 5DYGA 5EZ5A 3NH6A 1IOZA 3QBTA 4C0KA 3U60B 3KJEA 1CRQA 2G6BA 3O47A 2VF8A 2ZI7A 2DPXA 1HA3A 3UXMA 3F8TA 2FN4A 1NKTA 2ZRAA 3ZIAD 2NO9A 3L0OA 4B32A 2P2LA 1JNYA 3AUXA 5LB4A 4U7DA 4GMDA 4MQBA 1TL7C 2VHUA 1V5WA 2VIIA 1H8HD 3T5GA 2QAGC 3GLIB 4OBEA 2ZE7A 1QZXA 1O3YA 1XMSA 2A5DA 2W00A 1HV8A 3U7GA 3SJBA 4EPWA 1LF5A 1L4UA 1E9CA 1E3MA 2AD1A 1CULC 3I73A 4MRRA 5DO9A 2OM2A 4X8LA 4MGIR 1GUAA 1X8KA 2G1KA 1E2NA 3O8DA 4PQYA 1II8B 1HUQA 2ANBA 4NYMQ 3VTKA 4BLOA 3QSYA 1CJKC 4IDPA 3FOZA 2IYUA 2YYZA 1VECA 3W6PA 4Q4JA 1KJYA 2GDJA 1E9BA 5DNYB 2FDCA 3X2SA 2V1UA 4I1SA 1KKLA 5FBQB 3WBKA 4RZ2A 3KB1A 2FFQA 2Z83A 3DZ8A 4Q4HA 3FE2A 3QJYA 4MRNA 5DSZA 1NLYA 2VP5A 2BCJQ 1ZIPA 3BOSA 3CNOA 4UXIA 2I1QA 2QPAA 4NBSA 1OYWA 1ODFA 4F4IA 4OHZA 3KKOA 2F1RA 5CYOA 1NLZA 3R20A 1U81A 3BH0A 4TMTA 3B1WA 1GL7A 3C8UA 4Q1CA 4AK9A 3EARA 1ELOA 4MKFA 5H1YA 1P9RA 1QBKC 5B57C 1T9HA 1FP7A 2IC5A 4BASA 1W7AA 3WYGA 3MAAC 4BFXA 1I4DD 3O8CA 4LBWA 3KUDA 2CL7X 2O8DB 3RC3A 1CEEA 4D2IA 2N46A 2J7PA 2DFNA 3X1ZA 4M1SA 1JR3D 4Q9JA 4AG6A 3AP2A 1G7RA 4Y0VA 2XITA 2Q21A 4TQ9A 5ELXA 3THYB 4CF7A 3GLGA 1CR4A 2ERYA 1FZQA 4PO1A 1NBMD 2ZR0A 5DHFA 3CX8A 4WAUA 1LB1B 4L15A 1OT3A 2KB0A 2V7QD 3NXSA 2ZS9A 4MGZR 2IBMA 3TE6A 3VR5A 3K0SA 1P62B 4IRUB 4P31A 4KITB 4RZ3A 4Q9LA 3I92A 3GPLA 1ZYUA 2V9PA 2FFBA 2QBYB 2QZ4A 3QXSA 4RD0A 3UG6A 2O0KA 1KNQA 3HU2A 1X1RA 5CIQA 4PTLA 3I8XA 4ZDWA 4OI1A 2NZJA 3C7KA 3KUCA 4Q01A 4Q1BA 3OAAD 1XU4A 3GEIA 3K0FB 3IUYA 1Q1ZA 3GLFA 2HJVA 2VLIA 1Z6AA 1Z28A 3AV0B 2AX4A 1MO3A 2WZQA 3VR3A 5E3HA 4C3ZA 2XXAA 2X2FA 2ZI4A 3LW7A 3EG5A 1F2TB 1GNPA 5TV2A 2ZU6A 2RHDA 3QVUA 3EC2A 4C0JA 2ZJ8A 2ZJ5A 1AZSC 1G4UR 2EYUA 4EJSC 3SEAA 4A2WA 1P2TA 1XEXB 2ODEA 2F9MA 4JYBA 3AUYA 4Q1DA 4UKDA 1BIFA 5E95A 3TNFA 2ONKA 3CKLA 1MR3F 5FTMA 1N0WA 4L9WA 4PHGA 3C5HA 1Z22A 1PLKA 3CZQA 3Q7PA 2FSFA 5FR1A 2BHRA 1WMSA 5DI3A 1GKYA 3F5FA 4L4UA 2Z4SA 4U5XA 4KO8A 4KXFB 4DKXA 2LKDA 1I2DA 3GLHB 4BWYA 3KKMA 1Q1QA 1RZ3A 2WVJA 4OHWA 2JIZD 1NMZA 4ZKEA 1M7HA 4W5WA 2WSSA 3WY9A 2F1JA 1N5KA 3ECCA 3NBFA 3EIHA 1GKUB 3WHLA 4FI3C 2DWPA 1ZC3A 4WXRA 5UKDA 4A4DA 1D6JA 4ZPXA 3CPEA 5JMTA 4HAZA 4WOPA 4A15A 3QPVA 1HY3A 4ESHA 5IK2A 1IJFA 1Q20A 5FTJA 1G3IA 4TTPA 1G3RA 5B30A 1Q21A 2BM0A 1OF1A 4B76A 1M1YE 4HAXA 2CHVA 1K8RA 3X1YA 5JI2E 1CJVC 1Z07A 4YQFA 2ZVQX 4HB3A 2Q3MA 3UWKA 6Q21A 4YMSA 2VHQA 1T3LA 1TADA 2YV5A 3C4JA 3K9NA 5K8TA 5D3MA 3QXHA 5CK5A 4HAUA 4RCYA 2HXSA 2ZAMA 2XNSA 4S2EA 1FUKA 1W0KA 2QE7D 4C0HA 4DSTA 1H8EA 1MT0A 3KFVA 4LJYA 4ZIRA 4H9GA 1E1RA 1U0LA 2WMOB 3CR7A 2YHSA 2I3BA 1GRRA 1TEXA 3Q5DA 2ZJ2A 1AGRA 3LVQE 2XX3A 2XOKA 4JT4A 2GBLA 3WXMA 2XEXA 3PXGA 3UMSA 4BEBA 2HDNB 1S1CA 2FEOA 4EPVA 1KHTA 2CJWB 1RJ9B 4AKGA 2BEJA 2VO1A 3E1SA 3SDZA 4GP6A 4JJKA 5DYIA 2PX0A 3I62A 3U7FB 2B6HA 2F43A 2CNWD 2FH5B 4DSUA 3M6AA 1OE0A 1D5CA 1OXXK 4C0QC 3TVDA 1NG1A 4KAXA 4DCUA 5IT5A 2W83A 1DAGA 4NYIR 1LS6A 3ZZTA 3DO6A 5DE3A 3R9IA 3SHFA 3B8HA 4W7SA 3ADBA 4B3GA 1EXMA 1R8SA 2PT7A 3CB4A 2ZSBA 4TYPA 5C1BA 2RCNA 3AEZA 1YHNA 1DBSA 1M7GA 2GCOA 4YDSA 4Q7LA 5JS7A 1E2QA 1HT2E 4AIIA 2RGEA 4AYTA 4E03A 3ZVNA 3FYHA 2FPKA 1YZNA 3K8YA 1H8HA 1NN0A 4TTRA 2PZFA 3CRVA 3ND8A 2DFLA 4NYJQ 2Q6TA 4MYHA 2OG2A 1GRNA 2EVWX 3L0PA 3T15A 4ARZB 4DLYA 4MDFA 3RRYA 1OKKA 1JECA 1S3GA 2FFHA 2QGNA 2OFXA 5AJYA 3NEYA 4BECA 1LTQA 1FQJA 3N2IA 1OJLA 2JJ2D 1HT1E 3CH4B 1JBKA 5JRZA 4C7OA 3I4LA 5SZHB 4DSNA 4C2TA 2YOGA 3B2EA 3X1XA 4QJ4A 1OLOA 3BD9A 2VF7A 2P6UA 2O8EA 4RVCA 2L0XA 821PA 4KODA 3GD7A 3THWB 3MUFA 3LFUA 4YMUA 4KHZA 5EUMA 2OAQ1 2O8FB 4BGDA 4M4SA 4M8NE 4M1OA 4EPRA 4L8GA 3RANA 1G6OA 1UBGA 221PA 3W8NA 4KFSA 1RRFA 4URZR 5CJ2A 1ZVQA 2D06A 2VP4A 2IL1A 2ZE5A 3GJ6A 1OIXA 2IHBA 3K9HA 3SS8A 4URVR 3U3KA 2ZTSA 3FKSD 2DFKB 2YZ2A 4M9QA 4D0NA 3VMFA 1D9ZA 4LDJA 2KWIA 4Q7MB 4KLZA 4Z8YA 2BOVA 1NVUQ 2HLDD 2CVFA 3B1YA 4RFSB 1NF3A 3LQQA 2IXEA 4CRWB 2KJQA 1T0HB 3FMOB 3BFKA 3N70A 3LLMA 3NDBB 1P75A 1TQDA 3THWA 1ZCBA 2BC9A 3DOEA 2ZYWX 4RY2A 4FCVA 1KO1A 2LCFA 4HB2A 2EWWA 4HLUA 2C9OA 4IEEA 5CDFA 3MMPA 3TQFA 3PV0A 1XXHE 3AVXA 1GL6A 2BDTA 3P27A 4LC0A 3G82C 1PLJA 1E79D 3GJ8A 4CVNA 5LD2C 1NMXA 2GHIA 3UIEA 2P6RA 3PITA 1UBCA 1XTRA 2PT5A 1JXMA 2NPIA 1E0AA 1TEVA 2Q9BA 1HQCA 1Z6TA 4A6PA 3EX7C 4OKSA 1E98A 3ZD6A 1DAIA 2IA5A 4PAQA 1YRBA 3AKDA 3U3OA 1QHIA 4PZYA 1R7RA 1E0KA 2GBLC 3UG7A 1OH7A 5KPJA 2OT3B 4Y0AA 2CLCX 1EFTA 3RNLA 4CDGA 2ZPTX 5KU1A 3BFVA 1ZP6A 2XNDA 3FVQA 4JLVA 5JWRA 2AFIE 4PSKA 1J90A 3AVVA 1GIAA 2QT1A 1JQLB 1WDTA 1EFHA 4KU4A 2ZE8A 4TLBA 2HT6A 3U6BA 1ZW6A 4DB4A 2ZITA 2Z43A 1Q1EA 3A4NA 1C1YA 2HCJB 4RZUA 3FWYA 1HURA 5EQTA 4B3BA 1A5TA 1TAGA 3T5DA 5KO2A 1DADA 3QQ5A 5AUNB 2ORVA 1DG1G 3GJ0A 3AVYA 5F2EA 1JJVA 4D4MA 4BLPA 4JVNA 4HLCA 3WNBA 1ZUHA 4IOKA 3K0AB 4EJSB 1E2IA 2V6IA 2GXQA 1GAJA 5KDDA 1N6RA 3NG1A 1UM8A 1RRCA 2DR3A 2B7BA 1EX6A 4TWZA 2WHXA 4BUJA 4LHVA 1E9RA 2UZ3A 2W2XA 4FW9A 1YZUA 4F93B 3IHLA 4B2PA 3QF4B 3MWKA 5TMPA 3BXZA 4GBMA 3V00A 1A1VA 1CLUA 3AVOA 3B1ZA 4JKYA 1X86B 4GOXA 3A1TA 4OJKA 2G0TA 3DL0A 4JVLA 1OH6A 2OBLA 1OYYA 2V7QA 3MD0A 4Z54A 4G5OA 2G1JA 4A0HA 4BPBA 4FINA 4V0NA 1IM2A 3U44B 2W2TA 2GEDA 4QG7A 2C95A 1XPOA 4LC1A 3THXB 2C03A 2VP6A 1NI3A 1G5PA 4ZDKA 3EPLA 4CGZA 2ZXUA 2BJVA 2IXGA 5IDVA 3F3YA 4LJ5A 3AF4A 3W9YA 1YRAA 1SKQA 2FX3A 3HPRA 2VSOA 5IF9A 3GLHE 3CNNA 1DAFA 3B78A 4JKIA 3TMKA 2NG1A 1NVVR 2WSMA 1W5SA 1PZNA 2WV9A 1WB9A 1UKZA 3U3MA 5K8IA 2FSIA 1OW3B 1IAQA 2PEZA 2ZRIA 2OILA 3C5CA 1R5NA 3CW2A 2F3RA 3PENA 4ABYA 3ZVLA 3L0IB 4BFWA 1OB5A 4OI4A 3EA0A 4NTZA 3Q72A 1JPNA 4B71A 3TR0A 5AUOB 1WBBA 1G291 4RKFA 3UK6A 5BW8A 3BJIC 3DPUA 3IBGA 3T12A 4F38A 4LZZA 1NNEA 4QJ3A 1C4OA 5KPDA 4NCHA 1NSFA 4FMBB 3W34A 1OIWA 4ZKDA 4Q47A 3B1VA 2OCAA 3TH5A 3LBNA 3P4XA 2WWYA 2AFHE 3CF2A 1KZGB 3RYTC 2ZEJA 4M1KA 5H70A 3DKPA 2VSFA 4UJ5A 1KDRA 1E2DA 4TL7A 3Q8XB 1NL3A 3LAWA 4K8OA 1XEXA 2QMUA 4JBXA 5AK0A 1W4CA 2JA1A 3X1DA 3LDAA 5EP2A 3AF0A 2Q3FA 2RGXA 3B13B 2H5EA 1AKEA 2V3CC 4AURA 2QM8A 1G3QA 1F2TA 2QL6A 1V43A 4Q1FA 3GJ5A 2LWIA 1S0UA 4Q1EA 2IS6A 1VDZA 1E2LA 1TU3A 3K0FA 3KL4A 2CE2X 4HLDA 4LYJA 2RMKA 521PA 3GLFE 1XTSA 3OIUA 2GTPA 1KI8A 1OV4A 3FMFA 1SXJC 1PVOA 1G5TA 2VYFA 1W4BA 1W46A 5JJLA 3OEHD 4RFSA 3VFDA 3IHWA 3GCGA 2QTHA 4Z1MD 2C8VA 3EA5A 5C4MA 4CEJB 4OHXA 5F98A 3TR5A 3AVQA 2K5UA 2J7KA 1R0WA 1A7JA 3KJHA 4WXPA 4XWOA 3SZRA 1P72A 3OFNA 4MGKR 4RD2A 1QRAA 1XEFA 1R2QA 4KSCA 3U3RA 4B73A 2FJUA 2WJHA 2WIAA 3LQRA 3QXCA 1NG9A 2FE4A 4FN5A 2ZI3A 4TQUS 3PUWA 4AKIA 3PVSA 3AM1A 3QF4A 2IYVA 3TW4A 4JYCA 5B64A 2A9KA 2ZYTX 2FEMA 5LPNA 1KOFA 2GILA 1OFTA 4PR0A 2WAYA 1E0SA 1P60A 3IKJA 1Z8FA 4M2LA 2O0HA 1F3OA 3FHOA 2R65A 4EPTA 1BYUA 3I61A 4BFSA 2DB3A 1OHHA 3LH5A 1ZM9A 1ZIOA 2ZUBA 4GT1A 3TLXA 4HAWA 1QHGA 3B6EA 3T1VA 3WMEA 3QG5A 3GLIA 1TF5A 3U7EB 3VKGA 3FKSA
chains in the Genus database with same CATH superfamily
4HN2A 4HQFA 3VPHA 2O20A 5HFAA 3A25A 5B6PA 3VR6A 1G41A 3LC7O 4KAJA 1H2WA 3ZCVA 2VHWA 4HUQA 4Q5IA 4BO1A 4R83A 3ZC3A 1JWBB 3OBIA 1L7VC 2HJGA 1XL1A 1JJAA 4A8JA 2HA3A 3NBZC 3ZHRA 3MFQA 3FCSB 2B1QA 4XFDA 2HX1A 2Y71A 3TJRA 2GCGA 3UAZA 3PGJA 4FFSA 4LYFA 4MUFA 3U40A 1ZK4A 1FUIA 1RHRA 3IEUA 1U28A 5BSGA 1EXWA 1MBZA 3OZEA 4WOJA 2XWSA 2JJ2A 2ZAYA 2O3TA 3C6ZA 4Y2XA 3KXPA 4LVOA 3TW8B 1C9KA 1T15A 4M22A 1NMEA 2IW3A 3BK2A 1LKZA 8LDHA 1MDFA 1RMTA 2AC7A 4K9KA 4C7VA 2I91A 4YRIA 3T7EA 2QRKA 4MHSA 4Y1RB 5P21A 3SBDA 1Z63A 2W71A 3RTAA 3U9TA 2X1HA 1WPQA 4Q3NA 4CEHB 1XJWA 2E89A 2PQ2A 2Z4RA 3KO8A 3MT9A 4M1MA 4EY8A 4L51A 1XDDA 3V8NA 3GFOA 1FYWA 3K09C 4P3XA 5NULA 3ZWPA 4Z7JA 2PEYA 1ZK1A 3KX2A 1ODTC 4I08A 4HZUA 2E5FA 2H17A 1VCNA 3DWEX 2D0PB 3GCWA 5FUYA 3ZV7A 1XZFA 1COWA 3UGTA 1RKXA 3BJZA 3DBVO 1KOLA 2DYKA 3ND6A 4TT3D 4TZ6A 1IZ9A 2VK2A 5HIKA 2XYQA 2NO0A 4GVLA 4L74A 4RVFA 3QI2A 5CFNA 2G88A 5A5FA 1EFKA 4O1HA 1JAXA 4MKIA 1SIOA 4RSRA 4ZT2A 4QLAA 5BSFA 5BP7A 3VH4A 5E7MA 2GEFA 3MWFA 8AT1A 1M6EX 2PRZA 4M60A 4PRZA 2JGEA 5BQXA 2D2XA 2ZKIA 4HFRA 4J1TC 2QT0A 2ZWIA 4YRLA 1GKIA 4Q03A 1NXSA 2RGCA 4JLBA 3EF0A 4MCAA 4JJEA 4JBHA 2ETXA 4U2FA 3KXDA 5KX5B 2I4NA 3QG1A 4PLPA 4EHFA 1X7HA 1YDEA 4X44A 5K99A 5GZ3A 4ALNA 3E53A 3AR6A 1LEHA 3GEDA 2XCIA 1N4AA 1C7EA 2D0IA 5A4KA 3LA6A 4DUGD 1VDMA 1L5QA 3GGDA 1CY6A 1Y63A 2OZPA 4U3JA 1XRMA 2NXWA 2PYIA 4IFTA 4LKOA 2ONCA 3ABRB 1Z2PX 1HX7A 4I19A 3C4VA 4YV1A 3O4JA 2A5YB 1X3LA 4FBLA 5F3WB 1R9JA 3PF9A 2QX9A 3MYYA 1LLQA 5C53B 1GADO 1TYBE 1RADA 1P4AA 4E51A 4K0KB 3VA7A 4GNKA 3IUEA 1DV2A 1J5XA 2OQIA 1VHWA 4D8UA 4DLNA 1XCBA 1NBMA 4INPA 1ZGAA 4EVRA 4XGNA 1U28C 5LXTA 1TPYA 3K0HA 4B3MB 4FI3F 5HJ2A 4JBYA 1PJBA 5IEJA 2WICA 5FNVF 2IF0A 1KSGA 4RSGA 4GP9A 3RHSA 1HE4A 3S1AB 3WRXA 1WOMA 3MERA 3KQYA 5LU8A 1U4OA 3L4KA 1VG9B 3PNKA 4ZV9A 2OLJA 3QMPA 3LBIA 1NT4A 2EEPA 1KDVA 3SSMA 3NVMB 2CSUA 4K26A 2PJUA 3W04A 1XTPA 5TLSA 2PMFA 4CTMA 3C74A 5FD8A 4JMPA 4BNUA 3T61A 2AXPA 1J2JA 2GYVA 4WD3A 3AEYA 2XA9A 4BJ1A 1P2UA 5BV8A 1NDUA 4FHDA 4Q0MA 3QE0A 3Q0TA 1JP7A 3U7JA 5BW6B 4F6CA 3LUCA 4TS3A 4MDEA 1TEHA 1VSQA 1XEWX 2AEEA 3E8SA 2OYRA 5BSWA 4ZO7A 4C7OB 3FHTA 5BR7A 1NBHA 1NZDA 3UEOA 2Q8PA 5LNK6 3L18A 2NTYC 1R0LA 3HY4A 4I46A 5C80A 2OD9A 5I9NA 4YP5A 2R6CA 1IXRC 2J3QA 4IW3B 1BMTA 1F8GA 2IH4A 4RE6A 1R10A 1F5SA 5BV2P 4DNQA 3ELYA 1HDXA 3DV0B 1NVTA 2V74B 3JVVA 1TUBB 1BAPA 2VT6A 3C6KA 1UM9B 2G17A 4MA4A 3SMQA 1IUPA 5HS6A 4LX8A 3KTAB 4OJQA 1NBOA 1YZFA 2PR7A 3C7CB 2YWGA 4Y9DA 3VDXA 1YGPA 3HMKA 1LSUA 3N2GA 2E1RA 4CQJA 5A2QA 3SC2B 2WUFA 3O2SB 3QRWA 3GQVA 1W48A 4KDFA 4BAUA 3O4FA 4RD6A 3AU8A 2RIRA 3ME5A 5E2AA 3FDXA 3N2EA 4I99A 1SXIA 3L0ZA 5ANRB 3TKAA 1UR5A 2BUAA 3LYHA 3O3OB 1LPPA 1AOXA 2J32A 2YVLA 3N2KB 3OUZA 1EUCB 4XTRA 1E9FA 3HJFA 4BYMA 1ENPA 1CHDA 2YC2C 4PG7A 2XAAA 3WQSB 3ANSA 4YRGA 1GNTA 5EWJB 3AWDA 1YUNA 3MS7A 4DNOA 4LJRA 2F1IA 2VLBA 3EMKA 4UU8A 3R24A 4RO0A 4ZD6A 5I9TA 3PFHA 2WWVD 2XCRB 5IBQA 1ZRHA 3AV3A 1ZC4A 4JQCA 4K40A 3JQAB 4WXHA 2B34A 1MX3A 4HGRA 4KDEA 4RENA 1DWUA 3G23A 4P4UA 5GONA 3WICA 2EX0A 5CGQB 4ENQA 1HDIA 1OXMA 2WIJA 4MW6A 2O06A 3Q6IA 5J4YA 4LQDA 3PQEA 4M8IA 5TX7A 4AY4A 3EXEB 4QSMA 2P4HX 3I8SA 3AGQA 2QN1A 4GE0A 4P4NA 2IPOA 4KEAA 5CFRA 2YUTA 2WF8A 3DYVA 3WGOA 4HCJA 2A67A 2OCYC 4RPLA 2YJ4A 5CTAA 2JBWA 2DTDA 3JQAA 1G20E 1E2UA 1L5FA 1QFXA 3EW7A 4BV8A 4W9MC 3C5VA 2VPTA 4QEKA 4BNDA 1YCFA 2VI5A 3AEUB 4Q4AA 1U7TA 3NUGA 3TM5A 3E23A 3PKIA 4HWGA 1ABEA 2Y67A 5TDHA 2WD8A 4I50B 3LLUA 5BSVA 4WIAA 1DFHA 4RK1A 4A4DA 1J20A 2C5HA 1LJLA 4Y1FA 1LD3A 2PNJA 2I4MA 1SBTA 4QPNA 4YWJA 3NCTA 1C3JA 2XGSA 3BFXA 3N0RA 3UATA 5HKOA 2LBPA 4R98A 2H18A 1B14A 2IUFA 2PBZA 1SM4A 4DQKA 3SQLA 3TZKA 2ZUDA 5B6IA 4NK4A 1S3FA 2Y0PA 2JJ1D 1VG1A 2DUNA 4LHZA 2ENWA 4YMGA 1EUDA 1P2BA 3LPLA 2TMDA 4M1TA 5A7GA 4LRWA 3T1QA 1L5YA 1QH0A 1BEZA 3KBOA 5DM2A 4DYDA 4DDVA 1QO9A 2BMFA 1N5IA 4KGZA 4NV0A 5ALUA 4CG0A 1O87A 2AR7A 2O8BA 4Y2VA 3WLAA 1T26A 1N34B 4Z9FA 3OOHA 4F72A 3KQVA 2XA1A 4MGHA 4H4DA 2PX8A 3ROFA 1U8FO 3CTMA 5BSMA 1OI2A 3ACDA 2DQYA 2VL7A 3A27A 3O1LA 3OBBA 4N40A 2X77A 1BKSB 2AMFA 3VM6A 2FYTA 2NVUA 1IAVA 1OR8A 2HA7A 4N5NA 2OQVA 1PJAA 2A9QA 1I2MA 1CYDA 4HDRB 4MRSA 4RF5A 1J0CA 2PX4A 1BKDR 3ETCA 4BV2A 2I3ZA 4FX2A 2ZBRA 4FFWA 2EKQA 4LSWA 4N0DA 1X0VA 2VQ6A 3WNZA 3LWNA 1SZDA 4CWAA 3PEEA 3GBPA 2AC2A 1A9QA 3TI7A 2AT1A 3RFVA 4HEHA 3WQRA 4DOMA 1I33A 1OSNA 1V9LA 3AHIA 1DEOA 4M88A 2IXDA 4A0RA 1TZCA 4GI1A 5FNZA 5HBRA 4E94A 2C8LA 2ZREA 4F04A 4OMUA 4R2JA 2NU7A 2XLCA 3FZYA 4ZQBA 2BF7A 1PSDA 1W52X 3DFZA 2P9FA 4MR8B 3ADDA 3BE5A 2H4YA 2X3YA 4BLQA 2CHQA 5F1PA 5JEDA 2Z30A 2OYCA 3NIFB 4CEIA 2WF7A 2DY1A 2JHAA 3I9JA 4EYSA 3OJCA 2V4ZA 1S4MA 3HUUA 3DD5A 4O25A 3CIFA 2OENG 1DTWB 5K9ZA 2JKVA 1JKFA 3AI7A 1J33A 3E1GA 4TPKA 2JLZA 3WKCA 1QONA 1VHLA 3I8OA 1G5QA 2ADOA 2PYDA 3CYFA 4RVUA 5JFGA 3DOCA 2RHCA 3MD9A 4JMLA 4Q9AA 5FWDA 4ZQHA 3FDIA 1N32B 4QARA 1QJCA 1Y80A 3B7WA 2YMPA 4YLYA 3LA8A 1LTKA 1YZKA 4G1UC 4WCFB 3GFVA 2YMMA 3GLGE 4HB0A 3RKUA 1IUOA 3TB4A 4ENWA 5F9HA 1NW5A 3GUHA 5EJMA 4W8OA 1K5DA 4NCIA 3VKWA 2XCSB 4HH1A 1JG2A 3UZUA 3GNLA 5DNUA 4KWTA 2I6TA 3KPUA 1CIJA 3ASUA 2ZK7A 4A0QA 2X23A 3HV2A 4L4SA 1P1JA 2IT1A 1U90A 3MGCA 1TA9A 5E6UA 2EW1A 3DCIA 1Y0BA 2A92A 2RC6A 3HRHA 4QUDA 4YGXB 3SHTA 4JH0A 4HZGA 5KHAA 1HH4A 1CB7A 2OUIA 1IXSB 2QVYX 2AR0A 3N2LA 1KFKB 1FP6A 4E5UA 1LWNA 4N5HX 1DQRA 3B82A 4YYZA 1PFWA 1ZVMA 3A9SA 1P81A 3IAXA 3KP1A 3KWFA 2WHQA 4JLJA 4B0PA 3RYFB 1NI4A 5KNCH 1T3GA 1Z7YA 3WYAA 3FPCA 4YCMA 4BE7B 1O94C 1G9TA 2RFLA 4ANFA 1KQOA 3RSHA 4FMCF 4GFDA 1RKBA 4DYVA 3MS4A 3CUTA 4QQRA 5ER9A 3RS7A 1N2BA 1O6ZA 1Z4KA 3SNHA 2PHZA 3OKAA 4PLHA 4Q02A 3HH8A 4L75A 1V39A 5JALA 2Y99A 3GQBA 5AVXA 1G66A 1G18A 4KVAA 1LBHA 5WRFA 5GPBA 3S5UA 2JH8A 2J67A 3OQHA 4HEA6 3BEOA 3ICWA 3VZPA 1L5HA 4JLOA 2BEWA 5E1BA 2EFEB 4L9RA 4TXLA 5EHQA 4D8VA 1MU0A 1NF2A 1W6RA 1WMEA 2HMSA 2C88A 4OLJA 2P9GA 3DEFA 3AQ4A 3KKEA 4K6HA 4OAQA 4QDTA 3HK2A 1NM5A 2ZUSA 4HWKA 2DOKA 5K6TA 3TG2A 5HR5A 2R6R1 4R7ZA 1RRGA 2QPTA 4OIFA 1P1KA 3RUAA 3RUIA 4ZYYA 1OFHA 1GVHA 3L01A 1J8YF 4HXFB 1U9IA 1O0CA 4N3CA 3BGDA 3E22B 4OIMA 2OBXA 3ZE9A 5G3ZA 3SMVA 1I6KA 3CLUD 4G07A 2BR4A 2Q0XA 5BNZA 4RHEA 5A2GA 5CMLA 1GAEO 5TS2A 5AK6A 1PZXA 4PANA 2E55A 3NT5A 4I4TA 1GPMA 2UYCA 4KE8A 4Y2PA 4E15A 2VR1A 1V8BA 5EMMA 4TRJA 16PKA 1NZJA 2HJRA 4H6WA 1USIA 2C98A 3UCXA 3PLAE 2PGDA 1ZXBA 2N75A 3NHAA 2RBKA 2FQYA 2GPSA 4DMCA 4UREA 2V6FA 1GAWA 1FMLA 3C0KA 4OB6A 4EFNA 5JQWA 2PIAA 2D3TA 2YVKA 1QYVA 3QKRB 1Y9DA 5B7QA 3L8DA 4DQXA 2Z2ZA 1DE0A 4UVDA 2ZSAA 4LTNA 4CNBA 4F9TA 3MLAA 2NQTA 4B9AA 2A88A 2CUKA 1KO4A 1NF9A 1XZ8A 3IO3A 5FOUA 1Q57A 3DC7A 1KGSA 1VTKA 1Z6PA 4EQZA 1BWSA 1N57A 4GI7A 3VZQA 4PW0A 3LY5A 4MA0A 4O0MA 5FJJA 3C8ZA 3GH3A 4EHAA 3V3KA 5KNDH 4MJXA 1IOVA 1Z06A 3BYZA 3ON5A 1HQYE 3A6FA 1Q7GA 3GELA 2F3UA 4M21A 4QASA 3QXXA 5AK4A 2BFWA 2PX3A 3P96A 3HCPA 5GWXA 1VJTA 4LV6A 1J00A 1KEPA 4REOA 3GY0A 4IJWA 1E61A 3E7WA 4KSBA 2Z08A 3IV6A 3PDIB 4MINA 3B3FA 3ANYB 5IMBA 1EVIA 1JJ7A 2MYUA 2YICA 4U7HA 4ARSA 4RM2A 4L50A 5JSZA 1OXVA 4JEHA 4UEJA 1XVUA 3AUJB 1INLA 4AJ2A 5AWFC 1U94A 1ATZA 4H16A 4O5OA 2AMVA 4XUDA 1M6WA 1AKMA 2FPOA 3S0JA 3VNRA 3DTVD 3FLAA 4EGFA 4BNGA 1KWKA 2IYQA 2P6NA 2YWHA 3K6JA 2IEZA 4OD0A 2QAGB 2QX7A 4FGSA 2CGEA 4XWYA 1LK7A 3NVDA 3LNTA 3CO5A 4B3RB 4LI0A 3DMFA 2B0JA 1Z47A 3O1JC 3CRMA 3QWBA 4URYR 1ACJA 3GNTA 5FL7D 3RARA 3DVQX 2CDRA 4ZZ0A 3AJ9A 1GGHA 1NFQA 1TB4A 3QEMB 5ICEA 2FNAA 1UBNA 2GTIA 1JPUA 4M0KA 1C7QA 4TUYF 4DYHA 1GSHA 1ZY2A 5EHGA 4CMJA 3RAEC 1V5IA 2EBWA 3EFEA 1T0PA 1YULA 2ZM5A 2TMKA 1ZVVA 1N6HA 3GWZA 2IYYA 1FA9A 1TD9A 3GG2A 4EOGA 1PV4A 4HDOB 4S1WA 3L7IA 1JX6A 3PC4A 3GD5A 4LQLA 4MI6A 4H0CA 4DCCA 4EG4A 4ZVVA 3EPJA 3MWYW 4DMFA 5KHLB 4GC5A 1T0JB 1FFBA 1AB6A 5FPSA 1YRQA 2VA8A 1D1QA 1EWVA 1MC8A 1Q92A 1QCCA 4Z7OB 3AHHA 4JYZA 3S29A 3ICQB 3EIFA 5TVKA 1IG0A 2G4VA 4D3YA 3KOOA 1MAHA 3BMCB 2PL5A 2VN8A 4EO9A 1GNRA 4D9IA 4DG8A 1Z0KA 3AY6A 4OVKA 4RTKA 3B5EA 3GDGA 3L6BA 3F47A 1LC0A 1WB6A 1HTTA 3TXXA 4RK6A 4TWRA 4LDAA 5DGTA 1ADGA 4OUKX 4BZXA 2HQ1A 1Z7GA 2X0IA 4F7WA 1I1HA 3ENZA 2OWDA 3SYRA 5JWOA 5AM3A 5DBIA 2X58A 2XJ9A 3JQ7A 4PBRA 4EI9A 5G4KA 3T4PA 4XJVA 3ZTTA 1QB7A 1QLWA 3HFJA 2JH3A 4HTFB 1O0SA 3UUFA 4AJLA 2HRZA 1G2QA 1KDYA 4PSDA 1U1DA 1XUOA 2EF1A 1EG2A 2L18A 5M04A 3B9BA 4WXYB 5CIYA 3QVLA 5HE9A 2DKFA 4FHGA 3USZA 5T6MA 4DNFA 1N6LA 2A8YA 2EJTA 1J8DA 4WFJA 3SIPA 5EIXA 1A8IA 4HUJA 3OZUA 3WXBA 1KOJA 2MJLA 1FX0B 2O3RA 2R2AA 3D7MA 1BDIA 4BQEA 4J3NA 1GY8A 2PMEA 4FBMA 4MV0A 4MLDA 4V0QA 1MORA 2PL3A 4WUVA 3D4IA 3V32A 2BH2A 1E92A 2P5YA 1QIEA 2GFHA 3EDQA 3NDRA 1KS9A 4G86A 2VQ3A 3ESZA 3IQFA 5DHSA 5CLQA 4X1IB 3VU9A 1KBZA 3LXXA 2M2IA 3UBTA 4OGGA 4L0QA 1KVQA 4UZEA 1E1NA 2HN9A 2AL7A 3FYCA 3LWDA 4F11A 4Y3UA 2RHHA 3L84A 1DHRA 2ZRJA 4O4HF 2E48A 3E9DA 1H6BA 4K2HA 2BGUA 4IEFB 5HRCA 2HB6A 2VPPA 4LAFA 5EE3A 2QU7A 1KL7A 1Y6QA 1CUJA 3OPVA 4KMRA 2X0EA 3R8CA 4DWVA 3BTSA 4CFZA 3ZV4A 2YJ6A 1GA6A 3MYRA 1U0FA 4EHLA 1UDWA 4OAPA 2ZULA 4ITRC 1VE9A 2WPDA 2ACVA 2RGNC 2XTJA 4FQ5A 1LSOA 2NVOA 3G9QA 3H5WA 4MUKA 5FBLB 5B1YA 4ZICA 3CXRA 1L4GA 5K3BA 2QY9A 1FFEA 1Y6RA 5I4KA 1U0JA 4DIMA 3FLEA 2YFHA 3IMFA 3MGGA 1Y8RA 1XDSA 2B78A 1QFMA 2ALJA 3P9KA 1TK3A 1W44A 3GOQA 2W37A 4W5JA 5L6MB 1XMOB 5E7IA 3F90A 1M8PA 5J2UB 5J5AA 3LPAA 4RY8A 3NC1C 3VOBA 1QVRA 1M2KA 5DBEX 3DEKA 3GB9A 4D46A 4ZK6A 5EJ8A 2DKNA 3ZZNA 2Q49A 5L7YA 4W5QA 2GKSA 3L4BA 2CV2A 1R5OA 2VZEA 3IODA 3C1AA 2KLBA 1U7UA 3KWLA 5F3RA 4DR3B 1I3CA 1FFSA 2EFJA 2GD6A 1R66A 1KH1A 1V11B 3DR5A 3RJTA 5KTRA 4KAFA 4KKVA 5LA6B 1RI2A 3ZTWA 1H5UA 2X8JB 3COJA 4ZANA 2Y1DA 1GGEA 1V0JA 4E5YA 2ZSIA 3HKCA 1E6KA 4LSGA 1EX1A 1USKA 2EBHX 1MXHA 2C1ZA 3OO1A 3SXPA 3TB6A 4JLPA 5F5NA 4F5EA 3IRVA 1SPBS 4ALKA 3KOWA 3E9MA 4X93A 3TTVA 5CB4F 5EUQB 5DLYA 3FKJA 5I7AA 3CX4A 4RLFA 3RSCA 2O8DA 1G21B 2FPLA 4KR2A 2FF5A 3I05A 5IFKA 3DGEC 5BW4A 4EW6A 5FYDA 3DBIA 1E1MA 4M7PA 3SM3A 3UWOA 5LZ4A 2FUEA 2HRCA 4FMDF 4JP5A 3S8YA 4DCVA 4WADA 1TUEA 2R6HA 5DJ5A 1DWPA 1VLJA 3KVRA 2SCUB 4K87A 4QYWA 1ZD2P 2F64A 2CF5A 2OOSA 1PS9A 1SCBA 2F8MA 3CKMA 4QTXA 3VOSA 4ZVSA 3AYZB 2IX3A 5LQMA 4QHYA 2VBFA 3DMRA 3LW8A 3MJTA 2X0FA 3RW9A 1PFVA 5ICMA 1UC8A 4V38A 5J4LA 4M9UA 3IH5A 1W5AA 1BU8A 2RHWA 4UUOA 3CNLA 2C04A 3H2ZA 1N2CB 4DLVA 3ASZA 2QS9A 2YRXA 4LA4A 3PWSA 2NWQA 2ORIA 3U7RA 5JVDA 3VMMA 2M32A 2VXCA 1QZUA 2ZXFA 2PUGA 4OLHA 3DZDA 1J2UA 3LX5A 1MC5A 3ORFA 4KBYA 4MS3A 1EFRA 2DTEA 3V6MA 2ZYVX 2I99A 1PYDA 3LF1A 4BMPB 3HCOA 4JI7B 4RDXA 2VDUE 2X0JA 4A91A 2FZVA 4JROA 4V2IA 3RTDA 3EJWA 2C4VA 3TSZA 4KUGA 2PA3A 2PH5A 3Q2KA 4EIWA 1U99A 3IIMA 2CLHB 2HQBA 2W6JA 1G20B 3TRKA 2G1AA 4K0RA 3RM3A 3JSXA 4NEHB 2C83A 2DTXA 5LDGA 1EFPB 1NOJA 3N8GA 2BMJA 2GBIA 4GOND 1OX4B 3BT7A 4PIMA 1QHXA 2ODWA 5COAA 5LQCA 1FQWA 2CE7A 2WYVA 4F4JA 3BGOS 2XXAB 3Q0IA 1RPTA 4M1WA 3RVMA 2E6KA 4C2UA 5IKMA 1VPWA 2UKDA 1KY5A 2AZ4A 1D8AA 2ZJ0A 3BCRA 4DT1A 3R6TA 2VP0A 3DL2A 1ZNYA 3CSDA 5DN6A 1KORA 1GFSA 3GX1A 4PONA 5D2CA 5K1ZA 3R7NA 1V3QE 2ZJBA 1XQWA 4IQGA 4NZOA 4NQZA 3PIRA 4MI3A 5L3RA 2PMKA 3L7CA 2AG1A 3GCXA 3K0EA 3T34A 3M6MD 1GCAA 3IJEB 9LDTA 4YMTA 3HGQA 3RNOA 3MC1A 4TXHA 4LMAA 1GDTA 1ZISA 4Q00A 5B1HA 3KIPA 5J4VA 1EBFA 2Y8EA 1ADBA 4OLFA 4ENVA 4BX3A 4YIKA 1GU7A 3D6MA 2WWFA 3B53X 4PLFA 1RI1A 4U2DA 4XA8A 4XPIB 4PRYA 4BVJA 2ZFUA 4J0CA 2B2NA 2VSXA 2IHVA 4G0PA 4OGFA 2ODNA 3E84A 4K6OA 3QUBA 3KQSA 4EVQA 1QO7A 3FAKA 2Y0BA 3AR2A 3Q9UA 5FA8A 3TOXA 1T2CA 4JWTA 2GK7A 4G4SO 4IQ0A 3LUDA 3KB8A 1QQ5A 2J3LA 5FWXA 1KZ9A 4C3VA 3UHAA 1ZINA 1A7AA 3JD1A 3HB4X 4Q21A 1PS8A 1NX9A 4XLTA 1DWOA 4EFLA 3FSEA 1XVTA 2X8JA 1QIIA 3NI2A 1A4RA 4MRPA 1I0IA 1IN5A 2OCPA 4L4XA 1MO2A 3UAOA 2O5CA 1ZI9A 1D0VA 1KO5A 2VYNA 5DNVA 3RRBA 3SVZA 4OHFA 2OXRA 1CS0B 3Q7QA 3HYNA 4I7EA 4YRFA 4QBHA 4ZK2A 5KTTA 1PL8A 2NP7A 4OBWA 4WY2A 1MN6A 1SH7A 3E61A 1MKYA 1P7WA 3VYUB 1U0BB 3AH8A 3C6YA 2AZXA 1YFKA 4YCCA 4Y2SA 4L16A 1ISFA 4HRAA 3OFND 1TIPA 2FPMA 4DREA 2R00A 2Q0HA 4CM8B 4N76A 3DDSA 3J81k 2WYWA 2O5EA 3CBQA 3JARA 1AQYA 2X0RA 1Y8AA 3HUDA 1R8XA 5AJZA 3KWMA 1QRTA 4Z4FA 2JD1A 4EUHA 1G3UA 2ZR7A 4HEQA 1II0A 2BLLA 5I4BA 3GLUA 4O4JB 2IF2A 2LCIA 1CQIB 1VE1A 2BLNA 4HDKB 2DEUA 3VPDA 2ZRCA 5CD9A 2FMTA 1NRWA 5KJEA 3CH5A 2CC2A 2YMQA 2V1XA 2E5WA 4PQFA 5JBQA 1A50B 3CF4A 3LCRA 2IGBA 5FTNA 2V9ZA 2VRWA 4KN9S 2GXAA 1YGYA 4PFQA 4N4AA 5FUXA 5CVTA 1KAMA 1NRIA 1U7OA 2XGGA 3NAMA 1XF1A 2C7GA 4W9NC 5K8CA 2V03A 4ARUA 1E89A 3RRNA 4KQHA 4RGBA 4PHHA 2CK3D 1RYHA 2GETA 3HADA 3T3GA 2XT0A 3SDSA 4DIKA 4IIXA 1H2ZA 2ZROA 1KYIA 5DXAA 4V0SA 3UCFA 4CHGA 1EA7A 3BMNA 3M49A 4EB0A 4F3YA 2WHPA 4MYRA 1ONOA 4V0KA 4E11A 2AFRA 5FPYA 4PC1A 3A1FA 3VPAA 4C4OA 4JV5B 3EWSA 1CDEA 1Z5OA 4WE3A 4REQA 1CUIA 4GM4A 3Q1KA 2C59A 1RVDA 4PWZA 4UULA 3S1LA 1T1GA 5CVDA 1CKEA 1TMGE 2AKAB 2E21A 2IHZA 2PV7A 3FTCA 2O8VA 5G1NA 1U3GA 3QI7A 3U4HA 1RKQA 5D7BA 1QOZA 3ENVA 1SGWA 2QNRA 2I8AA 2QROA 3ICOA 4N8DA 1G55A 4C0XA 1NMYA 5DK4A 3NZEA 5EG5A 2ID9A 4MRMA 3RS8A 4R2LA 1USVA 3F3SA 3OTQA 4TZ0A 3JATA 3BWXA 2ABWA 4MUYA 3RWMB 3T52A 3REGA 2P1RA 3SF0A 1SXJD 1LH0A 3G6KA 1D2GA 5DM4A 1XOIA 5AJUA 3QU9A 1RWXA 1Q3TA 1WUTA 1ST3A 2RGYA 3AWIA 2K7FA 2DCUA 1GJRA 4DIEA 1Z6ZA 1WU7A 5GOZA 4GL2A 2XJ4A 1ZMXA 2C2YA 2XTZA 2VH1A 3LXRA 1Z74A 1O94A 4XEHA 2VTKA 4M0CA 5ICCA 2EIXA 1WVMA 5KNDD 2P11A 3OE7D 5JHGB 1XZLA 2M6KA 4CR7A 3DLBA 1CJMA 2VH2A 4UBNA 2RHRA 1JQDA 2KM1A 4GWGA 1CFJA 4TOIA 3ZV5A 4ASUD 4XD7D 4PYJA 3DOUA 5KEIA 4LK2A 1S2IA 3CW8X 1N2ZA 4TRNA 1QU2A 1AKNA 2WA2A 1HE1C 1SZCA 2XDAA 4C05A 2BUCA 3ZCQA 2C9MA 2VYVD 3GCZA 1YAHA 3TPZA 3WJ1A 1YQTA 2ZVJA 1YUMA 4QDKA 2IOFK 3ZEIA 4NP6A 4MQFB 1UK6A 3EXAA 4Q4JB 1BKYA 1C1DB 2M9MA 3H5RA 1NIPA 3W7VA 4GOJA 3FF4A 4YT5A 2VF5X 1AGNA 3SFTA 3UWMA 2Q6KA 1AVTA 4IDHA 4IIHA 5JNLA 1LDMA 3UHFA 5CFLA 1ZPDA 5GY7A 1NP7A 2ZVPX 2OPHA 3UJ6A 3Q15C 1U2TA 2QAGA 4UU7A 4W5HA 3CUUA 4R0MA 1Y82A 1K75A 4O4IA 4UBJA 4CUZA 4AMYA 5IJZA 3BBLA 4EB6A 2CLMB 2WINI 2QW8A 3FMPB 1EWRA 3D6VA 2VEOA 2WD7A 1LGYA 1OJ7A 1WKVA 2BGIA 2FLWA 4XJSA 5IF3A 1VJGA 2OCXA 3C1UA 3PEUA 1EZ4A 2AVNA 3BXOA 3PGVA 1Q0ZA 3WRYA 4J8PA 3R40A 5LDHA 4IYJA 2FMFA 5JNSA 2RGBA 3WLSA 4U6QA 3QBVA 1QVZA 4YAFA 3TX2A 4BLUA 3F4BA 3NJ4A 2JLQA 3EH2A 3QEJA 2FSSA 1M2HA 4H0FA 4NS4A 2AWOA 2UYYA 1S4QA 1K4KA 4IQFA 3S55A 5G53C 4ENSA 1S8NA 2R6FA 2H2DA 2KPOA 1WUJS 4PEVA 5KWEA 3OEEA 2BFDA 1IZYA 1CS4C 1V3TA 2AS0A 3LBHA 1NATA 2AZDA 3L6OO 3MRSA 3QVWA 3N28A 4HNAB 2FG7C 4PSVA 5ITZA 3P0HA 1ZOIA 2DLCX 1ZR2A 4YRNA 2QR2A 3H1TA 3TM4A 3OP1A 1XVAA 4RMJA 3JYPA 3CGWA 4BVGA 2ZIUB 4CIDA 1KKUA 3QX9A 3R5JA 2BTOA 2JHCA 1L0BA 3IEIA 4KMOA 2JFXA 3WL6A 4F3KA 3I2YX 1V35A 4FBGA 1BH6A 2BKXA 1TTPB 2H57A 2QY6A 5C3UA 5JYCA 3WHPA 1Q84A 1WSDA 2FI1A 3GC6A 2Y1FA 2WV7A 5TARA 4V1CB 3WP0A 3D6TB 2HMAA 3DONA 1EXDA 2EL9A 1ZL0A 3GVCA 4YDQA 3DJYA 3DR3A 4BVEA 1VM6A 3S99A 3E03A 4FFNA 4IBOA 4TTIA 2AD5A 2WD9A 3BIJA 2CNNA 4OMDA 3M83A 5CNIA 3JYOA 5JSZB 1YBHA 1L5GB 1O8BA 1H4QA 3DWIA 3F1LA 3HXMA 1UXOA 1JLMA 1Y1KE 2QIPA 4NH0A 4OL9A 1ESEA 3KS9A 4DV1B 1UQTA 3WYDA 2XYPA 3DG9A 1V8PA 4A6XA 4CKYA 2CJFA 3MWGA 3IMKA 2LDBA 5EYPA 3UHPA 3O3MB 4H7PA 2CV1A 4UBOA 1QYIA 2QKYA 3PYLA 2VPZA 4NU6A 1K9VF 2Z09A 2G4CA 2OHFA 2FWIA 2GA8A 4LWOA 3DJFA 1Q91A 2DULA 3IP1A 2R84A 1Z62A 2G5TA 4G85A 1GPNA 3CCFA 5AP9A 1RRVA 5EPUA 3O7WA 3RS9A 1P73A 3M2TA 5BQPA 4QVIA 3ADCA 3VAZA 1ZEJA 3JRNA 2WJYA 1SVUA 4N49A 1IATA 4FNAA 1ZEMA 1XYGA 3FVRA 3GAAA 3NUQA 3ZS8A 3AKEA 3GAZA 1Z6YA 5SZJA 1I7QB 4IDOA 3V34A 5G40A 2H51A 4RUKA 2IHTA 2WZCA 1VL1A 1GP2A 3QH4A 2H00A 4UATA 2PGLA 3W06A 4CR6A 5T8KA 4YRPA 1SAYA 4YC7A 3U1TA 2OD7A 1XWFA 3KAQA 1MG5A 3IILA 4HATA 4GLJA 2PKQO 4I9FA 4PLCA 5ALVA 1AH2A 4N1AA 4KR3A 1TTQB 1AA9A 3S68A 5CFMA 5GVRA 2QN8A 1KEKA 2VG8A 2D2VA 3KALA 4EKGA 1XMQB 5DYNA 4JLAA 3VX3A 4ZVRA 5SYMA 1TEZA 4C88A 1X1TA 4P3YA 2RKBA 4FD2A 2I7XA 5LP6F 1TVKA 1X8JA 4OK3A 3VVMA 2V6MA 4TMVA 5H81A 5CVJA 2AH5A 3T0GA 4KPEC 2XV1A 4EEXA 2CNWA 4GE3A 4J16C 2IUSA 2OO3A 2CV0A 3OT1A 2QLTA 3QHPA 5KZMB 4P5EA 4BDTA 5T5QA 3H97A 1Q1NA 1TKAA 2VNIA 1GGJA 2IKSA 5BSKA 3NNDA 3JQ9A 3WLQA 1V1JA 1O08A 2N9UA 2QSZA 2QJWA 4FZ3A 3FVWA 5IAEA 5B4TA 3TKYA 3IVRA 4AG3A 1XPUA 5L53A 3M5CA 5L3VA 3EBPA 1QLHA 1QLJA 3BZWA 1BGWA 3AGPA 3HLTA 1FNDA 3TRIA 1N6PA 2NZYA 3HWSA 1K5PA 4J90A 1SUFA 1FJGB 1U04A 1J49A 3EN0A 3UA3A 3YASA 4MYTA 2Q7DA 3I2FA 2IKQA 3LUJA 1W5FA 5EJ6A 1T2FA 2NMVA 3Q7IA 4OPMA 1VMKA 4FFPA 1ZU4A 4OQXA 3QBDA 3S2GA 3KYCB 3SOPA 4RF2A 3SKXA 1Z6XA 2Z9CA 4P8RA 1SIBE 1MX9A 1D1TA 3DZFA 1MT3A 1P29A 3HZRA 4RKWA 3FHCB 5LFAA 3ITNA 3OKPA 2CMDA 2RK6A 1PBNA 1YCGA 4GYWA 5TIIA 1A2BA 2LXNA 1M0TA 2GEKA 2ODTX 5GZ6A 4WCFC 4YEDA 3B70A 1GG8A 3TQRA 3LO8A 4P4SB 4YLEA 3MG9A 5JBIA 1B73A 3HJRA 4E3ZA 2BE9A 2FV8A 3QTTA 4GI3A 1NVMB 1MB9A 5EFZA 1L8XA 2CNOA 4GLOA 4BS9A 4UVEA 1E62A 4YO7A 3A7DA 4TXJA 3GGSA 4BKMA 3QEBZ 1X94A 4LMRA 4LVCA 4MVJI 3B60A 4OK6A 4PX2A 4YR9A 4EUKA 1RAGA 3R3JA 1KJZA 3DEHA 4XDYA 2ZCJA 4MPDA 1IRXA 3EVZA 1QAMA 5JS6A 2CLKB 1NYQA 5AOAA 1MV8A 4WLUA 3TMAA 3R5KA 3ZU2A 3L79A 1QP8A 1D4AA 1UT6A 4F6RA 3HJHA 2JD2A 1N9ZA 2VUIB 1ANKA 2WWHA 3GFPA 4V3BA 5KNDA 1SCNE 3X2FA 4YUAA 5KYKA 1V8FA 3PU6A 2AZMA 2ZYGA 3OC6A 3FHJA 1U0RA 4CKCB 4BWGA 4WW0A 3ZY4A 1ZH8A 4N47A 1V45E 1PIWA 1AS0A 3AEXA 1K63A 2BFCA 1TM2A 1YQWA 1RM0A 1JG7A 1J8QA 2W58A 5J4KA 2FW7A 3M1IA 3PK0A 3T8YA 4AG5A 3AHDA 1ZJJA 3J7AC 3LT0A 1ND5A 4D02A 4KJZA 1X3SA 4EJ6A 1QCZA 1Z4JA 2DQKA 4B6GA 1IDN1 2W2LA 4IFEA 5AHOA 3WRXC 1E60A 3HPQA 4IIFA 1XTQA 5FFNA 4EGCB 2FZKA 2JJYA 4FDTA 2O9JA 2PWZA 4QXOA 4E5DA 4BFLA 1XMPA 5A5GA 2ZUEA 3T1OA 1F8UA 2M6LA 3G9ZA 5EMHA 2G36A 1T2VA 2AMYA 2FX2A 4PG6A 4CM6A 1RC1A 1NQVA 2EGGA 1FE8A 3A1DA 3M2PA 2XQJA 1UIRA 2PSEA 4A5OA 4AC9A 5CCBA 1WB4A 3PE3A 3IBSA 3FWKA 3HXKA 4FFLA 2VJQA 1R5BA 1U98A 4FR5A 4Q7EA 2P9JA 3MHTA 1ISSA 1X38A 1YQ9A 3KVNA 3WB2A 3OF5A 3RSQA 2GCPA 4ZXPA 2WKWA 5ICSA 5JAHA 4UD6A 3B6KA 5CD1A 3NKVA 3G5UA 2JIBA 4KLCA 4XR9A 3O83A 2ZPUA 3JALB 1EG7A 2UZ4A 3COSA 2VP2A 3ESBA 3BB4A 1FYXA 1NN1A 4QBGB 4WOKA 3H2GA 4PQRA 4K9DA 4E5SA 5A1TA 1ESNA 4EMUA 4WNAB 5LUBA 4B6EA 4WJZA 2HMYB 1KQ3A 2PG3A 4NYJR 2HEIA 2PVCA