1N6LA

Crystal structure of human rab5a a30p mutant complex with gtp
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
168
structure length
168
Chain Sequence
GNKICQFKLVLLGESPVGKSSLVLRFVKGQFHEFQESTIGAAFLTQTVCLDDTTVKFEIWDTAGQERYHSLAPMYYRGAQAAIVVYDITNEESFARAKNWVKELQRQASPNIVIALSGNKADLANKRAVDFQEAQSYADDNSLLFMETSAKTSMNVNEIFMAIAKKLP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title High Resolution Crystal Structures of Human Rab5a and Five Mutants with Substitutions in the Catalytically Important Phosphate-Binding Loop
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein transport
molecule keywords Ras-related protein Rab-5A
total genus 58
structure length 168
sequence length 168
ec nomenclature
pdb deposition date 2002-11-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1n6lA00
1A7JA 1GSIA 1XCPA 1NLFA 1ZD8A 3TAHA 4C0QC 2JA1A 4C0KA 3NTUA 1MO5A 3T12A 5CITA 2PCLA 1OXXK 4UNRA 4LV5B 4ZIRA 2FH5B 2DFNA 2QTFA 4OHZA 4LCBA 4QHTA 1XU4A 2JIZD 4Z54A 2WM9B 2JJ8A 3IQWA 4RD4A 4BASA 4PFSA 1E96A 5FBVB 1E1QA 2ZI5A 3AV0B 2WIAA 5L3QB 2O8BB 2V6JA 3MJRA 1OFIA 4M9SA 2OV2A 1NJGA 2DWPA 5GJCA 1G5RA 3CBQA 1NG9A 3CZPA 1E9EA 1GRNA 2XZOA 3KJHA 3ZDQA 4GDFA 4OJQA 2X8AA 2REOA 4MGZR 2ZIAA 2J45A 3A1TA 4FMBB 3VR2A 5FR1A 1T3SA 4TYNA 3FGNA 3RYTC 2ORIA 2VHTA 3T1VA 1DG3A 2YNMA 4AKHA 4I1VA 4Q4AA 4B73A 3R20A 1D8TA 4EPRA 3VX3A 3I32A 2PLFA 2GEVA 2Z4RA 3CNLA 3I8XA 4DDUA 2CJWA 1UFQA 2QRNA 3TGPA 4FMDB 4C0SA 3B9PA 1UM8A 3CM0A 3H2YA 3P32A 4TL6A 4H1VA 4OQXA 1G17A 1U0LA 4LC1A 3QKSA 1GIAA 2PBRA 3T34A 5F98A 4LV8B 5FI1B 3SJAA 4GMXA 1PUJA 5EP3A 2KB0A 2IEYA 4JLPA 3QXXA 4PAQA 4KSCA 4AIIA 4DWJA 4DHEA 3TW8B 2GCNA 5FL7D 5JWOA 4WXRA 3ZD7A 2AFIE 4R98A 3A4LA 3EIQA 1EFCA 3MAAC 3RDPA 3TUZC 3ZZUA 1FQJA 1NVVR 1G7RA 1VYUA 1TF2A 3CRMA 5E95A 4ZI3A 3GJ0A 2GAAA 2LKDA 3CR7A 4FWIB 3GLFA 3RRMA 3L8YA 2ZSAA 2ZU0C 3JZAA 4F4IA 2G1KA 2Q0HA 3BIFA 3NDBB 3PUXA 3S1AB 3LWNA 4MUAA 2F43B 2V7QD 3BH0A 1P2TA 4KI0A 2ZRJA 3KTAB 1N6PA 2G0TA 4QOSA 3THWB 2PCJA 3DMNA 1E6CA 3TQCA 1N3BA 4A8JB 4TSFD 4LHVA 1KK3A 3U3RA 1H8EA 1FW6A 2B8TA 4F4JA 4U5XA 3I5XA 4DEYA 5FTKA 5JRJA 4IOLA 4FD2A 2O8DA 1XXHA 1SXJB 2GZDA 4M9XA 1UJ2A 3PXGA 4F92B 3T61A 3IGFA 4RZ2A 1IN6A 4FIDA 5HKKD 1YKSA 3U4QB 2GJKA 1GITA 4RFVA 2V54A 5AJYA 2XSZD 3K0CC 1FMJA 2GEDA 4ZIRB 1FQKA 1SHKA 2FFHA 1OXUA 4KVGA 1YR6A 3TRFA 1NIJA 2FPMA 1EX6A 1Z28A 1VIAA 2OBMA 4CZ2A 3WRYC 5L3SB 1J70A 1FX0B 2DWQA 4X8LA 3AVTA 5B58C 2ZRIA 1ZUHA 4M1YA 4DIDA 2ONKA 5IDVA 1BYIA 1DG1G 3OIWA 4WOPA 1VDZA 1O3YA 1NVXQ 1Y3AA 2VYFA 4MYCA 5L3SA 3IBYA 3U6KA 2W2TA 1UBEA 2WMNB 4B2PA 2ZJOA 4DUGD 3K9LA 5KNBA 5FI0B 3F0TA 4IVQA 4O0MA 4QKQA 5CLLA 4EUNA 2G6BA 2W2VA 3Q9LA 4PO8A 4MITA 2IX3A 1EFRA 3NH6A 4DT1A 3C7KA 3OIUA 5KDLA 5FOSA 4TQAA 2OXCA 2ATXA 2OSBA 4URYR 2J46A 4O2RA 1W1WA 3KFXA 3ZGXA 4ABYA 5DHAA 3SFZA 2CE2X 1YZLA 3FWYA 1DO0A 3SHFA 4KHZA 4QGFA 3N5CA 4B43A 5F3WB 4JS0A 2C8VA 4NCJA 4A0RA 2P6NA 2D62A 4Q9LA 4A6PA 3IBGA 2PX0A 4HZUA 4A15A 5GJWC 1XCMA 1J90A 2XJ4A 3U7EB 5KDDA 2ZRNA 2NZ8A 1F5NA 5KOYA 2KSQA 4D0GA 2QAJA 1U2RA 3RC8A 3VX4A 1BKDR 4Y0VA 2IUUA 1C1YA 2BJVA 3GJ8A 4RZUA 3MWKA 1OW3B 1JI0A 3H84A 5JS7A 3PUVA 3K0AA 2PT5A 3IEVA 5JMTA 3K70C 1X3SA 3T15A 3P4YA 3EZ7A 1W48A 2JDIA 1LF5A 4CEHB 2C04A 1R5OA 3EAQA 1HT1E 2D74A 2QMEA 1EWQA 1YZGA 2V3CC 4Q1EA 3U3OA 1NI3A 1XDBA 1Q3TA 5DI3A 5EE5B 2QROA 4DVGA 1P62B 4XSGA 4BE7B 1SVLA 1SXJE 3AVUA 4HAUA 1XPRA 2ZJZA 1U8ZA 2A2ZA 3TAUA 5AUQA 5K8UA 1D6JA 4HSEA 1DAIA 2YYZA 2IYRA 3AVOA 4HUQB 5FL7A 2IWHA 4DCSA 1JALA 3K9NA 1Q3HA 2VHQA 3GJ7A 4ZCLA 1ZYUA 1JPNA 1ZINA 3AF1A 2O8FA 2IC5A 2ZE7A 3GLFB 3GLIA 1FP6A 3IO5A 4HATA 4ZCMA 4B44A 4DSUA 4E22A 1QBKC 1OYWA 5HR5A 4G3XA 3WMEA 1LY1A 1OFHA 5DN6A 2FGKA 4QGAA 2O8FB 1Z0IA 5FTJA 1F2UB 4C30A 4Q9KA 2YKGA 3RNLA 2IBMA 1HYQA 4PO9A 4B75A 3P20A 2WJHA 4EJSA 4B47A 4W5HA 1G3UA 4NCIA 4Q18A 1GRQA 1T9HA 1Z29A 2RGNC 3C41J 3I73A 1NBME 4JLMA 4V02A 3SS8A 3W5JA 3W8NA 4OK3A 3O8BA 2ZSEA 1GOTA 1W47A 3THOA 1P72A 1PZNA 5FOXA 1F2TA 1KY3A 3KTAA 1S4QA 4DT1B 2JJ2D 2QI9C 3RVBA 2CVHA 5UKDA 2JJ1A 1TL7C 1Q12A 2E1RA 4UXJA 4O2LA 4B6FA 1UDXA 1LS1A 3T5DA 2OCYC 1VCNA 5JHHB 2BCGY 4ESVA 2W2XA 1KO5A 1NSTA 4NCKA 4JLVA 4TT3D 4GRAA 1X86B 2O0HA 3FB4A 2BCJQ 3DM9B 1W2HA 4Q9IA 3MWYW 4DEXA 5DNYB 4ZDIA 2BMDA 2GXUA 1W36D 1RJ9A 1G3QA 5EXPA 2ZSDA 1U90A 1R7RA 1CJTC 3K9GA 4OI4A 2QMUA 2WVJA 4TQUS 4L16A 2OBNA 1Z47A 1KI4A 3EZ2A 4LUCA 4M1TA 3E70C 4ZKEA 3F3YA 1E9RA 4UNQA 3QI2A 1CJKC 3EARA 5DI9A 2MMCA 5FL3A 4GBMA 1KSJA 3ICQB 3DEFA 2EFDB 3AQ4A 3AF4A 2IYLD 621PA 1UKZA 1DEKA 3D3QA 2P5SA 2X2FA 3BOSA 2GCPA 4BECA 3BB3A 2WZQA 3KKOA 4QL3A 4Y0AA 4I1UA 1G6OA 2HYIC 1UPTA 1XD8A 3B9QA 4HYYA 4AURA 1DOAA 4UJ3A 1X8KA 1U0JA 3AGPA 3AGQA 2RB4A 1SVKA 1HUQA 2VF8A 3WYFA 4RZ3A 4MYHA 4TMTA 1WCV1 2H7VA 2XNSA 4LJYA 2MSDB 3BS4A 1BYUA 1W0JD 1ZP6A 4TTQA 3AEZA 1E9CA 2Z4SA 4JLBA 3SYNA 4HUTA 3QPVA 5HKKA 1VIYA 1VHTA 4DCNA 1GFIA 3PCRB 1HH4A 1YQTA 3Q5EA 4M2LA 1OIWA 5GVSA 2ZRPA 4OQNA 3EPKA 4P4UA 4LHZA 1MABA 1TUEA 3EG5A 4FXPA 2YWEA 2ZYVX 2WICA 4YMWA 3W3AA 4G5OA 1YZUA 1EGAA 3RS2A 1G64A 1NN1A 2RGEA 1XD2B 4LBZA 5DHFA 4Q4HB 4B3FX 3EWSA 3LBIA 1A1VA 4B76A 5DIFA 1II8A 1JQLB 1D5CA 3FOZA 2QORA 1XD2A 4QXAA 2GAOA 1GL9B 1P73A 1G5TA 1NSFA 2Z83A 5FTLA 4KFSA 2O8EA 4NYIR 3NEYA 1P7CA 2WKPA 3RLFA 4Z51A 2DBYA 2ZREA 5C18A 3HYTA 3KB1A 1LVGA 2IYUA 4XH9B 5AJVB 1DAHA 4ILEA 3K70B 1FMLA 4PQYA 4G5SA 1G3RA 3FMFA 3KXIA 2R65A 4Q4JB 3GLHE 3P1JA 4A0GA 4HAWA 5L8VA 4QNRA 2CK3A 4A6XA 3V4FA 1LTQA 5L3RA 1ZNYA 3LFUA 4OJKA 2OFOA 2ODBA 5DISB 1YZKA 1Z2AA 2FEOA 3TVTA 1QG4A 1AKEA 5JCZA 1YR7A 1QVAA 4NU0A 2YVUA 2DCUA 4W9MC 2AL7A 2ANBA 1RKBA 3LQQA 2QPOA 4LV6A 4XJXA 4C9BA 1KDTA 2XOKD 2RGBA 2CK3D 3EC2A 2H8KA 5FPKA 4PAMA 1MO3A 3NHAA 2QMHA 1KAOA 2FNAA 3OHMA 1UKVY 3FPAA 4M8NE 3J81k 2BDTA 4CEIB 1KI2A 2X1VA 4KBFA 1RW4A 4OHWA 3PEYA 3BH6A 1E2JA 2D2EA 2W6IA 2PX3A 3CIOA 1GM5A 1KMQA 1KSFX 1CKEA 5EP1A 5HCIA 4UNNA 5LBIA 2F1IA 2QAGC 1J8MF 4PSKA 2O8BA 2VQSA 821PA 2J0SA 4WXPA 4TZ6A 1QHNA 3GJ6A 3L82B 1KI7A 4I99A 2ORWA 1Q20A 4RD6A 2IUTA 2ZJ5A 4RSGA 1IONA 1CP2A 1WP9A 1IN4A 4LI0A 2FX3A 1MT0A 2AK2A 1E2DA 2BWJA 3KXKA 1Q1BA 2QE7D 3EZFA 4CIDA 1V5WA 5KYKA 4ZI2A 2X19A 4HZIA 2F3TA 3KQUA 2I1VB 3B78A 1R0WA 4Q00A 1IN5A 3GLHA 1Z83A 3ADDA 4JJKA 4DLWA 2ZR7A 4H9GA 1JB1A 4WZ6A 1E3MA 1E9DA 2B92A 3IILA 4PPNA 1G9XA 1Z22A 1DVRA 1E32A 2W0SA 2HUPA 1JR3D 1EFTA 1WB9A 4O25A 4DDVA 1WQ1R 2ZYUX 2QT1A 2ZR9A 3CNOA 2EU8A 2KBEA 1Z0KA 4LK2A 4PAOA 1CJMA 3UXMA 4NTZA 3AVWA 5EE0A 2J0VA 4B6EA 1OPXA 1R10A 2RMKA 4KYIB 5D3MA 2WWWA 1W4CA 3CPJB 1E2HA 1WMSA 3K09C 1MOZA 2CNWD 1CEEA 1IQPA 1G7CA 1WF3A 1KJWA 2EFHB 4V0ME 5EP2A 3TMKA 3ZVMA 2ZVQX 3W8RA 4B3BA 3PG5A 3RSOA 2F43A 2IA5A 3VR6A 2R8RA 2YOFA 2AD5A 3PJRA 4BEBA 3I61A 1RRPA 3LA6A 2OCPA 5EQTA 2F1JA 3FHOA 4Z8YA 4LX0A 1A2KC 3PENA 5IRCD 2FPLA 2OLKA 3VNVA 1M8PA 2XOKA 1HV8A 4M1MA 3THYA 2EYUA 1YZTA 2NGRA 2JASA 2R2AA 3AH8A 2ZAOA 2OXRA 1ESMA 4NYMR 1PLKA 4HLUA 3M4YA 2WOOA 2JLZA 3A6PC 3THXB 1TQDA 2BM1A 1A5TA 4F7WA 1U8YA 1E94E 1UEJA 2CL6X 2BBSA 2QPAA 4A9AA 1KK1A 4HUQA 2QAGA 1G20E 1ZAKA 4D25A 1G4AE 4FMDF 2BEKA 4MKGA 3KX2A 1CR1A 2P5TB 3EPJA 2BKUA 4BLSA 1US8A 2ZVPX 5CDFE 3QXHA 3JVUA 2D06A 3KKMA 2ZANA 4RD3A 3H1TA 4M9QA 2ZE5A 1SVSA 1U8AA 1G4UR 4K8OA 1F6BA 4PQRA 1CR2A 5JRZA 4MKIA 3RRYA 3ICEA 4PC7A 1Z3IX 2QGNA 3PR1A 4N3NA 2KBFA 3EA5A 3AB3A 5HPYB 3VKWA 5CYPA 1CIPA 1IXSB 3V4RA 2AWNA 1EWRA 1MR3F 2IF2A 4LBYA 3SJZA 4B32A 3UPUA 2GF9A 2WJVA 5CJ2A 3KL4A 5GVRA 3K0EA 4IFBA 3R9WA 2IXFA 4POAA 2FZ4A 4EPWA 5FOWA 1ZNXA 4YMUA 1AGPA 4BFXA 2V6IA 3BC1A 3BB4A 3MRSA 3QXCA 5EXTA 1W46A 3Q5DA 2WBLC 5JJKA 4MH0R 3AUYA 1CXZA 1Z6XA 4YDSA 3A4MA 5J47A 5FTNA 1EFUA 3KKQA 3QF4B 4HDOB 4II7A 4Q4AB 5FPSA 1E2QA 2IXEA 1QHXA 3WHLA 4JBXA 1BS1A 4LJ7A 3W9YA 3AKCA 3T35A 1BH2A 3GLFE 2G1JA 4HDCA 2ZSFA 1KO7A 2QGZA 4XWAA 4URZR 2WTUA 1RJ9B 3UG6A 1OIXA 1WE2A 1E98A 3R7WB 3WBJA 2RGGA 4S35A 2QZ4A 3I1FA 1OLOA 3SR0A 2NMVA 2W6JA 1PVOA 2A5DA 2FFQA 3AVXA 1VCMA 1R6BX 1T3HA 2O0KA 2CHGA 1M2OB 3ADBA 4KU4A 3DKPA 1VPLA 2P6UA 1GNPA 1XF9A 2ZI9A 3AP1A 2QNRA 4XWOA 5JCPA 2C96A 4RD1A 5DSZA 1RVDA 3FE2A 2D4HA 4AYXA 4GPTA 3OAAA 4Q7JB 3ZZTA 1DAKA 3E2IA 4C0LA 2OG2A 3OEHD 5IF9A 3CNNA 2ASEA 4Q66C 4IEIA 4LZZA 5H70A 5TV2A 1KHTA 1UAAA 5KUTA 5B30A 1Q1EA 2JEOA 2PZGA 2Q21A 3IHWA 3KFVA 4Q4LA 2IUSA 4ARZB 4D4KA 5IK2A 1JEEA 5JI2E 2J9RA 2OFWA 4YLGA 5EP4A 3AVYA 3CRRA 4Q9HA 3IUYA 3F8TA 4URUR 4C3ZA 1E4YA 4Q9JA 1GKIA 3AM1A 1BOFA 5HCNA 2IYQA 4TTRA 2OUKA 4Z8XA 3HP1A 2MSEB 3TE6A 5TDHA 1E69A 3L43A 2H17A 5JECA 1NL3A 2YWGA 1KDOA 2Z43A 1KI1A 4ASUA 5BW8A 3OESA 1BO6A 1Z2CA 3QKTA 2QE7A 5E3HA 3Q7QA 4Q19A 1A82A 1P75A 3KQNA 3F5FA 1H65A 3CPEA 3PEUA 1OH8A 4PTLA 2R62A 5GADl 3M6AA 1ZM2A 2QPTA 3SYKA 3WYAA 1OKKD 2GWHA 2IYSA 2QP4A 4BLPA 1G3MA 1VG8A 1E2PA 1QHGA 3CKLA 3CX6A 2EWVA 1ZVQA 2TMKA 2GZAA 2XX3A 3SBEA 4DLSA 2FDCA 1SKYE 2ZI3A 2FSFA 4F91B 5FOVA 3LQRA 4E03A 3DM5A 3OEED 3QPWA 3DVLA 4MKHA 4A0HA 4CW7A 3O8RA 2ZETA 4GSYA 5IHPA 2AWOA 5JWHA 4D26A 1S8FA 4GI7A 2GVZC 2XTZA 1UKEA 2QAGB 1KMHA 4GZLA 3KJEA 3PUZA 4BFUA 2PL3A 5H68A 4C7OA 1AKYA 1YE8A 2DHRA 4US2R 1YZQA 4P3YA 2NG1A 4TLBA 1JPJA 1XTKA 3X1ZA 4BFSA 2XB4A 4D82A 3GEIA 3X2SA 3NH9A 2WWFA 4EFNA 4IJMA 5FUWA 2QUZA 2BMEA 1D2NA 2FGJA 3GJ4A 3KXLA 3BAFA 5FUYA 1FX0A 2GILA 2IYVA 2IL1A 2BEJA 1N6LA 1ZC4A 1PJRA 2ANCA 1QHSA 3A1UA 4GL2A 4GMDA 5JJIA 4JVSB 1U9IA 4CF7A 1ZUNB 1Z6YA 4OQLA 4QJ4A 2V1UA 5SZJA 3U44B 4KFRA 5ELXA 1FTNA 1RYHA 1S9HA 2JDID 1S1CA 1OH6A 1TQ2A 2B21A 4BZPA 5J4KA 2VBCA 3EIHA 4KO8A 1EESA 1YHNA 2YJTD 2C2HA 1N6OA 1IXZA 1LS6A 1NLZA 1OSNA 4AG5A 2NO0A 4AKIA 4B2LA 4XD7A 2YC4C 4F93B 1XMSA 1SKYB 3VKGA 2ZROA 3GMTA 1FFHA 4WIAA 1EFHA 3P26A 4P0TA 4BUJA 3U7GA 3TW4A 2Z5FA 2GTPA 3H86A 3SFVA 5DN6D 1KK0A 1CRPA 2CE7A 2W6JD 4D0NA 3BRWD 3UWKA 1HE1C 2RHDA 2OFXA 5G53C 4TSFA 4TYYA 1AS2A 3EZ9A 1G3IA 4MRPA 2LWIA 1P6XA 1NN0A 3RAPR 2LCFA 3ZH9B 4V0OA 3MWJA 4B3XA 1U9IC 1KJYA 5F9FA 3A37A 2KJQA 4CYMA 4NP6A 2J1LA 5IT5A 4KSBA 5KNCA 3IO3A 3EZ6A 5BN3A 3WNDA 2GJ8A 3AUXA 3TUIC 1ZM3A 3AF3A 3CRW1 3ZS8A 1LV7A 1SZPA 1ZNZA 4P31A 3T1QA 2ERXA 4FN5A 3ZS9A 3A4NA 4UNPA 3GLIB 2ZE8A 4PO1A 3K53A 2EFCB 2PMDA 3U7HB 4US0R 1AQYA 1XX6A 1KSHA 4Q21A 4Q47A 1G1MA 1TQ6A 5AJZA 2HF8A 1GTVA 3LLUA 2WJGA 1US8B 2Q3HA 4P32A 3JZMA 3SC3A 1YZNA 1XPUA 4OI0A 2UKDA 2WJJA 1DPFA 4CRWB 2BBOA 4OI1A 5J4HA 3SQXA 4ZDKA 5BN4A 1OHHA 2XITA 3FFBA 3X1YA 3KZ1E 4UNSA 3TIFA 3QNUA 3VR3A 3SDZA 1GILA 4BQSA 3KKPA 4P4SB 1R0XA 3I8SA 2OILA 1SKQA 2ZPTX 3W6PA 4Q4JA 2HJVA 3VHLB 3B1VA 5CM9C 2RGNA 2OCBA 1HA3A 4HLCA 2ZRMA 3QVVA 3SJBA 1JJ7A 2J41A 1WDTA 2A9KA 1IY0A 5KPDA 3HYRA 1OKKA 2V55B 3NG1A 1J8YF 4K46A 2OAQ1 5F9HA 2IS4A 5LPNA 2XJ9A 3C4JA 4MDFA 1RYFA 2GETA 3B6EA 3L0PA 4ACAA 4YDHB 3I62A 2BBTA 3RS7A 2QBYA 4U7DA 2WHXA 2NPFA 5J4YA 4NCNA 1ZUIA 3QE0A 2R6AA 1X8LA 1VG0B 5G3ZA 3ZVRA 3GJ3A 3MD0A 1KIMA 1NMZA 1J99A 3QKUA 1RRCA 3K0SA 2H57A 4OHVA 5HZKA 2ZJ2A 5AJXA 3WP1B 2O8CA 1VKJA 4BFWA 2SHKA 3CWZA 4DUGA 2DB3A 2QN6A 2C5LA 2GEUA 1G7TA 1XTSA 4HLDA 2Q9CA 2WJIA 4WA7A 4DLTA 2NO9A 1JR3A 1E4VA 3L0SA 4UQOA 5AUOB 2RGAA 4TTPA 3AP2A 1JAIA 2VH5R 2BKEA 5FBLB 5JBQA 4WBSA 1G291 2IK8A 4AWXA 4G01B 4L9WA 2P2LA 4MYUA 2E87A 4GP7A 3D7MA 1KSGA 221PA 4NYJQ 1KNXA 3KB2A 3RS5A 1HT2E 4M4SA 4LC0A 2CCKA 5KU1A 5KPJA 1AQUA 2R6DA 3QKRA 3R9IA 1OYYA 4EPYA 4QHYA 4DCTA 4GOJA 2WV9A 2HEIA 3P4XA 4C0BA 3IEUA 5JI3E 4AKGA 1N2CE 2J0UB 3LV8A 4IDOA 5JSZB 2QTHA 1WRBA 1N5JA 1E79D 5CK5A 1TEVA 1BMFA 1I4TD 4PC1A 1NJFA 1W5TA 4URXR 3GLGB 4RFSA 4ITRC 1G8PA 5CIQA 4PHGA 3CX8A 1SXJD 1IM2A 2IS6A 1ZCBA 4AKEA 4Q48A 2DPXA 3T1OA 4RFSB 3GPLA 4EAQA 1DE0A 2XEXA 1OF1A 4NONA 3C5HA 1XMJA 2F1HA 3LDAA 1XTIA 5ANRB 5FPTA 4JVLA 3MGCA 1O87A 2BMFA 2WPDD 3KQLA 1SHZA 2BMJA 5LB4A 4Q1BA 5IK2D 1IN7A 4C2TA 4KODA 5TY0A 4TZ0A 1IJEA 2IYZA 2QENA 2K5UA 2VA8A 1YU9A 4RD0A 4H1UA 3THYB 4CGZA 2ZJ8A 4JLAA 4KFUA 3KDSE 4YC7A 2RCNA 4N1AA 3CRVA 4NZYA 3DHWC 1MKYA 2L0XA 2VSOA 5C1BA 2FJUA 3PFIA 4BZXA 4YQFA 2R9VA 4B48A 3MWLA 3A1VA 3QOFA 4HB3A 4TMVA 5DI3B 1XXHB 3W90A 3ZZ0A 5EUMA 3W34A 1QZXA 1GG2A 1KDPA 1NKSA 3LRPA 1FUKA 3N70A 2RGCA 4Q5IA 2NQ2C 3IDQA 1R0ZA 5LD2B 1S3SA 4HEJA 3C8UA 2ODEA 1W0KA 2A5GA 4LJAA 1JJVA 3QVUA 1P9RA 3CRQA 1ETUA 1LNZA 1GKYA 3CH4B 1QHYA 2P65A 3CUEF 4YONB 3R8CA 4DB4A 2OM2A 3BE4A 5FBQB 3G5UA 1CS4C 1DELA 3ND9A 1TEXA 3SU8A 2JJ1D 1KO4A 1F3OA 1E2NA 2I3BA 1I2DA 3LBHA 3H4MA 2ZJBA 2NO6A 3TVDA 1E1RD 2WWYA 1B23P 4FCWA 2ZM5A 1G18A 4S2EA 5GJBA 1P2UA 2CVFA 1KKMA 5J40A 3TBKA 4JVNA 2ZXUA 2HXYA 2ZRLA 4LJ8A 2ZRFA 1DAGA 4NYMQ 4LHXA 1IN8A 1XBTA 2GXSA 2JLUA 4BFTA 2AXNA 2J7KA 4HZUB 1COWD 3GJ5A 1WBBA 2FSGA 3N2IA 2VP0A 2W00A 1Z0AA 2VP6A 2J7PD 3CF6R 4TN1A 3C5CA 2QMOA 3FMOB 3PIRA 1KMHB 1KTVA 3PVSA 4LBVA 4IXMA 2JLXA 1M7HA 3HDTA 5KSZA 1BIFA 2FU5C 4PANA 3V00A 1L7VC 2NIPA 1JAHA 1M7BA 3L0OA 3QJYA 2FFBA 1E1RA 3L2OB 1JXOA 1XNJA 2VP4A 3LBNA 5E7JA 1P2VA 3IIKA 4JL8A 4LJ9A 3DKVA 2RHMA 4LBWA 1S1MA 4NL4H 2J0UA 4JLKA 1ZM4A 2C9OA 3AP3A 1E2GA 4PZLA 3T5GA 1LF0A 4L8GA 3ZQJA 4Q1CA 1ZMXA 3GLHB 5JWRA 5CDFA 3GLGA 1UDWA 2QM7A 1AA9A 1KY2A 3RWMB 4PPFA 4B74A 4LHYA 2I1QA 2DR3A 1W0KD 4BEJA 4BFYA 1TAGA 4EIWA 1EFRD 3TR0A 2IS2A 3LXXA 5K8TA 3U60B 3SEAA 4ZKDA 1KI6A 2VTKA 4J0QA 2WWIA 4ESHA 3NEJA 4XWKA 1PLLA 5F2EA 2N1BA 4TMKA 2GRJA 4LGMA 3Q8XB 1TF5A 3GQBA 1E2KA 1NRJB 3TKLA 2QTVB 4FCTA 3B1WA 5CYOA 3T06B 3HJNA 2E9SA 3GFPA 1TADA 1X8JA 3I92A 3ONWA 4PC2A 4PQFA 1Z0DA 4TLAA 1Z8FA 4WVFA 4HI0E 5SZHB 3LW8A 2JIZA 3TH5A 2WWXA 1IHUA 3HU3A 4DLRA 4AC9A 2DFKB 4DLUA 4XSHA 3U7FB 4DLZA 4QJ3A 3MFYA 3E5HA 4RY2A 3THWA 2PZEA 2WPDA 2YHSA 1VCIA 5TXGA 4QBHA 5H8WA 4OHYA 1DAFA 1Z06A 3ASZA 1ZU4A 5EE1A 3K70D 1Y63A 4C2UA 1JNYA 1CJVC 3MSXA 3NWJA 4BRWA 1YR8A 4URVR 1XEFA 2JGNA 3Q3JB 3BD9A 3TQFA 1MO4A 3VHXA 1RIFA 2XNDD 4PSVA 2REXB 2R6GA 1PUIA 2D7CA 2ZU6A 2HYDA 1II0A 2D3WA 4AI6A 3LW7A 2GJSA 2UZ3A 5C2JB 5K8IA 1F2TB 3A58B 4GOXA 4OI2A 1CBUA 4GZMA 1XZPA 4QFMA 4RZXA 2WKRA 1XZQA 4XOIA 2O8EB 5HE8A 3D31A 2FN4A 4Q7KA 5H1YA 3B1ZA 3FFAA 1SVIA 5E7MA 2OE2A 4ACBA 3B7GA 4NHOA 2CEAA 4E5UA 3OIYA 3U3JA 5K8LA 4DLXA 1W7AA 4MUBA 4PHHA 2WWHA 3A8TA 4WZBE 1G5PA 2GK7A 1D2MA 4Z1MA 2HF9A 5KSPA 2ZI7A 4JL5A 2W6ID 2QQEA 2C9CA 2ZS8A 3MMPA 2ERYA 3QG1A 4HLQB 1GNRA 2IHBA 2P3SA 2XAUA 2Q9AA 2UVQA 2HCJB 1SVOA 1OHHD 1ELOA 2GZHA 2VP9A 4LDJA 4N0EA 3EPLA 1HEIA 1N25A 2C77A 5CB6A 2JLYA 2VEDA 5B2ZA 4QBIA 1W4RA 2AR7A 4LY6A 2GJAA 4I4LA 4KYUA 4EQ6A 1Z08A 3WMFA 2QBYB 2GCOA 1XEXA 2WSSD 3RS0A 3FKSA 2J87A 1A4RA 3BORA 3O47A 1NVVQ 2HV8A 1D9ZA 1DARA 1UKYA 5AR1A 1FPMA 3CLVA 1P60A 1JR3E 1U98A 1KO1A 1N0VC 1U99A 3LO5A 5CLQA 1OB2A 1AJEA 1NVUQ 1JR6A 3I3SR 1Q1QA 4CEJA 1BMFD 3B60A 2B7BA 4DBLC 3QY0A 4BLTA 4D80A 2KE5A 3GD7A 3REGA 4C4PA 4Q7MB 3LNCA 1J7KA 1M74A 2XZPA 1M6NA 4KXFB 1R4AA 2EFEB 4Q4HA 2G0NA 1QRAA 4DRZA 4NYJR 2VIIA 4BLOA 4EPXA 5AUPB 2ZJAA 4X8OA 5P21A 1CRQA 2PJZA 1NBMD 1IAQA 3SN6A 1TU4A 2LKCA 1FL9A 1MRNA 1ZW6A 2GJ9A 3AF2A 3THXA 1XWIA 2JLVA 5C4MA 2V1XA 4QBFA 5LB2A 2ZSBA 4M1WA 5D3QA 1L2TA 4DLYA 3ND8A 4Q1DA 4OK6A 3IIJA 4RKFA 2GHIA 2B8WA 2V9PA 3DL0A 3U6BA 2NO7A 4Q1FA 4MRNA 2C78A 4KV9A 4TL7A 5LD2C 3RS3A 1HQCA 3VAAA 5D3MB 4RJLA 1G41A 3MJHA 5SZKB 2F7SA 3OFNA 5BYKA 1W49A 1E2FA 2C9YA 3HR7A 1P4SA 4LYHA 1NLYA 4MGKR 2C99A 1TF7A 4V0LA 2H92A 2R6CA 2WAYA 1HTWA 4O3MA 1CR4A 2ZE6A 1VTKA 3OE7A 3U61B 3GJXC 4BRUA 2IW3A 4X8MA 5C4GB 1M1YE 1K5DA 2PJRA 4TYWA 1TNDA 4BFVA 2CL7X 3CH5A 2F6RA 3UG7A 1E79A 3TR5A 1Q22A 2C03A 3R9XA 1ESNA 4Q1AA 3GFTA 3FKSD 5FPHA 4BWYA 5BYJA 1T4GA 2FA9A 2O8DB 4LHWA 1G6HA 3NC1C 5A0FA 4CEIA 3NC0C 4M1SA 2Z6VA 4DJTA 1W36B 2IYXA 4E07A 5J4LA 3BK7A 2VP5A 1HE8B 2C95A 1EXMA 1CLUA 3TK1A 4BPBA 1GP2A 1Z6TA 1W2GA 1R5NA 4KLNA 5CM8B 1KK2A 4PPQA 4B35A 1F48A 2FG5A 4YMVA 2VLIA 1JEDA 3V9PA 1X1RA 2AFHE 4ON9A 1NNEA 1I4LD 2REBA 3ZVNA 1U94A 3ASYA 4FCVA 3SQWA 1R8QA 1Q21A 3CX7A 4R9UC 4OKSA 5KDOA 3L0IB 3OEEA 1IY1A 2VL7A 2GESA 2XTNA 1EG7A 1FZQA 3U3MA 1CJUC 3K0CA 2NPIA 1ZIPA 3WP0A 4QNMA 5AUNB 3HR8A 1TMKA 3W3ZB 3GP8A 3PUWA 3GLGE 5TMPA 1IXRC 2XXAA 2GCOB 2QP3A 4DIEA 4PSAA 4QBGB 5DE3A 5TB5A 3EW9A 2OEPA 5FUXA 4B34A 5DYGA 4F4CA 2ORVA 2A30A 2XXAB 1IY2A 3WHKA 4EDHA 2VPPA 3W6NA 5BN5A 4DB2A 1YVDA 2OCAA 3KJIA 2R6FA 5JEDA 1RRFA 4PC6A 4ZCIA 3K09A 2VHJA 2FF7A 2G83A 2GK6A 1GL6A 1Z0JA 4TMZA 2WSSA 4PHTA 3ZYCA 2FE4A 4UXHA 2RGDA 1Q57A 3IPXA 1XMIA 4IDHA 2NOAA 3NBZC 1H8ED 2GXQA 3SHWA 2FFAA 1UBGA 2XGJA 3KUDA 3WYGA 4A36A 2CDNA 4JSTA 2JATA 3B13B 3OAAD 4QGHA 3W5IA 3VR5A 1U81A 2VSFA 2ZRAA 1G21E 1SULA 4P33A 1F2UA 3VU9B 1DTSA 3PEVA 3BH7A 4KITB 3WBKA 1OH7A 4D4LA 1Z63A 3LLMA 3EIEA 4TL8A 1XPOA 5GJVC 2QRZA 4G0NA 1KI8A 1LFDB 1WA5A 1IBRA 4P4TA 1AS0A 4QM6A 1NVWQ 2CCGA 4FINA 1LB1B 2C98A 4AY2A 1F60A 2JCSA 5CIWA 3TUJC 3QKSB 3C16C 4V0NA 1P2SA 4F38A 4JIMA 3JVVA 2QEQA 2I4IA 3M0EA 5KSYA 3UWOA 4GNKA 3FHCB 2VHCA 1JBKA 3FMPB 1X1SA 2OAP1 2WSMA 4NMMA 4JL6A 3Q72A 1W4BA 2ZR0A 2IXGA 1YRBA 5EE9A 1IOZA 2GF0A 1EK0A 5EZ5A 2HLDA 3WRXC 2HDNB 3OF5A 3QEJA 1N0UA 2RGXA 4EJSC 1XCGB 1AIPA 1KZ7B 1OXVA 3DZDA 4XD7D 5LDDC 4GOKA 3D6TB 2BHRA 1XTJA 4QHSA 4MGYR 5DO9A 4EFLA 2CCJA 4M9ZA 3QUSA 4M53A 4EPVA 3AVPA 3FVQA 4RD2A 1G8GA 5KO2A 2Q9BA 2GA8A 1AGRA 1OT3A 4GP6A 2BOVA 3CO5A 3UIEA 2Y8EA 3U44A 3VNUA 2BV3A 2PH1A 2V8OA 2CHVA 2IF0A 3ZQ6A 4Q7LA 1L4UA 2FPKA 4RVCA 2OBLA 3RRZA 2N46A 3BBPA 3DOFA 1W0JA 2YWFA 1GL7A 1CULC 2ZUDA 2ZI4A 1AK2A 1FNMA 4L5BA 4B2IA 4QGGA 5FPYA 1XP8A 1SXJA 3AKDA 3FDIA 3GEHA 4UJ5A 2ZRKA 2ZITA 1RE0A 1DO2A 3SE0A 1C4OA 4M22A 1R8SA 1ODFA 4BFZA 2P0EA 2J59A 4ZDJA 2HT1A 3B85A 1FP7A 4JLDA 1KYIA 2NZJA 2JLSA 5FBWB 2BVNA 4L4UA 4OQFA 1QG2A 3EC1A 4PPGA 5HTKA 3A1WA 3K0FB 4EFMA 1KKLA 3FMIA 5BWMA 5FTMA 2J0QA 3UKDA 2MSCB 8OHMA 3KQKA 1XJCA 3A1SA 1E9AA 3X1WA 4HAZA 1D2EA 3HWSA 3UMFA 2EFGA 1NMYA 3LVQE 4DKXA 4JYBA 2HT6A 2OT3B 2AHOA 1OE0A 1E2IA 1L8QA 4DSOA 2AX4A 1XTQA 2CLDX 2QM8A 2ZRCA 4LYAA 1N6IA 4Z1MD 1MRSA 5BQ5A 3MUFA 4R2HA 2W83A 5FH9A 3UK6A 2EQBA 5JJLA 1XEWX 2EYQA 1GUAA 1L4YA 1XJ0A 1ZJ6A 4DSNA 3T1TA 4LJ5A 4L15A 3DMDA 3PITA 1KI6B 3BB1A 1H8HA 3DO6A 4L9SA 2JAQA 4U02A 4LPSA 1P3JA 2X77A 2XB2A 6Q21A 5J5CA 2JLWA 2WJYA 4G5GA 2QP9X 3U5ZB 2GKSA 3VMFA 4ASUD 2VHUA 5DGXA 4IOJA 4D2IA 4IDQA 421PA 4GT1A 121PA 1XTRA 1OH5A 4IFEA 3MG9A 3K8YA 3LX8A 3ZVLA 2Q6TA 4G5RA 2GBLA 4NDZA 1NY6A 2J5XA 4TLCA 4ZPXA 4EKDA 2FWRA 2YINC 3O8DA 1JQJC 1Z6AA 1N6KA 4JT2A 1Z0FA 4A8JC 3WY9A 2G88A 2ODWA 3CZQA 2ZS7A 1G16A 3EWAA 5SZIA 1ZBDA 4OYHA 3VR1A 2WIBA 3AKYA 3NXSA 4JLJA 1E0KA 2HCBA 1QDEA 2WMOB 1JXMA 2IEZA 4XTRA 2CNWA 4JSYA 4B71A 4V03A 1COWA 4A82A 4ARZA 2IS1A 1ZD9A 1SXJC 3REFA 1KNQA 2KWIA 4LYFA 3VTKA 3EPHA 4M0LA 3KJGA 1MV5A 2BJWA 2W0MA 3GEEA 1GDDA 2NO1A 4EPTA 2QQ0A 2X2EA 1G8YA 3UATA 2AD1A 4MGIR 1XRJA 1NIPA 2GDJA 2WOJA 1M34E 2VP2A 2G77B 2V7QA 2ZRGA 1NF3A 3BXZA 1AZTA 4YXWA 4XIGS 1FTSA 2OESA 2O5VA 2GBLC 2ZTSA 3K9HA 4WZAE 3BGWA 4URWR 4FW9A 4I1SA 5A5GA 3B1YA 3OFND 3B82A 4NE2A 4RCYA 2OLJA 1P61B 4KVAA 4U00A 4UXIA 1YJ5A 2G3YA 2QY9A 2WAXA 2UZIR 1H8HD 1GVNB 4C0AC 1ZIOA 5KTYA 3SI7A 3QF4A 1SGWA 2ZYWX 3AVQA 4IVRA 4QJ5A 1I2MA 2OZEA 1G7SA 4JZKA 2CBZA 2ZUBA 4HB2A 3UMRA 2PEYA 4C0JA 2F9MA 3PUYA 1N5IA 2N42A 1KAGA 2KI5A 1SQ5A 4HB4A 4LPKA 3DDCA 1VYTA 3QENA 2FSIA 5DYIA 2W58A 4DLVA 5JLJA 1ZCAA 1T5LA 4PR0A 1NN3A 1RZ3A 4JYCA 1OB5A 1DADA 1SVWA 4MQBA 3VU9A 4V0MA 2F9LA 2YOGA 1RRGA 1E0SA 1GNQA 4W7SA 4D4MA 4TL9A 3HU1A 2GVDC 3P27A 4TT3A 3R7WA 3I72A 4IVPA 5KHOC 5FUVA 4NPHA 4A2QA 1II9A 3C15C 1OV4A 1GRRA 4W5WA 4TQ9A 4WW0A 2R44A 721PA 1TX4B 3I5YA 1YRAA 3QXJA 1CF4A 3K0AB 2CXXA 1GAJA 4V0KA 4G1UC 2BC9A 3QXSA 2PEZA 3IHLA 2XNDA 2IYYA 4TLDA 4ZV4A 2XTMA 1NY5A 4IKEA 1G8FA 4AK9A 5BXQC 1N6HA 4LJ4A 3G0HA 4BZQA 2YWHA 3LY5A 3CF2A 1OIVA 1VG9B 4DZZA 4X8HA 1CU1A 1AS3A 5EZ6B 4K81B 5JS8A 4CT4B 1U0HC 2RKOA 3WXMA 4DDTA 3BERA 3G82C 3MCAA 1TU3A 1S9DA 1Z5ZA 1TPZA 4IOMA 3LAWA 3KKNA 1OFUX 3NHBA 1N5LA 3ADCA 1E9SA 4CVNA 2CMKA 4EJSB 4B3GA 4PC3A 5FOTA 1E1QD 4KLZA 3DZ8A 4Q01A 2ZUCA 5E7IA 3SYLA 4B33A 1UF9A 3D8BA 3RANA 4CDGA 1XEWY 4QRHA 3RRNA 3RHFA 3PV0A 1V43A 2AK3A 1ONBA 3FKQA 4JJZA 4MRVA 4A8JA 1TTTA 4I1OA 3NVAA 4MKFA 3AVVA 1M7GA 2J3EA 4B3CA 3NBFA 2ATVA 5CJPA 2OHFA 5FR2A 4IOKA 1G19A 2ONJA 2PMKA 3NBXX 1S3GA 3KUCA 1DBSA 4RKEA 2EW1A 4IXNA 4KFTA 2BIFA 3K1JA 4MRSA 5E4FA 2ZAMA 4OBEA 4TMWA 5L3QA 1QHHA 2DFTA 2ZS9A 4QC2A 3SZRA 4D0LB 1QVRA 1SVMA 1ZC3A 5DH9A 3CWQA 3CONA 3ECCA 4A0FA 3GFOA 1VCOA 4IHQA 2NTYC 1Q0UA 4R2IA 1OXTA 5JHGB 4A2PA 4CT5A 5G40A 3RC3A 4HLUC 3NDPA 4B3DA 4AYWA 1KZGB 2H5EA 5EUQB 1MO6A 5M04A 4TWZA 1E0AA 1NKTA 4NYIQ 5J4VA 3DPUA 4DSTA 5FFMA 2H1LA 2A5FA 3B1XA 2WWGA 3RABA 2JLRA 2AN9A 4YXWD 1N5KA 4NKRA 3SJCA 2FV8A 5EXXA 3R8FA 4LWZA 2AXPA 4D4JA 5FOUA 2ZRHA 1S0UA 1PLJA 4JBWA 3I4LA 1XJQA 5G3YA 1GZSA 4A92A 3PQCA 1KI3A 4HDQB 5AJWA 1KI9A 3BFKA 4AG6A 4EQ6B 1NMXA 4E09A 2D2FA 2F1RA 3BWDD 1XEXB 1KDRA 4DDWA 4Q02A 1E9BA 3CPHA 3WNBA 3AF0A 2VF7A 3PEWA 2A5YB 5FBRB 2VRWA 3U3KA 2HLDD 2QL6A 4R71A 4XVUA 1DS6A 2CLSA 2B6HA 4TYPA 2Q3MA 3KQHA 3VKHA 4LRWA 2VO1A 3M1IA 2P6RA 4LJ6A 2EWWA 3SOPA 4JLOA 2GNOA 4DCUA 1E2LA 1WBDA 4CEJB 3DOEA 3IPYA 4AYTA 1N0WA 3AKEA 3QBVA 4YMTA 3Q7PA 1R5BA 3CB4A 2O52A 3VR4A 2QU8A 4TYQA 4QM7A 2A5JA 4M1OA 4LOAA 4IW3B 3TLXA 1CTQA 2IT1A 1D9XA 2B7CA 2QSZA 5CB8A 3UANA 1JECA 3NIBA 4A4DA 4JMPA 3LD9A 5TVKA 2XZLA 1DAMA 2AKAB 3NKVA 4MRRA 1W44A 1VMAA 5B64A 1RC8A 3ADKA 3W6OA 1Z6GA 2ZRBA 4TMXA 1AM4D 4QG7A 2FOLA 1MABB 3LXRA 1ZRHA 1RPZA 2PLRA 4MYTA 1CR0A 3QQ5A 5TARA 1E9FA 1UEIA 1B0UA 4OQMA 2J7PA 5HE9A 1II8B 4BLQA 3LH5A 2YC2C 1S2MA 1MH1A 3WNCA 4BLRA 1T6NA 4BGDA 2A7QA 3EASA 2F3RA 1VECA 1NN5A 1Q44A 3MLEA 1NG1A 1W5SA 5HZHA 1XB2A 2MMGA 1Q1ZA 3HPRA 1VHLA 1T3LA 3BJIC 1XD9A 4IDNA 3U2QA 5EXSA 5JZVA 1R0YA 4KAXA 5CK4A 4G5QA 521PA 3RWOA 2GXAA 2V4ZA 4R7ZA 4AD8A 5KSOA 3QPUA 2ZI6A 1K6MA 4DC9A 3IQXA 3RSLA 3EXAA 4I81A 4C0HA 5EE3A 1QF9A 2YZ2A 3ZLJA 4N0DA 1AZSC 1UBCA 2CHQA 4KBGA 2IWRA 4MA4A 2EVWX 3TSZA 4A1FA 1ANKA 4NCHA 3LX5A 3NBYC 2XSZA 1NP6A 3ZJYA 1E99A 3SNHA 1YR9A 4A2WA 3CW2A 3VFDA 4IEEA 2H18A 1E2MA 4Q03A 2O8CB 4XVRA 1QHHB 1W36C 4FMCF 2DY1A 1W4AA 3A36A 2IYTA 2WKQA 3HPQA 1T8UA 1G8HA 2IYWA 4OL0A 3OIVA 1XFAA 3N2EA 1KGDA 3BFXA 4KJZA 4YMSA 4DCVA 2QG6A 3U4QA 4C7OB 2BBWA 1DAEA 2HXSA 5EJEA 1T8TA 3O8CA 4IRUB 4LYJA 3L8ZA 4ZO4A 3ETLA 1K8RA 2FMXA 3WMGA 3ZIAA 2ZJYA 3ZD6A 1C9KA 4LSGA 4HAVA 3QKRB 1QHIA 2RAPA 3QIAA 3X1DA 1AN0A 1FUUA 1OXSC 2BM0A 4RCZA 1N6RA 1LW7A 1S96A 3TNFA 5JSZA 1RFLA 1T0HB 3K0FA 4D81A 2FZLA 2DFLA 2ZEJA 1ZNWA 2DYKA 3OE7D 3EX7C 2CJWB 2ZRDA 3HU2A 3ZIAD 3E1SA 4XTCS 4NH0A 2PT7A 2HJGA 3QF7A 1OJLA 2OO7A 1P5ZB 1I4DD 3GCGA 4M21A 2VSXA 3QG5A 4W5JA 1VYVA 2CL0X 3H0KA 5G41A 4KCGA 2Q3FA 3FHTA 5L3VA 5B57C 2D7DA 3B8HA 5C46F 1T5IA 4ERNA 1N6NA 2QA5A 3VQTA 3QBTA 1J2JA 1P9NA 3UMSA 2FEMA 5A4JA 1XXHE 4MDEA 4OK5A 2PZFA 3OZXA 2H16A 4D6PA 1K5GA 2P67A 1KO8A 5AWFC 4PZZA 1P9WA 4UKDA 4FWTA 2Z0MA 1TUIA 4IDPA 3IIMA 1FOEB 3C14C 4PZYA 3B2EA 4JKIA 5JFGA 2A78A 4NBSA 2A3RA 4JLNA 4WAUA 1GKUB 3Q85A 4PHFA 4PX9A 1NBMA 3CF0A 1KJZA 1ZM9A 3BFVA 3QSYA 4HB0A 3SBDA 2G9NA 2F55A 4GFDA 2JLQA 1ZM7A 4XVQA 4CEHA 2IHYA 1HURA 2QT0A 3FYHA 4OHXA 5KNDA 2O0JA 1HQYE 4JVMA 1PV4A 4M1KA 5JEEA 1KOFA 4FI3C 1TQ4A 3S1AA 5DLQC 4ZDWA 1UBFA 4JBYA 4JT4A 1X6VA 1ZU5A 1GWNA 1OFTA 2QSYA 3TSOA 1VG1A 1E0JA 5AK0A 1IJFA 3IKJA 4TLEA 3RS4A 2ZQ5A 1E2EA 3QEOA 3FTQA 3GLIE 1A2BA 1T0JB 2DWOA 3X1XA 3LVRE 2CLCX 2YV5A 1T91A 3B5JA 3CR8A 2RH5A 3EA0A 4P4SA 2ODNA 4US1R 1FNNA 1EX7A 1XMVA 4FMCB 1Z07A 2ECKA 2YOHA 1R2QA 3OEHA 4HAXA 1UADA 1ZD1A 3TJZA 4HAYA 1WXQA 4JKYA 2ZYTX 2JJ2A 3TSWA 4DXAA 4PXAA 1HY3A 2AKYA 2FSHA
chains in the Genus database with same CATH superfamily
1S6YA 3NALA 1VZ2A 3VJRA 3BQMB 3NWBA 2GYVA 4MB0A 5TPWB 1JLSA 1MO5A 4OQQA 3T12A 2PCLA 1OXXK 2L42A 5CITA 3AHHA 4L6CA 2FH5B 4TVSA 1CB7A 4JP3A 3SVZA 2RDMA 4DC1A 2JIZD 1NVBA 3HGTA 3HB0A 3IEXA 2WM9B 3M4JA 2JJ8A 3OZTA 4PIPA 1UP7A 3M5PA 4GQIA 5FP0A 3S68A 3TRHA 4LY0A 4PFSA 1XXLA 3FSEA 5FBVB 1I32A 3FDJA 2ZIVB 3IVMA 5L3QB 1ONNA 1XVLA 2CW5A 3HXKA 3D8HA 2Q5FA 3MJRA 1OFIA 2JGKA 3MZ0A 4O1HA 1MB2A 3RJMA 5B2FA 1O94C 2PGAA 2DC1A 2DWPA 3ZW9A 3R7AA 5KWVA 1WCIA 1G5RA 1PQ4A 5U9CA 3CBQA 5F2NA 4BO4A 2GYWA 2EX4A 2H4FA 4NZZA 4EENA 4DIBA 3E3MA 1SQGA 4WUVA 3ZDQA 1D0IA 5CB4B 1EFVB 2ZIAA 3FOWA 4TQGA 3A1TA 3P2KA 1N9GA 1CUHA 3HNRA 3HBFA 1T3SA 1WXWA 2E1PA 3EUFA 2YYSA 2SNIE 5JTTA 3CNBA 3RYHB 2F3SA 3R23A 5DMXA 4M0EA 4B73A 4HFNA 2FZVA 2GRAA 3I32A 1Z4QA 1HRDA 4DJEC 1EM8B 3PWZA 5IASA 1AXEA 1HE5A 3FCYA 2R1ZA 3I6IA 4HD8A 4XGQA 2CJWA 2QRNA 4OJNA 1O6GA 3EIWA 4B79A 3TGPA 3NBKA 4AJEA 3JAMA 1AKMA 3OQNA 3HKEB 1X1BA 2WNIA 3ABRB 3HMQA 1TT5A 1UM8A 2G8LA 3E3LA 5K0CA 2NP6A 5DCYA 2WG1A 3L6CA 5DYYA 4A8HA 3R4VA 4M1EA 4UEOA 1B2RA 1GUFA 2C2ZA 4OQXA 2PKWA 2NACA 4C07A 2WHEA 2BKXA 1RLUA 5HIJA 3UK1A 3ZXSA 4DV5B 3BT7A 2PBRA 5F98A 4QG3A 3PI6A 4GMXA 5MDHA 4GKBA 2XTJA 2X8JB 2IEYA 1PJLA 3WYBA 4A0SA 1JJAA 4CV2A 3JW8A 3GP3A 1SQ0A 3IR6A 1ISHA 4AIIA 4KE9A 4DHEA 4ZCRA 3TW8B 3DO5A 3MGAA 4P3PA 1V1MA 2H4ZA 3G9ZA 2JFZA 1OPRA 3IQIX 3PD1A 5DF1A 2I4NA 5HA5A 4BVHA 2Y2UA 1FP2A 1X3LA 2NSDA 2V5AA 2XUFA 2R1UA 2HMTA 4QLOA 1LC3A 1EFCA 2QX7A 1ISGA 2ZULA 1T4CA 1P0IA 4J3JA 4NV0A 4OHUA 3DE7X 3DDNA 3R76A 3ZZUA 3TUZC 1RIIA 4YECA 1G7RA 3QV2A 5A2GA 4YJGA 5HILA 3STVA 2LKDA 1B3RA 3QBDA 5HZGA 1OGIA 4AS3A 2QIPA 4I0WB 4P5DA 3L8YA 1HFJA 3DT6A 4F4FA 2XUPA 4JASB 1QIKA 1ZNQO 3QLVC 3NDBB 1V8FA 3CUKA 4MUAA 2F43B 4OMDA 4LFCB 3ABZA 4U4AA 3M34A 1PP4A 2HJHA 2ZRJA 1EDOA 3OJCA 2G0TA 3O2JA 1NR1A 4C6TA 4GXRA 3DMNA 3NHJA 1N3BA 4MW9A 4LGVA 1RJEA 3OQIA 4JUBA 1EVKA 2ENWA 3DXXA 3RYIA 5B4VA 5JYCA 2B3DA 2FPXA 3VKUA 2PX4A 3GRPA 1FFGA 2HQOA 1H8EA 3O84A 3TTTA 2B8TA 4F4JA 4C7VA 2XWBF 1P8JA 4MYDA 3DVSX 2MWMA 2GVNA 1AGYA 4DEYA 3H11B 1ZMOA 5FTKA 1BKSB 4XB2A 2AFHA 3IERA 3AYZB 1NUUA 3QW2A 2YN2A 3PXGA 1AHIA 1TKAA 3LA8A 2AC4A 1YA8A 4Q1VA 4RZ2A 1IN6A 5FWAA 2Y1WA 1YKSA 4RFVA 4XD2A 2V54A 2Q8NA 1FMJA 3MMNA 2GEDA 5A9TA 1FQKA 1SCNE 2FFHA 2IDKA 2H29A 3BRCA 3L06A 3N2KB 1SEVA 2ISCA 4KVGA 4RM2A 5B36A 4HYEA 3HM9A 4FGJA 5KVVA 2R11A 4CZ2A 4KZKA 3WRYC 5JH7A 1JHVA 5L3SB 1FX0B 3A0RB 1ST2A 4X8LA 3AVTA 4CHTA 3G2QA 4M1YA 1ZOSA 4DIDA 2ONKA 5IDVA 1H4QA 2H5IA 1Y6GA 1O3YA 1NVXQ 3PNSA 4G24A 4HQOA 4F11A 2AV6A 4B2PA 2WMNB 4RGVA 4JCCA 3F0TA 3KK0A 4K1XA 4Y67A 4QKQA 4YJ2A 2G6BA 2GARA 2OV8A 3M9XA 4FEGA 1J0CA 4G1CA 4MITA 3NH6A 3OIUA 2C4HA 3D7KA 2HDOA 5FOSA 2OXCA 2OSBA 3RSGA 2NUAA 1KPIA 3JR7A 3MHPA 3R44A 2NSJA 4O2RA 1EFVA 4ABYA 1R16A 4XRGA 4PIVA 4KPEC 2NZ2A 1ULUA 3SFZA 3FWYA 1PWZA 1DO0A 3IMEA 1N5OX 1HPLA 4MS3A 2DQYA 4QGFA 1GKLA 3SHFA 4CQLA 3PKZA 2D5CA 2C8VA 3PNQA 4P0PB 4LYEA 2C2YA 2GYYA 2HCRA 2P9GA 5DTQA 4Z0HO 4Q93A 1IPHA 3KC2A 1ZITA 4WNCA 2I1WA 5AP9A 3UAOA 3U7EB 1R9JA 1K2VN 3FUUA 4BMVA 5KDDA 1TM2A 3WL3A 1I6MA 4BQEA 2HMSA 4G4SO 1YOVA 5CT8A 1KU6A 4Q4DA 3RC8A 2PBZA 3KYIB 3VX4A 2IUUA 3DCYA 1SQSA 4YEDA 3MWKA 4DC0A 3IT1A 2VUUA 2YJ3A 3M4NA 4ZYLA 2VI5A 1JMKC 3IPAA 4II2A 3I9JA 2CV0A 3T1HB 3QJGA 3K0AA 5DWQA 3QX3A 5ABPA 3DV9A 3PFKA 3ZI0A 3CLTD 1BJKA 2JDIA 2PS0A 4JQOA 3T7EA 1RQRA 3Q7IA 4MR7A 3TOZA 2Q2OA 3DE2X 2D74A 2QMEA 4ZV9A 5IUKC 1SEPA 4C06A 2GZ3A 1S89A 1K3FA 1NI3A 1PX0A 3EDYA 3H9EO 4DRXB 2MYPA 4KV7A 4F5ZA 2LDXA 1P62B 3CV3A 1V1MB 4XSGA 5ALJA 4CG2A 1QS0A 4QXMA 3AVUA 3DT9A 1MG5A 5I9TA 2XQGA 2A2ZA 2ZJZA 4FOSA 1DX9A 3GA5A 3SD7A 4B5KA 4BAZA 1Q3HA 1U1EA 3GJ7A 4ALJA 3LHIA 1XL1A 2X9GA 3B48A 1ZINA 2QQFA 5A1TA 2A0YA 2ZE7A 5LQJA 5T64A 1FP6A 2W8BA 2RC5A 4KQXA 1J20A 2HIMA 1X9IA 5AM0A 10MHA 3IO5A 4E22A 4DSUA 4PGGA 3RFXA 7ADHA 1M1NB 3F1KA 2VUTA 1R0CA 2O8FB 2YZNA 3K35A 5E1OA 4B4VA 3AZPA 2Z8ZA 3R7BA 1LTHR 1WKCA 4PY2A 1HYQA 2Y99A 4CIBA 2J6BA 3FA2A 3W2IA 2FPIA 2WJHA 4A16A 1UJBA 3JYOA 5KTTA 3QU4A 4W5HA 1G3UA 2C29D 2JGDB 4Q18A 4IDBA 4MJ3A 2RGNC 4BNUA 1NBME 3SS8A 4KXNA 2OG1A 7ABPA 1NE7A 4QASA 4FBMA 2CZQA 1EFKA 4PXYA 2VNSA 3TBHA 1PFVA 4AX4A 5CFLA 1Z25A 4G63A 2FX5A 3SQOA 4JEHA 2AEEA 4WEOA 3KTAA 5IUNC 4Y30A 2QI9C 4F72A 3RVBA 5JZBA 1XU9A 4FJ0A 5KWJA 3JV7A 3A9TA 1TL7C 6REQA 2E1RA 3F67A 4TTJA 4Y2HA 3SYMA 1DC8A 1T34A 1I1OA 2VSYA 4ZAYA 1RQPA 3T5DA 1XZLA 1SVUA 1UPFA 2BCGY 1LBIA 4R01A 4BNKA 3PCXA 4NCKA 3WRWA 4K9SA 4FC6A 3QPCA 4OXNA 1GV1A 4JLSA 5LKAA 4XCXA 4PAWA 4LDAA 1E5DA 1V71A 1J4AA 1HT0A 1VXRA 5GAJA 3V97A 3DM9B 3UJ6A 4W63A 5DHUA 5LU8A 1D04A 4DWWA 5K0EA 3KOYA 3MWYW 3CC8A 5E8RA 4DEXA 4ZDIA 3GFBA 3KAQA 4V3BA 3ET5A 4HDAA 4YRIA 3GFVA 1AKNA 4QAQA 3L8HA 3GGSA 1G3QA 4ZI7A 2DPMA 4DCPA 1C8KA 2O4UX 3T9AA 1R7RA 1CJTC 2WJ4A 1R37A 1XLTC 3K9GA 1N77A 1WB4A 3ENWA 5BXYA 2XAAA 4ID3A 1Z4IA 1NRXA 1NVFA 2REQA 5EHZA 4DJDC 2X3UA 1V1RB 2G82A 4LZNA 1Z47A 1KI4A 1WQ4A 1PTJC 2AOWA 4P81A 5HGJA 3F3YA 2E4UA 1CJKC 3EARA 1N9ZA 2JK1A 2MMCA 3QHQA 3QI2A 5HGXA 1P2DA 5E2IA 4KN8A 3T54A 3GZJA 3CSSA 2AI2A 2W6OA 1RKVA 5D6OA 3ICQB 4PNZA 1F0NA 1NVEA 4PNPA 1BCRA 2EFDB 1D4FA 2WNSA 3AF4A 3AQ4A 4MVXA 4LMBA 3W0LB 5LA6B 5IJWA 1UKZA 1YQQA 1O5TA 2P5SA 1EWKA 5TJHA 2HLPA 2WT8A 5LXTB 4H6VA 2ZAGA 4BGUA 2ZOSA 5JYDA 1RQNA 4QL3A 4RHTA 2R1TA 4EYSA 2B1GA 5JY1A 4I1UA 1UPTA 2ZWMA 1L7DA 3B9QA 3EW7A 2QTVA 3L04A 1UBNA 3JRXA 5EMKA 5LP6A 1E5VA 1U0JA 1JDBC 4TRRA 1SVKA 3VUEA 1JPVA 2VF8A 3FCCA 3TO5A 3BXGA 5JXWA 2AC7A 5H9WA 4MYHA 1Z5WA 3X44A 1ISMA 3IAS6 3NHRA 4QFBA 3VM6A 2XNSA 4LJYA 1R9NA 1TVEA 1V41E 4M0KA 2W2KB 3AEZA 4XYBA 3LHKA 1KEVA 2OPBA 4JLBA 4MR7B 1EH5A 2O6LA 5DX0A 2PNJA 3N0VA 3GZNB 5HKKA 4GD3Q 1VHTA 2M32A 2ZSIA 1HH4A 2E3JA 3S28A 2XWPA 4D92A 4MWEA 4ZICA 3K9FC 4DMHA 2DECA 2P7IA 4FXOA 4RJKA 1HLGA 4LHZA 1TUEA 1C29B 3A2MA 2NTNA 4PV7A 2WICA 1ECGA 2X76A 1E92A 1YZUA 3P52A 4KQ9A 4Q3OA 4G84A 1TT5B 4DRYA 2PRJA 1YQXA 1M8JA 5JSFA 4XM0A 4PRLA 1NMSA 4EI2A 1G21B 3EGDB 2J6IA 1VXOA 1JQLB 4HH4A 5HM6A 2B98A 3QHAA 3ZCVA 3VJLA 1UOPA 4BDSA 4QXAA 1P3Y1 2ZTHA 1DWUA 4RACA 1ZQ1A 1G5TA 2C9BA 3MOIA 1IJBA 1NSFA 3F7MA 1NBOA 2OZVA 4DA6A 2OUIA 2O8EA 4Y6LA 1VJGA 3P96A 3RLFA 3IUPA 1C41A 5C18A 4UHDA 2D0OB 1GN8A 2VHZA 4X85A 2UU9B 2PRSA 1FLDA 1L6IA 3N2KA 3IDFA 4PQYA 3FMFA 2Q4OA 3GW8A 4Q3AA 4Q4JB 3GLHE 3QFRA 3PC3A 3D2BA 4A6XA 1JQKA 2HSGA 3FD8A 2FLVA 2I6SA 1LTQA 3TIVA 5CA0F 3EK2A 2IHZA 3HZOA 2CNLA 4IBOA 1DIOB 4OJKA 1A97A 2OFOA 2UV8A 2FSSA 4BOYA 2F3UA 3WLKX 1CE8B 3F73A 3WIBA 2O7RA 1NFFA 1X74A 1MNAA 3DTVD 1SZCA 3TOCA 2FWNA 1Z2AA 2Y1LA 3LL4A 1QG4A 3TVTA 1AKEA 4EFKA 2VF4X 4JJ6A 4OMCA 3ZDBA 3AY3A 4MV9A 1RYNA 1Q7EA 4G0PA 5AJHA 2DCUA 4W9MC 1HDYA 2ANBA 4MUKA 2AYXA 4QOEA 3O9MA 1Y6RA 2YZKA 4LV6A 4XJXA 5K0SA 1FBNA 4JGGA 1CQXA 1KAOA 3GGJA 2GN1A 2ZZMA 1UKVY 3J81k 1E6LA 3TLZA 2YIJA 4Y18A 5CGZA 4NQRA 4QYXA 2O2SA 3LIIA 4WE3A 2J3HA 3GDWA 1P39A 1TD9A 4TYMA 5KVAA 1DC6A 1KYVA 2IHTA 3G13A 1G2OA 2AMJA 2E18A 3IQZA 1EJ6A 3Q41A 4TV8A 3OF3A 5I4IA 1H9AA 4WJKB 2IUYA 3ERCA 2JFGA 3L7LA 5AK3A 3BHMA 4OVKA 4EECA 1J8MF 5IPFA 5JMOA 1Q19A 5L7WA 3GZTB 3HI4A 2IYAA 4UD2A 2J0SA 4WXPA 3W9UA 1PYOA 4V2UA 1QHNA 1R6AA 3WKDA 4LGYA 5KINB 5KKNB 1V2HE 1J07A 4G1FA 3VUFA 5HIKA 1FP4B 1Q20A 4RD6A 2L69A 1H3EA 3COSA 1WP9A 2EQAA 1IN4A 3EZLA 4BV3A 2AK2A 4CIDA 1E2DA 2BWJA 1Q1BA 4OFZA 1V5WA 4K9RA 4ZI2A 3SPXA 1QGUB 2X19A 3GG2A 4HZIA 5DEOA 5KMGA 4MUXA 1LXCA 1W6UA 3G5AA 2F3TA 4JGIA 4PGAA 4Q00A 1UK8A 1LEHA 4Z7NB 4DLWA 4H9GA 5LXTA 3LKZA 1HDIA 2BJHA 3CH7A 3JXEA 3IILA 4NU5A 4PFQA 4MI6A 2R1TB 4RJIA 1SPBS 5ALNA 5ENZA 4ZGBA 1E32A 2BR5A 1ARZA 1Z74A 2JLAA 3HKCA 4DXHA 3RIGA 1F9EA 4DRXA 4I4TA 3OCUA 1WQ1R 4HQRA 3TKAA 2BFEA 2FPGB 4FFDA 4BNGA 2ZR9A 5FULA 1ZCZA 3PTZA 4QT0A 1YB6A 1QUFA 3TLCA 2KBEA 3UUFA 1WDLA 1CJMA 2BM8A 5C4IA 1M2WA 1O03A 5TR9A 5CVJA 1XMQB 4UQLA 1R10A 4MVWA 1ZK4A 3HUEA 3ZLTA 3EBPA 2PD6A 3VTZA 4AMYA 1HDXA 4F4DA 2YN0A 1KYQA 3DR5A 3ROZA 5J5VA 4C4ZA 2Q3CA 5CFPA 2IHNA 1CDZA 2PPVA 4X66B 1FS4A 1MOZA 3H9CA 3NGXA 4MMXB 5DHSA 5KJEA 4K05A 2Z2JA 4QRDA 3SBOA 4DLPA 2EFHB 4KFCA 3PUIA 5EP2A 4IDFA 3TMKA 5FLXA 3W8RA 2IVFA 4K0RA 4XE5A 4GKJB 3PG5A 2QXYA 5J63A 3S40A 1YTUA 3OKPA 2NLOA 5L9AA 1T15A 2JGDA 3IVCA 3LA6A 2P9JA 2F1JA 3FHOA 1OD6A 2QVGA 5A9RA 2YDXA 4BMOB 4X1YA 3A70A 5A4DA 1W96A 4YJGB 4O3FA 1LUAA 3DL4A 5IRCD 2FPLA 2OLKA 3M2PA 1G6KA 5EPEA 1A8IA 5FHQA 1KEUA 2C4KA 4BVFA 4G9EA 4HF7A 3SVLA 5IJ9B 2NGRA 1FB5A 2SKDA 2P0YA 2ZAOA 1ESMA 4WOCA 1PDOA 4RKQA 3U26A 4EH1A 4HLUA 3FCOA 3M4YA 1N32B 2X41A 3A6PC 5ARCA 5HKBA 1F7UA 4F7WA 3ZDEA 4OD0A 5CDGA 3CZCA 1E94E 1JFSA 3GRCA 3D3EA 4FX5A 1RC0A 1QBGA 1ZAKA 3ASUA 3IQFA 5DXAA 1GPJA 4ZYYA 1U5CA 4Q3KA 2D1FA 2FWJA 3C4VA 4AWBA 2JI7A 3K4PA 1NDHA 1YBHA 1N9KA 5DBFA 2ZVPX 2V6BA 4HQKA 3LGSA 2BELA 2D06A 3KZVA 4BX8A 2JIMA 4ZI7F 2HQRA 4PQRA 3HVIA 1O5OA 4J8PA 1CR2A 4F1JA 2BI8A 4N8EA 3ICEA 5BPHA 2ECQA 3FBGA 4HPWA 4PC7A 1AE1A 3RJ5A 3ZJ4A 1JSLA 2QGNA 4MHOA 1O4VA 1XZMA 1KAQA 2M98A 1HDZA 2HJSA 2YFKA 4N3NA 2GI4A 3OIGA 2B4QA 4YK7A 1K9VF 1NXSA 3ONFA 1L1FA 3ZQ4A 1H5UA 3EVCA 5CXSA 3SQDA 5CYPA 4BP8A 4BQQA 1IXSB 4V3CA 3I2YX 2ZIGA 1EWRA 1GR0A 5C8YB 3EFEA 5HRCA 2HGZA 3KL4A 4JR2A 4UDOA 2RHLA 2Q2NA 4IFBA 2IXFA 2WC1A 4WRRA 4EPWA 3K1YA 4G5HA 5FOWA 3JRWA 1KHHA 3NB0A 1P81A 2QZ9A 4FGKA 3KDAA 5CNJA 2SCUB 3MILA 1Z2NX 5EWLB 1TYDE 3GX1A 5DNUA 1ZGGA 2FXVA 1W46A 2WBLC 2Z08A 3FI0A 2JF0A 4II3A 2CHFA 2WHPB 1CXZA 1PHRA 5J47A 1EPUA 2VYND 3M6IA 1FU7A 3MMZA 4NENB 4EUFA 4LF5B 5FTNA 2PN1A 3KKQA 3QF4B 4II7A 1KU0A 5MFPA 2V4UA 1ZY2A 2ADFA 4ZVOA 2EG5A 3T35A 4CIWA 4HDCA 1KO7A 1KIAA 3I01M 3P9XA 2I33A 3E2PA 4OUDA 4QD3A 4URZR 1OIXA 3UF0A 2WWTA 2Y0DA 3EWNA 1G4HA 4Q3EA 2O8VA 3DVAA 4J1QA 3I1FA 4BO0A 4CNBA 2W98A 1SU6A 3BHJA 1L4LA 1NRIA 4FX2A 3DNMA 2W6JA 3IYLW 4CETA 1GRVA 1PVOA 2NMVA 1FSFA 2HRQA 4NBTA 4P83A 5F5NA 4DE5A 3AVXA 1R6BX 1VRWA 2OO5C 2A0KA 4KU4A 3ADBA 3DKPA 1Q17A 2A84A 3K32A 5LDGA 2P6UA 1GNPA 5JBNA 5K01A 4RLSA 2FAXA 3HKDA 4XWOA 2JZCA 2C96A 3V2IA 3ZEIA 4RD1A 5DSZA 2PM8A 5B58T 1GADO 3TDNA 2BLNA 2JAPA 2V65A 4GPTA 4DMUB 1K1EA 2HQSA 3EGXB 2Q6OA 1C1DB 2V7TA 4DY6A 1P31A 1BTOA 1KS9A 1ORDA 3MIZA 3K6RA 2OG2A 2XDAA 4E70A 3HBJA 4I9UA 5TSDA 1GA4A 1K5PA 4GYYA 4UEKA 5IF9A 2G9VA 3UUEA 3LQ4A 1KJ9A 4Q05A 3K5WA 3QLJA 5H70A 3TRKA 1UAAA 5TE9A 1F0PA 3FR7A 4MO2A 2BEWB 1HXHA 4ZEOA 3KFVA 4AF7A 4ARZB 4Z4IA 3WLOA 4A8PA 4DCGA 5IK2A 1JEEA 5TLSA 5JI2E 1ZN9A 3DF9A 4XFJA 4K6GA 1C3VA 3AVYA 3NHWA 5EQFA 2QW1A 3F8TA 3AM1A 2XW6A 3D8SA 4RANA 1AQ6A 3AR5A 1Q0ZA 3O9VA 3TE6A 3HJTA 4TUYA 1CZKA 3L43A 3MRXA 3DLIA 3COJA 1WUIS 2J5RA 1KDOA 3M83A 3OZBA 2Z43A 4ZZ2A 3FGOA 2HLNA 3EGEA 5GOTA 2Y93A 1L6RA 3ZV4A 2JD2A 4X3PA 3C3AA 4ASUA 2JFPA 5E3HA 4Q19A 3W7BA 4C5AA 3GT3A 1H65A 5TF0A 4GICA 5JARA 4PHCA 4H7KA 4PTLA 5THKA 5JW6A 5GADl 4YUWA 1ZM2A 1GDHA 4EKEA 1TJ5A 5FT9A 1YUMA 2Q5HA 4JKOA 1XLVA 1K2WA 4KG7A 3HQ4O 4OO3A 2FPIB 3O2NA 3OC6A 4HR7A 5LMZA 2R0QC 3UT5B 5DTRA 1P4JA 1TO1E 2R00A 4UTVA 2EWVA 3AETA 2GZAA 3H3FA 1JKJB 1BCSA 3SBEA 4WK0B 3WADA 4GRDA 3KLOA 4NC9A 1MQAA 3L93A 1K3UB 1VSTA 3PS9A 4E03A 4CG1A 1Q2UA 3R0VA 2NXWA 3QPWA 2WYHA 3WV5A 1D5WA 4A0HA 4YRBA 1W73A 5A04A 1TAHA 2HJRA 3AUFA 3RM3A 4QUJA 4X65B 1JJBA 4EOGA 1IIRA 1Q0LA 1UKEA 2PYDA 3KJEA 1Z3CA 2O5RA 3RRFA 3E3AA 1OVMA 4BNDA 1E6KA 1AKYA 3NNDA 3EF0A 4P3YA 2NG1A 4TLBA 5CTAA 4K28A 1OLSB 2XB4A 4WUTA 1KRHA 3IOBA 3NH9A 3NX4A 4W4TA 1O57A 4IJMA 1TW2A 2UAGA 5A7HA 1GAXA 3BQNB 2QUZA 1SIWA 1A8SA 3NV7A 2HO5A 2R47A 3UB3A 2QLNA 1I6WA 2O7SA 3EJWA 3GJ4A 3QM1A 2AFRA 5DGHA 3VSBA 2IYVA 3CXRA 3T6KA 1YUNA 3TLGB 4JI7B 1N6LA 1ZC4A 1PJRA 1R8YA 2YWRA 1UPBA 2ZP1A 4RQAA 5IN5A 1TB4A 2VK2A 2Z1DA 4FDTA 1U9IA 3RIHA 1ZUNB 1BVUA 4EY6A 4B6OA 1FNBA 4QJ4A 2V1UA 5TPZA 4KFRA 1THTA 3LC0A 5E1MA 3VMMA 5BOSB 4C14A 5LUBA 4L9RA 5TS3A 1OZGA 2M6KA 1S9HA 3PDUA 1V45E 4LX8A 4QODA 1TQ2A 3LDHA 3BZWA 3OLYA 2GLTA 1PGPA 2OHJA 4AMVA 2VBCA 3EIHA 3ZV6A 5AI4A 1YHNA 3FGZA 1Y33E 2YJTD 2QJFA 1N6OA 1IXZA 1OSNA 2EKPA 3JARB 2Z6AA 1SBCA 1EMDA 4AG5A 4RTLA 4AKIA 1KBZA 1FFXA 3CVVA 5LQUA 3FPGA 2WF7A 1IBMB 4F93B 1XMSA 1SKYB 5ER9A 4EFDA 1U2EA 1MOSA 3AXSA 1BHSA 1FFHA 3GMTA 3GY0A 3IP6A 4P0TA 3VR0A 3K6SB 4TWIA 3I76A 4G8JA 3C5EA 3TW4A 3W3AD 1RHQA 3H86A 1JLLB 4C3OB 1TUBA 2O7NA 3SF8B 4BVGA 4U7JA 3U1BA 3UWKA 2GFQA 3ROFA 2RHDA 1I5OA 2LV8A 2I3DA 3GCZA 3O3OB 3PHBE 4H3KB 1C1XA 3I28A 4ZOBA 5LLTA 2VZEA 1AS2A 1ZJYA 3ENQA 2LWIA 1YS4A 2OBXA 2J48A 1P5FA 1OX4B 1PT9A 1UPCA 3MCWA 4B0PA 4UCFA 2KJQA 4HDMA 2PUTA 2C1XA 3GZNA 2BGIA 3WB1A 3ZHVA 3VYRB 5JV5A 5DTJA 3H9JA 3AF3A 2YZMA 3ZS8A 1LV7A 1SZPA 1W5BA 1V3VA 2ZT7A 3Q3GE 5KYWA 2FW1A 3T1QA 3N2GA 1ESCA 2P9QA 3TQOA 1EQ2A 4HNUA 2AFIB 3NQ41 3E48A 3EEQA 1ZFNA 3LYAA 4XDHA 3GRRA 3MSCA 4PO1A 4AFNA 4DTIA 4QUBA 4F86A 5JU6A 4CCWA 1NMQA 4NFLA 3BTSA 2NSHA 3PQDA 4HNTA 2GO1A 3G8AA 1V2GA 4MAFA 1G1MA 1TQ6A 3H99A 1DO8A 3IP9A 4K8RB 4ER3A 4EVRA 2R6R1 2WJGA 4P32A 1U0GA 3JZMA 1AB6A 3SC3A 3HCRA 3FZEA 4YB8A 1YZNA 3E3NA 3GEBA 4DBZA 4GZ5A 1XPUA 3OPYB 3Q3HA 3ZH2A 5B7PA 5CX1A 4GS5A 3EBOA 3JALA 4ZDKA 1QIDA 3FFBA 3IRUA 1FNSA 2CFSA 1QRTA 3LUFA 4Q12A 3SDZA 1EUQA 1RLJA 1GILA 3NYWA 4BQSA 4P4SB 1E1DA 2OKGA 1UFKA 2CSXA 4D1YA 2F3PA 1WW3A 2CXRA 2TYSB 1ZIDA 3DW1X 4YT5A 4Q4JA 4RX1A 5H0IA 4LWQA 1O95C 2OV1A 4UVDA 5HUJA 1LLUA 3B1VA 5CM9C 5LIPA 2VDLB 4H6PA 1HA3A 4IDEA 4XRRA 2XQJA 3TXAA 4YV1A 1NBEA 2ZIZA 3BJZA 1EYZA 1NYLA 3PPYA 4NABA 1P74A 2DKOA 1N2CA 3AV3A 2J6HA 5BPFA 4M9RA 4E31A 3HYRA 1CDDA 1ZK1A 1R0SA 3GDFA 3KZMA 4MAMA 4WNIA 3U1TA 3V1KA 2QTZA 4IO1A 3R4CA 5LPNA 3VC3A 2XJ9A 3KQMA 1P2GA 4CI9A 5H02A 4QAJA 4XUEA 2NPFA 5EN4A 1NZJA 1DP4A 4JC8A 1JS1X 2VSQA 4DNOA 1GQSA 1YJ8A 2MSKA 2Q7XA 1V9LA 3IAHA 1VL6A 2ZB3A 1QE5A 3DQZA 3RROA 1A76A 2H57A 3FDFA 1BXRA 3K0SA 4RYLA 5BSKA 1OZ0A 1YVUA 3A6JA 4XIIA 1PGOA 1MEOA 5LMUB 5BV8A 1T0IA 5KNBD 2DB3A 4RORA 4GPBA 1UMDB 5HF9A 2IEAA 4HLDA 9LDTA 5KSWB 2EHDA 4DCMA 3NJ4A 4G36A 4HMQA 4X20A 4O1IA 3L0SA 2IHVA 5AKZA 4FILA 4P54A 3P2IA 2BKEA 2Z4TA 3O93A 1F4LA 3IDZA 3WLEA 2KX7A 1CQJA 1MQ9A 2FSVC 2E87A 3FTNA 2O2CA 2JD1A 221PA 3G2IA 4IZ6A 1KNXA 3MGKA 4IL5A 3ZTTA 4LC0A 5KU1A 1GQYA 3W8DA 1OYYA 3B6KA 5D7NA 3L7OA 4Y7DA 5MFZA 5F3DA 2II6A 4CE6A 4ZZ0A 3KOMA 5JI3E 4HNHA 2GB4A 1TFRA 3AZQA 4IDOA 4Y9SA 4RQUA 5CFNA 1K86A 5ESXA 1TEVA 5KTSA 4J0JA 4PC1A 3GVCA 4QBKA 5IP5A 3GLGB 3AHCA 3S29A 4KIGA 3K8QA 5CIQA 5CB4A 4B1FA 3EFOB 2HTFA 2VTDA 4B17A 1IM2A 4KXLA 4R9VA 4NBUA 1JDUA 2ASVA 1XZNA 2D59A 1P1BA 3QEKA 4X71A 3G9UA 3T1OA 4KQJA 3ORFA 3QMMA 3A4TA 5CH8A 4J4BA 2XEXA 4NONA 2ZQYA 5ITZA 1XMJA 2QU7A 1UANA 3GOQA 3JQ9C 3ZNOA 5ANRB 1QFSA 1XQ1A 3AG6A 4JVLA 4F2WA 3V6MA 1Y3IA 3JQFC 1LFAA 1O87A 3KQLA 4C04A 4BYMA 3PC6A 2I78A 4AUKA 3RJTA 4O33A 2I66A 2XUZA 2ZJ8A 2PH5A 3KDSE 4LDZA 4C5BA 1AKVA 3KR9A 4N1AA 8LDHA 2GBGA 3CRVA 3DHWC 4D42A 3PFIA 2WHQA 3BIJA 1L4GA 4YQFA 5IC4A 1T6BY 1ONOA 2WV7A 3MWLA 3QOFA 3UJDA 1C4KA 3OY7A 5HIMA 3RVJA 4ZVQA 1DRKA 1XLUA 4ERXA 3SJUA 3I4CA 4HSGA 1S02A 1YVEI 1KDPA 4Q5IA 4CM1A 1FUKA 2RGCA 2ZYDA 5K4GA 5LD2B 1S3SA 4HEJA 5DGCA 3E7PA 3EYWA 2CWWA 2ODEA 3CLHA 3ZE0B 1CQIA 2BFDB 4LJAA 2EJWA 2PMFA 4R16A 4ZHQF 3LK6A 5KHLB 4M8SA 1GTZA 1NUPA 3I45A 3PQFA 1J1UA 3R8CA 5KYYB 2QVYX 3DTTA 4HQNA 1KAMA 2AJTA 3K5IA 3U7QA 2QZSA 5DLPA 3AZOA 3IUNA 1U2GA 4OA8A 4AYXA 2ORED 1E2NA 2ETXA 4OP1A 3OOHA 1I2DA 1H69A 2BFOA 3SR3A 1WSDA 4FDVA 3CRNA 2H1CA 2HIHA 2QQGA 4J0KA 2ZJBA 4C03A 2NO6A 2SICE 2IH4A 1E1RD 2WSLA 4GG1A 4MVJG 2D8AA 3LWDA 2C5HA 3VKVA 1K4MA 4KMOA 1P2UA 2CVFA 3BILA 5AW1A 2ZXUA 3PFBA 2HXYA 4WY2A 2WP0A 2HQ1A 2GS9A 3RAEC 1ZMRA 5SY4A 2FMHA 2WHYA 2ZW9A 5EIBC 3U17A 3OQBA 4NYMQ 4LHXA 1I5EA 3TW6A 5F23A 2RHHA 4QPNA 1XBTA 4H18A 4UAJA 3N6VA 2IH5A 2JLUA 1EZZA 2XDYA 4AULA 2AG0A 1C14A 1VHJA 1OXMA 2QE6A 3Q1LA 4U7GA 4P0QB 2AI3A 1XPJA 2W00A 1Z0AA 3CF6R 4X7BA 2WYIA 6LDHA 3C5CA 5AJUA 5SY9A 3JYHA 2P3QA 2ESRA 2H0QA 4LBVA 4JB0A 1XKLA 1GZ3A 3EIXA 2JLXA 5KSZA 4PANA 3V00A 3AEUA 4ISCA 3KDPA 1EINA 2E49A 5T57A 3MGGA 5JDCA 1Y9AA 2JKZA 1JAHA 2OHXA 3L0OA 3LPNA 2FFBA 1C1XB 4GSLA 4OJYA 5INTA 3EGCA 1Z13A 3NBMA 1K7YA 5EIHA 5E7JA 4CT0A 3HP7A 3IIKA 4I1RA 4W5OA 2C5AA 2VHEA 1DT5A 3EXFA 1ISJA 3P0FA 2G76A 2VKQA 1NM5A 2SKEA 4LBWA 3RS9A 4NLLA 3K05A 2JZOA 1DKNA 2KMLA 1JG2A 1CY0A 4QECA 2VK8A 5K3SA 4D56A 4MI3A 1GSHA 1JYSA 2OK7A 1E2GA 1RWNA 2HA5A 2VJCA 3GB9A 3L7AA 3VJKA 5HUHA 3T4EA 1I51A 5ALYA 1W1UA 4D9NA 4IHAA 4FGZA 3GLGA 2I2AA 3DEJA 4KTVE 3G1WA 4PPFA 2MYTA 1AF4A 4PG7A 4BEJA 5HMMA 1PGNA 1NKVA 5C5EA 4MV1A 1T2FA 3TBFA 4P80A 3ZUGA 4RHUA 2OYCA 1JR2A 3U60B 2JFNA 2FEPA 4ESHA 5JQGB 3K96A 4F04A 1E9VA 4RTPA 3F90A 1C0EA 3MT8A 4H4EA 1G8JA 3IAAA 1Q2XA 3NWOA 3Q8XB 4LGMA 3JPWA 2V7WA 5ENVA 4JOBA 3GQBA 1GPBA 2EERA 2X86A 4ND4A 3SZ3A 1B8NA 5KC9A 4IXWA 1NX6A 5CYOA 4GYWA 3ZU2A 4OHBA 1KOJA 2E9SA 2YYYA 3NIFB 5F51A 2LGJA 4BIMA 2YUTA 3WIUA 5HX7A 2JIZA 3IV9A 4Z1OA 2WWXA 2H5LA 1V9SA 1IHUA 3KVYA 2H4HA 2BGRA 3FVVA 2H1HA 1M83A 3ACCA 1J56A 1LK5A 1RLOA 2QRJA 5AW5A 3DBLA 5AHKA 3MFYA 2O20A 1S8NA 2X6QA 3E5HA 5LBTA 3ANSA 2PZEA 2WPDA 4MAAA 4PTYA 3B1KA 3BMCB 2WFLB 3ANYB 5H8WA 5DZSA 4BVEA 2PUCA 1ZU4A 2POQX 2QX4A 5EE1A 3E5MA 3E9CA 4HDMB 3CEAA 2JHCA 3NWJA 1DB3A 4Q3LA 1JX6A 1TC2A 3RVMA 1QPGA 1YR8A 4EA6A 5B12A 4HGYA 6REQB 2JGNA 2YHBA 5IYZF 1MO4A 2V3WA 3FYUC 3O4FA 3ABIA 3SMVA 4RDHA 3CEPB 3QLTA 4N6GA 2HYDA 3MTGA 3WGJA 3DDUA 3JQBA 2QMYA 2W6MA 5AKHA 1F2TB 4FPXA 4PZ0A 3T3OA 1E3WB 5D3KA 1CBUA 1YGPA 2R8PA 4W7IA 1XZPA 5G02A 3U4DA 4BX0A 3AW8A 1AXGA 2W8BB 3CWCA 3TEFA 5HE8A 5C1IA 3H11A 5I7RA 1RVV1 4Q7KA 3P97A 1XL0A 1X77A 3ZE8A 4JLUA 2F8MA 4O2BB 3FFAA 4M9CA 4MIKA 2FMTA 2G8NA 3GNTA 3B7GA 5EKDA 1EQAA 5ECGC 3UPDA 2CEAA 2ZIXA 3U3JA 3DE3X 4FR2A 4WLFA 1W7AA 4MUBA 1UBMS 4RV5A 2WWHA 3A8TA 1G20B 5C8DA 3GYGA 1IQ0A 3GRAA 3QVJA 4BGEA 1FRZA 1NV8A 4KNVA 4UNIA 2PS9A 4LZOA 3ZQKA 2W6ID 3QKWA 2RBKA 1JQ3A 2WZDA 3IPLA 1XDZA 2QQEA 2ZS8A 3MMPA 4LZJA 4P4LA 1C9NA 2AC2A 1CRWG 2K2WA 2J0EA 3A11A 4HXFB 4JUIA 2FPPA 4NFSA 1NXTA 2GYUA 2QB5A 4WNAA 4WZBA 5HCUA 3RHZA 1ELOA 2GTHA 2GZHA 2HFJA 1JFFB 1V8OA 3M6LA 1P5JA 3F7NA 2R5WA 4P9NA 5B2ZA 1W4RA 1NLUA 4LY6A 3HCCA 2CF6A 1K88A 3E61A 4JZYA 4PBTA