1N6IA

Crystal structure of human rab5a a30p mutant complex with gdp
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
167
structure length
167
Chain Sequence
b'GNKICQFKLVLLGESPVGKSSLVLRFVKGQFHEFQESTIGAAFLTQTVCLDDTTVKFEIWDTAGQERYHSLAPMYYRGAQAAIVVYDITNEESFARAKNWVKELQRQASPNIVIALSGNKADLANKRAVDFQEAQSYADDNSLLFMETSAKTSMNVNEIFMAIAKKL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ras-related protein Rab-5A
publication title High Resolution Crystal Structures of Human Rab5a and Five Mutants with Substitutions in the Catalytically Important Phosphate-Binding Loop
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein transport
total genus 58
structure length 167
sequence length 167
ec nomenclature
pdb deposition date 2002-11-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1n6iA00
2C04A 3UIEA 3IIJA 2XNDD 4JLAA 1SVLA 1EGAA 1IN7A 1NIPA 2HT6A 2XNDA 4G1UC 5HPYB 1Q57A 4CEHA 1CR2A 4LI0A 5CITA 1LF0A 4NCHA 1P62B 3C5CA 3TKLA 3DKPA 4XVRA 2GVZC 5KDLA 1N0WA 1GDDA 3KKPA 1G41A 5J47A 2FEOA 2HF9A 1FNMA 2J0VA 1M74A 1UKYA 1M1YE 1HEIA 4BFSA 3AF3A 2JLVA 1I2MA 3RRMA 4MGKR 2ZRGA 4QRHA 2NPFA 1KK3A 1OFUX 1N6IA 3PQCA 2GZHA 5FOXA 5JSZA 2W0SA 3JZAA 4D2IA 4NCIA 3O8CA 1TU4A 4MRSA 1NJGA 1XTIA 2H57A 4AKHA 2XGJA 1ESNA 3TVDA 2OLJA 4G01B 2P6UA 5GVSA 3K1JA 1XD9A 5JMTA 3UANA 2VHUA 4PPNA 3R8FA 4N3NA 4HAXA 1XTRA 3NHAA 3QF7A 4JLMA 2AD1A 1IXZA 1BKDR 3GJ3A 4M1SA 1EX6A 1ZM2A 3DMNA 3CM0A 4WAUA 3KQUA 4IFBA 2OCPA 5FTMA 5DI3B 3TUJC 2LKCA 2QPTA 4A2PA 4B6FA 5BN5A 3MUFA 1CJTC 2GDJA 1C1YA 1RKBA 4WIAA 3U44A 3A4MA 4IW3B 1KI6B 1ZU4A 5K8LA 4C2UA 1LW7A 1T5LA 1NMXA 5HE9A 1WA5A 2ZJAA 1AS2A 4KYIB 2AWOA 2CCJA 2QI9C 3BOSA 3OEHD 2Q0HA 3LLMA 3OEHA 5KNCA 2CDNA 5EP1A 2FFBA 4QBFA 1BO6A 3HU3A 3B7GA 3OHMA 3ND9A 1JQLB 2SHKA 3CZQA 3CNLA 2C96A 3LRPA 2A5DA 4QGFA 4F92B 4DB2A 4V0ME 4TTQA 4ESVA 2NMVA 2CVHA 1WP9A 3I73A 2XTNA 5CIWA 1E2QA 2N42A 5FR2A 1RVDA 2OBMA 4Q4JA 4XWAA 1KY2A 1QHXA 2WJVA 3QXHA 1DOAA 3U6KA 2CEAA 3AKEA 2JJ1D 3TGPA 5F98A 2MSDB 2JJ1A 4C7OB 4OQMA 1QG2A 2O8BA 3KTAB 5AUNB 2ZITA 1BIFA 1FP6A 2BBTA 2FX3A 1GUAA 1M6NA 2CHVA 3EG5A 2NQ2C 3DO6A 1Q21A 5CLQA 2YVUA 4Q9JA 3VHLB 4QGGA 4DSUA 2XXAA 2QRZA 4P32A 3RS7A 2QTFA 2Z4SA 4DDVA 1FX0A 3NWJA 2I4IA 3ZJYA 1XPRA 4RD3A 1Q20A 3ZLJA 2ZR9A 1DADA 3H1TA 2P0EA 2D3WA 2Z0MA 2OT3B 3CX7A 3ZVRA 2D06A 2FPLA 4G0NA 3REGA 2J0QA 1Z22A 3UG6A 2B21A 1ZNZA 2WPDD 4D0GA 1JNYA 2WPDA 1KKMA 4R7ZA 4YONB 1KZ7B 2J46A 3PR1A 4IVQA 2HXSA 2Q9CA 4UNSA 1Z0IA 4PHGA 2QSYA 4LYJA 1FQJA 2CLCX 2ZSAA 1N25A 3BORA 3B5JA 1GITA 4EFLA 2DFKB 5FUXA 4UNRA 4AYWA 2GILA 3R20A 2VH5R 2P65A 4TLEA 1E0SA 1YVDA 3NBZC 1JAIA 5FH9A 2V7QA 1IN8A 1CLUA 1F2UA 1OXTA 4NPHA 1RRPA 1W4CA 1VG8A 3KX2A 4BLTA 4FCTA 4DB4A 1XZPA 4OKSA 1LTQA 3REFA 2PX0A 1KI3A 2E87A 3LW7A 5KSPA 5K8TA 3QKTA 4AKEA 4RZUA 2EFHB 1ZP6A 5JHGB 5CYOA 1R5NA 1Z0DA 5J40A 4A2WA 2REOA 1G3RA 3A58B 2A78A 2Q3HA 4LHVA 2ANCA 4J0QA 1Z47A 2WJHA 2ZI5A 3N2EA 4KHZA 1XX6A 4WOPA 1SKQA 1NN1A 1UBCA 2ORIA 5JZVA 1K8RA 3DVLA 4PC7A 3K09A 2ZANA 2FH5B 2QNRA 2QTVB 1B23P 1E9CA 3I5XA 3I5YA 1P2TA 3I61A 4R71A 1Q1ZA 3GLGE 5AK0A 3K70C 4BFTA 4RZ2A 4CW7A 1MRNA 4IDHA 1T8TA 3I72A 1OIVA 4DVGA 4Q9IA 1PJRA 1UBFA 5DI9A 4QHTA 2AKAB 2B7CA 4B32A 3RS5A 3ICQB 4WXRA 2NO1A 1E1QD 1LF5A 3BD9A 2WKRA 5AJVB 3RLFA 3TSWA 2QORA 1E1QA 5HTKA 1Z8FA 3VR4A 4ZIRA 4NE2A 4DEXA 4DLUA 2XSZD 3AKDA 3K9LA 4OQNA 1AN0A 2XSZA 4US0R 2OHFA 2W0MA 4FMCB 3NKVA 4KCGA 4Q7JB 2GVDC 1KSFX 2GA8A 4JLNA 5C2JB 4KFSA 2PMDA 3U3MA 3T15A 2BEKA 2F43B 3SFVA 4C0QC 4HAUA 4MGYR 1HT2E 1Z08A 4OJKA 4Q1DA 3VFDA 1E2KA 4PHHA 3GCGA 1OYYA 3GEEA 1JB1A 4Z51A 2C98A 1E0AA 4AIIA 5B64A 1A2KC 1WF3A 721PA 2FGKA 2D7DA 1Z07A 2GXSA 4NYMR 4XH9B 3DMDA 4LSGA 1SULA 3G82C 3L0IB 4HLQB 4JMPA 2R6GA 2G1JA 1IJFA 2A5FA 4LOAA 5KO2A 1A5TA 3U60B 1GG2A 4QHYA 4Q01A 2F6RA 5EXXA 3AVOA 2ZPTX 1M8PA 2KBEA 4R2HA 1BOFA 3MD0A 1G3MA 4MGIR 2BBWA 3LXXA 4GNKA 3GLIA 5B58C 3IUYA 3ZS8A 3AKYA 2FSHA 3DZDA 5F3WB 4NMMA 4G5SA 3D6TB 1W47A 4C0AC 3UKDA 5FPKA 2ZS8A 3KQNA 1WQ1R 3T12A 1E94E 1UF9A 2EFGA 2P5SA 3I4LA 5AJYA 4EPXA 5JEEA 5IRCD 2O8EB 4DLRA 4KFRA 2GK7A 3NTUA 1EG7A 2H18A 2FDCA 1G8HA 2R6CA 5DGXA 5H1YA 5L3SA 5G40A 2A30A 3H86A 3KB1A 4KJZA 4FCWA 3IEVA 2G83A 1JECA 1KHTA 2EFDB 2QMHA 3U3RA 4U5XA 3SJAA 2ZYVX 2QUZA 5FPHA 5G41A 4TQ9A 2XZPA 2B6HA 1MRSA 1AK2A 4FN5A 1A1VA 1DG1G 1XP8A 3AQ4A 1AJEA 2ZU0C 4EPWA 3B1ZA 1TAGA 4U7DA 1CRPA 2QAJA 1V43A 5LPNA 1E2LA 4TLDA 2RGEA 2GTPA 1NY6A 3S1AA 4AG6A 2GJAA 2HV8A 3SE0A 5B30A 4LYFA 3LBHA 5BWMA 2JLZA 4PX9A 4QM7A 4NYIR 1SVMA 3AGPA 4X8OA 5GJBA 1OT3A 2D7CA 4QBIA 2VHCA 2PZEA 4IDNA 4P4TA 3GMTA 4PO8A 2ZM5A 4DKXA 4FCVA 3DL0A 3K9HA 1OSNA 2YINC 4KODA 3QKUA 3AVPA 3WP0A 2FPMA 4IXMA 4Q9HA 4KI0A 3M4YA 2R44A 2GK6A 1E99A 421PA 2JLSA 1ZD1A 5D3QA 5JFGA 2R65A 4HB3A 2G3YA 3B8HA 2GNOA 3BE4A 3QJYA 5EXSA 1RRCA 1U81A 1ODFA 4Q66C 2BWJA 4RD2A 2ODBA 2VRWA 3GLGB 2C8VA 3TJZA 2CCGA 1Z0AA 4ABYA 1E2HA 3QEOA 5KNDA 1LS1A 2W6ID 1Q44A 4LX0A 2W6IA 3F0TA 3QKRA 2ZREA 3PENA 3R9WA 5FOWA 2WMNB 2OEPA 1IJEA 2W83A 4W9MC 5DISB 4Q1AA 1PLLA 3TW8B 4BWYA 3R8CA 4Y0VA 3SI7A 4E09A 2ZAMA 2PL3A 3PUXA 2OBNA 1XD2B 3DKVA 1XMSA 1E4YA 2AXPA 4DXAA 3HYTA 3FPAA 1ZM3A 2ZRPA 3C41J 1E79A 2ZYWX 1YU9A 1FQKA 2OXRA 3O47A 3NC1C 4TL6A 2VP6A 2WSMA 3CRMA 3QG1A 4HB2A 1RPZA 3B13B 1KKLA 3J81k 2JASA 1XZQA 1IY1A 1ZM4A 1IONA 5CYPA 1KAGA 4D80A 2W00A 3NBFA 5E7IA 3BK7A 3ZS9A 2VQSA 3LWNA 4BE7B 4YMSA 2VHJA 1XFAA 3WYAA 3BH7A 3SYNA 2BJWA 5BN4A 1ZW6A 2ASEA 2ZJ8A 2X1VA 3THXA 1MO4A 1MO3A 4MA4A 3MAAC 2QP3A 3P4XA 1E9DA 2D4HA 4Q1FA 3D31A 3K53A 2P67A 4DIDA 3A4LA 1KMQA 3K0EA 4IOKA 1NNEA 4FW9A 3PCRB 2EW1A 1R2QA 3RS3A 4UNNA 2FNAA 3HWSA 3VU9B 2FFHA 4HB0A 5TY0A 2GCNA 2IXGA 5JSZB 1GKYA 5F9FA 4IEIA 4OQXA 5HZHA 1E2DA 2WJGA 1ZD8A 5FTJA 1D2EA 1VIYA 1TADA 1TQ2A 5EE9A 5H68A 1NVVR 3JVVA 1J2JA 1JQJC 1DE0A 1OKKD 3AVQA 3CB4A 3CLVA 1OKKA 1GWNA 1T91A 1QRAA 1YR6A 2ZR0A 3IHWA 4ZPXA 4AI6A 2ERYA 1P6XA 4A8JC 4B34A 1E2EA 4EPYA 1U8ZA 3AKCA 4UXHA 1W4BA 2HJVA 2ZE8A 4KAXA 1IQPA 4PQFA 4CDGA 2QM8A 2J45A 2OCAA 2KJQA 5B2ZA 3WNCA 2DFLA 1N5IA 2VF8A 3MWYW 5JRZA 1KI2A 3U44B 4RVCA 4D0LB 1W0JD 4DDTA 4EQ6A 2PJRA 2Q9AA 2ZU6A 1JR3D 5FL3A 1JR3A 4OQFA 3VR3A 2WBLC 4MDEA 2IW3A 5L3QA 3PEWA 3CIOA 4MUAA 1F6BA 2RAPA 4RFSB 2B8TA 3K70D 1O3YA 2GRJA 4Q03A 1G291 2UZIR 3X1ZA 4CEJB 2ZETA 3TMKA 2H1LA 3EZ9A 1T9HA 5LD2B 3WHKA 4Q4AA 4GZLA 1AQUA 1HURA 5FOTA 4K81B 4TYQA 2HUPA 2J9RA 3TRFA 4Q21A 3EA0A 2ZRMA 2ZI7A 4JVNA 1R0YA 2IXEA 2QPOA 3MWJA 5FTNA 2V55B 1UM8A 2IYUA 1G7TA 4RD6A 1IHUA 2H7VA 1VIAA 2G0NA 1U98A 5IK2D 3L43A 1NBME 2C9CA 5IK2A 2GJ9A 4AKGA 4QOSA 5JI3E 4KBGA 2DPXA 1CXZA 821PA 3ZDQA 4JS0A 3NBXX 3KUDA 1E2IA 1U9IC 2WIBA 1Q1BA 1T8UA 3B9PA 3TQFA 5A4JA 1G4UR 3U7HB 4Q7LA 1G19A 2CJWB 3PUYA 4L9SA 2W2XA 2ZJBA 3HPRA 1W5SA 1W36C 2O8DA 1H8HA 4JLKA 3UMRA 4GMXA 1US8B 1CF4A 1QHHA 1D6JA 1II0A 2FFAA 1AQYA 1HQYE 1CJMA 3BAFA 3RRZA 3C5HA 4I1SA 1GRQA 2RH5A 3IILA 1LB1B 4URUR 4NDZA 2AX4A 4A0RA 3QKSA 2PBRA 2ZSEA 3LDAA 3SFZA 1T3SA 3WYGA 1KY3A 3DDCA 3G5UA 3GLIE 2F55A 1GL7A 4B35A 4FIDA 4C0SA 4IVRA 2IYRA 1AKYA 1G7SA 2HCBA 2CXXA 3ZZ0A 2GCOB 2NPIA 4ESHA 4BLQA 1G5TA 4NYMQ 4BEBA 4DSTA 5TDHA 3U7FB 1TUEA 2QMOA 2RB4A 2IHYA 3TUIC 2P6RA 2PEYA 4JBXA 5FBWB 3UWOA 1XJQA 3BXZA 3LAWA 4LCBA 1S9DA 1NN0A 4B2PA 1OYWA 2VSOA 5FBQB 1DO2A 1LS6A 2IYSA 1W48A 1G20E 1PVOA 3X1XA 4ARZB 1GIAA 1VHTA 1ZIOA 2J0SA 2G88A 2CVFA 4JBYA 3W34A 3TSOA 4CEIB 1XD8A 5KPDA 2ZXUA 1JAHA 2QAGB 1I4LD 2R6DA 1OB5A 1L2TA 4EIWA 3SYKA 1P60A 3IO3A 4LUCA 4I1OA 2EQBA 1OXVA 4NHOA 3QQ5A 5EZ6B 5D3MA 2GEDA 3ADCA 1L8QA 3DOEA 1SXJC 4CT4B 2V1XA 1W4AA 1VCNA 4F38A 5IHPA 4WZBE 5KDDA 3WMEA 1W0KD 3GJ6A 4M2LA 5JS8A 1W0KA 3RS4A 1ZUHA 4MYTA 4NZYA 1R0WA 1SQ5A 3BERA 1W5TA 1GVNB 1Q1QA 3CONA 3PEUA 1P2UA 5SZHB 5FBVB 4AY2A 3QENA 4RY2A 3FOZA 4JYCA 2JJ8A 3FMPB 4PPGA 3BC1A 2EWVA 1FZQA 1HYQA 4R2IA 3FFBA 4P0TA 2R62A 5JEDA 4Z8YA 1GOTA 2I1QA 3CRW1 2FA9A 3C7KA 1G9XA 2ZS9A 1SHKA 1YE8A 4KYUA 2ZRKA 4L16A 5CK4A 1N5LA 4URYR 3VMFA 5CIQA 1HTWA 2V8OA 3MFYA 2ZRJA 2HF8A 1XBTA 4DIEA 2D74A 4UQOA 1PUIA 1FMJA 2F1IA 3RWOA 4D4KA 1AS3A 4PAQA 3R7WA 1WDTA 1F48A 4UJ3A 2W2VA 3WBJA 2GCPA 2FFQA 1NSFA 3E5HA 3EA5A 4N0DA 4LJ5A 4ZKDA 2AN9A 5F9HA 2VLIA 3K0AB 3AP2A 2QMEA 2KI5A 3HDTA 4R9UC 5TXGA 3EWSA 4C0BA 1QHGA 2NO7A 1UBGA 2R2AA 3GLHA 5B57C 1UDWA 2GXAA 4LJ7A 2CLDX 1ESMA 1FOEB 2PT5A 3AF1A 4PC3A 3RDPA 2HYIC 1D9XA 3EZ6A 1SKYB 4HUQA 4GP6A 1XJ0A 1R0XA 2H8KA 3NHBA 1KZGB 5E3HA 4Q9LA 1S9HA 2H17A 3EZ7A 4EPVA 2G77B 3CF0A 2FGJA 3EASA 1XPUA 5KNBA 3FHTA 3AVYA 2ONJA 2P3SA 221PA 1ZCBA 2JDID 3MG9A 5A0FA 3ASZA 2Y8EA 4DSOA 3AVVA 2JDIA 3QPVA 3GJ8A 1XJCA 2YWGA 1T3LA 2GF0A 2PZFA 3AVXA 1WE2A 4W7SA 2FMXA 3FVQA 1CR1A 3OAAD 1G5RA 1KAOA 1G5PA 3U3JA 4BFZA 4NP6A 1QVAA 4GOKA 3OAAA 4M9QA 2O8FA 2FU5C 1VCMA 5IT5A 1OXUA 3T35A 1Q0UA 2WVJA 3GLIB 3AVUA 3R9XA 1E9AA 2IYXA 1DELA 3PITA 4D0NA 3QBVA 3QSYA 2WAXA 3MCAA 5LB2A 3THYA 2IHBA 4I4LA 2QT1A 1TMKA 4B44A 3EC2A 4A0FA 2GJKA 3EAQA 1KDOA 4EDHA 2IK8A 5L3SB 4DCVA 4LV5B 3UG7A 4FI3C 4PQRA 5DHFA 4PSAA 2J41A 1P5ZB 3ZD6A 4PANA 1KK0A 2E1RA 2LKDA 3LLUA 4A8JA 4GDFA 1KI4A 3Q3JB 2HYDA 4GT1A 4OI0A 2AFIE 4E22A 4D4MA 2W6JD 3BB3A 3TQCA 5KSYA 3U6BA 2W6JA 1Z2AA 2BBOA 3NH9A 4JZKA 1GZSA 1SVIA 2QBYB 4QJ4A 4P4SA 1E0KA 3UATA 3VR6A 3GEHA 4HDQB 1NVVQ 1ELOA 4C9BA 3VNVA 1G7CA 1FMLA 1ZC4A 1ZNXA 1P2SA 4EJSA 3RSOA 3TAUA 1YQTA 3C8UA 1S1MA 3GQBA 4MRPA 1NLFA 2QA5A 3Q5EA 4PO9A 3ZZTA 4A36A 2EYUA 3T1QA 4A2QA 4B74A 4YMUA 1II9A 3OFND 3VNUA 1E9EA 3EIQA 3K0CC 4EFMA 1BYIA 4PR0A 4BGDA 3MRSA 3BWDD 621PA 3K0FA 2QM7A 2X2EA 1RFLA 4S2EA 1L4UA 2ZRHA 1KO8A 1G7RA 5KPJA 2YWHA 2ZSFA 1D2NA 2HT1A 4RD4A 1KDTA 3RSLA 1A82A 1EWRA 2P6NA 4JLPA 4V0KA 3ASYA 1XEXA 3EARA 1RJ9B 1N0UA 1YZKA 2P5TB 4LPSA 3KKQA 4TYWA 2NG1A 1YHNA 3FGNA 1OV4A 1U9IA 3MMPA 2Z43A 3ZQJA 2BCGY 3WYFA 2KSQA 4CT5A 1ZC3A 4TT3D 1YZUA 5C46F 3PUVA 4TT3A 1WBBA 1CR4A 1N6LA 1CU1A 2FJUA 1S4QA 3B60A 3H2YA 4PZLA 3T06B 3X2SA 1RRGA 4BLOA 1KO4A 1KJWA 2AK3A 5KUTA 4XSGA 1XTQA 1UEIA 2J1LA 1EFCA 1OFHA 4LY6A 3BBPA 3CX6A 2WV9A 2VP0A 2IYVA 3UPUA 2I1VB 2FSGA 4NONA 521PA 4PPFA 1FUKA 4H1UA 3KXKA 4JVMA 3HP1A 1W7AA 1OH8A 4K46A 1OW3B 3RRYA 3KFXA 1F2TA 4UKDA 3CPHA 1EFHA 2MSCB 3EIHA 4EUNA 3A6PC 4LRWA 3D3QA 1EESA 3EPJA 2QGNA 5AUPB 3FMOB 4ZCLA 2OXCA 4HB4A 2G6BA 1Y3AA 2BC9A 2MMCA 2RGGA 4HLCA 5JJIA 1L4YA 4JYBA 1XU4A 4QBHA 3K0SA 3LBNA 4WZAE 2WZQA 3SQWA 2VSXA 3P1JA 1UBEA 3BH6A 1QHSA 4O3MA 3HR8A 5BXQC 3RC8A 3W6NA 3A1SA 2L0XA 4AWXA 2XB2A 5KU1A 3LH5A 4QGHA 4NCNA 2ZUCA 1UJ2A 2J0UA 5EE3A 3SHFA 4BQSA 1E96A 1TQ4A 2QTHA 4FMDB 4FWTA 1Z6TA 2GHIA 2DWQA 1P4SA 3X1DA 4BPBA 1PLKA 1KI1A 3U4QA 1DO0A 2ANBA 5EQTA 1ZU5A 2IF0A 4DC9A 2IS2A 5AWFC 2WSSD 1G3IA 2BKEA 3AUYA 2K5UA 1II8B 2WSSA 3BJIC 5BN3A 3IKJA 3T1OA 1SXJD 1YJ5A 1SXJA 5JRJA 1CBUA 1OE0A 3TK1A 4CZ2A 1RYHA 2N1BA 4ZCIA 3QF4A 2PX3A 1HT1E 5AUOB 2ZQ5A 1FPMA 2ZJOA 3Q85A 1TPZA 1JPNA 4W5HA 2GXUA 4AC9A 2AXNA 4OHXA 1P73A 5KSOA 4LBVA 2A5JA 1KK1A 1YR8A 4IHQA 5CB8A 1NLYA 4Q4HB 1S96A 5JWHA 5LBIA 3GJ4A 4ERNA 4B3CA 3BS4A 4KU4A 1XXHA 4KFUA 4Q1BA 4F4JA 1PV4A 1VCOA 1Z6GA 2FSFA 2V1UA 5HKKD 1OIXA 1NKTA 4OL0A 1GP2A 4JSYA 4TZ0A 5HKKA 1Z29A 3IHLA 4HAYA 4IJMA 4BECA 2QQEA 3L8YA 4C0KA 1YZQA 4GSYA 3WP1B 5K8IA 1V5WA 5FI0B 1CR0A 2OCBA 3M0EA 4KV9A 2V9PA 4XWOA 4LHZA 3LXRA 2NZ8A 1GNQA 1Q1EA 2ZJYA 2Q21A 3E1SA 3I8XA 2VYFA 1MR3F 2WAYA 4JLVA 1VMAA 5C4GB 3A1WA 1BMFD 4D4JA 5KTYA 1EFRD 2D62A 3MJRA 1BMFA 3ONWA 2FG5A 1EFRA 3RABA 2XTZA 4MQBA 1R5OA 4B3FX 2Z6VA 4G5OA 4YDSA 1RW4A 3W3ZB 1KDRA 2FE4A 3DZ8A 2WICA 1TU3A 4OI2A 3PEYA 2CMKA 2ZUDA 4FD2A 2EYQA 2QE7D 1OLOA 1PLJA 1X6VA 4PSKA 4PPQA 4V02A 3W8RA 2QE7A 3W6OA 2F9LA 2R6AA 4B2IA 1WBDA 3BRWD 3M6AA 3QEJA 4YC7A 4PAMA 3HU2A 2G1KA 1GRRA 1OXXK 1WMSA 2CE2X 2REBA 4B75A 4TSFD 4BEJA 5FOUA 3WBKA 3Q9LA 3NIBA 4TSFA 5DI3A 5C1BA 2DCUA 4HDOB 4TL8A 5JS7A 1E69A 1E6CA 1G8GA 3RRNA 3T5DA 5LDDC 1N6HA 1T5IA 1SVSA 5AR1A 1I4TD 4ZDWA 3VAAA 4Q02A 1F60A 2H16A 1DPFA 4PFSA 3QKSB 3T5GA 3TR5A 3CR8A 2IXFA 3CF2A 3CZPA 3OIYA 3QXJA 4U00A 4BRUA 4B3GA 2C2HA 1OH6A 1NN5A 1T0HB 4HLDA 2HEIA 1IY0A 3W5JA 2FPKA 3F3YA 1EK0A 4JVSB 5HCNA 1Q12A 4JT2A 4N0EA 5EP3A 4M9XA 4Y0AA 1D2MA 4HZUB 2OCYC 3RAPR 4XIGS 4Q18A 1KSHA 2IL1A 4IXNA 4KVGA 5FPTA 2EFCB 5EE1A 3GPLA 2YKGA 1TEXA 4B2LA 3KL4A 2WJJA 1KOFA 4A1FA 4O2RA 2OBLA 3QVVA 1MOZA 3SJCA 4ZI3A 2DWOA 2ZRLA 2OFWA 2RGBA 3B2EA 3QNUA 2RKOA 1SHZA 4BFYA 4M53A 2WKQA 4Q1EA 5JCZA 3LV8A 1TNDA 4PAOA 1OJLA 1N5JA 5D3MB 1K5GA 2XB4A 1G3UA 4TWZA 4B43A 2O0KA 2XTMA 4C30A 4MRNA 1E2JA 1ZBDA 4DWJA 3BB4A 2CHGA 1MABB 2ZSBA 3VX4A 1ZMXA 3FWYA 3IPYA 4QNRA 1E2FA 4MRRA 4URVR 3WRYC 1CULC 2AFHE 2BOVA 4NH0A 3RANA 2ZI6A 4MUBA 2D2EA 3KB2A 1QVRA 2PZGA 4B76A 2BMDA 2J3EA 3AF4A 5G3YA 5CB6A 1GL9B 2XOKD 3IBGA 4OQLA 2EWWA 1MH1A 2XOKA 4YMWA 3TR0A 2HCJB 2OFXA 3L2OB 3K0CA 3ZD7A 2RGNC 1KYIA 1QHIA 3BFVA 4HDCA 2WWYA 1VDZA 2J5XA 3L0SA 1I2DA 4DDWA 1U90A 1OIWA 4FWIB 4XSHA 1HV8A 1W49A 4PC1A 1UDXA 4XOIA 3SZRA 2FWRA 4CEHB 3TVTA 4PZYA 1KSGA 4Q7MB 4TTRA 1P9WA 4BUJA 4B6EA 5TARA 1HH4A 3RYTC 2O0JA 1Y63A 3IIMA 3KJHA 2AK2A 4X8LA 3PG5A 2YOFA 4H9GA 5G53C 3E2IA 2ZIAA 3KXIA 2UZ3A 1YZNA 4XWKA 2YYZA 1CTQA 4PZZA 3OIVA 1VCIA 4TQUS 5JI2E 2F3TA 4II7A 2QGZA 2QENA 4KO8A 4HZIA 3A4NA 1XPOA 2W2TA 5JJKA 4GMDA 4V03A 2F7SA 3CH4B 3PXGA 2XEXA 1R8QA 3QIAA 4L8GA 4ZKEA 5EUMA 1ZAKA 5FBRB 1B0UA 2IUUA 1KSJA 1KIMA 4F91B 4B3DA 4LBWA 4GRAA 3BFXA 3W5IA 1XMIA 1ZYUA 1HE8B 3NBYC 3K9NA 2CNWD 3I92A 5JCPA 2CNWA 4GI7A 3L82B 4QGAA 4HYYA 3AVWA 2QP4A 2IEZA 2O8FB 2A5YB 2ZRIA 2IYTA 1G21E 4I1VA 5DE3A 4DRZA 2ZRNA 4KITB 4MITA 2IYQA 2YWEA 5EE5B 2PCJA 3AF0A 3CRRA 3MSXA 1E9RA 1W0JA 4D6PA 5G3ZA 1ZJ6A 2BM1A 3HU1A 5LD2C 1R8SA 2QN6A 3WRXC 2BJVA 3QPUA 3BFKA 4F4IA 5FL7D 4NBSA 1JR6A 4G5QA 3W8NA 3L0OA 4AG5A 1R5BA 3R9IA 2F1RA 4LHYA 4ZDIA 4DLSA 4MYHA 4GL2A 1UEJA 1KNXA 1D9ZA 1JXMA 2ECKA 4HEJA 1SXJE 3ADKA 4PSVA 2HXYA 4DLXA 2VTKA 5CJPA 1J8YF 2ZYUX 4OK5A 4YLGA 5H8WA 4F7WA 1G3QA 5A5GA 1YRAA 3O8BA 1GM5A 4LDJA 1A7JA 3THWA 2QMUA 4D25A 1Q22A 1ZM9A 4YDHB 1OH7A 4Q4JB 1NLZA 2XJ9A 1X86B 2PMKA 3H0KA 1VYVA 1FFHA 3KQKA 2C95A 2V6JA 3JZMA 1NI3A 2RMKA 2ZROA 3NEYA 2ZRDA 5EXPA 1AGRA 1XXHE 2BMEA 4EPRA 1PZNA 2D2FA 2O8BB 1DG3A 2A2ZA 1IXRC 4G3XA 1K5DA 3IGFA 3WMFA 2OM2A 4EJSB 4OYHA 1X8JA 3W9YA 2F9MA 1VPLA 3B82A 4UXIA 2C78A 3BB1A 4NU0A 3HYRA 1P9RA 2YC4C 4GOXA 2QPAA 3N5CA 2GZDA 8OHMA 4P31A 2XXAB 4TLAA 1FX0B 2GESA 2GETA 4B71A 1U0LA 1E3MA 5TB5A 4QXAA 5JECA 1AZTA 1N6RA 4ACAA 4C2TA 3K0FB 1AZSC 2H92A 2IEYA 5HCIA 5AJWA 2VEDA 2JLQA 4D26A 2YNMA 4H1VA 2O8EA 1DTSA 4JIMA 1N6NA 3GEIA 4TLCA 3KJEA 2Q3MA 4MYUA 1J8MF 1Z0FA 1YRBA 2ONKA 2VO1A 2ZE7A 2A3RA 3HPQA 2HLDD 4TYNA 1ZINA 2O8CB 3KKOA 3IQXA 3K9GA 2HLDA 2ZRFA 3LD9A 4JLOA 1GKUB 4LJYA 4MKGA 4D82A 3KKNA 4Q4LA 4BFUA 4ZDKA 1IXSB 4FMCF 3SR0A 5CJ2A 3PVSA 5C18A 3O8DA 1S3SA 1S3GA 2QAGC 1GAJA 3Q72A 5EUQB 3RNLA 2P2LA 4GFDA 4XJXA 2FV8A 3A8TA 1AGPA 3SN6A 4E07A 4LJ9A 3AH8A 4OK3A 1DVRA 3CKLA 1UADA 4CYMA 2F3RA 1U0JA 2NTYC 4LWZA 4OJQA 4L5BA 4L15A 1G1MA 2IUTA 4QL3A 4O0MA 5EJEA 1NF3A 1IY2A 2RHDA 1R0ZA 1DAEA 3I62A 1JALA 5DSZA 2Q3FA 5FOSA 2IS1A 3EZ2A 3PUWA 2VL7A 4QG7A 4D81A 1NN3A 1SVKA 1IOZA 1F2UB 1NVUQ 2Z83A 4QJ5A 1QBKC 1KMHA 3PIRA 3MWKA 3V9PA 5KHOC 2BEJA 1EXMA 2NOAA 4A82A 3QXSA 5DN6D 4A15A 2YWFA 2ZVQX 1X3SA 2N46A 2BM0A 1S2MA 2BMJA 3I3SR 2LWIA 4A92A 2QL6A 1KNQA 4UNPA 1G4AE 4O2LA 2ZEJA 3F5FA 3TNFA 5DLQC 1D5CA 1GTVA 1HQCA 2O52A 3QY0A 1G8YA 2QU8A 1MT0A 1VECA 1ZUIA 5JJLA 3GLGA 3O8RA 2J0UB 4TMWA 1WXQA 1QDEA 4O25A 4L4UA 4CRWB 4AURA 2VIIA 3SOPA 4URXR 2DFNA 3RC3A 4NL4H 3T1TA 1OHHD 4IRUB 2UKDA 1OHHA 2E9SA 4BZPA 4LJAA 4NYIQ 2IYWA 4B3XA 3VTKA 2JLUA 1ZM7A 3GJ5A 4V0NA 1KO5A 2DYKA 4F93B 1YZLA 4CF7A 3OF5A 1JBKA 1GRNA 4DT1A 2A7QA 4DZZA 1C4OA 3Q7PA 3QVUA 1G64A 3BIFA 4DCUA 5FPYA 2RGXA 2JLWA 3CO5A 1U0HC 1G16A 3LX5A 1NIJA 4Q19A 3I1FA 2IWRA 4ZIRB 3TSZA 5J4KA 2ZUBA 3SJBA 5KDOA 4C3ZA 1NVWQ 4Q9KA 1VKJA 3C14C 2ATVA 2CL6X 3LO5A 1XTKA 3P26A 1W46A 1XXHB 3UK6A 2IUSA 3P32A 1QHYA 4OI1A 2YZ2A 2IA5A 3NDBB 1NY5A 1FNNA 2RGNA 2IX3A 4HUTA 3QBTA 5E7JA 3B85A 4EAQA 2F1HA 2GAOA 1D8TA 4RSGA 3E70C 5GVRA 2GEVA 1Q3TA 5GJWC 2VHQA 1AA9A 4QJ3A 1P3JA 4NYJR 5DYGA 1XEWY 1EFUA 4M1OA 4DLVA 2BCJQ 2LCFA 1H65A 1T0JB 4M9SA 1LV7A 1R7RA 1YZGA 1P9NA 2FSIA 5J4VA 1HY3A 1P2VA 4KLNA 3VU9A 2QT0A 1AIPA 4JBWA 1DAKA 4B47A 3PJRA 1M34E 3A36A 1KJZA 1S1CA 3GD7A 5JBQA 3B78A 4JLDA 4MYCA 2B92A 2BVNA 3NH6A 4ZV4A 4B3BA 4LGMA 3CPEA 3RHFA 2NO0A 1DEKA 3EX7C 1WRBA 4HLUC 3T1VA 1NJFA 1JPJA 1MKYA 4IOMA 1P75A 2YOHA 4YMTA 2R9VA 3NDPA 4AYTA 1E1RD 2JLYA 2OZEA 1E2PA 1MO5A 1E1RA 4YXWD 2WHXA 1Z6AA 4YXWA 4OK6A 3WNDA 4PC6A 4B33A 2GEUA 3B1YA 4IFEA 5AJZA 2ORWA 2PH1A 3VQTA 4DSNA 1F3OA 1PUJA 3AF2A 3G0HA 2BBSA 4BZXA 5BQ5A 1TF5A 4QHSA 3LQRA 1XTSA 4HI0E 2JAQA 2WIAA 1P72A 1QHNA 2I3BA 3CF6R 4G5RA 1FW6A 4MRVA 4Z8XA 4TZ6A 3WXMA 4US2R 5HZKA 4GBMA 3S1AB 2QQ0A 4RCYA 4URWR 4RFSA 2EU8A 5CM8B 3AM1A 1TEVA 4ZCMA 4CEJA 4ZDJA 4MKIA 2FF7A 1JR3E 4DDUA 5IDVA 3TUZC 3VHXA 1SGWA 2X2FA 4TYPA 3N2IA 1H8ED 2QSZA 2V6IA 3LA6A 3AGQA 1H8EA 4ITRC 4A0HA 6Q21A 2WWHA 4BFVA 3IIKA 3AVTA 2UVQA 1TQDA 2GJ8A 2OAP1 3FTQA 3GFOA 2B7BA 4LHXA 1NP6A 2DFTA 3F8TA 4NTZA 1OF1A 2GBLC 121PA 4LV8B 3OFNA 4C0JA 4TMXA 1SVOA 1NKSA 1YZTA 5KYKA 3AV0B 2IS4A 1BH2A 3VKHA 1M7HA 2R6FA 3HJNA 1CP2A 5DIFA 4DEYA 3EPKA 1KI7A 3UMFA 4YQFA 3ADDA 2ZJ5A 4US1R 3V4FA 2AHOA 2Z5FA 2CJWA 1ZUNB 4HSEA 3RS2A 4DLTA 4NCJA 1KI9A 1U2RA 3LX8A 1US8A 3QKRB 2NGRA 3SYLA 1YR9A 4LBYA 4I99A 3KXLA 2GKSA 2J7PD 4I81A 3W6PA 3TAHA 1SVWA 2J7PA 3FDIA 5FUVA 5GADl 1KI8A 1XTJA 1XNJA 1W36D 4M1MA 4QFMA 3DM5A 1DAHA 1W1WA 2OILA 5TMPA 1U94A 1F5NA 1CRQA 1VYTA 3FE2A 1C9KA 3QXCA 1DARA 3VX3A 2C9YA 2FOLA 3P27A 3PFIA 3TIFA 5BYKA 5H70A 1A2BA 1NG1A 4PXAA 3EPHA 1LVGA 5JHHB 1ANKA 2VP2A 4RFVA 1QG4A 4FXPA 4DJTA 1J90A 3FB4A 3KQLA 2GCOA 3SEAA 2ZI9A 2O5VA 4JLBA 3W90A 1E9SA 5EP2A 1L7VC 1R6BX 2KWIA 2IC5A 2ZR7A 1Z3IX 4BLPA 1MV5A 1DAMA 2ERXA 2XZOA 1DAIA 3M1IA 2ZE5A 1QF9A 2VP9A 3KFVA 4GZMA 1Z83A 1ZD9A 3LQQA 1OFIA 3OIUA 3EXAA 4D4LA 2IYLD 3FMFA 1JJ7A 5SZIA 3D8BA 2WOJA 1JXOA 1RIFA 4ARZA 4A0GA 3LW8A 2GAAA 2B8WA 4GOJA 3THXB 2O0HA 4CEIA 2ZJ2A 5EE0A 3IEUA 2QAGA 2AKYA 2QROA 1NMZA 2V7QD 5F2EA 2IBMA 5SZJA 3VKWA 4A6XA 5FFMA 4Z54A 2A5GA 3ADBA 1U99A 4UJ5A 3U5ZB 1VTKA 4XTCS 3IBYA 4A6PA 2YOGA 3QOFA 2XZLA 1OXSC 4I1UA 1COWD 4M21A 4HAZA 1COWA 1KO1A 4OHZA 5JLJA 4PHTA 4TL9A 1K6MA 2ODEA 3NVAA 2Q9BA 2IF2A 5FR1A 3GLFA 1TUIA 2TMKA 3IO5A 4C0HA 5DYIA 1IBRA 1KK2A 3X1YA 1N0VC 2EFEB 4LC0A 1Z6XA 2J7KA 3OESA 2R8RA 4GP7A 3LFUA 4M1YA 4TL7A 2ZAOA 3U7GA 5FOVA 1UPTA 2MSEB 2VF7A 4Q7KA 2VP4A 1A4RA 4MKHA 5FUYA 3SQXA 1WB9A 2ZI3A 1T4GA 3TH5A 1DBSA 1ZVQA 1BS1A 3C15C 1T6NA 4C0LA 4IVPA 4BASA 3FKSD 1LNZA 1JI0A 4PTLA 3FKSA 4IKEA 1GNPA 4X8MA 5DO9A 1EX7A 2REXB 2FZ4A 2CL0X 2X77A 1YKSA 3ND8A 3BH0A 4NCKA 1J99A 1N3BA 4EQ6B 4BRWA 1EFTA 1DAFA 5TVKA 4URZR 2WWIA 4DLZA 1AM4D 2RGCA 4Q1CA 2AWNA 4LYAA 1N6PA 3GFPA 5L3QB 1R4AA 4JJKA 3GP8A 2QEQA 3V00A 3N70A 4Q48A 4AD8A 3FYHA 4IDPA 1NBMD 2JJ2D 3DOFA 4M8NE 3K70B 1NBMA 2JJ2A 3K0AA 1W4RA 4Q4AB 4HAVA 5J4YA 1Q3HA 1EWQA 2ODNA 2EVWX 2XITA 2J59A 3GJXC 3AUXA 1W44A 2OE2A 1X8LA 3THWB 4E03A 5JWRA 4RD0A 3LNCA 3KZ1E 2MMGA 4BLRA 4IEEA 3SBDA 3B6EA 3KJGA 4JVLA 3CPJB 1RYFA 3Q8XB 5AUQA 3RS0A 5ELXA 3DHWC 1R10A 1S0UA 2C77A 1CKEA 1RE0A 1IN4A 1J70A 3GLHE 3DEFA 2QRNA 1E32A 1TF2A 2HDNB 4LV6A 3WNBA 1XCMA 4Q5IA 2F1JA 3EPLA 2PEZA 4XVUA 1XWIA 1XRJA 5DNYB 3KDSE 2ZTSA 4N1AA 2BKUA 1SZPA 4MKFA 1VG1A 3I8SA 4IDQA 5IF9A 3H84A 3ZZUA 3LVRE 1I4DD 2DHRA 3CX8A 5GJCA 4EFNA 3DPUA 5E4FA 3SDZA 2O8DB 3Q5DA 4FMBB 5BYJA 1QHHB 2FZLA 4PHFA 1VHLA 3VR2A 4WVFA 4BZQA 2PT7A 1KI6A 2IYZA 5JWOA 1WCV1 2ZRBA 3NG1A 1E4VA 4QKQA 4DBLC 4JL8A 1JJVA 4RKEA 2ZVPX 2Z4RA 2OG2A 4PQYA 2V54A 2X19A 3LY5A 1Z0JA 4RKFA 3KQHA 3ZVMA 1RC8A 2QG6A 3B1WA 1UAAA 3VKGA 2ZYTX 4FINA 4Z1MD 4Z1MA 4HLUA 3A1VA 3L8ZA 1ZNWA 4NYJQ 1J7KA 4P33A 4BFXA 3AB3A 2WJYA 1FL9A 1E2NA 1N2CE 1P61B 1S8FA 3WMGA 1BYUA 5K8UA 1Z2CA 3L0PA 1T3HA 3RVBA 4M1KA 2WM9B 1ETUA 1NRJB 4YMVA 2GJSA 3B1VA 3UWKA 4XTRA 5CDFA 3CBQA 2RHMA 2QBYA 1DAGA 4M4SA 1UFQA 3C4JA 3TE6A 4C7OA 4RCZA 1XMJA 3KTAA 4BLSA 1E2GA 2C5LA 2VA8A 5BW8A 4KSBA 3SS8A 2JGNA 2WWFA 3NEJA 4RD1A 2CLSA 3CWQA 2IWHA 2WWWA 1KMHB 2KBFA 2AL7A 2WMOB 1IN6A 3JVUA 2BIFA 3TLXA 4P3YA 4K8OA 1E9BA 4EPTA 5AJXA 1CJUC 1JEDA 3AP1A 2J87A 4W5WA 1FTSA 3GJ7A 1GSIA 2QP9X 4M9ZA 1GILA 1XMVA 2VSFA 4OI4A 4QC2A 3QUSA 1GL6A 2NO9A 3SHWA 4TMZA 4JL5A 4DCTA 2GBLA 4DCNA 1KJYA 4R98A 1RJ9A 1QZXA 3FHCB 1IN5A 2V3CC 2G0TA 2IT1A 2PCLA 1GKIA 2BDTA 3QI2A 4A4DA 4KSCA 5KSZA 2VHTA 1TTTA 3MLEA 3X1WA 2QZ4A 3CRVA 4AYXA 2VP5A 1CEEA 3P4YA 4TMTA 4DCSA 1ZRHA 4ILEA 3ICEA 4ZI2A 4WXPA 3RWMB 4JJZA 5DHAA 5LB4A 3R7WB 2OO7A 4DT1B 1E9FA 4PO1A 2XJ4A 3B1XA 4TMKA 4QNMA 4DLYA 1N5KA 2FN4A 2WKPA 1XCPA 1IAQA 3OEED 1E79D 1CJVC 3OEEA 2JCSA 3EIEA 2YC2C 2NO6A 4HAWA 2JIZD 4TN1A 1GFIA 1LFDB 2A9KA 3U7EB 1U8AA 3H4MA 5FTLA 2JIZA 4KVAA 3GLHB 3LVQE 2DB3A 4LK2A 3DM9B 2GWHA 4M1WA 4X8HA 1Z63A 1KGDA 1RZ3A 3MJHA 3FFAA 1KTVA 1CS4C 2KE5A 1HA3A 3U3OA 5GJVC 4HUQB 2ORVA 2AD5A 4UXJA 3CWZA 3THOA 1OPXA 3CNNA 1Z6YA 4LHWA 4TYYA 1TX4B 4V0OA 1TQ6A 5L3VA 1RRFA 2ZSDA 2WOOA 2X8AA 4EKDA 3T61A 3GJ0A 4LZZA 5CM9C 4RZXA 4JL6A 1W2HA 3SNHA 4KFTA 1NMYA 3CNOA 2XNSA 4Q00A 3FHOA 2YV5A 4L9WA 5SZKB 4XVQA 4TLBA 2CCKA 3LBIA 4PC2A 2PLFA 1Z28A 1MO6A 2ZS7A 1II8A 2H5EA 4M22A 4XD7D 3U3KA 4NKRA 2NIPA 1CJKC 4XD7A 4IOLA 2IS6A 3W3AA 4V0MA 1IM2A 4M0LA 3THYB 4QM6A 4AK9A 4Q47A 3EC1A 2ODWA 1E0JA 4U02A 5CLLA 1FUUA 1HE1C 1M7BA 1VYUA 3GFTA 4B48A 3GLFE 1UKZA 4QBGB 5FL7A 2PLRA 1X8KA 2VPPA 3QE0A 4CGZA 5L8VA 1ZCAA 3FMIA 2OV2A 4LYHA 3WY9A 3D7MA 1OH5A 1XEWX 4Q4HA 3UMSA 4RJLA 1NVXQ 3MGCA 2NZJA 2CE7A 1UKEA 2BMFA 3CRQA 1X1RA 1O87A 4DLWA 1AKEA 4A8JB 1ZIPA 1CIPA 2OFOA 2WWGA 2KB0A 4W5JA 2Q6TA 3ETLA 4JKIA 1N6OA 2AR7A 4EJSC 2F43A 1OB2A 5J5CA 4C4PA 2O8CA 4JSTA 1G8PA 3SBEA 3A37A 2XX3A 4WA7A 3B9QA 2GF9A 4P4SB 3OIWA 3FKQA 2DWPA 1XB2A 4TQAA 4LJ4A 1XCGB 3KKMA 3NC0C 3V4RA 2CK3D 2BV3A 5EXTA 1VG0B 2CK3A 3IQWA 1ZNYA 4RZ3A 1NSTA 3ZVNA 3OE7D 4FMDF 4IDOA 2IYYA 3Q7QA 5E7MA 2OESA 3OE7A 5FI1B 2W58A 4OBEA 1FTNA 4KXFB 1XF9A 4OHVA 2CBZA 5J4LA 3SC3A 1M7GA 3IDQA 2C99A 5EP4A 4KLZA 1U8YA 2ATXA 4F4CA 2HJGA 1G6OA 4CVNA 3C16C 4LC1A 3PEVA 2BHRA 3KUCA 1Z5ZA 2WJIA 2DBYA 4JT4A 1HUQA 2GZAA 4JKYA 1SKYE 4M1TA 1XEXB 4G5GA 3K8YA 2RGDA 3CR7A 1FP7A 1H8HD 1VG9B 5ANRB 5EZ5A 2C9OA 4ASUD 4OHWA 2JLXA 3PV0A 2V4ZA 4ASUA 3SJZA 5HE8A 3AEZA 4ZO4A 3T34A 3CH5A 4OHYA 2JEOA 1NL3A 3ZGXA 4WW0A 1W36B 4TMVA 4DUGD 2WTUA 5CK5A 1G8FA 2RCNA 4DUGA 3PUZA 4V0LA 2JLRA 2ZI4A 3QXXA 1W2GA 3MWLA 3VR1A 1N6KA 4LPKA 3AP3A 4GPTA 1F2TB 4HZUA 2XAUA 4DHEA 1DS6A 1E2MA 3HR7A 5FBLB 5UKDA 4E5UA 2YHSA 3A1TA 5HR5A 2ZE6A 2WWXA 2OUKA 3QG5A 1AS0A 2G9NA 5E95A 3QPWA 4CIDA 2PJZA 3ZYCA 3ZQ6A 4WBSA 3ZVLA 5P21A 5M04A 5DN6A 5TV2A 4HATA 1TL7C 1GNRA 4POAA 1G18A 3EW9A 1KDPA 1OFTA 1XEFA 3SU8A 4TTPA 3K09C 1X1SA 5FUWA 2GXQA 1LY1A 2RGAA 4WZ6A 2C03A 4BFWA 4ACBA 3TW4A 3NXSA 3WHLA 2OSBA 3A1UA 4LJ8A 1NG9A 1M2OB 2CHQA 5FPSA 2OLKA 5CDFE 1ONBA 4A9AA 3ZIAD 3BGWA 3VR5A 3KJIA 3ZIAA 3IPXA 5KOYA 1G17A 4MGZR 4MH0R 3U4QB 2JATA 1Z06A 1MABA 3CW2A 3OZXA 1XDBA 3U2QA 3GLFB 3CUEF 3I32A 3P20A 3EZFA 4P4UA 4MDFA 1E98A 5C4MA 1P7CA 2CL7X 4LBZA 1SXJB 2ZRAA 5FTKA 4AKIA 4KBFA 3QF4B 2FEMA 1Z0KA 1UKVY 2DR3A 1TF7A 5J4HA 1G6HA 4JLJA 1XD2A 2YJTD 3ECCA 4S35A 2JA1A 3TBKA 3U61B 4UNQA 2OAQ1 2ZJZA 2VBCA 2ZRCA 4IOJA 5DH9A 4ON9A 4LJ6A 1JEEA 1YR7A 3UXMA 4B73A 3EWAA 3ZH9B 2QY9A 2DY1A 1KO7A 5L3RA
chains in the Genus database with same CATH superfamily
1KZHA 1KEEB 3GHHA 3I37X 3L1KA 3UIEA 3W2EA 3IIJA 2XNDD 4MUIA 1SVLA 2QTAA 4HFNA 1IN7A 2XNDA 1U65A 1Z82A 2Z1MA 3FUTA 3FVWA 3FZGA 1Q57A 3NW9A 1P62B 4PYOA 5B5SA 5AW7A 2XBMA 2PZ8A 1A50B 3DKPA 3QOXA 4PCUA 5KDLA 3WYCA 3RUPA 4RTMA 1LSUA 2AN5A 3KKPA 4L2IB 4CTJA 2FEOA 2HF9A 2JRLA 3OFVA 4JCOA 1FNMA 3TMAA 2RHBA 5K4GA 3QUQA 1UKYA 1NI5A 1Y1TA 5FHRA 1A8HA 2WYHA 1TVEA 4N82A 4BFSA 2C00A 3ZHZA 4UAGA 3I34X 1U8XX 3PP8A 2IOHA 3RRMA 3HVJA 2ZRGA 4QRHA 3PNMA 1LPPA 3KALA 4CIVA 1XR3A 3EQ2A 4G09A 2GZHA 5JSZA 4AO6A 1N34B 4R2JA 4G8DA 4DRXA 3O8CA 3JSAA 1XMOB 2WIGA 3ZLTA 4DLKA 1NJGA 1RMYA 3RBZA 3GPBA 4AKHA 1J0DA 1F2DA 5E1OA 1T1JA 1F9EA 3G2NA 1QVWA 2FZKA 2WF5A 1WEKA 1ESNA 2EG5A 2ZULA 3DAYA 4HAIA 1TVKA 4LXHA 4ANFA 1J8FA 3WFIA 3K1JA 3MS4A 2ZCVA 3OLYA 3SQNA 4JCCA 1FS4A 3K9CA 4PPNA 3R8FA 3DBHB 4N3NA 2MDTA 1EDDA 2IDMA 4DG8A 2AD1A 1LQ2A 2GZ3A 4M1SA 3AYXB 3OOHA 5LIPA 3CM0A 3GAAA 4LTMA 4RORA 2BJHA 5FTMA 1Y1KE 2JGEA 1PR4A 1YCDA 5DI3B 3TUJC 3ZCTA 4CM6A 3EFOA 3GNQA 3G6KA 5BURA 4MX8A 2VWQA 3BTSA 3KJQA 4X6XA 1R6AA 3TD2A 1FFGA 1V11A 3CLHA 2DWUA 2OHXA 1KI6B 1ODCA 3M5DA 4BN5A 4C2UA 4QUBA 5TC4A 4PRKA 1AS2A 1JIVA 1G2PA 2NVUA 4KYIB 1BCSB 4DMMA 2Q0HA 2CDNA 3PC7A 2FFBA 4HT3B 1HRKA 4FDVA 1PGJA 3PUKA 3KELA 4IXWA 4DCJA 4F21A 3B7GA 3NHMA 1MORA 2ZYDA 1PX2A 4F92B 1NQ5A 1ABBA 3FCEA 1CF9A 4HH0A 5CX1B 4DB2A 4V0ME 4DDMA 1TZJA 2CVHA 5IHXA 2FZEA 1LZLA 1W9HA 3HCAA 4EENA 2P2SA 3NGMA 3I73A 1G5HA 1NFRA 2D13A 2EBFX 3CXRA 5DBEX 5AJUA 4OFBA 4LX8A 2OBMA 4QU5A 4LZLA 5ARBA 4YJDA 1QHXA 2IE0A 1M2EA 4P5EA 4WESB 2PPLA 5IDXA 1QH8A 3U6KA 2I6SA 4G86A 5A3SA 2PFSA 5LOVA 3W7AA 1H9BA 3AKEA 5HWSA 3TGPA 5F98A 3GVXA 1JBEA 3CLSC 5A4MS 3GJSA 3KTAB 1MGPA 3QWFA 1KQNA 2ZITA 3HV2A 3RKRA 1JFFB 2GD6A 1THZA 1FP6A 3VV2A 1XRPA 1NF8A 1M6NA 3BRQA 3AB8A 2VSNA 3I1IA 3LUKA 2JAOA 4RPHA 4RYDA 4EHHA 1H1LA 1I9CA 2AR9A 1ZA1A 1LDNA 3VHLB 4FBGA 3W5CA 3BHMA 2QIOA 4AUKA 2GJ4A 4P32A 3S8EA 2XKJE 1KY5A 2GX6A 3ZJYA 1M83A 2BGLA 3BWBA 3TM5A 3FFWA 5C32A 4YV1A 2KX7A 1Q6ZA 3IDOA 1XCJA 3K05A 2ZR9A 1DADA 3WGLA 1KR5A 3H1TA 2P0EA 5ED0A 4B40A 3ZLJA 2AFVA 1X14A 5LZ2A 2OT3B 3CX7A 3M49A 4J6EA 4F3TA 1M1UA 2D06A 2UYYA 3PQDA 1ID1A 4HWRA 4OGGA 3BDIA 1XZNA 5HF8A 3UJAA 2J0QA 3UG6A 4YJ3A 4W5NA 1JNYA 2QX4A 4QXRA 4U4AA 3RG2A 3O95A 3JAMA 4YONB 2HW8A 2Q62A 5EMNA 4F84A 1L7MA 4OGLA 2CDCA 4EI9A 5CCBA 1DC8A 3V7FA 4KWIA 3NS7A 4JASB 1EJ0A 4ZWNA 3KYBA 2QRVA 1M8GA 2OUIA 1FQJA 1IBCA 2DUJA 4WNAB 1BVHA 3EOAI 4JWKA 2CFSA 1NSYA 4LZWA 2ZSAA 3DW1X 3QFCA 4GXNA 2PKEA 2WYUA 1GITA 4P1ZA 2DFKB 1B00A 3SVZA 2OCIA 2CFOA 1Y9AA 4TLEA 3R3JA 3VPAA 2PT9A 3QFRA 3NJRA 4DQLA 1AUPA 1CUGA 1LRJA 4EW3A 2EFJA 5F1PA 2YZ7A 3ND6A 5BO5A 4AZ0B 4NXNB 3J80A 4AJPA 1UP6A 3EBPA 4HZGA 3UKJA 1CLUA 1OWMA 5AI8A 1EFKA 4IZOA 3GMIA 3NRJA 2IV7A 4YXFA 2I34A 1XZPA 4OKSA 4V0RA 1O5TA 4PNPA 3BXPA 2TS1A 4PRYA 1SD2A 3ZV6A 2HPAA 1ZKMA 4ZVMA 1QFJA 4HVAA 1P5HA 2DPLA 4CI0B 5JTUA 2ZWVA 3WLRA 5JHGB 2E4AA 2Y2VA 4ZT7A 5CYOA 2DLCX 4FFOA 4GI1A 4L6IA 1A9YA 4XIIA 2CJFA 1G3RA 3DOIA 4YJHA 2FSPA 2Q3HA 3L9XA 1Z47A 4ETWA 1SKQA 4JB2A 2XUFA 1KVSA 2H4XA 1SXIA 5JH7B 2QWXA 1UBCA 2O7NA 2ORIA 3CUTA 1NPTO 2VZEA 4JR2A 4JDPA 1JDBB 1I3CA 1XA0A 1GZHB 4PC7A 3WIUA 4LF6B 2JCBA 2ZBDA 3D6JA 4ND6A 2NUAA 1TYBE 3GA7A 2OENG 4MXDA 4YCJA 4LF8B 3HUFA 4RPGA 3ZDXB 4QEDA 4R71A 3I61A 2HU5A 3IJ5A 5HIIA 3GLGE 1QG6A 2ZXEA 3A1CA 5AK0A 4O4IA 3TPCA 2NO5A 1VM6A 3OY2A 1M1XB 4RZ2A 5CXXA 1QORA 1MDBA 2IGBA 3TL2A 1ZNQO 5IWCA 1RC0A 1ISHA 1AZLA 4Q9IA 1UXJA 4WN9A 1PJRA 5J3JA 1UBFA 3PHLA 1FQOA 5DI9A 5HIMA 3ZI4A 4C7JA 1G66A 1NUAA 1MW8X 5HUQA 1E1QD 4OQDA 4P92A 4NARA 1Q95A 1E1QA 3ZGVA 4WA8A 5AW6A 1YI8A 2C7OA 1P5RA 3ZLBA 3U7JA 5LP1A 4DV5B 1EP2B 1C9MA 5IVDA 3DTNA 2M1XA 2XSZD 3PHJA 3AKDA 4M6WB 1PT9A 1AN0A 2XSZA 3E9DA 5I8ZA 4FMCB 5LA6F 1JDTA 2YN2A 3Q2OA 3H9UA 3NKVA 4Q7JB 2R47A 5CCDA 1KSFX 2GA8A 1PL7A 3NIWA 5IYZA 4KFSA 3GRAA 3T15A 2BEKA 1I3NA 3UOWA 2NM0A 4HAUA 4Q1DA 3G68A 3LHSA 1PVDA 3VFDA 2WYWA 4PHHA 5BQ3A 5JXJA 4WKGA 5BSMA 4B3HA 3UV3A 1KJNA 1A2KC 3I6YA 1U8FO 1XNHA 4CN8A 2UVPB 4RBNA 3L7IA 1WHTB 1Z07A 2FW7A 3MIZA 2QLJA 4NYMR 1N92A 3TSYA 3DMDA 3OQMA 4D9IA 1YBMA 1KIAA 3G82C 2PNJA 4JMPA 4ZAFA 5KO2A 3KPJA 2DEUA 5T4FA 1FSGA 3WB2A 4EUKA 2GNPA 1P1RA 2O57A 3U60B 2F6RA 4GKAA 3RAFC 2QUKA 1BX0A 1V5GA 4FZ5A 1BOFA 5TQJA 1KAHA 3MD0A 1O97C 4MGIR 4AJIA 3ILXA 4GNKA 1I6KA 3MB5A 5I7SA 4ZZ1A 5IASA 3AKYA 3DZDA 5DHQA 2OQRA 3RJZA 2NUTA 5LQCA 1L7OA 1SHJA 4LRXA 4QODA 3KQNA 1V8DA 3C0KA 5D2CA 5DX8A 2FKAA 3TQIA 5AHXA 1GTMA 4EX7A 1V1JA 1E94E 1UF9A 2EFGA 3EVNA 3QTLA 4RSMA 4EPXA 2O8EB 5EPEA 1JU9A 3KC2A 1MBZA 2XWPA 2GK7A 2F2TA 3O2QB 1UMBA 1EM6A 3OUUA 4MQEA 4YJGA 1WUHS 2H18A 1MZVA 3BD7A 3VBEA 3OZ7A 4IXTA 4YRSA 2A0UA 4I46A 5H1YA 3NHJA 2R7NA 1LDBA 2A30A 2H0RA 4MR8A 2CGEA 2RHTA 1PWXA 4KXNA 1ADGA 4UUQA 1AMUA 4JXXA 1Z2PX 1JECA 2R8OA 3P2IA 5AT1A 5DEIA 2EFDB 3K73O 3NHKA 5L7TA 3RR2A 4RVFA 3J81A 4DMFA 1JLKA 3SJAA 1B8UA 3WZMA 2B6HA 3G5AA 1IB0A 5E6UB 3OICA 2AZDA 4KPGA 1DG1G 1QTNA 3MK31 1PYGA 1AJEA 5HGXA 1O6GA 5AW0A 1WOMA 2P91A 2RGYA 2ZBUA 1QFMA 4TLDA 5C1DA 1HTTA 2RGEA 2GTPA 1NY6A 4JC5A 1H4QA 1ECJA 3I2GA 3SE0A 1R9MA 1UXKA 5BWMA 1MJ5A 3RC9A 4PX9A 3I23A 3QV2A 4NYIR 1SVMA 5CFQA 4K2AA 4BX8A 2YMPA 4G36A 4ZYLA 4QT4A 4OA8A 2D7CA 3IUQA 2IEGA 1KAEA 4QBIA 1EVKA 4MDYA 4IIUA 2BY4A 1JP7A 3PFKA 3HUDA 2FR0A 2DUWA 4O4HA 3HDVA 2EKQA 2Z04A 3C6KA 3NHRA 3UZUA 1A9TA 1N9GB 1OSNA 1ECGA 3AVPA 3QKUA 4TLMB 5IU6A 3CEMA 3ZCPA 3G8AA 1NQVA 3PGLA 4Q9HA 3ILSA 4ZO9A 3RSQA 1ENOA 1HDGO 4N01A 3LECA 4RYLA 1QYCA 4PSDA 1ZD1A 3RVKA 3DC7A 2BZSA 2G3YA 1CQXA 3B8HA 2GNOA 1C8LA 5DBFA 3I28A 4KUHA 5JCOA 4AU1A 3N8HA 4QAJA 1RRCA 3DEAA 4EL0A 1K7FB 3D0QA 4LYDA 4YIKA 4LY0A 2VDVE 1YNSA 2QXTA 4C87A 5FORA 4ZTUB 2CCGA 5KNDD 1Z0AA 3QEOA 4G0XA 4GG1A 5KNDA 5KJEA 2W6ID 1Q44A 3SDBA 5K2OA 4NCBA 2W6IA 3PENA 3R9WA 3FLAA 3Q11A 4UFNA 5FOWA 2AG0A 4F86A 5EJMA 1TLLA 2Y68A 4HTAA 1UWLA 1WLYA 2W83A 3F4BA 1PO7A 4R40A 1J0CA 2XA2A 1Q7EA 3R8CA 1VRWA 3NIFB 1YAJA 3VDMA 3HXTA 2PGXA 5ALEA 1PJQA 3AUAA 2ZAMA 2IU6A 4NBWA 3WGQA 2PL3A 4HBZA 1H0KA 3PUXA 4RO0A 1OX4A 1RWOA 2YH2A 2AXPA 4DXAA 4KH0A 1MZPA 1ULHA 2D0PB 2PANA 1E6MA 2OXRA 2X5XA 3O47A 4KQWA 5AW8A 1A4IA 3NC1C 4I2NA 2B5WA 2VP6A 4LMAA 3OM9A 3STWA 4EFDA 1IONA 1DXHA 8ABPA 1QGAA 1NWHA 1VL1A 2HRDA 4P53A 4D80A 2LDXA 2PT6A 5E7IA 2C5HA 5LLDA 3I09A 2EBWA 4GXRA 3LWNA 3RTBA 3OCUA 3HXPA 3CG4A 3GH3A 3MCWA 4GQBA 4XQGA 3D3JA 2BJWA 3AUTA 4HGYA 3TB4A 4UU1A 5BN4A 2OKGA 2EKPA 3N0WA 1GTJ1 2WABA 1N1MA 3P45A 1OMOA 5HKOA 4K9PA 4WNIA 4FDAA 2QP3A 3P4XA 2EHDA 3H5VA 1FFSA 3K53A 3L9WA 2P67A 3HJAA 1UC8A 3GRCA 4U3JA 5CDUA 1PZMA 2ECOA 2Q3LA 2SKCA 3OZFA 5D6NA 2PSFA 5HS6A 2XQGA 4EUSA 3N2KB 5JQGA 1GUYA 1RQLA 2HZ7A 4JENA 5TY0A 4YCCA 5ITSA 4G0UA 1ID8A 2IXGA 3HBNA 2GI4A 4G23A 4IEIA 4OQXA 1JDSA 4M7RA 1GT6A 4C6HA 5EJ6A 2WUVA 4I5IA 3FAZA 1TQ2A 2NT4A 4F5WA 3CW9A 4IVNA 1DE0A 3G1WA 2WEKA 2AZTA 2PRIA 2BFDA 4ZAGA 1ZWKA 2ZR0A 3IHWA 3S40A 2HREA 1GA4A 3VJMA 3A2NA 3TOSA 4L1KA 3M83A 4RV5A 1Z5VA 4A8JC 3IVCA 4B34A 1CNMA 1N0IA 1T9ZA 2J3JA 3RHTA 4KAXA 4ZRDA 4GM1A 3WK4A 1IQPA 2R79A 4PZPA 3CE6A 4PQFA 2AFIA 5B1HA 1O9GA 2QM8A 1ISJA 1G5FA 3IMFA 4GPBA 3OMXA 1RLJA 5B2ZA 2VF8A 3MWYW 4M3NA 5JRZA 5KTOA 5KYGA 3U44B 5LXTF 3WLAA 4DDTA 2BR4A 2EJVA 3ZW8A 2Q9AA 2ZU6A 3WIVA 2OGSA 5JNWA 3BXEA 3IPCA 3EISA 3T5BA 1H3NA 4FDLA 4U9IS 1C1DB 2V7EA 3NUGA 5E9AA 4K86A 3RIMA 5IUNC 5L3QA 4JT9A 3LLCA 5I4CA 1J0EA 3C3DA 5K3DA 5EKDA 3WOHA 3RBXA 1JUDA 2B8TA 1O3YA 1QS0B 1WUTA 1G291 1WW2A 2GRJA 4Q03A 4U6NA 3VVBA 5DM60 2ZETA 4Y1RA 5AYVA 3WL7A 4XLTA 1T9HA 3S28A 4Q4AA 3P9NA 5GV8A 5FOTA 4BZWA 3H5RA 4TYQA 2HUPA 5EFOA 2OHGA 3LQKA 4Q21A 1R0CA 2ZI7A 4JVNA 3ZU5A 5FTNA 1UM8A 2BFMA 2VAVA 3C98A 4MKRA 5KNCH 5FA6A 4MP8A 1KYVA 4DJAA 1U98A 4XUEA 2K4MA 2SKEA 1HE2A 4F45A 2GKGA 2QLNA 4AKGA 1MTOA 2MU1A 1CXZA 1P1KA 3HZZA 4P08A 4UBOA 3ZDQA 4JS0A 3NBXX 1Y9ZA 1T8UA 1XMQB 3BE6A 4KIGA 1C3EA 4F5YA 2CT8A 4JI8B 4QDKA 1BVUA 5HKLA 3FPLA 4RKWA 1TAUA 4P3PA 1G4UR 3RUEA 3E05A 3E22B 3PUYA 5K45A 3WS7A 3PQEA 3HPRA 1DIBA 4ZOLA 5EJIA 4GMXA 5ALVA 1K3TA 2V7WA 2FFAA 3BAFA 1HQYE 4YRDA 1CZRA 4FE4A 3HB9A 5JSFA 1QQAA 2B69A 4PG5A 3RRZA 2WUFA 2GD0A 3LQ2A 1PWYE 4DMCA 2AX4A 2P2YA 2ZVJA 3G6WA 3COPA 4WLNA 2PBRA 1ICIA 2ZSEA 3SFZA 3OLXA 3PYLA 1KY3A 1DKLA 5IXJA 1EQ2A 5FJIA 5IM4F 3GEGA 3KYCB 4C0SA 2J3QA 1LWNA 2HY7A 3MCVA 3UHAA 4CMHA 2DF8A 4EHBA 4XJVA 1GPMA 1Z4MA 5COAA 4I55A 1XJWA 5ADWA 2NPIA 4ESHA 2BEUB 4DSTA 4WZAA 4AIRA 3NVDA 1A9PA 5TDHA 3WK7A 2QMOA 3G5TA 3UJ7A 3DE5X 3ICOA 1R4MB 2IHYA 2ZBRA 2YMLA 1SRQA 3BBLA 2PEYA 3EFBA 4XGIA 2RD2A 1CB7A 1VE7A 3ZVMA 1CCWA 3JQ8B 1RCFA 3LAWA 3V3TA 4S1TA 1N8SA 4AQDA 3FM9A 1Z56C 3FHJA 3DZCA 4YRTA 2AG6A 1W48A 4UUMA 2H1RA 1N32B 3NT5A 1ZIOA 3COYA 4EHFA 2J0SA 5LJLA 1Q11A 2PUCA 1D6MA 3I04M 3HHPA 4P2BA 3MILA 4RGYA 4AJKA 2I91A 1XD8A 2WM8A 3A9TA 2I65A 3WLJA 4XM0A 3FNEA 3N76A 1L2TA 3DCYA 4AY5A 4P5PA 1JAZA 4TV8A 1P60A 1P4AA 4B5LA 5KKCA 2PKQO 2B4QA 1SPBS 3AJAA 5FP0A 3WI7A 3QQ5A 4B87A 4S0ZA 1RWQA 3V97A 2IIVA 4CT4B 3H18A 4F38A 1Q7BA 3K2IA 4WZBE 4YRGA 3O3MB 1W0KD 2WYIA 3GJ6A 2LNDA 3UOGA 1W0KA 2FWJA 1ZUHA 3I9KA 1BFKA 2A1IA 2YR0A 5DULA 5KWJA 1VL0A 4MYTA 2PIAA 3HO1A 1R0WA 1SQ5A 2W2QA 1W5TA 2XGSA 1G2QA 4GKBA 2R6ZA 1PR3A 4K6GA 1QWOA 3RNOA 4MCIA 3S0JA 1L3CA 3FOZA 1AV7A 3FMPB 4HO1X 4IJWA 3D7SA 5AM0A 1DKQA 5K05A 2EWVA 4R2IA 1HYQA 2VNKA 2Y1FA 4RUKA 5DK6A 5EA2A 5L51A 1GDTA 3DMTA 2E4UA 3P94A 3DXXA 4EP1A 1XTBA 1KEWA 3C2QA 4P7BA 4WL0A 4MV8A 4EYKA 4CM3A 4LDRA 3GGSA 3L4SO 2X7HA 1RI2A 1SHKA 4JU8A 4RDXA 4REOA 2B4AA 2HCTA 5ITZA 3VMFA 5CIQA 1HTWA 1TYZA 2ATCA 1GD1O 3WLPA 2ZRJA 3G49A 2HF8A 5JU6A 1DQRA 1Z2NX 3UJ8A 4MQ5A 1FYXA 2DUUA 2BL4A 5HIAA 4KBYA 2F1IA 1FMJA 2XE6A 4DREA 4IKOA 3LIIA 3HYLA 4OUDB 2MSKA 2W2VA 3PC4A 4AX8A 3WBJA 3WZLA 4Z4QA 4CIWA 1V1MA 3FXAA 3LYHA 1O7JA 2NV0A 2AJ8A 2ZYSA 1UT6A 4LJ5A 3ENZA 1BMTA 1LQUA 3G13A 2VLIA 3K0AB 4R54A 2QMEA 5HVNA 5F9HA 1JQ3A 4L76A 1F06A 1I33A 1P0QA 2CB0A 3ZQKA 3FHLA 2JLAA 4OA5A 3EZYA 5C31A 4LJ7A 5CURA 4GE3A 2GFHA 5B2EA 1WNTA 3AF1A 4PC3A 3RDPA 4DY4A 3L4JA 3RU7A 1SKYB 1VZ3A 1WPRA 2QRKA 2H8KA 2YYAA 4ARUA 4D1YA 1ECBA 4MP6A 4RK6A 3G9TA 3PWTA 4CKCB 3EZ7A 2WZBA 4OQYA 4YAUA 5KNBD 4HTFA 5KNBA 2H4FA 1U3CA 5ED4A 4NDNE 3TXAA 3FLMA 3VUFA 3DD1A 221PA 2E4WA 1EZ4A 1GPKA 1M72A 3ITEA 4DSOA 3AVVA 3PKZA 1XJCA 2DETA 1XL1A 2PGNA 1UODA 3N9IA 3JYHA 5G0VA 3AVXA 5C3MA 5I4BA 3FPBA 1B3RA 3FVQA 1CR1A 3BTVA 1G5RA 4OL9A 4PCAA 4XWKA 1QVAA 2JH9A 3ZLVA 1J24A 1B8PA 1J2RA 5IT5A 4BNDA 1Q0UA 2WVJA 4JUBA 1XEAA 4QUGA 3AFMA 5EMKA 3AVUA 2KHZA 1W5FA 3PCTA 2FMKA 3OEYA 4WI1A 3AB7A 4YRQA 5LC1A 4LHSA 4MVCA 2EAUA 2XYPA 4GLJA 2AUNA 4MHSA 4D9NA 2RK6A 1OZGA 1USUA 3TRIA 5B4UA 3Q1LA 3THYA 3OU7A 2F48A 1IG0A 2P2GA 4I4LA 4IBOA 2J9XB 1MB0A 3F71A 1SZCA 3EC2A 1H2AS 1QC5A 3IV7A 2XMBA 2YS7A 4HAWA 4FLMA 5I7FA 2FZ5A 4M54A 5L3SB 1G9TA 4FI3C 1B41A 3KD3A 1GGMA 1G20B 1ZI6A 3ROEA 4EY3A 2MTBA 2XQKA 4MVJI 1FDWA 1PF7E 2DAPA 2PYZA 3B48A 4PANA 4FGSA 2E1RA 4A7PA 3DBRB 3OLZA 5T57A 3LLUA 3WYDA 3O91A 1DXQA 4L7QA 2LTAA 5I9LA 4QOFA 1JLHA 2UYQA 4HDSB 4HNRA 1KI4A 3UVEA 2FW1A 2PMWB 4Y1GA 3Q3JB 2HYDA 4XYLA 4GT1A 4XDZA 1QYDA 2QUAA 2BSQA 4JJEA 3N39C 3WC4A 1TK3A 5JISA 1MAHA 1SC9A 4X93A 3GJTA 3VR6D 4LE0A 3WA6A 5A3JA 3H1PA 3S1SA 3VR6A 3GEHA 5FFNA 1U0OC 1G98A 2PRKA 3BIWA 4MVJD 1MGOA 1NVVQ 1V95A 1OAOC 3EIWA 3HKDA 4MVJA 1DKNA 4RA6B 3V6MA 4AF8A 1C7FA 1G7CA 1YI1A 4DNOA 4EJSA 3LQ1A 3N0RA 1ADCA 3RSOA 4D96A 3TAUA 1YQEA 4K1LA 1S1MA 1FMFA 1L4EA 1XYYA 4EHLA 4GI3A 1O1YA 3Q5EA 3WICA 1MUUA 1W88B 3NHPA 3T1QA 1ML4A 1G6KA 2A14A 4Y2QA 5K3FA 2JD1A 3W5BA 4A5OA 1E9EA 1DP4A 3ETHA 2IX3A 3RTCA 1XZHA 4OYRA 4PR0A 1WZCA 4RMHA 4Z7OB 4BGDA 1RRKA 2AQHA 3KR1A 2PK3A 5LFAA 2EXXA 1XZCA 3D8HA 2CF5A 1G7RA 2I4MA 3U13A 5KPJA 2GR9A 1AA6A 2B98A 2HCFA 4LCJA 1XGKA 1A82A 1EWRA 2JGRA 1SCIA 3C3JA 3ASYA 3BMQB 3GZTB 3ITNA 1JTFA 3R5SA 2JFPA 3K9QO 4FYXA 4JGGA 4G1BA 1QOQB 3KKQA 4WFQA 4XGNA 4E12A 1Z13A 2X14A 3FGNA 3KZNA 5ALOA 4A0SA 5JCOC 4B5KA 1ORDA 5LYJB 5EZYA 2X5JO 3N7UA 3W9UA 3WYFA 1RAFA 2KMLA 2UZ1B 4CT5A 5ES3A 4TT3D 5C8YA 4HDRA 1NFQA 3BK1A 2IYEA 5C46F 3PUVA 4TT3A 4CQNA 1CR4A 3ERCA 1EVYA 4UEQA 3H2YA 3B60A 3LMKA 4PZLA 4YA6A 3X2SA 1KO4A 2ACVA 2WDPA 3ORHA 3ANLA 3BJMA 5CH5A 5KUTA 3B6IA 3OKPA 2J1LA 1EFCA 4LY6A 4HNAA 3BBPA 4Q3BA 2VP0A 2YXBA 3H87A 4TKMA 5EIBD 1BXZA 3VZQA 4WFIA 2J6IA 5A2GA 3K5IA 2SICE 2PGAA 4LXUA 521PA 4F06A 3FIJA 2GD2A 1S2DA 1V6SA 4WERA 3ZEAA 3PQFA 1MC5A 1NVAA 3PNSA 1F2TA 4MMYB 4WT7A 3WK8A 2NSYA 2MSCB 2DRIA 3O3NB 4LRWA 3D3QA 3SS7X 5AUPB 1JTEA 1SC1A 1EE1A 4N0QA 3UXHA 2O8NA 1QGUA 2C3PA 2OXCA 4HB4A 3QX7A 1VRVA 2D1YA 2G6BA 2JHAA 3HM2A 3KZXA 4HLCA 4HDKB 1J2TA 1L4YA 3RUAA 4JYBA 4OLHA 4QBHA 3K0SA 2FWIA 2O7SA 2LIVA 2WZQA 3F5SA 3ZDYB 3BQMB 3P1JA 4FSDA 2REQA 3HR8A 4BGUA 5BXQC 3B52X 1TU0A 4UU0A 1G21A 2L0XA 3K0HA 1XA3A 3F6RA 4MB0A 4QIHA 1MEEA 2XB2A 1JI3A 6REQB 1DC6A 3IQHX 1E1DA 5EE3A 1T6YA 2YMQA 2HQRA 3QMVA 5THKA 2BCEA 1RKUA 4ZXFA 1U9YA 1H2XA 1H23A 1IBSA 1P4SA 1T3GA 2WUWE 3HJTA 4WK4B 3X1DA 5AM1A 1T6XA 4BPBA 1Z3CA 1IWPB 1GRVA 1KBZA 2ANBA 3D4IA 3E3AA 2PGOA 5F5NA 2FWPA 4A27A 3NX4A 4DC9A 5F9MA 2BKEA 3QEKA 5K3SA 3ROZA 4RDHA 2GQ0A 2BI8A 3DLAA 2FHSA 4Y9UA 1KBOA 5AOCA 1JIKA 2HNBA 1X1EA 3DQPA 3LGAA 3X43A 4L4YA 2PA0A 4TT8A 1RYHA 4GOMD 2N1BA 3OOYA 1YZHA 2ALJA 2BDEA 1MPXA 1Q16A 2LE0A 3PPXA 5EWJA 3Q85A 3FB1A 3ROXA 1ZVKA 2YN4A 1P3Y1 2PM8A 4GR5A 3IHTA 3UB4A 3UJPA 4ZK6A 3AWDA 1GG5A 5H3LA 1KMIY 3ZV7A 2JCXA 4LBVA 1Y6RA 2C2BA 3KUUA 1OWOA 1CP3A 5JWHA 1J0XO 2OV3A 3DUFA 1X7XB 2FEAA 1DJLA 1T6ZA 3RVOA 3ZWWA 4BLUA 1Y42X 4OAQA 4BBAA 1PV4A 3CHYA 1Z6GA 2JHPA 1V4NA 1CDDA 5JNRA 2I7VA 3D2LA 2V1UA 1OIXA 1O8BA 2VCHA 1GP2A 4OL0A 4GBED 3IT1A 4WOCA 3TLJA 4CF4A 5LQDA 4KHPB 4ZGWA 2QQEA 1FXUA 3L8YA 1YZQA 4W8OA 5LYYA 5AM3A 3N6RA 5KEIA 4LA4A 2C3UA 4O4JF 3WP1B 1V5WA 2XI4A 2OCBA 4IH4A 4HX9A 2NU9B 5BP7A 1VKRA 3L8GA 3M6XA 4MW4A 4KX3A 3TD9A 4BNTA 3QRWA 1U3VA 4I14A 1WXEA 2B78A 2Q21A 2VTVA 1QLJA 2VYFA 3I8XA 1MR3F 1UBKS 4TV9A 1BS9A 3CC8A 1OX5A 1PKXA 1SU6A 3QLTA 4M55A 2X9QA 1Q50A 2D0DA 2PGIA 3ZWMA 5KTYA 4HWSA 5EESA 4DV7B 4DR1B 3ONWA 3GZJA 3Q6IA 3RABA 1KDVA 1JAYA 2XTZA 1NXWA 3A3YA 4I36A 3D2AA 4WNCA 3OCWA 2NU8A 4B3FX 4UVIA 3W3ZB 4Y6SA 1AU9A 4B7ZA 2WICA 3KVYA 4KSYA 2VJLA 4MS3B 3PFFA 3JS5A 3PS9A 4JJAA 4ZQIA 5U9CA 2H85A 3G0OA 4NVRA 2VK8A 5BT9A 3VR0A 4DR4B 1QYRA 2CMKA 1YDMA 3H7IA 3WRVA 1A7AA 2QE7D 1OLOA 1DRKA 1RADA 3W8RA 2QE7A 3JR7A 3O9MA 1U7ZA 5AW5A 3ZY2A 1Z36A 2ETXA 3IJPA 4TTIA 3BRWD 2QU7A 3IP7A 4BQFA 5CEJA 5LMUB 4KRGA 1P8AA 3ABRB 3G9UA 3QVKA 1H66A 1WMSA 1FLNA 1XVVA 1T1SA 4PR3A 2ZB7A 5FOUA 4KLCA 3QW2A 5ILGA 3IB3A 3BKWA 3NIBA 4EYGA 3TTYA 4YRBA 5JY1A 3G2PA 1EFDN 1EMDA 3T5DA 1TT5B 4BJ6A 2M9MA 5LDDC 3LK6A 1T5IA 1O96B 4M8SA 4KIJA 5AR1A 1N77A 4CMCA 1F60A 2H16A 3ZK9A 4PFSA 5DX1A 3I2IA 4Y6LA 2IXFA 5B3JC 3OIYA 4B3GA 1CY0A 4ZD6A 3HFRA 1DPGA 4G41A 4DCGA 1IY0A 2DLDA 1SM4A 1ECCA 1JKXA 2W4QA 4J76A 3F3YA 4P4LA 2H4ZA 2P3LA 3D3WA 1FUEA 4JVSB 5HCNA 1Q12A 1EE2A 4YUWA 2Q4EA 3HFJA 4NMXB 3NHWA 3B53X 5EP3A 5KJ6A 2OHOA 3ZVKA 5DJ5A 4TRMA 2Z58A 2IU0A 2IYPA 2ZWAA 5TMEA 4DADA 2QLFA 3ZQUA 3ZWCA 1T36A 4I4TA 4LOJA 3JQGA 4KQEA 4MUNA 5L7YA 2D1FA 1V3UA 1ZMBA 3QGMA 2YYSA 4UARA 4C43A 3GLRA 5EE1A 3WX0A 1P18A 4QPCA 2B3TA 2ZM6B 4EWLA 4DTIA 1Q77A 1KOFA 2WJJA 3NOVA 1OR8A 4O2BB 3FSEA 2OBLA 2OY0A 3MGKA 4DTCA 1RXWA 2GTIA 1JEYB 4NS4A 3U4AA 4ZI3A 4D9MA 4K9KA 2D0OB 2OFWA 3QNUA 2RKOA 1QHFA 3M3PA 5FRDA 4Y30A 4BNKA 3WMWA 1RYMA 1G2OA 2CJXA 1YT5A 2WKQA 4MR9A 4TTSA 2OWEA 4D97A 4Q1EA 5JSYA 2C7RA 1TNDA 2WWVD 1ZD3A 3IAUA 1XDGA 3STTA 3MBOA 4RK7A 5D3MB 1K5GA 3UAWA 4CF3A 4ZCSA 1G3UA 4TWZA 3BWXA 2O0KA 5E6SA 4MRNA 1ZBDA 1UWCA 4D42A 3BB4A 1X94A 4JYZA 1XJ5A 2BZ0A 4DC1A 2AT1A 2O3TA 4KL8S 4COOA 1QRSA 4YCNA 3FWYA 4LW8A 3OT1B 4RLHA 1FUYB 2V03A 4UMDA 1A8SA 2VXOA 4AN0A 1QGOA 1CULC 1K9VF 1SU4A 2AEJA 3EMKA 4FGKA 4MULA 4NH0A 2ZI6A 5H0IA 4A0QA 4B3JA 4KQJA 2I7CA 3WADA 3KB2A 1QVRA 4XWGA 3AF4A 3T9CA 4EGSA 5JNTA 2EWWA 5AKIA 1KAQA 3QVGA 3ZD7A 2HCJB 5FOQA 1NASA 5F1OA 4Y7DA 4LSWA 1Y81A 4S24A 3DE1X 1RM0A 1X0VA 1A77A 4HDCA 3K71B 2WWYA 1VDZA 1XZBA 2EX0A 4CG2A 1U90A 1RQ2A 4LVUA 5G4KB 4YCDA 1DZ3A 1L7NA 3CLUC 2IXBA 2JGDA 3OD5A 3KJNA 4LISA 1JHZA 3FZEA 1BDJA 1XTUA 4HCJA 4O4LF 4PC1A 5I9BA 4CFSA 3K70B 3OM8A 4JJFA 4FI3F 3NNDA 4UM9D 4PZYA 3CUVA 1JHVA 2PJUA 1ZRSA 4BUJA 1FXSA 1HH4A 3S4YA 3MUNA 4X1YB 2K87A 2EBUA 3DO5A 5ALUA 4XLZA 1O08A 1V26A 1OCEA 2AK2A 2OK8A 1M6EX 3KJHA 3LBFA 3NTVA 3PG5A 4QEZA 4R81A 4W99A 3ZTWA 3QX3A 2P90A 1E8DA 1GG8A 1E5VA 1I80A 2PTHA 3Q3CA 4XRRA 2DX7A 2UZ3A 3PX2A 1TCAA 1L5RA 3TTVA 2QMQA 2XDQB 4JXKA 2ZSHA 4G89A 2WIKA 4JB0A 4RIHA 3B2QA 4EW6A 3JQ7A 1BGWA 4KQFA 1O95C 5DHSA 3WR5A 4Y9SA 4ENUA 1NMEA 1QRTA 3CX4A 4V03A 5PNTA 4B6JA 4BWFB 2IVZA 5HFJA 4L8GA 4OMDA 3DF7A 5EUMA 4BMSA 4BTLA 4UMVA 2RC6A 1RHUA 4PGMA 1IU9A 1MB4A 2IUUA 1KSJA 5FXMA 3UK0A 4F91B 2I62A 4B3DA 3FPJA 2GPJA 3N6XA 3K9NA 4RJIA 1O54A 1X87A 2HRQA 1BW9B 3I0NA 1YDHA 3AERB 3IVXA 4QGAA 3UPTA 3AVWA 3VNQA 3K35A 7REQB 5HJ5A 4A6DA 3PPYA 2O8FB 1JU4A 1K3UB 2A5YB 1BU5A 4PVDA 2DZDA 3PSHA 3IAEA 5KC9A 3CURA 4KITB 3HVHA 2ZWPA 5CAEB 4B4VA 4C76A 3LSTA 3GL9A 1ZD2P 1QP7A 3W06A 4D6PA 5GWXA 4RTPA 2V4UA 3HU1A 4YUAA 1DC4A 3P0EA 4M0UA 4YQYA 3QPUA 4OXKA 4EG5A 4F4IA 4FHZA 4DYDA 4NBSA 2OO3A 1WMAA 2JVJA 4R41A 1QOZA 2AEEA 4R1LA 1R5BA 2BH9A 5DGTA 3R9IA 3AUUA 4MYHA 4DLSA 1RHQA 1TYAE 4QLBA 1QP8A 1HKUA 4BMYA 1WUYA 1JXMA 2EKDA 3BMOA 1J8DA 3PGXA 4J3FA 1EBUA 2OTCA 1BH6A 2B20A 1ZY2A 3OQ6A 4PSVA 2BFNA 2IDJA 4QUIA 3T7RA 1X7WB 2IPAB 5H8WA 1G3QA 4NHEA 5EJ9A 3RYFB 4BVLA 3G2OA 2VJKA 1X42A 3JSXA 1DX6A 4BNYA 4LDJA 1A7JA 4HYTA 2QMUA 5K3EA 3THWA 2HBQA 4QYWA 4IMRA 5B1IA 2XJ9A 4ZARA 4WLOA 3H11A 4TKUA 3KQKA 2V6JA 5BOSA 4JNKA 4FJ2A 1AUXA 4N9QA 5K0FA 3GVIA 3F3MA 1NNI1 2ZRDA 1DFIA 4RNCA 4DIDA 1NBEA 2HSDA 3REQA 2BP7B 2D2FA 5AKHA 4NJMB 2A2ZA 5FI5A 2A94A 1N2OA 3CRZA 3U7QA 3L0CA 1U2QA 4G3XA 4I7EA 2CBXA 3IGFA 4DILA 2OM2A 2C0PA 1HT3A 1WSAA 1OPRA 2FEWB 2F9MA 3EAFA 3W9YA 3B82A 4FZVA 4EO4A 1EZ1A 2VUUA 4KE7A 3SKXA 3BB1A 9LDBA 3ODGA 2DQKA 1IM5A 2XMZA 3N5CA 2KPOA