1N6KA

Crystal structure of human rab5a a30p mutant complex with gdp and aluminum fluoride
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
167
structure length
167
Chain Sequence
GNKICQFKLVLLGESPVGKSSLVLRFVKGQFHEFQESTIGAAFLTQTVCLDDTTVKFEIWDTAGQERYHSLAPMYYRGAQAAIVVYDITNEESFARAKNWVKELQRQASPNIVIALSGNKADLANKRAVDFQEAQSYADDNSLLFMETSAKTSMNVNEIFMAIAKKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title High Resolution Crystal Structures of Human Rab5a and Five Mutants with Substitutions in the Catalytically Important Phosphate-Binding Loop
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein transport
molecule keywords Ras-related protein Rab-5A
total genus 57
structure length 167
sequence length 167
ec nomenclature
pdb deposition date 2002-11-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1n6kA00
3QOFA 1RVDA 1WXQA 1NY5A 5FBLB 2NO0A 2QTFA 2PT5A 1X1SA 2KBFA 3P1JA 1W49A 4D4LA 1Z6XA 5EXSA 3ZIAD 2JDID 2ZE5A 4DEXA 4OK5A 1Z28A 2C9OA 3R9IA 2JLVA 3O8BA 4W9MC 2IEYA 4LYJA 3SQWA 4IRUB 1QHXA 3X2SA 1HY3A 3K0FA 5IF9A 3SR0A 4GNKA 1OXUA 1QHHB 4D0NA 3CUEF 5C2JB 1KDOA 3I8SA 3QY0A 2C96A 2HXSA 4MKHA 2IA5A 4DC9A 4HUQA 3IKJA 2V6JA 4UNSA 5HPYB 1FPMA 2GBLC 4HAUA 2ATVA 4LBVA 2YVUA 3GJ4A 3FPAA 5J5CA 2ZJ8A 1T3HA 1WMSA 1UEIA 1VG8A 2V7QA 1KO8A 2KJQA 3SC3A 2CJWB 2XJ4A 2JLSA 4A9AA 1AIPA 1CULC 2QQ0A 3S1AA 4H9GA 3H4MA 2RGXA 1OPXA 2IF2A 4RKFA 1D5CA 2ZJBA 3THOA 1HT2E 1P61B 2GJSA 2OT3B 3MG9A 2QAJA 5EP1A 3LY5A 4Q1EA 2HUPA 1TPZA 1UDWA 1OT3A 5TB5A 1S4QA 4DSNA 1XCMA 4UXHA 4B75A 4EAQA 2JLQA 4RD3A 4Q9LA 3RC3A 4CVNA 1ZC3A 3FFBA 4JBXA 1EESA 1EFRA 2F43B 2RGGA 4YXWD 1RIFA 4KV9A 3L82B 4MUBA 2VP6A 2AXPA 3AF2A 3DM5A 2ZYWX 1WE2A 3EZ6A 3W3ZB 4XWOA 5AUPB 1EWRA 3K09C 2J3EA 2PZGA 4HZIA 4DSTA 1C9KA 4IVPA 1YR6A 1E2KA 3NG1A 1XD2A 4JSTA 4L15A 4P4SB 2Y8EA 3ZYCA 3C4JA 2HLDA 2ORVA 2IXEA 3RLFA 4B74A 1F6BA 4OHVA 4I1UA 4C2UA 5FOVA 1TQDA 2MSDB 2TMKA 4BZPA 2F3RA 2QRNA 1SULA 5A0FA 3E5HA 3K0CC 2J59A 2CXXA 3CX8A 2FZ4A 5LD2B 1G64A 4A8JC 2QMOA 1E79A 2VP4A 3MCAA 4L5BA 4URYR 2J7PA 4GOKA 1E2DA 4PXAA 3W34A 3UXMA 1DEKA 4E5UA 3KUDA 3AVUA 1X1RA 5FL7A 2GJKA 2LWIA 1SVOA 1KK1A 1LFDB 2PT7A 3CX6A 5EP3A 1Z8FA 4QJ4A 5HE8A 3KQNA 3RSOA 4BLTA 5JRZA 3VR3A 3IO5A 3IEUA 2XZOA 1L8QA 3CLVA 2EU8A 1YU9A 2ZSDA 2W0SA 1FP6A 1YVDA 5JCPA 4PC7A 3BD9A 2GNOA 1XTJA 2GTPA 3CWZA 4TMVA 1SVKA 2BM0A 3VX3A 1F48A 3MD0A 2VSFA 4U5XA 4XVRA 2IYQA 3VR4A 4Q4LA 4TZ6A 1JAIA 1TF2A 4N0EA 5G40A 4M9SA 2PBRA 4C0HA 4OI1A 4CEIA 4M21A 4Q18A 2G6BA 2H8KA 4ZDKA 3CF6R 2YOHA 4D26A 3LAWA 3KKMA 4QHSA 1EX7A 3FKSD 3KXLA 3SNHA 4LPKA 4TYYA 2IWHA 1T0JB 3W5IA 4BFVA 3G5UA 4PHFA 1AZTA 5FOWA 1R7RA 2GDJA 3DM9B 4TQAA 2J1LA 4PAMA 2VP5A 4EJSB 4Q1BA 2VF7A 3SBEA 4TYWA 2ZJYA 4ZKEA 1U8YA 1G7RA 1AQYA 1SVMA 5EE5B 2F43A 4LJ7A 3N5CA 1E9RA 1ONBA 1VCNA 2CHGA 3V00A 3GP8A 2F1HA 2FPLA 2OCBA 3DEFA 4I4LA 5B2ZA 5GJCA 4DB2A 4C0JA 1T3LA 4G5QA 4JLPA 5J4YA 1VG1A 4PPQA 2NZ8A 3GJ7A 1KKLA 5CYPA 3JVUA 5FTNA 1T6NA 4GMXA 2I1VB 3NBYC 1CJMA 2WSSD 3ASZA 2QM8A 1FMLA 1U98A 2C2HA 1D8TA 1KDTA 2JJ2D 3QJYA 3PUXA 4CF7A 2O8BA 1YR9A 1N6KA 4KBGA 4RFSA 4OHXA 2OXCA 3EWSA 3NXSA 1EFRD 4KBFA 3CW2A 2ODEA 3QENA 3A4LA 2MSEB 2RKOA 5CM9C 3LW8A 2N42A 5KDDA 2DYKA 2ODNA 3HPQA 1IONA 3GPLA 1KJWA 5EXXA 2ONJA 1E9SA 1Q57A 3LBNA 4DCNA 2BBOA 3Q3JB 4GI7A 2DB3A 3HYRA 4KU4A 3THYB 1SHZA 1XDBA 3BE4A 3VKHA 4MDEA 3UATA 1W7AA 2NMVA 2WJGA 3PEWA 2V1XA 1QZXA 3OEHA 5JWHA 1TU3A 2WZQA 1RKBA 2FMXA 4O0MA 5KDOA 1N3BA 3B5JA 4TYNA 2FN4A 5FOSA 4LJ8A 2BBWA 2FSFA 3UWOA 2QY9A 2ZUDA 3VQTA 1S9DA 2IHYA 1LF5A 4HAXA 2UZ3A 2CCJA 2GKSA 2Q9AA 2Z4RA 2BM1A 3AVPA 2PX0A 1LS1A 1R6BX 1NBME 3K0AB 3TMKA 2ASEA 4KFRA 5DSZA 1W2HA 1ZVQA 3P26A 1SHKA 3HU2A 1E98A 1GKUB 1DAFA 1DE0A 2BKEA 4LBZA 4CIDA 5TMPA 4Z1MA 5L3SA 2ZS8A 2WJYA 4IDQA 2ZYVX 3CZPA 3KJHA 3Q7QA 2IS2A 3U44B 5FFMA 1XEWX 1ESMA 4A2PA 5FPTA 3L0PA 4Q19A 4URUR 4L9WA 1CIPA 1GP2A 3C5CA 3RS7A 2UKDA 4MRSA 3LBIA 3WHLA 1GTVA 2OBNA 1ZM7A 3GFOA 4DCSA 4YMTA 5CB6A 1KDPA 2GA8A 2QGZA 3QBVA 4W5WA 1G6HA 3BAFA 4KODA 5D3MB 3QF7A 2X2EA 2C9YA 2D2FA 4DUGD 4NZYA 3TIFA 1L4UA 1FL9A 1Y63A 2FE4A 4OHWA 2ZRFA 1L2TA 4WXPA 1EX6A 4KYUA 1WF3A 1VECA 2BOVA 3P27A 2BBTA 4B71A 3UPUA 2GCOA 5GADl 2VYFA 1A5TA 1N6RA 3AH8A 3L43A 3PG5A 4BEBA 2ODBA 1XZQA 3EASA 3CBQA 5LB4A 3TNFA 4MRPA 4RJLA 5DN6A 4KLZA 1IY2A 5KPJA 3ZVMA 4Q5IA 4JSYA 2GK7A 2OAP1 1G7CA 4A8JB 1P60A 4EPYA 4OQMA 1G3MA 1TTTA 3P4YA 3NWJA 2BWJA 2FPKA 2G9NA 2F1IA 2RHDA 4RD0A 4NL4H 4EPTA 2WMNB 3B1ZA 5KNDA 1ZM4A 2WWFA 4US1R 2H57A 1ZIOA 1IXRC 3OFNA 1E1QD 1E2JA 4UXIA 1BS1A 1IJFA 2EFEB 2IW3A 5HCNA 1ZINA 3KQUA 3BH7A 2GK6A 2J87A 2VPPA 2AWOA 2P67A 3LX8A 4EPXA 1YRAA 4M1KA 1OJLA 3NIBA 4EJSA 3ECCA 2P5SA 3WHKA 1SZPA 3WMFA 1OXTA 5F9HA 1U8ZA 1AJEA 4M22A 4WOPA 4PSKA 3U4QB 3REFA 1E69A 4P31A 3LXRA 3ADCA 1G21E 4QBFA 1B0UA 3WBKA 2ZYUX 1J70A 1VHTA 2Q0HA 4L16A 4C0SA 5D3QA 1NKTA 5JJLA 3TSZA 2FOLA 2IYUA 1H8HD 1IN6A 4QL3A 3D6TB 2W2XA 4RZ3A 4P4UA 3W8NA 521PA 2RGDA 5CLQA 2ZJ5A 1KJZA 4DLWA 3O8CA 4MRNA 5LB2A 1CR0A 3EC1A 3KB1A 3GLFB 1WQ1R 2IYVA 4QFMA 1VPLA 4BE7B 5KSYA 2ZANA 4HSEA 1W0JA 4KYIB 3EZFA 3NHAA 1ZBDA 1CXZA 1RW4A 4IOLA 2CK3A 4PHTA 4ZKDA 5LDDC 2Q3HA 3U2QA 4QBHA 1FMJA 1ZCAA 3BB1A 4IFBA 1E9AA 4AYXA 2BCGY 2NO6A 5BQ5A 4M1YA 2IYYA 4PQFA 1PLLA 3CKLA 1OHHD 1IJEA 1XWIA 4JLVA 4CEJB 4PSAA 2ZVQX 2VSOA 4GRAA 1XD2B 3BRWD 4I81A 4LJYA 4EUNA 3AVYA 2JJ1D 3KTAA 3RWOA 1NVUQ 5JHHB 1FUUA 4R2HA 4LI0A 4DT1A 4DDTA 3ZS8A 1DPFA 3CNNA 3OIYA 4HB0A 2YC2C 2CHQA 4TLCA 1R5BA 1V43A 2QA5A 3R8FA 2WICA 3G82C 4QBIA 4JIMA 4ESHA 4GT1A 3SBDA 3GLIA 1YHNA 1MRNA 3AF4A 3K9GA 2G88A 1W44A 1GL6A 3EXAA 1TEXA 3LBHA 4MKIA 2OAQ1 1JXMA 3C15C 3QKSB 1QDEA 4MDFA 4P4TA 3ADDA 3LO5A 3BB3A 2VHUA 4HDOB 5DGXA 4XD7A 3QG5A 4LWZA 3EPLA 3D8BA 3OF5A 2QPTA 4G5RA 1SKYE 2ZRHA 2GJAA 3OEEA 1K8RA 4IOMA 1G3UA 2ZETA 2ZI3A 3HR7A 4OI4A 2GWHA 3PVSA 1SXJB 4LX0A 3JZAA 4QJ5A 5JMTA 1NVWQ 2O8FA 3AUYA 5K8IA 2NOAA 1GIAA 1V5WA 2ZSFA 4IVQA 1CR4A 4MITA 1Z2CA 1G5TA 1TQ6A 2XNSA 1SKYB 2H7VA 4LC1A 4QXAA 3EA5A 2DBYA 5TARA 4C0AC 4BRUA 4DEYA 1BYUA 4BECA 3VFDA 2FX3A 3BOSA 1W1WA 2BCJQ 4LGMA 4DLRA 2BJVA 5J4LA 4ILEA 1II0A 4FWIB 2XAUA 2R9VA 2ZRJA 5BYKA 3NH6A 3HWSA 3N2IA 1KAOA 1FNMA 4P3YA 2QG6A 1WCV1 3H84A 3BORA 1E0AA 3B1VA 1J90A 4KXFB 1GUAA 1JR6A 1ZNZA 1UAAA 3MWKA 1KGDA 4TMWA 5JSZA 4DLYA 1N6IA 3A8TA 2GBLA 4LV6A 2JASA 2Z6VA 2ZE8A 3LVRE 1G4UR 3G0HA 2J0QA 2CNWD 1S1MA 1ZD9A 2A7QA 1Z0JA 2KBEA 1UDXA 3QF4A 2GZAA 3J81k 1SVLA 2ZITA 3FHOA 5HKKA 3DDCA 4D0GA 1IOZA 1G20E 4JVMA 1EK0A 2A30A 2WPDD 2W6ID 2X1VA 3AEZA 3MGCA 2EYUA 3QIAA 4V0KA 4NTZA 1G8YA 4AYWA 2GF9A 3AKEA 2VSXA 5FPHA 3WYAA 3ICQB 2WJVA 1TX4B 3UMRA 4MRVA 4KFTA 3EZ2A 4YONB 3F5FA 4KJZA 4PPNA 2V8OA 4TTPA 2JLWA 1OKKD 3DO6A 4O25A 1KIMA 4CDGA 4IVRA 4LJAA 4EFMA 1ZM2A 5FOTA 1FUKA 2WPDA 4CEHA 4WZAE 5KSZA 4IHQA 3HR8A 4ZIRB 5EZ5A 4QOSA 1DTSA 3K9NA 5DI3B 1JR3D 2PL3A 2ZEJA 2P65A 2CNWA 3SI7A 1YZGA 2CHVA 5KSPA 1NLYA 2C8VA 2YZ2A 3AGQA 5AWFC 1KI8A 3CNLA 3AP2A 3C16C 4HATA 1E94E 2CDNA 3AV0B 4TMKA 5FR2A 2F3TA 4HLUC 4YMVA 1BO6A 4ACBA 1OIWA 3U61B 2W0MA 2GILA 2YC4C 2ZRBA 1M1YE 3A1VA 4MYCA 2OSBA 2X2FA 1DAMA 2GZDA 3AF1A 3ND8A 3U44A 3KQKA 2IBMA 2ZRMA 1CP2A 2JEOA 5E4FA 4WZBE 3PUWA 5FL3A 2XB2A 1DAEA 3K9LA 4A36A 1B23P 3ZVRA 1XTSA 3IPXA 1R8SA 2E1RA 3PUVA 4B3DA 4EKDA 1RPZA 1G8PA 4LHVA 1P5ZB 4DXAA 1W48A 1KSGA 3GLHA 3NKVA 3TKLA 4DUGA 1XEXB 4PHHA 4LCBA 4Q9HA 3KB2A 3MWLA 1Z6GA 3GEIA 3B1YA 2IHBA 1LVGA 2A5DA 3T12A 3U7HB 3VR6A 1Z0IA 3IQWA 4NONA 4A8JA 2WKQA 4Q03A 5J4KA 2EFCB 421PA 5K8LA 1XFAA 1TAGA 4I1VA 2NO1A 2J0UA 1G7SA 2ZI5A 4JL5A 2IS4A 2DWPA 1RRPA 4Y0VA 3SOPA 4N3NA 2J45A 3NVAA 5FTJA 3ADKA 1XMIA 2IF0A 5CB8A 2OCAA 4YDSA 1NY6A 1AN0A 3W6NA 4Z1MD 3HU1A 1R0WA 2QAGC 1BH2A 5LBIA 4JLKA 3O47A 1LY1A 5JZVA 3GFPA 1E0SA 1T5IA 1W0KA 2R6DA 1N5KA 4JL8A 1U8AA 2RGEA 4HLCA 2QUZA 1P2VA 4GOXA 1AZSC 4RFVA 1U9IA 3A4NA 3H2YA 2BC9A 1JR3A 4UNPA 3AGPA 1KAGA 1TUIA 3V4FA 5BN3A 2VHCA 4GSYA 3CRW1 2WKPA 1OIVA 1NRJB 1XX6A 4FINA 4JLNA 4FMDB 1NLZA 1HE8B 2IEZA 3CPEA 4ZDIA 1C4OA 4LUCA 5HE9A 1A2BA 2JIZD 1IY0A 1DOAA 1JI0A 1Z83A 1MKYA 1FTSA 1E99A 5DI9A 2WVJA 3TSOA 3WRYC 1W36D 2UVQA 1YE8A 2QP3A 2XNDD 1VCMA 3T1VA 4C3ZA 4JLBA 1Q44A 3KKQA 3K70B 4O2RA 4LRWA 1H8ED 4X8LA 1J7KA 4ACAA 4LV8B 5FPSA 3T15A 5B30A 1T4GA 4AKIA 2F9MA 1QG4A 4V0MA 1XXHA 2OG2A 1S3GA 2DY1A 4E22A 1H8EA 2GEVA 1Q21A 1NBMD 2LKCA 2ZIAA 1XPUA 4QNMA 4BUJA 3EAQA 1UEJA 1HQYE 2NG1A 3KQLA 4RD2A 4A2QA 2ZR7A 2A2ZA 2XXAB 3L0IB 1ZM9A 1GG2A 3FMOB 1DAKA 1PZNA 3U5ZB 2VO1A 1A1VA 2V3CC 1HURA 1Z29A 2FSHA 3OEHD 4EPRA 3AVWA 1XBTA 3R9XA 4PC6A 4CRWB 1E9BA 2ZI6A 1Q0UA 2R8RA 2CMKA 3BFXA 3NEJA 5AJYA 3ADBA 3Q85A 1GKIA 2QNRA 3GMTA 3OIVA 4TMXA 3KXKA 2WJHA 3TK1A 4HLQB 1O3YA 4HUQB 3UANA 2VHQA 4YXWA 4TZ0A 3PJRA 4AKHA 1FTNA 3ZD7A 2LKDA 3TAHA 3EX7C 4MGKR 4PO9A 4ZO4A 3WMGA 3U6KA 2QN6A 3GFTA 2VL7A 1ZYUA 3SFVA 4DLSA 3BS4A 4FN5A 4Z8XA 3VHLB 1RC8A 4AKEA 1QHGA 4GBMA 3SQXA 1CTQA 3GD7A 2REXB 3TW4A 5ELXA 3IHWA 1NNEA 4LC0A 2GXAA 2PLRA 1OFHA 1N0VC 3MMPA 3NEYA 2A78A 4NP6A 1XMJA 5F3WB 5AUNB 1NG1A 5BN4A 1G3IA 3MWJA 2QEQA 2ZR9A 4PTLA 3DMNA 2XTNA 1IXZA 1Z08A 4PZLA 5CLLA 1TADA 4KHZA 3SZRA 4V0NA 1T8TA 1NMYA 1KK2A 1E2EA 4JS0A 5EZ6B 1KTVA 4C9BA 2ORIA 3CRVA 1E2PA 3Q9LA 4F4CA 1KO1A 2ZRCA 1G5RA 2CL0X 4NE2A 4Q48A 1GM5A 5C1BA 4AI6A 1LNZA 2GESA 4KVGA 3LRPA 4ZCLA 4NYJQ 2G1JA 1P3JA 4BFYA 2YKGA 1ZRHA 2WOOA 4TTQA 3VNUA 1L7VC 2GF0A 2HF8A 2FGJA 2GVDC 4XH9B 3QVVA 2GAAA 3OIWA 1OYWA 1UM8A 4WXRA 2J9RA 2IT1A 2O8DB 1YZNA 3SDZA 2VHTA 3OEED 1N6NA 4DDWA 1UBGA 2ZRLA 3H0KA 5P21A 3THXA 3OE7A 8OHMA 4P4SA 4B76A 4QHYA 1NN5A 2KB0A 1KI1A 3LXXA 4DLZA 1QF9A 2E87A 3FKQA 4D6PA 3TR5A 2B8TA 4G5GA 2Z83A 1M8PA 1IN5A 3JVVA 1NSTA 2DFLA 4FXPA 2QU8A 3T61A 1G9XA 3VTKA 3U7EB 2ZS9A 4TMTA 1BIFA 2I4IA 3PITA 1AS3A 2V54A 3TW8B 5TDHA 3TBKA 3VR1A 4UNQA 3B9QA 3NBXX 2HV8A 2XTZA 4JYCA 1G41A 1M7GA 4BASA 4YQFA 4B47A 2REBA 2AK3A 4AWXA 5B57C 1R8QA 2RH5A 2VF8A 1ZIPA 2NZJA 4NYMQ 4FMCF 4B32A 4NBSA 4A0HA 1G19A 4M8NE 2FH5B 2VLIA 1Z0DA 5C18A 4URZR 2QPAA 3LW7A 1YZKA 3SYLA 1AM4D 1ZNYA 2WJJA 5F98A 2ZS7A 1XNJA 3CIOA 2ZUBA 3TUZC 2R62A 1GDDA 2ZSBA 2RGCA 2IUTA 2CK3D 3RRNA 1KNQA 1UKVY 4B44A 1QVAA 3HJNA 4RFSB 1U94A 1OB5A 3L8YA 3BH0A 4C30A 2K5UA 1Z06A 1TF7A 4TL8A 3PIRA 4TQ9A 1FX0A 2O0JA 2PJZA 4HEJA 1IM2A 1GNRA 2HXYA 5IDVA 1JPNA 1Q1EA 3U3KA 3EPKA 2PX3A 3FWYA 4G3XA 1OW3B 2VQSA 2NQ2C 4AYTA 4W7SA 3R8CA 5EP4A 3EPJA 2ONKA 3TJZA 2VP2A 1BOFA 2W58A 4GZMA 5K8TA 1E1QA 3AKYA 1Z6TA 3I92A 4JBWA 5HKKD 3T34A 2YWEA 3CPJB 1R0YA 3CO5A 1XPRA 1D9ZA 3GLFE 2O8EB 4L4UA 4TLEA 1HYQA 5L3QB 2ZTSA 3KFXA 4MGIR 3W6OA 5J4VA 5KOYA 3M0EA 5EE0A 4NCNA 1A7JA 2NPIA 2PMDA 3EC2A 1DELA 3IGFA 5EUQB 4KITB 2J0VA 1U0HC 3P20A 2FSGA 5FOUA 4PO1A 4DHEA 1ZUIA 2ZRPA 2E9SA 4BZQA 1T9HA 4WZ6A 1Z0AA 4XD7D 2EW1A 5B58C 2OEPA 3THXB 3IUYA 2JCSA 2IC5A 3EIEA 5JRJA 1BKDR 4XSHA 2EWVA 1DADA 4C0BA 4LHYA 1ELOA 3L8ZA 5L3RA 1P2SA 3K9HA 5IT5A 2P3SA 4BLOA 4U02A 1E0JA 2CCGA 3MJRA 4C0QC 1KSFX 4P33A 5AJWA 3OESA 2GRJA 2GEUA 3FHTA 3FB4A 2D4HA 2KWIA 3PR1A 3U3RA 2KSQA 1R0ZA 2DFKB 4IXNA 1MO3A 1R0XA 3FE2A 4QGAA 3M6AA 4B48A 3CB4A 4DKXA 4QHTA 2UZIR 4NYJR 2AFHE 2GHIA 5KDLA 4F91B 2Q9BA 2JA1A 3BERA 5GVRA 3K0EA 4B3CA 1VIYA 2O8BB 1ZNWA 3EA0A 5JS8A 3I5XA 2VH5R 3WY9A 3KXIA 3ZZTA 5JS7A 1F60A 3FKSA 1GITA 1NN3A 3BH6A 4M1WA 3B78A 4B6EA 2QAGB 2G3YA 1D2NA 1FFHA 1Z0KA 1J8YF 1KY2A 1OHHA 1W4CA 3LA6A 4IDHA 4XVQA 1Q20A 1NG9A 1NIJA 4M1MA 1Z6YA 2BEJA 2F55A 4C7OB 3D31A 1NF3A 1T0HB 4M9XA 4V02A 2IYLD 2Z0MA 2IYTA 4BFSA 1UBCA 4FMBB 4GDFA 2QE7A 1UPTA 3RS5A 2ODWA 3IPYA 5FUYA 121PA 5JBQA 1X6VA 4X8OA 1D9XA 1W0JD 3BFVA 3DOEA 1D2MA 3HPRA 2BDTA 1WB9A 1Z6AA 3DL0A 1F2TB 4DLTA 4KVAA 1GOTA 1VG0B 3ZDQA 4RVCA 2PEYA 2ZRGA 5EXTA 3T35A 2BKUA 2XZPA 1CR2A 3IIJA 1I2DA 2WIBA 3IIKA 3QSYA 4D0LB 1K5GA 1K5DA 4WAUA 3F0TA 2IYSA 2YHSA 5TV2A 4CT5A 3X1WA 2ZI7A 2V1UA 2QT1A 1VMAA 4FMCB 1KO7A 2QT0A 5H8WA 3AUXA 1G3QA 1OXSC 3AVOA 4NYIR 1A82A 3ND9A 2F1JA 4W5HA 1PJRA 1JAHA 5FTKA 2W6IA 1TL7C 5EE9A 3TUIC 2QMHA 3RSLA 3EG5A 1KSHA 2GXQA 1M6NA 1N0UA 3WNCA 3A37A 2DWQA 2FJUA 5D3MA 2PEZA 3FMFA 1YZLA 1P2UA 2CEAA 2CLSA 4EFLA 3X1XA 1RRFA 5FBWB 2EFDB 5FUXA 2JJ2A 4MYUA 2YINC 2BEKA 3UMFA 3O8DA 2XJ9A 5FH9A 2ANBA 1IN7A 4MYHA 3GEHA 1NBMA 2C78A 2NPFA 2IS6A 1Q1BA 4NCJA 2F7SA 4M2LA 4TYQA 4KCGA 3BC1A 1KKMA 1ZD1A 5CJ2A 1JXOA 1R10A 3K09A 4HLDA 4LBYA 4FI3C 4EQ6B 2D06A 3ASYA 4QRHA 3TVTA 4B3GA 1NMZA 3T1QA 1OH8A 3T1OA 5KSOA 4A0FA 1P2TA 1YKSA 4BQSA 4JLMA 3VAAA 1KI6A 5LPNA 1CEEA 4C0LA 4FCVA 5UKDA 3EPHA 3LLMA 4XTRA 4B33A 1OE0A 4ESVA 1P9NA 3OFND 4V03A 4DIEA 4B43A 4ZDJA 1AKEA 1SKQA 1MO5A 1TF5A 4B3BA 1LV7A 2Q6TA 4HAYA 4N0DA 4F4IA 4JT4A 1VG9B 4H1VA 1FNNA 3KJEA 2DPXA 1AGPA 3CZQA 2C04A 3O8RA 2WWGA 4GFDA 4IEEA 3QKTA 5G41A 4BGDA 1UF9A 4WA7A 1R4AA 1E2HA 2XOKD 5FUVA 1KY3A 3L0OA 5G3ZA 4Q7KA 4L9SA 3OHMA 1VCOA 2VRWA 3KTAB 4I1SA 4B3FX 3MSXA 1YZTA 3VU9B 3ZVNA 3EIHA 4LYFA 4AG5A 1U0JA 2ATXA 1GWNA 5FTLA 3THYA 1HE1C 3KJIA 4ZV4A 3M1IA 1F2UB 2IWRA 2WJIA 1CJVC 2H92A 1E1RA 4ERNA 4ZI2A 4RD1A 1QBKC 4YMWA 1EFCA 4Q7LA 1S8FA 2OLJA 1CRQA 4URVR 3A1TA 2EQBA 1M74A 2CJWA 4JJZA 3B60A 3LV8A 1IXSB 3IDQA 1K6MA 1Q3HA 3X1YA 1T5LA 3UIEA 2NTYC 4OYHA 1HQCA 4GPTA 3AKCA 5DI3A 4Z51A 3DZ8A 3LWNA 2VBCA 2BJWA 3PCRB 3FGNA 1FP7A 3V9PA 3WNDA 2AWNA 3SHWA 1U90A 5HTKA 1X8KA 1NSFA 4Y0AA 4EJSC 5M04A 2V55B 1II8A 3R7WB 1US8A 1BMFA 3AKDA 3THWB 4A6XA 1OKKA 3QKRB 5SZIA 4AG6A 1OH7A 4TL7A 1QHHA 1GL9B 1OB2A 1AKYA 3EARA 1UFQA 3E1SA 3B85A 4XSGA 2R44A 4IOKA 4LHXA 4DVGA 1H65A 4Q21A 1DAIA 1U81A 3FHCB 5G3YA 3SE0A 1P73A 5FL7D 3MWYW 4CYMA 3C8UA 3TQCA 2RAPA 2OBMA 1SXJD 1JJ7A 1US8B 2JLXA 4A0RA 1DO2A 5C4MA 1J8MF 4FWTA 4QNRA 3QXHA 3IHLA 5SZKB 4LPSA 4A1FA 2BMJA 2A9KA 2R6AA 1GRNA 2YOFA 4PAQA 4HAVA 3LLUA 1KDRA 1E2GA 1I4LD 4E03A 4EFNA 4UJ3A 3W5JA 2WIAA 3RS4A 4C7OA 4J0QA 4U7DA 4M9ZA 4KAXA 3RDPA 2IUUA 3GEEA 2YV5A 4HB3A 1WBDA 1DARA 4R7ZA 4B2PA 1LW7A 2XNDA 4BFTA 4US2R 2HJGA 4OK6A 1AA9A 2ZRKA 3TGPA 1F2TA 5JECA 5JCZA 3QBTA 2IYWA 4EDHA 3QXCA 3VR2A 2O8CB 2PH1A 2JLUA 4PC1A 5JI2E 4K81B 2ORWA 4TLBA 1XJ0A 4XJXA 4IXMA 3NBZC 2VIIA 1DAGA 2AFIE 5FTMA 1GL7A 4BZXA 2PZEA 1N6HA 4RZUA 4HB4A 1R2QA 4V0LA 4WVFA 3U4QA 1W0KD 3PFIA 4M1OA 4XIGS 4A0GA 4M53A 3AVVA 1N6PA 3T5DA 2YYZA 2ZU0C 4YLGA 3I8XA 5AUOB 2GJ9A 3GJ5A 1CRPA 1P7CA 4CEHB 1CJUC 1KOFA 3IBYA 2X19A 3NHBA 4WIAA 1HA3A 4QJ3A 2FG5A 3RABA 5KU1A 4I99A 1XTRA 2HCBA 3N2EA 3OE7D 4M1TA 3C7KA 2XITA 2D7DA 4IEIA 4Q01A 5KNBA 5SZHB 4G1UC 1BYIA 1MT0A 1QHYA 2FFQA 5G53C 5B64A 1NVVQ 1TMKA 2YWGA 5F2EA 5FOXA 3LD9A 3HYTA 4NMMA 5DH9A 3U3OA 4ARZA 3K8YA 1D2EA 1W47A 1OV4A 1VCIA 1HTWA 2G77B 2X8AA 4Q00A 5JHGB 4UXJA 1KK0A 2CLDX 3ONWA 3BXZA 4OI0A 1VTKA 4NDZA 4LV5B 1XXHB 3UWKA 2AX4A 2HCJB 2HT6A 2ZXUA 1OFUX 2FZLA 1N5JA 4ZCIA 5JSZB 2A5GA 2VTKA 4AD8A 1TU4A 5DO9A 5L3SB 3B9PA 4XWAA 3B2EA 4CGZA 4HAZA 1R5NA 2FV8A 4D4MA 3QKRA 4TTRA 2BMFA 2QP9X 3CF2A 3EW9A 1NP6A 3C41J 2FSIA 4URWR 5ANRB 3KQHA 1W2GA 2HYDA 4DJTA 1OFIA 4PFSA 1E4VA 2O8EA 3QEJA 2P5TB 5JEEA 1T3SA 1QHNA 4PHGA 1RFLA 4LBWA 2VA8A 4Q1CA 4Q4AB 3RWMB 2JLZA 4DCUA 4PZZA 1DAHA 1KYIA 1OLOA 4Q02A 1DVRA 1EFUA 1U2RA 3AVXA 2H18A 1JPJA 1ZAKA 4GP6A 1PUJA 1G8GA 3R9WA 2XOKA 2B8WA 1ZUHA 3IO3A 4E09A 3TVDA 1FOEB 2JJ1A 3WYFA 3WMEA 1XEWY 2JLYA 4LJ6A 1QG2A 5BYJA 1E9CA 1ZC4A 3I1FA 2PCLA 2JGNA 4FW9A 5JEDA 1SXJC 4PQRA 2OFXA 4NHOA 1X86B 4KFSA 2IYRA 1PVOA 3AF3A 4DDUA 4OJKA 3H1TA 4II7A 5FUWA 1E4YA 4Q4HA 2J7PD 1PLJA 2Z43A 3SEAA 1E79D 3DOFA 1E2MA 1M2OB 2OE2A 2WAYA 3PXGA 1GKYA 3U3MA 2ZI9A 1KK3A 1KI9A 5AR1A 3WBJA 1NN0A 2PJRA 1L4YA 4MGYR 2OZEA 4A92A 4PAOA 1XTIA 3CONA 3F3YA 1E2IA 4ZPXA 3SHFA 1XEXA 1ZJ6A 5BN5A 1KMHA 4TLDA 4GL2A 1XTQA 5J40A 2D62A 3A1WA 1G8FA 3AM1A 2PLFA 3LFUA 1S9HA 3QPVA 1TQ2A 1A4RA 2GJ8A 2REOA 5E7JA 3TE6A 4ABYA 4C0KA 4DSUA 4Z54A 1T8UA 1H8HA 4PX9A 3K0FB 1Z22A 4JVNA 3ZJYA 2FGKA 3L2OB 4NYIQ 1MO6A 2DHRA 1XF9A 4MKGA 1UJ2A 2G83A 3E2IA 4Q7MB 3UG6A 4B2IA 3K0SA 4D81A 1Q1ZA 1W4AA 2O8DA 4ZCMA 4DB4A 3LNCA 4UNRA 2WBLC 2J5XA 3DHWC 4PZYA 2AHOA 4UJ5A 2NO9A 5FBQB 5DHFA 5FBRB 1E2LA 2ZE6A 1RJ9B 4V0OA 2GZHA 1LS6A 2CE7A 4JLAA 4WBSA 4LJ5A 4JLOA 3SYKA 3W6PA 1KNXA 5CM8B 5DNYB 3GJXC 3RNLA 5HR5A 1Z0FA 4M9QA 5J4HA 2HYIC 4OBEA 2WMOB 1I4DD 1N5IA 3NBFA 4HAWA 1I4TD 1PLKA 2FFAA 3DKVA 1UKZA 4QGFA 2F9LA 5DN6D 5KO2A 1QVRA 3RRYA 3W9YA 1IY1A 2IS1A 3KKPA 4HYYA 2R6FA 4OQFA 4PPGA 2XGJA 2Q3FA 3PUYA 1PUIA 1W36C 1NLFA 3QVUA 4PO8A 2ZJZA 3NH9A 4O3MA 4OKSA 2Z5FA 4MQBA 3E70C 1CKEA 2V7QD 1XD8A 1OYYA 2B21A 2JLRA 4Q9IA 1UKYA 1GSIA 2OILA 4Q7JB 1E0KA 1CU1A 1G1MA 4R2IA 2ZPTX 1RJ9A 4CZ2A 5DISB 3A58B 3GJ6A 2D2EA 1TQ4A 2QTVB 3CRQA 1G17A 4X8HA 4HLUA 3FMIA 4TN1A 2QL6A 3DVLA 4CT4B 3N70A 3QE0A 2O52A 4MGZR 3SN6A 1DO0A 4Q1AA 2IL1A 1SQ5A 2A5FA 4JLDA 2W00A 2IYZA 1Z47A 2QP4A 1U0LA 1G8HA 1DG1G 3A36A 4QKQA 3Q5EA 2G0NA 3WP1B 3BK7A 4Q4HB 2B7BA 1COWD 1II9A 3AB3A 2CVHA 4DIDA 4DLUA 2QQEA 2CE2X 1II8B 1T91A 2G0TA 2V4ZA 2OCPA 4FMDF 3R7WA 1IN8A 3QNUA 5DYIA 1F5NA 1JQJC 3QPUA 2V9PA 1GRQA 3QI2A 5E3HA 4ASUA 2A5JA 2QSYA 4P32A 1S2MA 2NO7A 3W90A 2ZSEA 4QG7A 4ZI3A 2CLCX 2IXGA 5JJIA 3OAAA 3FMPB 2ZRAA 2OBLA 1RRCA 4GOJA 3QXSA 1RYFA 2FA9A 2FEMA 1OFTA 2QI9C 3RRZA 4LHZA 3LDAA 1F2UA 1VDZA 1UBFA 3BFKA 1KMHB 4BWYA 1CBUA 1YQTA 3MRSA 2J46A 2I3BA 2XX3A 1P72A 1XMSA 1C1YA 4D4JA 2H1LA 3VU9A 2ZE7A 4A2WA 4DDVA 4D4KA 4Q9KA 3A4MA 2EVWX 2GAOA 1KI3A 3GLHE 2WWWA 1KI4A 1U9IC 4JVLA 5CIWA 4CEJA 3CRRA 2BBSA 3KX2A 5JWRA 4S2EA 1WA5A 2Q21A 3MAAC 2EWWA 3TLXA 2G1KA 3VHXA 3BB4A 5AUQA 1Z63A 3RANA 1LF0A 4P0TA 2GETA 5JLJA 2PCJA 3R20A 1X8LA 4D80A 1ZNXA 2ZQ5A 5IRCD 1Q22A 3C5HA 2NIPA 3IBGA 2ECKA 1W5TA 1OH5A 1KZ7B 4G5SA 2GCNA 2OO7A 2ZRDA 4H1UA 4AC9A 3UMSA 4F7WA 5BWMA 3CH5A 2IYXA 1DS6A 1AS0A 2ZRNA 4XTCS 1XB2A 5TY0A 4EQ6A 3FDIA 2C77A 4ITRC 1CLUA 5HZHA 4ARZB 5CITA 4LY6A 1MRSA 4XWKA 1YR7A 1XXHE 5CK5A 4V0ME 2V6IA 5AJZA 2QROA 4JVSB 4K8OA 4B6FA 3KFVA 5FI1B 1ZW6A 1R5OA 4OK3A 3QXXA 3HDTA 1E2NA 2N46A 4BFUA 3LQQA 4MA4A 2AKAB 5GVSA 3ETLA 1JB1A 3GQBA 4Q9JA 4DRZA 3B8HA 4Z8YA 1JBKA 1NMXA 4DZZA 1W36B 4B34A 3I32A 2QM7A 4A15A 1CJKC 4DLVA 1FQKA 1ODFA 5K8UA 4HZUB 3FOZA 4JYBA 4TL9A 5CDFE 3P32A 1IAQA 3SJAA 3PEYA 3K1JA 2IK8A 4KSCA 4UKDA 4K46A 1KJYA 1IQPA 4TLAA 3VR5A 2DFNA 1JR3E 3M4YA 4QM6A 2OFOA 3SS8A 2N1BA 1W4BA 3I62A 1S1CA 3PEVA 4LJ4A 4PC2A 4MH0R 5J47A 3GJ3A 4RCZA 4RY2A 2R6GA 4RKEA 1NN1A 5E7MA 1ETUA 4BFZA 3AVQA 2F6RA 1GVNB 3RAPR 4LHWA 1W4RA 3THWA 4X8MA 2WWYA 3QXJA 1SXJE 1KMQA 3BBPA 2MSCB 1XEFA 5HCIA 3VMFA 1KO4A 3SJCA 3ZZ0A 2O0KA 4LYHA 2AR7A 3GJ8A 1M34E 5IK2D 2FFHA 2P6NA 3TSWA 1KI2A 2WWHA 1J2JA 1D6JA 2FEOA 4Q47A 3H86A 4N1AA 5A4JA 2H5EA 3EIQA 1PV4A 2HLDD 4Q4JA 1OSNA 3HP1A 3SU8A 4B35A 2B7CA 4EPWA 3AVTA 4M0LA 1Z3IX 4TSFA 4G01B 2ZYTX 4A6PA 1N6LA 4IW3B 2XXAA 1E32A 1O87A 4BLRA 2QRZA 2QAGA 4BRWA 3VX4A 1P62B 2ZJAA 4TT3A 3EWAA 1W46A 4RD6A 1G3RA 5H68A 2B92A 4GZLA 2FNAA 2QMEA 3CX7A 4PSVA 3QKSA 4A82A 3Q8XB 2VP0A 2GCPA 3AF0A 4BEJA 1LTQA 1J99A 2CL7X 1VKJA 5DIFA 5FBVB 2BIFA 5C4GB 1ZP6A 2R6CA 2CCKA 2KI5A 2W6JD 2RGBA 1XPOA 1QRAA 1CR1A 5FR1A 4U00A 2JIZA 2IXFA 4JL6A 1ZM3A 3RS2A 4DCTA 3W3AA 1XP8A 1LB1B 1X8JA 2R65A 4L8GA 3U60B 2EYQA 3NDBB 2AD1A 4DSOA 4BLPA 2J41A 1FQJA 5CJPA 5CYOA 4NCKA 4KFUA 4QBGB 3SJBA 4DLXA 2ANCA 1EG7A 3ZLJA 2O8FB 2BMEA 3KZ1E 1S0UA 2VP9A 1NVVR 3TR0A 2HT1A 3RS3A 3SJZA 1NVXQ 2YOGA 5CK4A 3T1TA 5GJVC 3NTUA 4OQLA 2D3WA 2D74A 2JJ8A 3KUCA 4PC3A 5EJEA 4PANA 4HUTA 1ANKA 2C99A 2WWXA 3LVQE 4JBYA 2AXNA 1NKSA 2GVZC 2LCFA 3CRMA 4TL6A 5EUMA 1G291 4M1SA 2BV3A 2A3RA 1G7TA 2C5LA 3F8TA 1VYUA 3FFAA 3WXMA 3B13B 1ZCBA 3CF0A 1SVWA 3A1SA 1NIPA 2J0UB 1CF4A 1GRRA 4TMZA 2ZI4A 3D7MA 1SGWA 5TXGA 2FF7A 2QTHA 4US0R 4BFXA 4YDHB 1BMFD 2PZFA 4W5JA 1XCGB 2ZAMA 3CNOA 3RS0A 2AK2A 3B82A 1WP9A 4AIIA 4B73A 4F4JA 3GJ0A 3BJIC 5F9FA 2GXUA 1TEVA 3IQXA 1JQLB 5EE1A 4BLQA 3KL4A 4QGHA 1G16A 1P9WA 3U3JA 4ASUD 2ZJ2A 3PENA 5DYGA 1GFIA 1F3OA 2QGNA 2XB4A 4OQXA 1VYVA 4IDOA 2VHJA 4OL0A 4IDNA 4ON9A 1RYHA 1FW6A 5BW8A 1JEDA 4RZXA 4JZKA 4RCYA 4C4PA 1CS4C 1E9DA 2J0SA 5EP2A 4IDPA 3GLFA 3B6EA 1HH4A 2RGNC 1KI6B 4ZIRA 1NL3A 4NU0A 5SZJA 2W2VA 2H17A 5KTYA 1E1RD 1EXMA 3ZD6A 1FX0B 4AY2A 3GLGE 4BLSA 3I4LA 2Z4SA 1NI3A 1YJ5A 3KKOA 2IX3A 1CJTC 2OHFA 1NJFA 4JKIA 2GXSA 2JDIA 3CPHA 1ZUNB 2AN9A 1X3SA 3CR8A 3VKWA 5KYKA 4FCTA 4D2IA 3PEUA 4G5OA 1G18A 1XJCA 3QKUA 1OXVA 1SVIA 2ZREA 3PUZA 1MH1A 1ZU5A 1UKEA 2FPMA 2W83A 4POAA 3REGA 1KO5A 2WV9A 3PQCA 1HV8A 3B7GA 2DFTA 4MRRA 3MUFA 2O8CA 2A5YB 2DCUA 1AGRA 2WHXA 3KDSE 3TQFA 4R71A 2MMGA 3DPUA 4IFEA 1UBEA 3BGWA 5AK0A 3GCGA 2QZ4A 4Q1FA 4KO8A 1MO4A 4D82A 4F93B 2Q3MA 4F92B 3IEVA 2I1QA 5EQTA 4ZDWA 3QQ5A 1Y3AA 3CM0A 3T5GA 2JATA 1QHIA 1Z2AA 1RRGA 3A1UA 2NGRA 2BMDA 2CVFA 2VEDA 3I73A 4OJQA 6Q21A 5FPKA 3ZH9B 2PMKA 4DBLC 1EWQA 4NH0A 3ZGXA 5JI3E 4G0NA 3EZ7A 1TUEA 1YR8A 2ZROA 4EIWA 2WTUA 3IIMA 2XZLA 5KUTA 5IHPA 4PQYA 1XTKA 4B2LA 2MMCA 2BVNA 4URXR 2XSZA 3OIUA 3UG7A 1IBRA 2OFWA 2WKRA 4R9UC 1E9EA 3X1DA 5JJKA 1S96A 5AJXA 1AQUA 4TT3D 3AQ4A 3I61A 2RHMA 3AP1A 1EGAA 3CR7A 1SXJA 1P9RA 2P0EA 2WSSA 1JECA 4B3XA 3FVQA 4DWJA 3JZMA 2GCOB 2IUSA 1IN4A 1VYTA 3L0SA 4TSFD 3WYGA 3U7FB 1Z07A 3RC8A 4FCWA 3KKNA 1KHTA 221PA 2FFBA 1YZUA 2W6JA 2C95A 1N0WA 5GJBA 1OIXA 2GEDA 2OV2A 2HJVA 1QHSA 1GZSA 2ZVPX 2P2LA 2YNMA 4IJMA 4PR0A 1N25A 3DKPA 4JMPA 5AJVB 5H70A 3ZQ6A 2YWFA 4UQOA 4Q4AA 4MYTA 5BXQC 1XJQA 1OH6A 3GLIB 3QF4B 1GILA 2QMUA 1E2QA 4XVUA 3ZVLA 4O2LA 1RE0A 4TQUS 3WNBA 3U7GA 3U6BA 5DHAA 5CDFA 4QGGA 3Q7PA 1KSJA 2AL7A 4YMSA 3VNVA 5HZKA 3RVBA 3Q72A 2CBZA 2AKYA 3Q5DA 5TVKA 3TH5A 4OQNA 3C14C 1MABB 4I1OA 4UNNA 4AURA 3NC0C 2RGAA 4MKFA 3IILA 4IOJA 4RD4A 4HI0E 3UK6A 2P6RA 1U99A 1VIAA 4QM7A 2KE5A 1W5SA 4R98A 1FZQA 3RHFA 2ZM5A 1JALA 3ZZUA 1N2CE 3QG1A 4JLJA 3A6PC 4EPVA 1MOZA 3DZDA 1M7BA 1XCPA 2QENA 5E7IA 3S1AB 1E2FA 1TNDA 5E95A 4KI0A 1G5PA 1YRBA 3B1XA 5L3QA 1GNQA 1XRJA 4AK9A 2WOJA 2QE7D 3FYHA 4LOAA 1HEIA 1ESNA 4FIDA 2QBYA 1WBBA 2BHRA 2FDCA 1P6XA 1Q3TA 4FD2A 4XOIA 4JT2A 3HU3A 3ZS9A 2F1RA 4LZZA 4TYPA 1G6OA 2QORA 2EFHB 1ZD8A 1MABA 3RYTC 1COWA 1UADA 3EZ9A 3QPWA 1OXXK 3CH4B 5DE3A 1P4SA 3K0AA 3TUJC 2JAQA 3MLEA 4Q66C 1JNYA 4NYMR 3K70C 2ZUCA 4RZ2A 1Q1QA 2ZR0A 3MJHA 2HEIA 4OHYA 1WRBA 4KLNA 3RRMA 3W8RA 3WRXC 2ZSAA 3QUSA 1WDTA 2C03A 3LX5A 1EFTA 2QPOA 3AP3A 3BWDD 3T06B 5LD2C 2OM2A 2YWHA 3NDPA 1ZU4A 2QBYB 3V4RA 1E9FA 4S35A 3LH5A 5DLQC 2X77A 3VKGA 3WP0A 3LQRA 3I3SR 3KJGA 1A2KC 1AS2A 4F38A 1KI7A 4HDCA 2P6UA 5EXPA 2CL6X 2OESA 2OLKA 2D7CA 2QSZA 1GNPA 4CW7A 2ERXA 2ERYA 4NKRA 4LYAA 4NPHA 5CIQA 1RZ3A 3X1ZA 3SFZA 2WWIA 1EFHA 2C98A 3BIFA 5JWOA 2O0HA 5L8VA 4LSGA 4BPBA 4TWZA 4OI2A 5EE3A 4DCVA 5L3VA 4YMUA 3B1WA 2XSZD 2RMKA 4OHZA 4MUAA 2RB4A 3K0CA 2ZU6A 4LDJA 4A4DA 3UKDA 4D25A 5KHOC 2XTMA 2EFGA 821PA 3GLHB 3K70D 1VHLA 1XMVA 1Z5ZA 3I72A 2WAXA 3QEOA 1I2MA 3MFYA 2W2TA 5GJWC 2HF9A 5JFGA 1DBSA 2DR3A 3DMDA 4HB2A 4DT1B 4YC7A 2AD5A 1XU4A 4JKYA 4LJ9A 1MR3F 721PA 2OUKA 2WM9B 4HDQB 4C2TA 3ICEA 1DG3A 2HDNB 1XD9A 1M7HA 1HUQA 1E3MA 1G4AE 1OF1A 4KSBA 1AK2A 1MV5A 2FU5C 4LK2A 3NC1C 2SHKA 1P75A 1SVSA 3OAAD 2OXRA 1GAJA 3TAUA 5H1YA 4GP7A 2DWOA 4RSGA 3PV0A 1XZPA 1N6OA 4IKEA 4E07A 2RGNA 3I5YA 2ZJOA 2J7KA 5IK2A 3FTQA 2WSMA 3K53A 2YJTD 3P4XA 4QC2A 3GLGA 1S3SA 2R2AA 2H16A 5KNCA 1JJVA 1HT1E 3CWQA 1KZGB 1JEEA 4M4SA 1YZQA 3D3QA 5KPDA 4CEIB 1N5LA 2FWRA 2OCYC 2ZRIA 4NCIA 4Q1DA 4AKGA 3SYNA 4NCHA 2XEXA 5A5GA 621PA 1E96A 4JJKA 3GLIE 2RCNA 5FI0B 1ZMXA 4PPFA 5FPYA 3GLGB 4WW0A 1NJGA 3TRFA 3ZIAA 1E6CA 2B6HA 2O5VA 4BFWA 5C46F 3ZQJA 3OZXA 1Q12A 2Q9CA 1IHUA 4Q4JB 2ZAOA 4GMDA 2L0XA 4HZUA 2C9CA
chains in the Genus database with same CATH superfamily
1RVDA 4CWAA 4CF4A 2EW2A 1KAHA 5FBLB 5AKIA 3WX0A 3CZ5A 2IIVA 3LX6A 3OTOB 1P5RA 2PT5A 3KJXA 3MJDA 3RARA 3H5AA 4Z4EA 2H4FA 2A4KA 3P1JA 5DX1A 4CMIA 4QGSA 2AFHB 4U0KA 4DEXA 5C1IA 4G89A 3R9IA 5CYFA 3O8BA 4NCAA 4LYJA 4XEUA 4OKNA 2FQQA 3UK7A 3M6XA 3SQWA 2DXIA 2JFNA 1GGEA 3F1KA 3K0FA 1IPHA 1U3UA 2V65A 4KE6A 4GNKA 3SR0A 1JVBA 2V5VA 2VJPA 1OXUA 2PN1A 3Q1LA 4JUIA 3ROMA 3IP6A 1CY6A 1OLXB 1X7ZA 3M6MD 3CUEF 2Y3IA 2GN0A 1V1MB 1YACA 3X1MA 1SKUA 2OO5A 3I8SA 4FM9A 2WLSA 2EHJA 5J59A 2ZCVA 2PUEA 1TXGA 4AP9A 2HSWA 2HXSA 4DC9A 3VISA 3RK1A 3IKJA 3AR2A 5AVQA 4UNSA 2NZ2A 4KHPB 5HPYB 1FPMA 1Q7CA 1B00A 4HAUA 3OLCX 4L73A 5ALZA 2AZDA 3FYUB 3NTVA 2YVUA 5J5CA 4BPRA 1F0KA 2ZJ8A 3JSXA 1T3HA 1PT8A 1WMSA 1XDWA 1FSZA 2H1SA 3CFYA 3EXG1 4KOEC 4BWVA 3FPSA 1KO8A 2XJ4A 3I2YX 1J1IA 3ZR4B 3RYFB 4KXXA 1M66A 1WB5A 5DN9A 2C20A 1AIPA 1QQ6A 4A9AA 2QVGA 1NXWA 2R8XA 1JX6A 5CH5A 1BRTA 1CULC 2H9IA 1UOPA 2QL9A 4H9GA 4YMIA 4RKFA 4OGLA 5I4IA 2ZJBA 3OX1A 2HUNA 4WN3A 1YE5A 5JNRA 4UTZA 3CE9A 4A7PA 2IE8A 1ZI9A 2OT3B 4JB0A 5TGZA 2QXYA 1TVKB 1TA0A 3TBHA 4E1BA 3I4CA 1UDWA 2X4GA 2OCGA 3ZHOA 3BFPA 4ZCQA 1S4QA 2QJFA 4IG4A 5HGXA 4B75A 3R23A 3TIGA 3O2SB 3JRWA 1U1IA 1EFRA 1Y9EA 4UASA 3WJ1A 3T99A 1J23A 2RGGA 2VTBA 1GGFA 3DV0B 2DFDA 3DT9A 4X6YA 3ROPA 2VTVA 4ZHQA 1DKRA 1EVLA 1MN6A 3OETA 3ZU2A 3A9CA 3C2QA 3WQBA 3EZ6A 4XWOA 1MAAA 3ANLA 2W93A 3BSSA 3I05A 3KBBA 3TSYA 3ZC3A 4N5HX 2PZGA 4KPGA 3RVDA 3I3OA 3WK6A 1CF9A 2WJ3A 3HSKA 2IHNA 4LFAB 4DPMA 1E1CA 3R5FA 3EOAI 4L5YA 4TTTS 4EYSA 4JSTA 2A0XA 2JCYA 3G0OA 4HXYA 3L4KA 4V2UA 3G17A 1JDZA 4F9TA 3WSVA 1EWKA 1A8IA 1ULTA 4OA8A 5FJIA 3B3FA 1F6BA 1VA4A 3R5HA 3V7WA 2CFSA 2I65A 4C2UA 4MR8B 3ZCRA 1TQDA 2MSDB 3PQ8A 4WNAA 3TPZA 4PIPA 4B1FA 1D5WA 1Z15A 2TMKA 1T8SA 2F3RA 4BN5A 2D8AA 4NBWA 4EELA 2XADA 3S28A 4BNGA 1PR2A 5A0FA 3E5HA 1JMYA 1RR6A 3AJEA 3DCIA 3K0CC 4EYOA 8LDHA 4QPPA 2NTVA 1GQ2A 3CX8A 2FZ4A 3PB3A 3TZKA 5LD2B 1G64A 3CVYA 2A84A 3GF4A 1U3DA 4N7MA 1I2AA 2VP4A 3MCAA 3KT8A 2J7PA 4L50A 1ACLA 1M1YB 1D09A 3K73O 3N8KA 2RGRA 1GPLA 1DEKA 3HCOA 5JNTA 3JQ8B 2CNBA 2PU5A 4FIZA 1XLTC 2GJKA 2LWIA 3K96A 2RJ3A 4RK6A 1KK1A 1E2BA 3OPMA 3ES9A 3O95A 1U7TA 4RETA 1ZHOA 3DTVA 3I39X 2D1QA 3TLAA 1G2QA 3G68A 1GDHA 2C82A 3IEUA 1ZD3A 3MPUA 4ND8B 3CLVA 3R75A 1JJBA 2ZSDA 3P2JA 1YVDA 1L4KA 5DOZA 2WYUA 4YV1A 5JCPA 2PKRA 1BXRA 3AM4A 3EJWA 2XQGA 2PX8A 4QQKA 3CT4A 3CKKA 3VYSB 3RUAA 2JZOA 3SYRA 4A0SA 2GTPA 3CWZA 5CURA 4JEMA 1SVKA 2XCUA 1CNFA 4D5EA 3IELA 2BM0A 1LBSA 1PV2A 4A8PA 4KNVA 2FXIA 2IYQA 1O6GA 3HN7A 3SZ3A 2BGKA 1H6AA 1OX5A 4ALKA 4TV8F 3UXYA 2WUVA 3PQDA 1GNVA 2VPYA 2VSQA 4AS2A 1Z4PX 2PBRA 1NW4A 1QE5A 3LIPA 4M21A 2M6SA 5B37A 5J9FA 3CF6R 2YOHA 3LAWA 3KKMA 4JHXA 4QHSA 1AMOA 4TYYA 1T5OA 2IWHA 1T0JB 4P7JA 3C3XA 1EIWA 1HQDA 3P9CA 3J7TA 5FOWA 4LDAA 1WLSA 4QUKA 4FOPA 2PZMA 1H5NA 2GDJA 2I9PA 2QM0A 4P8RA 1TZKA 3GWGA 5BWOA 2TYSB 3D8HA 3ZXIA 2YS6A 2J1LA 4PAMA 4UM9B 1ZZGA 2XVZA 4ZT6A 3AHCA 4TYWA 2ZJYA 4LWPA 4E46A 2IY9A 3FM9A 3IP9A 3DDZX 1AQYA 1XAGA 4D6YA 2F43A 3JCZA 4RANA 3I01A 5TQ0B 3N5CA 1T6ZA 1E9RA 3C5WP 1ONBA 3JQ7A 3ORFA 2V4MA 3PWSA 4M0CA 2FPLA 2OCBA 3DEFA 4H6WA 3V00A 4BN0A 5JOQA 1H2BA 1T3LA 2VJMB 2ZW9A 4UCQA 5J4YA 1QP0A 5JD5A 1H9AA 4FFOA 4PPQA 3B12A 4EKEA 3V1TC 2NW6A 3LI2A 3GJ7A 1PT5A 4GMXA 1CJMA 3A10A 1PS9A 3TM4A 3WLRA 4DV6B 1U98A 1B8PA 2PGNA 1JMKC 3I9MA 4FMPA 3ZHRA 2J48A 3C5VA 4DL9A 1D8TA 1KDTA 3LU1A 2J9ZB 2QJOA 1I30A 4CF7A 5LQUA 5FQOA 1P0PA 2QN9A 1IB6A 2W2KB 1IDOA 4KBGA 5JBIA 2O8BA 4KBYA 3GLSA 5D5HA 4DWWA 4HDNA 1X7WA 3CW2A 3ACDA 1N2JA 2DWUA 4EZBA 1DC5A 2ODEA 1J0EA 3AB8A 3UF0A 5JYBA 3VVLA 3LW8A 3IJPA 3PR2B 3BRQA 4QYIA 1PKXA 5EESA 1OI4A 5HIIA 4Z2YA 4DM3A 2DYKA 3I2FA 5KDDA 5DGTA 2PRJA 3RBZA 4QASA 5LIPA 1N8NA 1U65A 3R7LA 1HLDA 4NLLA 4Q9DA 5AM1A 1Q57A 1HDRA 2C4UA 4AWAA 3BULA 4XVHA 3RYHA 4FFRA 3LBYA 1MOPA 2O4UX 3CZCA 2EQ5A 1UFOA 3H11B 3KVYA 3G2JA 3VKHA 1UMDB 4Z86A 5LKRA 4U9IS 1X70A 2AF4C 3E2PA 3IAEA 3IT1A 4MDEA 1FFGA 4R7TA 2V9CA 3OEHA 5EHNA 4G9BA 2BYTA 3V2HA 3I6YA 5FEMA 3AI1A 4TYNA 3LUHA 4O0MA 1N3BA 4KKXB 4P35A 1J2TA 2FN4A 4D3SA 5ERGB 4CMHA 3II6X 3PZRA 5DHSA 1L8AA 1Z37A 3T9BA 1P0IA 3PK0A 2ZUDA 4B3TB 4FC6A 4BGVA 3GD5A 4XGKA 1PJZA 1QO9A 1E8DA 4KGDA 2UZ3A 3G23A 2Z4RA 4WCFB 2PANA 3FYSA 2Q46A 3LPDA 3AVPA 1YZHA 4L6IA 1VBKA 1TW3A 2XYRA 3G88A 3H2JA 3TMKA 2ASEA 1UIRA 4RACA 1ZVQA 1SHKA 2QVLA 2V7UA 4FC7A 1I1QB 2HY7A 2XD4A 3AX6A 4IWYA 1DAFA 4MDHA 2BKEA 2WWTA 1R88A 3A2LA 4KVZA 4LBZA 5HDBB 4M37A 4EA7A 5AOAA 3PC6A 3PC3A 3TLGB 4CMKA 2WJYA 2YXNA 2ZYVX 4UE2A 3W8FA 1D4AA 4RUKA 3E81A 3Q7QA 2IS2A 2ZT7A 4H7IA 3DBOB 1FA9A 1YFLA 4Q3BA 4A2PA 4AF8A 5I9NA 3TI9A 4UCFA 5C52B 4WKBA 4MRSA 3CUWA 4L3VA 1ZR2A 1QM5A 2GN6A 4O4LF 1GTVA 2JGRA 2JGAA 1FYVA 2OBNA 2VK8A 3A1DA 3QWIA 4FZRA 4O2BF 3FKJA 5ARBA 1CQPA 1JBQA 1SCNE 1TIBA 3L7IA 2F8TA 5GONB 4UHEA 4W5WA 2AI2A 4GBGA 3IQZA 2WIKA 4HTFB 4KODA 4W1RA 5D3MB 5KTPA 1X1TA 2GGSA 4RQUA 1XU7A 2D2FA 1B0AA 5D5QA 4EUHA 2TMDA 1AU9A 1H3FA 1XZMA 1IBLB 3JZFA 4DV5B 2ZRFA 1CUBA 3OF2A 2UYHA 2Q2QA 5HJ7A 1VECA 2I71A 2PQ6A 3EGEA 3FNGA 1VMKA 2GJ4A 4ZT5A 5E6SB 1D1SA 2VYFA 4JI1B 1Y3HA 3L43A 2OQVA 3F6PA 3UTDA 3L7BA 4J9VA 1TCUA 2ODBA 3BWBA 3EASA 4ZO7A 3HJCA 3TNFA 3MUOA 1V5IA 1RBMA 1Q0RA 4WLNA 3HSYA 4ND5A 4Y2YA 5HIKA 3ZUGA 4RPIA 2VJMA 2OAP1 3NFRA 5DYWA 3EXFB 3VYRB 2XE7A 5CVUA 1QHEA 4YJDA 5T4HA 5FP0A 3DFMA 4EPYA 4OQMA 4O4JA 4PNZA 1P5JA 1AUVA 3OJOA 4HGPA 1Z4NA 3WGHA 4MVJM 4W82A 4ZVPA 3UYLA 5JCJD 3NLLA 4ND2A 4EPTA 3PSHA 4MPPA 2F3UA 1NYQA 5CGQB 3RGWS 1LW6E 5FAXA 1XVUA 2WD9A 4Q82A 1GNSA 1MGPA 5TNXA 4N5MA 3OFNA 1WXGA 2DRIA 3BQ9A 4PLFA 4MVXA 2KHZA 3TRKA 1LQTA 3QM1A 1BS1A 2HU7A 5D1NA 3T0FA 2NSLA 2XVYA 4YRPA 4HMPA 1V3UA 5KVCA 1APBA 3BH7A 3IJEB 3LX8A 3HM2A 1MB4A 2YJ5A 4M1KA 3K6SB 5KWIA 4CKWA 1SZPA 2CHEA 1MFZA 3WMFA 1AK1A 5ALFA 1U8ZA 2OGZA 1DRJA 1XYYA 4WOPA 2Q0SA 1P2GA 2VJYA 2XQKA 1ZMTA 4WCVA 3W2GA 2V7XA 1E69A 2O19A 2WYVA 4UC0A 2RHGB 4CV0A 4MXDA 4U4AA 2RG7A 2ZYUX 1VHTA 3EGOA 4L16A 4MWDA 1XVAA 3QKWA 5D3QA 4YACA 4GPBA 1XYGA 4WE3A 1CFJA 2HN9A 2IOFK 4HBGA 2IYUA 3QMPA 3ICPA 3PYMA 1EFPB 2QPLA 1M33A 4OBBA 3ZBUA 1H8HD 2DQYA 2UYOA 3WIOA 1E64A 4XQCA 4QL3A 4YO7A 1MG0A 2GYUA 1FUEA 2ZJ5A 3GLRA 1AGXA 1YMQA 3OCVA 3COJA 1HWYA 1FYWA 4MRNA 1L5NA 3W4JA 1YB5A 2C5GA 2N0SA 1UFVA 3EC1A 1SC1A 4BX8A 4YBRA 4EI8A 2J3IA 2PZ8A 2IYVA 1FEZA 3M8KA 4QFMA 5AW1A 2PYDA 1VPLA 3DJFA 3AINA 2C9ZA 3B3GA 3N0TA 1NBEA 4TV9B 2W37A 2O3JA 1W0JA 3OY7A 4MPRA 2QQGA 3WLFA 3RYCA 1SUCA 4PHTA 4DG9A 5FKJA 3L8GA 2OV8A 4GYYA 3P94A 2PZLA 3IP8A 2Y2VA 4HD8A 1M2KA 1GQYA 2NADA 1JHOA 1FMJA 1I6KA 3PI7A 4IUYA 1NX9A 2ON6A 3OU6A 5A04A 3BB1A 4IFBA 1X9IA 1YCHA 1U4SA 1B43A 3DO8A 4EVQA 4F1JA 2NYAA 2J9FA 3CKLA 1K8XB 5GAJA 1OHHD 3WJAA 3QWBA 1POWA 4IMIB 4JLVA 1M5TA 1X13A 2NSJA 3CCFA 4GBJA 4D8UA 2ZVQX 2B1QA 4PLZA 2EERA 4I81A 1AQ6A 3WGGA 5SV2A 3WV4A 4QTTB 2Z6UA 3TZQA 3GUVA 3P2IA 4S2UA 4DYVA 4DBVO 4R2HA 5ENVA 4DT1A 3G2LA 3RIMA 2OY0A 3OIYA 3ONDA 4OGGA 5FORA 4D9NA 3WDKA 1LQ2A 5HIMA 4U7HA 5E9WA 4TLCA 3ZGOA 1V43A 3BMOA 3F9RA 2R96A 1O97C 4BB9A 4FK8A 3KOUA 1E1MA 4MVCA 1FP2A 3KAJA 4KQHA 3UHOA 1KRXA 4JXZA 3TXAA 1YHNA 4MR9A 4BLWA 2GEFA 2QD2A 2HK8A 1NUQA 1E4OA 2AN5A 3C3WA 3S2GA 4ARAA 1MJGA 1EGMB 3ELDA 1TEXA 3BXEA 5KCMA 3Q3VA 2OAQ1 2FWMX 2RHJA 3O1IC 4JELA 1PDWA 1QDEA 4NE7A 1K88A 4Y30A 3UT6A 4RVOA 3LO5A 3ZQ4A 5LUAA 3ADDA 1URPA 3SF0A 1M8GA 4PSDA 1GKLA 3KQYA 4O4IB 4XD7A 6YASA 2ENWA 2FW9A 3UC9A 1FYDA 4AY5A 1CYDA 3OF5A 3EPLA 2QPTA 4G5RA 3WIVA 4PLWA 2ZRHA 5J1SB 2I54A 1ZY2A 1SXJB 3LVBA 4LX0A 3AL3A 4WBNA 2YZGA 4ADSG 4QJ5A 3MTJA 2EZ4A 2G06A 4J94A 4Q6WA 4M0MA 3M6VA 5HRAA 4DR1B 4RMIA 1TQ6A 3G2QA 2F8MA 1SKYB 1CDEA 2FJPA 2MHCA 1JIIA 1L6RA 4RM3A 3JVIA 2O3TA 1KFCB 1S89A 3ICWA 5TARA 4C0AC 4TV8A 3GJQA 5BOSB 5H9WA 4E2XA 1BYUA 4BECA 3CLTD 5ICCA 3VFDA 2FX3A 1W1WA 1SR8A 4LGMA 2SNIE 1JVSA 4OY3A 5J4LA 4ILEA 2IZ7A 4GR4A 3B6JA 1KETA 5IKXA 1U8FO 3SXUB 4CMJA 3G2MA 4X45A 1J5PA 2A9JA 2LP4Y 2PQMA 4EHDA 3KETA 2C4TA 2VZ0A 3B1VA 1BD3A 3DZCA 1L5YA 3H8WA 3Q3EA 3MWKA 4UAGA 3TNLA 1K98A 2OC9A 3WLTA 5JSZA 3IV6A 3KHUA 3ZOKA 4DLYA 5DBOA 4S1NA 4CM8A 5LLDA 3S81A 3A8TA 1JSZA 2GBLA 2ID4A 2JASA 3LVRE 2J0QA 1V4VA 2N3ZA 1C7JA 1S1MA 4X62B 4B7CA 3SLKA 2QV7A 3IRVA 4JASB 2BUBA 3NS7A 1FFAA 1Z0JA 5HF5A 2KBEA 4C1NA 5F73A 1XUOA 3QF4A 2IDKA 4IGIA 1PNRA 3KHTA 4HRAA 3CTPA 1JHZA 3H9UA 1ZOOA 3MC1A 2M9MA 4RDIA 1AXRA 2J33A 3AEZA 4E3ZA 1VOTA 1F20A 4LXQA 4NTZA 4X1OA 5AK4A 4AYWA 4ZHQF 3AXSA 5IH3A 3AKEA 3DQQA 2BEWA 5FPHA 3NX4A 5J1TB 3WYAA 3ICQB 3EQ9A 1TX4B 1HRDA 3UMRA 3DW1X 1FVXA 5E1BA 5JECA 1YD7A 4PPNA 1G2OA 1HXHA 1P0CA 4YO8A 5G1OA 4XIIA 4DNOA 5A6SA 3TW6A 1KEVA 1T5DX 1ZBQA 1W75A 4V24A 1KIMA 2XBUA 4Q3OA 1ZM2A 2FQ1A 1K7CA 2PUJA 2VPQA 4ECAA 2OVBA 1Z6QA 4CEHA 2QR2A 4ITVA 1OV6A 6ABPA 4Q6BA 2HDHA 5MGBA 1NQXA 4D92A 5CD9A 4ZIRB 1AMUA 4QOSA 2Q29A 2HNAA 2WTXA 1OXKB 4K87A 4HDRB 1JR3D 3L1VA 2P65A 3MJ4A 1BGXT 5GM1A 1MENA 3F2IA 5IAKA 2CHVA 3SI7A 3CZAA 4M8IA 4P93A 2WAOA 1LA2A 2JI4A 4JJ7A 4AS1A 1JDVA 5CFQA 3DW3X 1RM0A 2OUIA 3AV0B 3OP1A 4HLUC 4NU6A 1UUFA 1RI4A 4ACBA 5FLYA 3R7SA 3RNOA 2SKEA 5IJ0B 2YC4C 2ZRBA 1BX3A 4C4XA 3QVJA 1FXWA 1SVUA 2OSBA 2H2GA 2NYUA 2W6PA 4UHCA 2W48A 1DAMA 5IUJC 1AKQA 3HCPA 3O2NA 3FWNA 3TLMA 1S2LA 2IBMA 5GQSA 5JDCC 2O7NA 3DVAB 1FZTA 1R6AA 4WY5A 3H1EA 2EHDA 4K03A 1DWOA 3QELA 1PGNA 2RAUA 5JYEA 4S05A 2DG2A 2DBQA 3IPXA 1I01A 4ER6A 2I4MA 2XKAA 3PUVA 4XYEA 4B3DA 2GPBA 4CCYA 4E14A 1G8PA 2GCIA 5AK6A 4DXAA 1FLNA 4GOND 5FUQA 4ESOA 4U2GA 1XEXB 3A32A 4LCBA 4X6UA 5BN5B 4QU8A 5JXIA 4Q3NA 1EDEA 1Y4AE 1RXSA 1SCJA 2XUGA 1V8OA 3KFLA 2A5DA 2QUJA 5D86A 1J0AA 1ISPA 4A8JA 5REQA 5KX5F 4Q03A 5J4KA 2UYYA 421PA 1NQAO 2NN3C 1XFAA 1ZRNA 1Q7GA 3CLSC 4I1VA 4L22A 1X0XA 1DBVO 5K8LA 5A9SB 2ZI5A 4JL5A 1NR1A 4CDMA 1S02A 4XDYA 4DMFA 4JGGA 2YN0A 4GHWA 2J45A 1RTTA 5FTJA 3ADKA 2VRCD 3NIFB 4BFLA 2IF0A 3E9MA 4N5IX 5C5IA 1OFUA 2OCAA 2WJ6A 1NVFA 3OC0A 5I3CA 2GAIA 1Y1RA 1WVIA 4DMRA 3LYLA 1TECE 4MGHA 1UMKA 2Q8PA 4XWGA 4EJ2A 3STVA 2QAGC 4Q1VA 1DRUA 1ESEA 4JLKA 3KT0A 2RC6A 5JZVA 1KWKA 2BLLA 3GFPA 3MJTA 1E0SA 2R6DA 3WVNA 1D2RA 1NE7A 4RA9B 4CKCB 4C29A 1P33A 3UUEA 1AZSC 1SFRA 1INLA 3NYIA 4RYLA 4UUQA 1VE3A 3ENKA 1NW3A 1ZGGA 4KYVA 3V4FA 2QTLA 1G6Q1 3I9OA 4W4TA 4GSYA 3T9DA 4FJ2A 3CRW1 1BWSA 4QATA 3GVPA 2WKPA 1GXSA 1RLJA 1MO2A 1LI5A 1MVLA 4G1VA 1ECBA 1HE8B 3CPEA 1W581 1ZGJA 5KVQA 4LUCA 1PGOA 3WK5A 1FLVA 1Y6QA 1IY0A 2MWMA 5JJBA 1ST2A 4LY0A 2PKWA 1R0KA 1Z4JA 4S24A 3AM3A 3DAPA 3DFUA 4MP6A 1AC5A 1GARA 1OGJA 2QP3A 5C53B 2IDZA 1VCMA 4M87A 2FWAA 4W63A 3T1VA 4JLBA 4Y9RA 4JUCA 4MVJA 3K70B 1DC7A 1PYGA 1M34B 1QZ3A 4LRWA 3RIYA 4NZPA 3AEYA 1UDCA 3H6GA 1NNSA 1UT5A 3OM1A 4KN5A 4ACAA 1SELA 3PUIA 5IMSA 1X9HA 3A6EA 3T15A 1C3OA 2F9MA 2Q07A 3KQTA 5EIEA 1KJNA 1QG4A 1JHRA 1XXHA 2XYQA 3MN1A 4II3A 4E22A 1H8EA 3CO0S 5AKZA 2LKCA 2ECQA 1BXZA 4FGWA 3JALB 3ICVA 3K2IA 4PG4A 2D0DA 2ET6A 4N8DA 3V4PB 2NG1A 2VLBA 2F3QA 1ZG3A 3HI4A 2GF2A 3L92A 3NKLA 3R5KA 3G3EA 5H3HA 5TT1A 5AVWA 1WQ3A 4Z3OA 3L0IB 2PX2A 3NGXA 1GG2A 1XTBA 5D01A 1T9DA 3WYBA 1Z25A 5KTTA 3T0GA 1HURA 1Z29A 2FSHA 2HI0A 1PG2A 1Y1SA 2YZ7A 4EPRA 3D3NA 4Y6QA 4NOMA 4RV5A 3D1VA 1Q0UA 3U9SA 3PHCA 1GTJ1 3Q85A 1J9ZA 5AIBA 3GMTA 2I0FA 2FG7C 1I0LA 3QLEA 3AERA 4F9GA 2YVQA 3A27A 4LDNA 2M6KA 4HUQB 1Z5UA 3UANA 2IEAA 2EBFX 3HQ4O 4RLFA 1Z2DA 4YXWA 2WUGA 4NEQA 4QBTA 5TF4A 2LKDA 4QUHA 1QRSA 3TTTA 4QYXA 1SWVA 3WQRA 1G38A 4Y2XA 2C3UA 4B6PA 4DSAA 2A0UA 3OZGA 4DLSA 1NJ6A 1HX7A 2Y93A 4KIGA 3GD7A 2Y6VA 2VAXA 2Q45A 4HRVA 1ENZA 3RUIA 5ALHA 4KXQA 1NNEA 4LC0A 2X9NA 4FBLA 2WP0A 1SHUX 2HFKA 3SQOA 5F3WB 4WNIA 4REOA 4UBLA 1G3IA 4MVYA 2P7HA 2PKYX 3DMNA 3QEMB 3GWZA 3UJ7A 1KK2A 3A9VA 4TTVA 3ZHTA 4B5LA 4J29A 4F4CA 3SHVA 4O2BA 4FSDA 4ZT3A 1M5UA 5C1BA 1W1IA 4AI6A 1LNZA 2GESA 4G5YA 4MW9A 2H8GA 5BNIA 1SHTX 1EUCA 2ABWA 4ZXPA 1AH2A 3VNUA 1DLIA 1IEVA 3R2JA 4X20A 1L7VC 5DCUA 2GF0A 2HF8A 3WKAA 4D3FA 6REQA 3QVVA 2MDTA 1A9QA 1MX3A 3OIWA 1UM8A 4B81A 2QM3A 3MHPA 2FETA 4INOA 3W5UA 2JKVA 1T24A 1BXGB 1WHSB 1K08A 1UBTS 1O57A 3RHTA 4G5HA 1W0CA 1N6NA 1VE5A 3OEED 5MN6A 1GR0A 3PGXA 1UBGA 4C4OA 1AURA 3FDZA 3OE7A 4F1WA 1SXIA 2D7DA 3NO4A 1Q74A 4RWZA 4AJHA 4DLZA 4UCXA 5T67A 3ZKAA 1P2FA 2FWBA 2B8TA 4FFLA 2C4WA 4BGEA 1M8PA 4QZVA 5KTOA 3CUVA 5C8VA 3K9BA 4X95A 5GMOA 2WUEA 4TKLA 3FZQA 5KBYA 1XQ9A 1G66A 2R1TB 3WZ2A 1XV5A 3DPSA 1AS3A 2XHZA 4UUPA 5DM4A 5DWQA 3DZGA 3IPLA 4KRXA 1DUSA 1NTOA 3L0YA 2NZWA 1LZKA 3GJSA 2Q62A 5BV2P 3ZDAA 3VR1A 4UNQA 1FNBA 2PL1A 4AO8A 1SCAA 4G9EA 1KU0A 1DFIA 2REBA 2FVXA 2Z2XA 3N58A 1EUDB 2OYRA 3L8FA 4BKMA 2HEGA 4GUAA 5C8XA 3EGXA 4CMEC 4AMYA 3N05A 4B32A 3COYA 4NF2A 4D9IA 4XGNA 2J3MA 1XZBA 2IV7A 1NXQA 1E5QA 2G70A 2FH5B 3Q7IA 1Z0DA 1W2WB 2ZWAA 4KOAA 3WGOA 1B7GO 1F14A 4GVLA 5C18A 1ZIYA 2ZT8A 3KWJA 2COUA 3DBIA 4MHSA 1BWPA 3PEFA 2VDUE 1OILA 4A2CA 2R8OA 2VAMA 2PT9A 3AWDA 4MWGA 3RYFA 2WW8A 3WWDA 3VTZA 4FQ5A 2XUKA 5BO5A 1UM9B 2V03A 5DM60 2ZUBA 5LZ9A 3HGQA 3FJOA 4IUCS 4RA9A 2RGCA 3N3AC 5FD8A 4YRAA 2IUTA 1RCFA 5JSHA 3E3LA 2BUCA 1FFCA 3PDCA 5ECDA 1KNQA 3R0QA 5FA5A 8ATCA 3KNZA 1P1CA 4R01A 3WFJA 3WJ7A 3IVRA 1OB5A 2ATIA 3KVVA 3L8YA 3C6ZA 3O21A 2PJZA 3U3KA 1D2AA 2CJYA 4QECA 3LPMA 3E6AA 1JPNA 1CY7A 2H1WA 4G3XA 1CUYA 4ZQGA 5LU8A 4HEQA 4Z6KA 4AYTA 3MHTA 2OAGA 5F23A 5JNUA 2VP2A 1BOFA 2VAVA 2W58A 4LSWA 3H1GA 3AHDA 5GV8A 3HJUA 3CPJB 1YZVA 3CO5A 2XAAA 3QVWA 4IR7A 3GLFE 3FVVA 3KPJA 5G0TA 1I4OA 1HYQA 4AMUA 4GPEA 1P1RA 3W6OA 4F6RB 5J4VA 5KOYA 5EE0A 3OZTA 4NCNA 4QFDA 4CGYA 4BNIA 3EC2A 4FVTA 1MPXA 3QU4A 3AW9A 4J4TA 2V5AA 5HVNA 1USWA 3MT9A 3ENWA 5LMCA 3ZJUA 5CPBA 1QUFA 1ZUIA 4BO6A 1JEOA 1SCQA 4BZQA 1QFJA 4Q16A 1IH8A 3IDSA 1Z0AA 5FXMA 1NXSA 5DSTA 1H4SA 1I7NA 1SOWA 1YR2A 3ZD8A 3CPSA 3CG4A 3L6BA 5GZ6A 3L7YA 2IC5A 3EIEA 1JLLA 1G8MA 2PS1A 1LWNA 1USGA 4IS3A 2PGAA 4XSHA 5HUQA 1DXOA 1N5OX 1ELOA 1PVDA 4LHYA 1BVYF 1NASA 2X6RA 3G8DA 1VRVA 4U02A 1ZHHA 5K1ZA 3ZE1B 4C0QC 3ER9A 1FFSA 4OAPA 3V48A 1KMMA 3Q87B 2W2MA 3EGXB 2YWXA 3HNRA 4CKYA 4RELA 2KSQA 1U0EA 4D41A 3FE2A 2PRZA 3M6AA 3S99A 1PCXA 3I9FA 4K2AA 2MT9A 4ROSA 3SGLA 3JR3A 3ZZMA 4CG0A 3ZCQA 3INTA 1OXMA 5A5FA 4F91B 4I3FA 2IH2A 1JB9A 4YGXB 1AKNA 2JZNA 3AK4A 3K0EA 3RF7A 3L79A 4B3CA 4PYRA 2PTHA 4Q05A 2O8BB 1ZNWA 1EVEA 1DHTA 4L1KA 3EA0A 4AT1A 3ILSA 2VH5R 3WY9A 3ODPA 3ZZTA 1HYHA 4FXOA 1F60A 2EG9A 4OV6B 4CV2A 4QFCA 4QPDA 3BM5A 4Y2VA 3KLMX 2XE4A 4F3NA 5KU7A 2W2PA 2EZUA 3A6JA 4JA2A 4B6EA 5FULA 1R6XA 3ISTA 1OOEA 3FUVA 1D2NA 2I3ZA 3IAAA 1KY2A 2QN2A 4IDHA 1L5OA 1W4CA 3HY3A 4XVQA 1VLHA 3RTCA 3RJ9A 3K5WA 1NIJA 2G40A 3LHIA 3QPBA 4NFSA 4XI9A 5ADWA 4HWRA 4QVIA 2F55A 1GTRA 2DLCX 3MAGA 4M9XA 3EIWA 3H5IA 2Z0MA 4M99A 1Z2EA 4FMBB 1THZA 1UPTA 2VJAA 3Q3HA 2ODWA 3V55A 3U5ZB 1TU0A 3IPYA 5TIIA 2WM8A 121PA 2OGTA 5JBQA 1TCCA 1JUDA 1MNQA 1W52X 2P4SA 2RHWA 3CZRA 4N3CA 2PIAA 3BFVA 3VPBA 3HPRA 1D2MA 3QTTA 1PL8A 4C03A 4MV6A 2D7JA 3RYIA 3ZG6A 3BT7A 1WEHA 3BK1A 4YRQA 3ZDQA 4BO2A 2DT5A 2ZRGA 4PYIA 1Y0BA 4ALMA 4QE3A 1C9MA 2PWPA 3FTEA 2GUWA 3IV7A 4BNHA 3BD8A 3QSYA 1JSRA 1K5DA 4CUZA 2FB9A 2Y1XA 3EQ8A 3F0TA 3E03A 2ZI7A 4GM4A 1VMAA 5ESXA 1ZMBA 2A33A 3VU0A 3KT6A 2PFKA 4EBFA 2PRIA 4B8ZA 3AVOA 4DHWA 4L4SA 4W5HA 2O3RA 1K7FB 1PJRA 1JAHA 1OZHA 2FPOA 3GDWA 2LUOA 4YB8A 5FTKA 1YUBA 4UM5A 5C35A 2BI7A 4MOWA 2EP5A 3WGKA 3EQ6A 5EE9A 5JT1A 3UJCA 2QMHA 1F5SA 3LFHA 4RESA 3T7TA 1G59A 2IP4A 1RBQA 3THRA 4TXNA 1GADO 4X1IA 1N0UA 5AJTA 4PZCA 1DGQA 1ZH8A 4MTLA 4IUBS 4BBJA 5DB4A 3RG8A 3FMFA 3NIDB 2WV7A 1YZLA 3HGTA 3LK7A 4OBWA 4CMAA 3AL2A 2O3SA 4EHBA 3UGKA 4YP1A 1Q2UA 2B8EA 3U19A 4L2IB 4ND6A 3RWBA 5FUXA 4Q37A 2MSKA 5IJAA 2YINC 1WXDA 4BVFA 2Q50A 4M0FA 3L7NA 5IP5A 4ZI5A 3FLBA 5FNZA 3T54A 3L6EA 1EFVB 4B6GA 1O96B 3K6RA 4GR5A 4BJ1A 1EJ6A 5FH9A 2IPXA 4NS1A 4Y2TA 3VU1A 3DKKA 2C2GA 4QDUA 5LJIA 4KX5A 4TUYF 3C4VA 1Q1BA 3E4DA 2IBTA 5DASA 5LBTA 3PRHA 3B2QA 5YASA 3SZUA 3H5RA 1ZK0A 5D7BA 4G0PA 1HRKA 2RHTA 2W2LA 1KKMA 4LMAA 4QUEA 2IHTA 4M8LA 4HLDA 4EQ6B 4B3GA 4RORA 3ASYA 3W4KA 4CLRB 1Y7IA 5CTAA 2NVUA 2IUYA 2O23A 3DCYA 2IVZA 4RBNA 3T1QA 4TS3A 2H00A 3GEPA 4A0FA 1CJBA 1P2TA 2WTBA 5M3BA 4QVKA 3RFCA 9LDBA 1UZMA 1KI6A 1KXZA 3CGWA 4RZHA 1GL3A 1NJ8A 2PMCA 3EPHA 1VL5A 2F1OA 4B33A 4B6QA 1OE0A 2JJMA 3OIGA 4KO4S 4ZVTA 4AJ9A 4D98A 3JXEA 4D44A 3A31A 3GGDA 4V03A 4B43A 4BV2A 1L5ZA 4DIEA 1VXOA 3VVMA 4DNFA 4ZDJA 3LMKA 4H6VA 2VOEA 1NVMB 2DKOA 1IQRA 2G4CA 4JP1A 4B3BA 4CV3A 4JT4A 1VG9B 3EVBA 4H1VA 1FNNA 2HA7A 1N2SA 2DPXA 3KJEA 3O3OB 5B3LA 1O94C 2JB9A 1V41E 1PGPA 1XHFA 2PKQO 4GFDA 3WB2A 5G41A 4MUJA 4BGDA 4ZHSA 1GKKA 1N9ZA 1R4AA 2F17A 2L2QA 3U3DA 1KY3A 2DVMA 3L0OA 1ISRA 1QO7A 5G3ZA 3AETB 4Q7KA 3N2LA 3H8VA 2XDYA 4G1MB 1U1EA 1VCOA 4GPZA 4I1SA 3TRIA 4ZCRA 3B1JA 5BY2A 1YRQA 4B3FX 3MSXA 3AJRA 1YZTA 3VSCA 4UFPA 4M38A 1CE8A 5AW4A 5HNKA 4E7OA 3EIHA 5K3DA 2Q7OE 1LBIA 4IX1A 2A1TS 4XUCA 3HXTA 3ZV5A 5FTLA 3CINA 3HDVA 4UUBA 4ZV4A 4IDDA 4YDRA 4K88A 2VK1A 1JFSA 3VH2A 1CJVC 3G7NA 1E1RA 2XKBA 3T38A 3EVFA 3M9XA 1EM8A 4RD1A 5IN4A 3ROGA 1S8FA 3VDXA 4N9WA 1CRQA 2P75A 1L3BA 4RAOA 2H07A 1RKVA 3A1TA 1Z5OA 2X4IA 4LSZA 5LJLA 4CU2A 4EM6A 5AW0A 3T8YA 1ZX1A 2HO4A 2NTYC 4B5KA 1OBVA 5DI3A 1T8PA 1NW5A 2PJDA 3QTBA 1N9KA 4AJIA 7YASA 4HQFA 3PEEA 2QJWA 2WJ4A 2BJWA 3EVDA 1FP7A 1JDBB 4GLFA 3U39A 3ZEAA 4CMGA 1Q6YA 1U90A 3A6DA 1X8KA 1NSFA 1RWOA 5LCXA 4DGSA 1TEHA 1WD7A 4YNBA 2UYQA 1II8A 5AIAA 1BMFA 5AJUA 1KH1A 5T64A 3THWB 1H69A 3NHRA 5F52A 1DKNA 1NLMA 3BHIA 4AG6A 2W9XA 5GY7A 2BTEA 4K9KA 2R8ZA 3E1SA 4OOFA 3B85A 4F2WA 3KPVA 2ZYGA 1GUZA 3IQHX 4LYGA 1DAIA 1RQPA 3BJRA 4OGKA 5DJ5A 5DBGA 5HHTA 1K6IA 3G2OA 2AEEA 4DJAA 3RIGA 3C8UA 4WCDA 1C7FA 2EKQA 2Q2VA 4B9AA 2ZB3A 1YTLA 4RNDB 3DDUA 1SXJD 3AM5A 3OLVA 4V0QA 2BGLA 3F46A 1M2NA 4JQZA 4FWTA 4QNRA 2BY4A 3IHLA 1RSZA 3MTDA 5KMGA 1KERA 5IMBA 4A1FA 1D1PA 2WYHA 2A9KA 1ZH6A 2H7CA 4WZZA 3SOZA 3DH0A 3EA4A 3ZTWA 1E8MA 5K8VA 4BMVA 3D4BA 3OMXA 3QWFA 3W5JA 4XFDA 3L8DA 3LECA 3FOCA 3RS4A 4R0MA 3DEHA 3Q8WA 4U7DA 1VZ3A 3S2YA 1UQTA 1R9MA 1DARA 1OLSB 4R7ZA 4DIBA 1JAZA 4KLAA 4R5MA 4B2PA 4BFTA 4GDMA 1KPIA 1CEQA 1JA1A 4US2R 4JWKA 4Y98A 2PM8A 3DS8A 4OBXA 4RU1A 5JAMA 2ZRKA 3FCOA