1N6LA

Crystal structure of human rab5a a30p mutant complex with gtp
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
168
structure length
168
Chain Sequence
GNKICQFKLVLLGESPVGKSSLVLRFVKGQFHEFQESTIGAAFLTQTVCLDDTTVKFEIWDTAGQERYHSLAPMYYRGAQAAIVVYDITNEESFARAKNWVKELQRQASPNIVIALSGNKADLANKRAVDFQEAQSYADDNSLLFMETSAKTSMNVNEIFMAIAKKLP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title High Resolution Crystal Structures of Human Rab5a and Five Mutants with Substitutions in the Catalytically Important Phosphate-Binding Loop
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein transport
molecule keywords Ras-related protein Rab-5A
total genus 58
structure length 168
sequence length 168
ec nomenclature
pdb deposition date 2002-11-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1n6lA00
5EXPA 3DZ8A 2OHFA 3KZ1E 5HKKA 2KB0A 3HP1A 1L4UA 1CJUC 1JALA 3V4RA 3KKOA 4D6PA 4DXAA 1XXHE 3FPAA 1P2TA 1P9NA 2B8TA 2BCGY 2W2XA 3LVQE 4NCKA 4YDHB 1NLYA 5EE9A 4YQFA 4TLCA 4IDHA 5JFGA 1CP2A 4YMVA 3UXMA 5JMTA 4GOJA 5C1BA 1FOEB 2REBA 1ZW6A 1FX0A 2BJWA 3R9WA 3X1ZA 2GILA 1U98A 3DPUA 3VNUA 1MO4A 4BLOA 2OUKA 3F8TA 4IKEA 3ZS9A 5BN5A 4W5HA 3BH7A 2GZHA 2QMOA 2IYRA 5FBQB 1T5IA 2I3BA 2V55B 4F4JA 821PA 4QKQA 2BBOA 2YWEA 4RZUA 1W2HA 2QAGB 2HLDD 1TU4A 4IOKA 4LYJA 3ZVLA 5AJYA 2BMJA 1NN1A 3VMFA 2J3EA 1OLOA 2B92A 4JJKA 3DKVA 3JVVA 4Q5IA 4IHQA 2C04A 3F3YA 4C0LA 1NP6A 3VHXA 1OIWA 2CCGA 3LQRA 4C0AC 1EGAA 3D6TB 4TYWA 3CRQA 5C46F 2IHYA 2GXQA 2GJ9A 1CRQA 5EUMA 3WHKA 2CCKA 1G6HA 2WJHA 4C0QC 4URYR 3AV0B 2UZ3A 4Q1CA 5HZKA 4NBSA 2WKRA 3QOFA 4Q9LA 1AKEA 5SZKB 3BE4A 3U3OA 3KJIA 3D8BA 2QT1A 3AVYA 1AGRA 1ETUA 4Q02A 1E2DA 3HPRA 3VR2A 1OSNA 1GUAA 4IXNA 2ZU6A 4UKDA 5CYPA 2VYFA 4ON9A 4TYQA 2P6UA 2YJTD 3W34A 4ESHA 3KJHA 4IEEA 4PPFA 1DG3A 4HZIA 2BC9A 4PQRA 3CWZA 5FPSA 5JSZA 3VR4A 1TUIA 5CM9C 1JQJC 1NKTA 2R9VA 1S3SA 3P27A 4AURA 2CVFA 1HQCA 1SKYB 2ZQ5A 1FL9A 4OI1A 2FEOA 2R62A 3PG5A 1KMHB 2IWHA 1VHTA 2YINC 3NBXX 4DJTA 2XEXA 3G0HA 5KTYA 3LVRE 4Q4LA 4HUQA 3AKYA 3WMEA 4B3FX 2WSMA 3OESA 4PX9A 2PEYA 4JSTA 2ZVQX 2PZFA 1NBMA 1Q57A 1E1RA 3QXSA 2EYQA 3MLEA 1Z6AA 1DAMA 3EIEA 2ZVPX 2P0EA 2VHQA 2NZ8A 2BIFA 3HU1A 4GP6A 1E98A 4WZ6A 4C0KA 1GRRA 2HUPA 4Q19A 2GCOB 3QF4B 4NYIR 1KI3A 2OILA 2FSGA 3K70D 1XTIA 2P6RA 1E4YA 2ZI9A 2ZSEA 1IQPA 1K5DA 3AVOA 3V00A 5G40A 4LBZA 1IXRC 3A8TA 4FN5A 3THWB 4IDNA 1P60A 2WJJA 5J4KA 1RE0A 3ADBA 4XJXA 3CIOA 2QZ4A 3UPUA 2ZRKA 5FOTA 2Y8EA 3UG7A 4LC0A 4A8JA 3QKRA 2BWJA 2WMOB 3Q72A 1KK1A 1QG4A 1CR2A 2VRWA 1W4CA 5FPHA 3K0SA 4G5OA 1FX0B 1OFUX 2FOLA 2V6IA 1ZD9A 1L4YA 2Z6VA 2IXFA 4HAXA 1MO6A 3RS7A 5JBQA 3QVUA 2CK3D 3I62A 4OHYA 1P9WA 3CF2A 3FMIA 1UFQA 3EC2A 2HJGA 4ZCIA 2C03A 3K0FA 4QXAA 4FMDF 4YMUA 3GQBA 4ITRC 4TQ9A 3X1WA 2FPKA 2BBSA 4QHYA 1UBCA 2CHGA 3QEOA 4DCUA 2R6CA 1LF0A 1E9RA 3BXZA 2A5JA 2QAGA 1OKKA 1NNEA 4Q48A 1LNZA 2JA1A 2WPDA 4AG5A 5D3QA 4LBWA 4C0SA 4NL4H 2IL1A 4NMMA 4B32A 3GJ5A 3HJNA 5M04A 3KQHA 2WMNB 1OXTA 1O3YA 1IY0A 2WZQA 1DO0A 3PFIA 5FH9A 2Z4SA 1M34E 2A5FA 1EWRA 2H16A 2WOJA 3C16C 4WZAE 5FUXA 1LB1B 5JJKA 3WY9A 5H68A 4HB4A 2WWIA 1UBGA 1VYTA 3S1AB 3CRMA 2YKGA 3NWJA 1IOZA 2PL3A 4EFMA 1MO5A 2HT1A 3GCGA 3CH4B 3FKSD 3FYHA 2IXEA 1E32A 4HAZA 3OIWA 4MKFA 4PQFA 4QC2A 4OJKA 5CJPA 3EWAA 3UK6A 3HYRA 5GVRA 4DCTA 3HU3A 2Z43A 5AR1A 5CLQA 1UKEA 5FPYA 3VHLB 3FHTA 3TBKA 4CT4B 4QGFA 5FI1B 5TARA 3OE7D 2JLWA 2DWPA 2YC2C 3NG1A 3SQWA 1CR1A 1QHYA 1IN7A 4LBYA 4A92A 5E7JA 4JLJA 2VHJA 5CIQA 3O8BA 1S1CA 1OKKD 2FFHA 3AGQA 1ZIPA 2BOVA 2VH5R 1LFDB 2BCJQ 2AFIE 5E4FA 2WTUA 1CS4C 3IO5A 2VP6A 1ZIOA 5FPKA 3SJCA 4GP7A 2ASEA 1KDTA 2DFLA 4PZLA 4GFDA 4ARZA 1XJQA 1E1RD 2F43A 4WOPA 5DN6A 4LJ4A 4JMPA 1GKYA 5HE8A 2ODNA 4M1OA 1G16A 1U8AA 2H17A 2ZIAA 2RGXA 4GMDA 4DDUA 3TVDA 1M8PA 1NIPA 4DHEA 4DT1A 1N0VC 4BRWA 1E4VA 1J90A 2IYZA 4EJSA 2P3SA 1TQ2A 4KO8A 2W0MA 4MYTA 4ZO4A 3RANA 2ZM5A 2ZR7A 5FR2A 4NP6A 1T3HA 2F43B 1AM4D 4NDZA 4KHZA 5J4HA 2C95A 1D6JA 3Q5EA 2DWQA 3A1TA 2ZREA 2KBEA 3BIFA 4A36A 4TQAA 1N6KA 4B35A 1W4BA 1SVKA 1E2MA 2ZRJA 1Z6TA 2CL6X 2XGJA 3FMOB 4WAUA 1R4AA 2ERYA 1IN4A 3EW9A 5JZVA 2QPOA 1FNNA 4DIEA 4TYNA 4C0HA 2X2FA 4JVMA 1CIPA 1GDDA 3U3MA 4PR0A 4V02A 1SXJE 5HCNA 3I73A 1LW7A 4JLVA 2GAOA 8OHMA 5TDHA 1KJWA 3MWJA 4I99A 4OI4A 4YONB 3RNLA 4BLSA 3KQKA 1RC8A 3GJXC 4B76A 2RGAA 1R5NA 4PC1A 4N1AA 2XTMA 1FW6A 4CEIB 5FBVB 4B3DA 4B73A 2QG6A 5FL7D 4U00A 3U44B 5H8WA 3M4YA 1GKIA 3BWDD 2CNWA 1N6NA 2W6IA 4DLSA 3U7EB 4BZXA 3M6AA 1ANKA 3BB4A 1U2RA 2FMXA 1QVAA 2RGCA 2CDNA 2OBMA 5EE1A 4MH0R 1EXMA 4WZBE 5DE3A 1Z8FA 1CULC 4M53A 5L3RA 4NPHA 3ZS8A 1ZYUA 1XMJA 2G1JA 1S4QA 1PZNA 2IYQA 2YOFA 3SHWA 1Z07A 4Q21A 4XVUA 2QM8A 4ZDJA 3EARA 4TZ0A 2A2ZA 2RAPA 1EFCA 3CZQA 3THXB 1WDTA 2P2LA 1JJ7A 2QROA 5LBIA 3C4JA 2G83A 5CK5A 1RKBA 3AF3A 2DCUA 3PEYA 2Q6TA 4AKIA 1US8B 2BMDA 2PZGA 1E9AA 1Z2CA 4DDWA 4B33A 4I1UA 4UXIA 1Z28A 1KI9A 3ZZUA 1ZP6A 4EQ6A 3Q5DA 2A9KA 5TB5A 4A6XA 1KAOA 4DDVA 4H1UA 2G0TA 4PPQA 2VP4A 3OZXA 4NTZA 1ZVQA 4B2IA 3T34A 2CBZA 4DCVA 4JSYA 2RCNA 1CU1A 4EPVA 5F2EA 3ADKA 2AD1A 5IK2A 4BZPA 4L8GA 3TK1A 1OXSC 5JSZB 1JR3E 5FTLA 5HTKA 1WCV1 2GXUA 4ESVA 5JS7A 3X2SA 4IFBA 3L43A 2F55A 1SVOA 3CWQA 4EQ6B 3B1WA 1NSTA 1GIAA 3FE2A 3MFYA 1MKYA 1HH4A 1ZCBA 1DO2A 1M74A 3KFVA 1ZINA 4PTLA 4HZUB 4RFSB 4IXMA 4OQMA 2YNMA 2F3RA 4CEHA 3VU9B 2REOA 3W6OA 3N70A 3K0CA 2FEMA 3A4LA 4QBFA 3U7FB 4O3MA 3GJ8A 1YQTA 2DR3A 3WHLA 1OB5A 1Y3AA 1KJYA 3IEVA 4UNQA 1KI8A 1MV5A 2WWHA 3THYB 1QHNA 1Q0UA 3DMNA 2CMKA 1MH1A 2JJ2D 3Q9LA 4GRAA 5G3YA 5DNYB 1XNJA 1NG1A 1YRBA 3MWLA 4NH0A 2V8OA 2BV3A 3OAAA 1TEXA 4JYCA 1IAQA 1X1SA 3AKEA 2E9SA 4B2LA 3OEHD 1G6OA 1T5LA 2BKUA 4HB0A 2FSHA 1VG9B 3C5CA 3FVQA 1N25A 1OHHD 1WE2A 2C9OA 2SHKA 3UKDA 1E2QA 2OV2A 3C15C 2QENA 1I4DD 5GJCA 4NYJQ 2PCLA 2ZJOA 2OXRA 1CRPA 4MDEA 3T61A 3LBIA 2F1JA 1K8RA 3LQQA 2OG2A 4LYHA 1Z0DA 5L3QA 2IS4A 2DFNA 1ONBA 2E1RA 4YXWD 1P5ZB 1HY3A 1SQ5A 1MRNA 1KAGA 1SXJC 1R8SA 5AJZA 1U9IC 2ZRAA 3N2EA 2Q9BA 4K8OA 4M2LA 4DBLC 3V4FA 4V0KA 3TAHA 1UKZA 5FTNA 3GLHE 1GITA 1KMQA 4LSGA 4XD7A 4AK9A 3K53A 3BC1A 4XOIA 2RHDA 2GJKA 3KXIA 1R7RA 3R8CA 4FW9A 2BJVA 2GEUA 3I92A 3B60A 1BYIA 2GF9A 4H1VA 621PA 4JS0A 5K8IA 3TSZA 2O8BA 4BFUA 5E7IA 3IPYA 1F5NA 4V0ME 2QT0A 3B1XA 1E6CA 4W5WA 4Q9JA 4D82A 1GL9B 1AQUA 1OIVA 2H8KA 5HE9A 2MSEB 4BGDA 1Q44A 2B6HA 1ZM2A 3O8RA 2CL7X 4PC6A 3SHFA 4IDOA 4KLNA 2QBYA 2ERXA 4FD2A 3NDBB 2JATA 4FIDA 4U02A 2O8BB 5DHFA 2XOKA 2VF7A 3OIVA 4ACBA 1X86B 4D2IA 1SVIA 1JPNA 3O8CA 1XCGB 2XOKD 4Y0AA 4JIMA 2QE7D 5KO2A 5FI0B 2JLUA 3FHOA 1D2NA 3R9XA 3PQCA 2QAGC 4RSGA 1E2NA 2VP2A 3FHCB 4CT5A 4F4IA 2Q3FA 1XEXA 2XAUA 4QOSA 2IXGA 2JEOA 3TQFA 1GNRA 2ZXUA 2WSSA 5F9FA 4URZR 2KI5A 3PUWA 5CB8A 4PC7A 5EE5B 5ANRB 1XPUA 1GFIA 4EPWA 4KXFB 4MRVA 4US2R 1AS2A 1SXJD 1XXHA 4MRNA 3RDPA 3Q8XB 4KITB 4L4UA 5JCZA 2WIBA 4M8NE 3TRFA 5FPTA 1VCNA 3MWYW 3SBEA 4WBSA 4FI3C 3RVBA 4DEXA 1AZTA 2AFHE 4DT1B 3ADDA 4PHGA 1KNQA 2OZEA 1WQ1R 1GAJA 2G77B 1GZSA 1E99A 2AWOA 5SZHB 1JECA 2G9NA 3U4QB 3CM0A 2REXB 1AN0A 1N0WA 1ZC3A 2FA9A 2OLKA 3SDZA 5CYOA 1KHTA 2RMKA 4BFSA 3F5FA 4RZXA 5GVSA 1BKDR 1R0XA 1N3BA 4OK6A 1OXVA 3TMKA 2LCFA 1E79A 5JWOA 3GFPA 4XD7D 1TQ4A 5F98A 3CW2A 1S1MA 2F3TA 5FOSA 5BWMA 2XB4A 2AL7A 1SXJA 3BERA 2O8DA 3QPWA 3T12A 1MABA 4CIDA 4TMVA 1R2QA 4UXHA 4AY2A 1Z06A 3ECCA 2PX0A 4NZYA 1TF5A 1JR3D 1MRSA 2ZROA 4NYJR 4TWZA 2J0VA 3DMDA 1R0ZA 4Q4HA 3PUXA 1G17A 2ZU0C 1Z47A 3QJYA 2OFOA 3KKQA 1G7TA 1J2JA 4M9QA 2W6JA 5C4GB 3BRWD 1FQKA 3H84A 2QSYA 4TYYA 4ILEA 4M4SA 1KMHA 1T0HB 4ASUA 2ZRBA 1KI2A 2BEKA 4KVGA 3X1YA 2QSZA 2WWYA 2J9RA 1OIXA 1IN6A 3TJZA 3NXSA 3T1QA 2F7SA 1UKVY 1VCOA 4A6PA 1E9DA 1ZJ6A 1NVVR 2J41A 5KSPA 2XNSA 2PLFA 2IYXA 4YMSA 3WYAA 1QHIA 4GT1A 1KO7A 2QP3A 1JNYA 4G5SA 1E2JA 1YZLA 1G20E 4AD8A 5K8LA 4QFMA 3W6NA 2X19A 4Z51A 4FCWA 3CUEF 2FDCA 3TE6A 4XSHA 4RD6A 1DPFA 3B82A 3L8ZA 4US1R 2BBTA 5HKKD 1HEIA 4XWAA 2QQ0A 4MGYR 5AJVB 1WB9A 3OIUA 1W1WA 4JVLA 2AN9A 4NONA 3IIKA 2ZEJA 3ONWA 2XITA 1IM2A 2FH5B 3B5JA 3B85A 3CH5A 2QI9C 1P7CA 4LPKA 1HT2E 4O0MA 3AF4A 2VHCA 4M21A 4RKEA 2ZI4A 1XTRA 1PV4A 3UMSA 2JAQA 5EUQB 4DDTA 2GDJA 1A2KC 3CLVA 2EFGA 1H8HD 2PCJA 2EYUA 3KTAA 2FE4A 4TMZA 1RYHA 2AHOA 3FDIA 4EJSC 2QMUA 2X8AA 2G0NA 1M7HA 5D3MA 1KI4A 3MWKA 3AVXA 1F48A 3ZH9B 3KDSE 4KYIB 5KNCA 4NYIQ 1U0HC 4RZ3A 4PANA 2QRNA 1G7RA 3GPLA 3AVTA 5KUTA 3CNNA 1JB1A 2ZJZA 3WNCA 3WNBA 1C4OA 2FNAA 3WBKA 1OYYA 1TTTA 3EPLA 3LAWA 4LV8B 1RRGA 4TLDA 1TQDA 3Q3JB 5IRCD 1C9KA 2WWGA 3THYA 1Z2AA 3I32A 2RGDA 2ZSAA 2GBLA 2YWHA 3LD9A 3MAAC 4HLDA 2OXCA 4JL6A 1N5JA 1OFIA 5C4MA 2HDNB 4M1WA 1N6PA 3GLFE 1MOZA 1P2UA 2XJ9A 1COWA 1HUQA 2JDID 3G82C 1JAIA 5F9HA 1IBRA 3SOPA 1XEWY 1G8FA 3CPHA 3VFDA 3CF0A 3N2IA 4KFUA 4IOJA 2AD5A 2C5LA 3CX8A 3JZMA 1J7KA 2DY1A 2FU5C 3UMRA 4HYYA 1RYFA 1PLJA 2ZYTX 1AK2A 4Q1AA 5BW8A 2VLIA 3M1IA 2AK2A 1VECA 3QUSA 4LC1A 1H8ED 5H1YA 1VIAA 1ZNXA 5BQ5A 1E79D 2JLXA 3EIHA 1KNXA 3A1UA 3NEJA 3NHAA 1TL7C 2NG1A 2ZRGA 1AGPA 1T3SA 2XTZA 1FP7A 3BBPA 3GLHA 3U3KA 2ZSDA 4AYXA 4BLPA 1XMVA 4B71A 4UNPA 4D0NA 3PEWA 2EFCB 2ZANA 3RHFA 1M1YE 3GMTA 2XNDD 3DOFA 3EASA 4IDPA 4AKEA 4POAA 1G7CA 3E1SA 3MG9A 4CGZA 4Q1DA 2W2VA 1KSHA 5P21A 2D74A 2CCJA 2V3CC 4MGIR 3WP0A 1M6NA 3CZPA 5KPDA 3BOSA 2IUUA 2EW1A 4C2UA 2FX3A 2VIIA 4LX0A 5KYKA 1Q1BA 3CKLA 4TSFD 3B9PA 2PEZA 3K9HA 4NCJA 4DCNA 2UKDA 4PPGA 3PR1A 3PJRA 2D3WA 2DPXA 4JJZA 1UBEA 4MYCA 4ZPXA 2QBYB 2JIZD 2ONJA 1P61B 2OEPA 4Q7JB 1XU4A 4JKIA 4R7ZA 4X8LA 2ZR0A 2WOOA 5DO9A 2EFHB 1SULA 2LWIA 5TV2A 2C8VA 3SN6A 3I5XA 4HUTA 4QM7A 2IX3A 1QHSA 3QXCA 4PO9A 4LV5B 3UMFA 3NEYA 3Q7QA 5E7MA 5HPYB 1XZQA 2D62A 2IYVA 3VAAA 1T3LA 4N0DA 3WMFA 1VHLA 1W4RA 3GFTA 4LHYA 3RABA 3IILA 2D06A 3X1XA 1RRFA 4LYAA 3GFOA 4A2WA 5CITA 4B6EA 4JL8A 4BLTA 1XP8A 2XX3A 2Q0HA 1VYVA 3UATA 3QKSA 4GMXA 2YWFA 4OKSA 4E09A 2GETA 4PAMA 4ZCLA 4PZZA 3T5DA 3W5IA 2H18A 5AK0A 3QBTA 3TUJC 1G3MA 1Z6XA 3MJHA 1N6HA 5LD2C 2HCJB 1M7GA 3LX5A 1KO8A 3VKWA 4BUJA 3CRRA 3SI7A 3GLIA 2JLZA 1Z0KA 4P33A 3QKUA 3QG5A 2ZI6A 4R2HA 4PHTA 1VCMA 3QXHA 3L82B 1YR9A 2GESA 4BFYA 1W5TA 3AM1A 3D7MA 3SS8A 4CDGA 1D2MA 1R10A 4G5RA 2GJSA 1GRQA 3GLGB 1F3OA 2JJ2A 4CZ2A 1IY1A 3IQXA 1GNPA 3K70B 2GVDC 4MGKR 2DBYA 5DI3A 3JZAA 3X1DA 4XIGS 5IK2D 4TL8A 2HYDA 3W8RA 1TX4B 3EXAA 4LHVA 2HF8A 1SVMA 2FZLA 2MMCA 2V7QD 4BPBA 2NO9A 4FCTA 3A37A 3KB2A 2Q3MA 5A4JA 4I1OA 3DZDA 4M9XA 2D7DA 1KSFX 4Q01A 5C18A 1E2KA 1NG9A 1UF9A 1HURA 3GEIA 4DC9A 3B78A 4AC9A 5ELXA 1NBMD 1E69A 2ZRCA 3KKPA 2OFWA 3L2OB 2QGNA 1JI0A 5JHGB 1KDRA 3F0TA 1LS1A 3LRPA 3THOA 1KO4A 2R6DA 4U7DA 2P6NA 4PSAA 4D0GA 1CJKC 2QP4A 2ZRDA 2V6JA 1SGWA 1XD2A 4Q4HB 2LKCA 4W9MC 4PC2A 1N2CE 2G6BA 2QTFA 4A0RA 3AKDA 2B21A 2GA8A 3AKCA 4HB3A 4JBWA 2IA5A 3FGNA 3TQCA 4R98A 2ODWA 6Q21A 3VKHA 1VCIA 2WWXA 1JXMA 1R5OA 3A4MA 4G01B 4M9ZA 4Q9HA 1VPLA 1TEVA 4C9BA 4DKXA 3ZD7A 2IUSA 2WSSD 4LDJA 1W4AA 3H1TA 3CPJB 4E5UA 2GK7A 5DYIA 4DLXA 4AYWA 5JI3E 4PSVA 5K8UA 3H2YA 3DM9B 1ZD8A 2GCNA 4U5XA 4OJQA 2BM0A 2JLSA 2YC4C 3HR7A 3TUIC 4ZV4A 1T8TA 3I5YA 4I1VA 1F2UA 2VA8A 3AB3A 4HLQB 4LGMA 421PA 1AZSC 1R6BX 4HSEA 3IBYA 1T91A 2JIZA 1UJ2A 2F1HA 1OPXA 1CR4A 3AP2A 3RSLA 3VR6A 2ZJ2A 1G8GA 1BOFA 1M2OB 2CLSA 3CR8A 4Z1MA 4MKGA 4N0EA 4X8HA 3CO5A 4IOLA 3ZVNA 4E03A 3I72A 4DLZA 5JWHA 1CJTC 1E2EA 3DM5A 3WRYC 5GJBA 2C96A 3B6EA 1Q12A 1CJVC 3FMPB 2B7CA 3OIYA 5F3WB 3LY5A 2BBWA 2VEDA 5JI2E 1ZM7A 2GJ8A 2VL7A 2VSOA 3VTKA 2AWNA 1W0JD 1JEEA 1YZNA 3KUDA 2IT1A 2V7QA 3L8YA 4PSKA 1WA5A 3NHBA 4RCZA 1UEIA 2BM1A 3B8HA 1CLUA 1TADA 3P32A 1EESA 3AUYA 1PJRA 1W48A 4KODA 3I61A 2C9YA 3IO3A 3P4YA 1Z63A 4NCIA 4CEIA 2GJAA 3QKRB 3LXXA 1E9SA 3K9LA 4EPXA 1LY1A 2N46A 1U81A 3T1TA 1X8KA 1LTQA 1XF9A 3NDPA 3VR1A 4DLRA 2ORWA 3I1FA 2YWGA 1SZPA 2F9LA 3K0FB 4GPTA 2OBLA 1Z5ZA 5FL7A 1DAIA 1OW3B 2PJZA 4GSYA 4S2EA 1VTKA 2FFQA 4HLUA 4D4JA 1IJEA 2X1VA 2NGRA 1Z0JA 1LS6A 2CEAA 4Q9KA 5JEDA 2O8FA 1Z29A 2I1VB 1SKQA 1XFAA 4UNNA 3THXA 2AR7A 1I4TD 221PA 2K5UA 1TQ6A 2C99A 3GLFB 1Z08A 5J4LA 4GI7A 1S8FA 2AKYA 3K8YA 521PA 4LJ7A 1B23P 4EAQA 2VP5A 1II0A 3GJ3A 2Z83A 1YZGA 5DIFA 2FSIA 2A78A 3R20A 2ZRFA 3U7GA 3B2EA 2GRJA 1Z6YA 4O25A 1PVOA 4LCBA 2H1LA 2QPAA 3LBNA 3BGWA 4A0GA 1JAHA 3CBQA 4BASA 1ZC4A 3VQTA 4LZZA 2J87A 4WXRA 4AWXA 3K0AA 2PZEA 1NLFA 4MYUA 1BS1A 1G1MA 1LV7A 2ZUBA 2P5SA 1ZU5A 1Z6GA 3SJZA 3AF2A 5AUPB 4R71A 3EZ2A 1SVSA 3GJ4A 4BFWA 4IW3B 2QN6A 4UJ3A 2ZRIA 4Q47A 3EPHA 1XBTA 1T8UA 1II9A 4EIWA 1RRCA 3GJ7A 4E22A 1DADA 2R6GA 1AS3A 1Q22A 2V9PA 4Q4JB 3ZIAA 4IOMA 5G3ZA 4AKHA 4RY2A 2WWWA 4K81B 4I4LA 4QGHA 1ESNA 1XCPA 2FJUA 3EA5A 2OT3B 3QENA 1KZ7B 2NOAA 1S9HA 1ZUNB 2PBRA 5JHHB 2GCOA 2O0HA 3QF4A 2HF9A 2RGNA 3D31A 3G5UA 1XX6A 5JRJA 1R0YA 4ZDIA 4BRUA 4TT3D 2OCYC 3OAAD 1E1QD 2QA5A 2W0SA 4CEJA 1P6XA 4TTQA 5K8TA 2D4HA 4OK3A 2RH5A 3FFAA 1COWD 1EG7A 1X8LA 4RJLA 3SFVA 5DGXA 3QSYA 3EZ6A 1SVWA 2D2EA 4WVFA 1KIMA 1NMXA 4EPRA 1Z3IX 3ASZA 1QZXA 4JL5A 3W3AA 4EDHA 1OJLA 3P4XA 4JLKA 3FFBA 2ZJAA 3NIBA 3CR7A 4JBXA 4D26A 2F6RA 3GEHA 1KK0A 1KY3A 1G21E 4OHXA 3CRVA 2L0XA 1IY2A 4HLUC 5EXSA 5BN3A 3SQXA 3CRW1 1E2LA 2Q9AA 3PUYA 4JT4A 3RLFA 4MITA 3TAUA 4C0JA 2QP9X 1DS6A 1W47A 3I8SA 2C2HA 2R6AA 3K09C 2J7PA 1TUEA 3H4MA 1E96A 1N5LA 3MMPA 3UG6A 2GEDA 1L7VC 2OESA 1P4SA 2KJQA 3LWNA 4XVRA 3DOEA 3O8DA 2E87A 2QU8A 1G64A 3KQNA 1W0KD 1X3SA 3VX3A 4MRPA 5B58C 2JLRA 5FBLB 4X8OA 2CLCX 2D2FA 2ZPTX 5KOYA 5EXXA 2WHXA 1W36D 3PUZA 5IF9A 3JVUA 4KJZA 1GKUB 4TSFA 3VKGA 3IDQA 2H57A 1QVRA 4CRWB 2O8CA 3RWMB 4GDFA 1GRNA 3DO6A 2H92A 2J0QA 1KZGB 1NMZA 1H8HA 4DUGA 3IQWA 2DHRA 1GP2A 5JJIA 2AXNA 5KSZA 1YZUA 3IGFA 2IYWA 4X8MA 1VG0B 1RRPA 3B13B 3PIRA 2R6FA 4PQYA 2QE7A 4B2PA 5KDOA 1D9XA 2VF8A 3ZVMA 3NH6A 4IVQA 4L15A 3KTAB 4QBGB 3ADCA 5G41A 3RSOA 4AIIA 2IYSA 1UDXA 3T5GA 1JEDA 3ZQ6A 1WMSA 5EZ5A 2DYKA 1QG2A 4BLRA 1VYUA 2QGZA 1QHGA 2J0SA 2R8RA 4JLPA 2ZI7A 1MO3A 2HT6A 1XD9A 2WBLC 1UM8A 1NRJB 1QBKC 2IF0A 4YMWA 4F7WA 1XPOA 1YU9A 2CL0X 3RRNA 4GNKA 3RAPR 4DRZA 4I81A 2QMEA 3HU2A 4B6FA 5FTMA 3TR5A 3A36A 1NY6A 2CJWB 2MSDB 4ZIRA 1F2TB 3MJRA 1W2GA 5IDVA 5FUVA 2GVZC 5GJVC 2ZSFA 4DUGD 5TMPA 4AYTA 4LRWA 2EU8A 2PH1A 4MA4A 3U5ZB 3QY0A 4OQLA 4L9SA 3NTUA 5EP2A 5HR5A 3TNFA 1XB2A 2CNWD 4C7OA 2PLRA 4D81A 4KI0A 3OE7A 5LB4A 1EFTA 4IEIA 2YOGA 1V43A 3CNOA 3RC3A 1MABB 1UPTA 1CBUA 4QL3A 2DFTA 1Q20A 3GJ0A 3ZVRA 1A1VA 3M0EA 1OE0A 2FGJA 4KV9A 5C2JB 3ICQB 2MSCB 5KNBA 3KXKA 4OHWA 3U60B 2GTPA 4LV6A 3OF5A 2WV9A 4A2PA 1ZNZA 2GHIA 3IHLA 5JRZA 1YVDA 1SXJB 3U6KA 3PITA 4Q18A 5KNDA 1QHHB 4LJ9A 2JCSA 4KCGA 4OYHA 3IBGA 4JLOA 4HDOB 4GOXA 5A5GA 3SNHA 2PMKA 5LDDC 3QG1A 1DAGA 4QGGA 1S2MA 1RPZA 5DI9A 3A1SA 4Q7LA 3NKVA 2DB3A 4FXPA 1XEFA 2ZUDA 2BDTA 2ZR9A 3AGPA 2ZSBA 1P2VA 1W44A 4JT2A 1L2TA 2GF0A 2YYZA 4LBVA 4OL0A 2QY9A 1EK0A 5EQTA 4TMWA 4IRUB 2Z5FA 2RGGA 4HUQB 4TZ6A 1KO1A 4QGAA 4RD3A 4IVPA 1NLZA 4J0QA 3WRXC 1DAFA 1OF1A 5EP4A 2KE5A 3EC1A 4A15A 1N6OA 3CX6A 4MGZR 4LOAA 4TQUS 4L9WA 3TH5A 2GKSA 4URUR 3RYTC 1U9IA 1FUUA 3RC8A 1XTJA 1Q1ZA 4JLBA 2J46A 5FOWA 3RWOA 1LF5A 2FPLA 1DG1G 4OI0A 5EJEA 4ZKEA 1OH6A 1D9ZA 2ZRLA 3C8UA 5E95A 1U90A 3LXRA 1YZQA 3PUVA 4Q9IA 1Q3HA 4M1TA 1PLKA 2R44A 2JLYA 1YHNA 2HXSA 3WBJA 2NZJA 1G3QA 3WMGA 4MYHA 2WJIA 4DVGA 5IHPA 2V4ZA 2ZRMA 2QNRA 2HEIA 1CKEA 3TVTA 2CLDX 2ZE8A 1DAKA 3K70C 3RRZA 2IW3A 4HAUA 5CK4A 5AUNB 4RFSA 1S0UA 4URWR 2V54A 5BYKA 4CEHB 1IONA 1ZMXA 1FQJA 1OXXK 2RHMA 3B7GA 1DARA 5L3SB 1O87A 2CHVA 5TY0A 1D8TA 1BMFD 1VG8A 2BHRA 3QEJA 3GLGA 1FNMA 1PUIA 3BFVA 2JLQA 2DFKB 3QE0A 1SHKA 2CE2X 1NVWQ 4P32A 4TLBA 1YE8A 2I4IA 4Q66C 3QQ5A 4M0LA 1XMSA 3LV8A 4RFVA 3BB3A 1JQLB 2X2EA 1RIFA 5L3SA 4DIDA 2WM9B 4GBMA 2NO7A 1N0UA 2IBMA 1GG2A 3NBYC 1U8ZA 1GTVA 4G0NA 4A0FA 4BFXA 4OQFA 4BQSA 3RS2A 4NCHA 1Y63A 1TF7A 1Z0IA 1FMLA 4D80A 4TMKA 1XDBA 3B1ZA 4JVNA 3WP1B 2FF7A 1NKSA 4A82A 4OQNA 5FTKA 1OH8A 4QBHA 4B75A 5L3QB 2BVNA 5CDFE 1ZAKA 1A2BA 5BYJA 3BB1A 4XTCS 4LHWA 1J8MF 3EZ7A 3S1AA 2W6JD 1ODFA 1CTQA 3EA0A 4M1SA 1VMAA 3QIAA 4QJ3A 1XTQA 2KSQA 2FG5A 5BN4A 3ZGXA 3K9GA 3D3QA 3L0IB 4Z8XA 1E0AA 3RS0A 1GOTA 1IHUA 1TPZA 3A1VA 2RGBA 5CDFA 2W83A 3NBZC 5FBRB 1A82A 2FFAA 2J5XA 3MGCA 2GCPA 1DELA 3ZYCA 2EWVA 3DVLA 2Z0MA 3PEUA 1JPJA 4Q7MB 3CPEA 1JBKA 3W5JA 1U99A 1MT0A 1F2UB 3B1VA 4LK2A 5AJXA 4OHZA 5JEEA 5EZ6B 4A4DA 2O0KA 2G88A 2ZI5A 1AQYA 4ACAA 3RS5A 4MUAA 1G7SA 2NMVA 2J7KA 3WNDA 3W3ZB 4DWJA 2VSXA 2N42A 3MUFA 3RS4A 2NO1A 1G5TA 1UADA 4MQBA 1WBBA 3EZFA 2PJRA 3AVVA 3ICEA 2P5TB 2ZE5A 5KDLA 3LW7A 2ZYWX 3MCAA 1FTNA 1I2DA 1II8A 1KI6B 1PLLA 2OFXA 3QPUA 4HLCA 4IDQA 4LJYA 1DE0A 1ZM9A 3NVAA 4RD4A 4F93B 3A6PC 4OQXA 1XEWX 3KJGA 4LJAA 1XEXB 1OV4A 3AVUA 5EXTA 5J5CA 4TLEA 2ZJ5A 1ZCAA 3K09A 1YZKA 4PO1A 1ZUHA 2ODEA 1GVNB 2WVJA 4MRSA 1G19A 3A4NA 4B3CA 3U3RA 1GL7A 2WAXA 1UAAA 3CNLA 1H65A 1UKYA 3VNVA 3BORA 2XZOA 1BYUA 2IS1A 1RJ9A 3FOZA 2JASA 4PC3A 1E2PA 4MDFA 3QKSB 1DOAA 2PT7A 4V03A 4XWOA 2ZJBA 1FPMA 2UZIR 2W6ID 4UXJA 1NJFA 2AX4A 4DLVA 3R9IA 4BZQA 4YMTA 1F2TA 1E0JA 4NYMR 1T9HA 2NIPA 1AJEA 4W5JA 1YZTA 1GM5A 1UEJA 1DVRA 4BECA 1TU3A 4F91B 3ZQJA 1OB2A 1W5SA 5JWRA 2WICA 1N5KA 3FTQA 5EE0A 4FMDB 2ZRNA 1YJ5A 1I2MA 1G8PA 5CIWA 3BJIC 1WBDA 4LJ5A 1E9CA 1K6MA 1KKLA 4GZMA 3AF1A 3EX7C 1FP6A 1TF2A 3T1OA 2XTNA 2A5GA 4R9UC 5JS8A 4JLDA 3W90A 1Z0AA 5AJWA 5JLJA 3L0PA 2X77A 1R5BA 4M1MA 1KKMA 3C14C 4D4MA 3Q85A 3OHMA 4Q4AA 1EFRA 5FFMA 1G3RA 4TMTA 1HTWA 4H9GA 3T1VA 4CF7A 5J4YA 4AKGA 1XD2B 5HCIA 3A58B 4TL6A 2PMDA 5DYGA 1XJ0A 5EE3A 2KBFA 3CONA 5CB6A 3LBHA 2IYLD 3GD7A 2P65A 1HV8A 2YZ2A 2IEYA 3R8FA 4OHVA 2ANCA 2RB4A 1IN8A 2FSFA 2ZS8A 3TGPA 3SFZA 1HT1E 5G53C 4HEJA 4FWTA 4JYBA 4KSCA 3SR0A 4MUBA 1KK2A 4ARZB 3IEUA 4US0R 3GLHB 1P62B 3J81k 1T6NA 1DAHA 1JXOA 4Q4JA 4QJ5A 4S35A 3LO5A 3R7WA 4I1SA 2OM2A 5H70A 1RFLA 4BEJA 2KWIA 4GOKA 3RRYA 2W2TA 2Q9CA 2Q3HA 3I8XA 3VU9A 3TUZC 2DWOA 4ZDKA 2VSFA 1BO6A 3TLXA 5JCPA 3T35A 1VIYA 2IEZA 3DKPA 3BH6A 4Q1FA 4IVRA 1QF9A 4D4KA 5TVKA 5FOXA 1HYQA 2ZRHA 3B9QA 3KB1A 2OCAA 1P9RA 1XTSA 1OH5A 1E9EA 2FV8A 5BXQC 1P3JA 3FKSA 4FWIB 4A8JB 1G3UA 1ZRHA 1KI1A 2C78A 3CX7A 4WIAA 5KPJA 5B30A 4URXR 4Q7KA 4TMXA 4TLAA 3QXXA 4KBGA 1E1QA 3SU8A 2G3YA 3THWA 1NI3A 4B47A 2ODBA 2VP9A 1AA9A 2IYTA 4LJ8A 4P31A 5D3MB 1YR8A 4QNMA 4B3BA 3CB4A 3MSXA 2EWWA 3KQLA 1FTSA 5LD2B 3C41J 1EX7A 1FFHA 2J59A 2ATVA 2CE7A 3B1YA 4LUCA 3IHWA 2QPTA 2J0UB 3L0SA 3SJAA 3ZIAD 5KSYA 3W8NA 2JLVA 4DLTA 4C30A 3AVPA 4OK5A 3QXJA 1U0JA 1GILA 4LHZA 3BD9A 1DTSA 4YC7A 4BFTA 3V9PA 4W7SA 1KY2A 3GLIB 3KJEA 2D7CA 3LLUA 2XSZD 4DSNA 3SYKA 5AUQA 4MRRA 3T06B 2GZAA 4PFSA 5FOUA 4JLAA 5SZIA 4EFLA 1QDEA 4BFZA 1VKJA 3QI2A 3PEVA 4DZZA 4JZKA 2YV5A 3IPXA 1NVVQ 4NCNA 5A0FA 5TXGA 2WJYA 3SZRA 1JJVA 2BKEA 4P0TA 2QTVB 1MR3F 5DISB 2OCBA 1RVDA 3LLMA 2B8WA 2O52A 1NJGA 1U8YA 1RW4A 2JJ8A 4DLWA 2F1IA 1H8EA 3P26A 3SC3A 1G8HA 4A0HA 2VQSA 4B74A 3AUXA 3FKQA 3C7KA 2O8FB 1E94E 1AS0A 1U94A 3QKTA 121PA 2P67A 3C5HA 4F4CA 1X1RA 2IC5A 1I4LD 3IKJA 3K0AB 1OT3A 1HA3A 2VTKA 4LPSA 5CJ2A 3HR8A 4QBIA 5E3HA 4NU0A 3QPVA 4BE7B 1Z22A 3W6PA 4DB2A 3DHWC 1ELOA 4PAOA 1XPRA 1NF3A 1S3GA 1S96A 4D25A 2EFDB 4KU4A 5FUYA 4Q03A 4DLYA 1TMKA 4RCYA 3TW8B 4O2RA 5GJWC 1JR3A 3UANA 1C1YA 4HZUA 2CK3A 3H0KA 4B44A 3DL0A 5DLQC 3IIJA 3OFND 2QORA 4CW7A 3AVQA 4E07A 4C2TA 2VHTA 1TNDA 2XSZA 4DLUA 2YHSA 2XB2A 4DSOA 2GZDA 2UVQA 1KDOA 3SEAA 5FR1A 4A9AA 3R7WB 1ZM3A 1JR6A 2QM7A 2GWHA 2ZRPA 2ZTSA 4KLZA 3U7HB 4II7A 1EWQA 4V0MA 3SJBA 4BWYA 3A1WA 1UBFA 2QTHA 1W46A 3BFXA 1M7BA 3FMFA 4BFVA 3TKLA 4HATA 3E2IA 1F6BA 1HE1C 1B0UA 2Q21A 2GAAA 2QEQA 4XWKA 3UIEA 4C7OB 2ZE6A 4C3ZA 1N6RA 1IN5A 2IHBA 2ONKA 1DBSA 1KI6A 4UNRA 1R8QA 5B2ZA 2XZPA 4Z8YA 3NBFA 3RRMA 5CM8B 1EFUA 1XWIA 2B7BA 2ANBA 3PENA 2WJVA 1IXSB 2J45A 4BEBA 2VHUA 4CEJB 1IXZA 3PCRB 2OLJA 1G5RA 5KHOC 3P1JA 1GSIA 3ZZTA 3IIMA 3BS4A 2RGNC 4B34A 2ATXA 1PUJA 3VR3A 3OFNA 3U2QA 4WW0A 1S9DA 1HQYE 2FFBA 3LDAA 3GLGE 4C4PA 3RS3A 2OCPA 2XJ4A 2QAJA 1TAGA 5EP3A 1G8YA 2J0UA 1P75A 3GLIE 4RKFA 3AH8A 1ZUIA 2F1RA 4JLMA 4EUNA 2HXYA 2V1UA 2O0JA 1G4UR 2NPIA 1G41A 3ND8A 4KFSA 3PV0A 4DSUA 3CF6R 2WKQA 2EFEB 1W49A 4Q00A 4QHSA 2IF2A 5SZJA 1W7AA 4YXWA 1NY5A 5DN6D 3U44A 2CVHA 1XD8A 2IS6A 3EPKA 2HYIC 4PPNA 5DSZA 1UDWA 2HCBA 3FB4A 1A4RA 3WXMA 1OFTA 1ZNWA 1KK3A 2YOHA 3TSOA 1FMJA 2W00A 1ZNYA 2QL6A 2ZS7A 1J99A 3KXLA 4LYFA 4TL7A 5FTJA 2O8CB 5JJLA 2ORVA 3QF7A 4TN1A 3BFKA 2A5YB 1EX6A 2QRZA 3SE0A 3TR0A 3WYFA 4MKHA 3NC0C 4V0OA 1QRAA 4GZLA 3U6BA 1XRJA 2GK6A 2ZE7A 4OI2A 2PX3A 2ZS9A 1CEEA 3LH5A 4A2QA 1E9BA 3LNCA 4ZI3A 1FZQA 1G4AE 1P72A 1QHXA 3AQ4A 3EZ9A 4FMCB 4TL9A 2JGNA 2ZAOA 2ECKA 2GEVA 3FWYA 3K0EA 4PAQA 5JECA 1US8A 1NN5A 4KVAA 4F38A 1CR0A 1FUKA 5DHAA 2IS2A 4JBYA 721PA 1WRBA 2IYYA 1P2SA 2J1LA 1Q3TA 5EP1A 5L8VA 3HDTA 3AP1A 2C98A 4QHTA 4DB4A 1ESMA 4YDSA 2ZJ8A 3K0CC 4Q1EA 1N6LA 4GL2A 3OEEA 2FPMA 1W36B 4DCSA 3E70C 1T4GA 3ZLJA 2N1BA 3OEED 4M22A 2FN4A 5L3VA 4XH9B 3EIQA 2J7PD 1WF3A 1YKSA 2OBNA 2A7QA 1A5TA 3BAFA 1KJZA 5B57C 1L8QA 3IUYA 4TTPA 3N5CA 1SHZA 2A3RA 1NVXQ 4JVSB 4KBFA 3TW4A 2NPFA 2JJ1D 3REFA 1AKYA 1DEKA 1J70A 3EPJA 2WIAA 4P4UA 3K1JA 4HDQB 1G5PA 1KDPA 4FMCF 4YLGA 4LJ6A 3VR5A 2CJWA 2OE2A 2ZI3A 4ZIRB 2EVWX 2GBLC 2CXXA 2QMHA 2WPDD 1Q21A 1GL6A 2WJGA 2Z4RA 3GJ6A 1NMYA 2GXSA 2WAYA 3OEHA 4G1UC 5IT5A 1F60A 4PZYA 3O47A 2IYUA 2W58A 4RD1A 1R0WA 3AF0A 3UWKA 1V5WA 3KKMA 4M9SA 2JDIA 3GP8A 1VG1A 1OYWA 2BEJA 5J47A 1E0SA 2QQEA 2ZYVX 4M1KA 4MKIA 5KDDA 3K9NA 4PXAA 1D2EA 4Z54A 1VDZA 2BMFA 1T0JB 1QHHA 1YR6A 3KL4A 2OO7A 2ORIA 3NC1C 1KYIA 1HE8B 4ZCMA 1CF4A 3HYTA 4A1FA 4R2IA 1E2FA 3EWSA 1W0JA 1U0LA 4PO8A 1P73A 1X8JA 1Z0FA 1SKYE 4M1YA 2VBCA 1WXQA 2ZAMA 4V0NA 3Q7PA 1WP9A 4D4LA 5FUWA 2WWFA 4D0LB 4L5BA 3WYGA 3BH0A 4RD2A 4EPTA 2RKOA 3NH9A 1KSGA 2AK3A 3AEZA 2MMGA 4XTRA 3ZJYA 5B64A 2XXAA 1KTVA 1ZU4A 4ZDWA 4HAVA 1E3MA 2HV8A 4LWZA 5KSOA 1E0KA 1NVUQ 1N6IA 1X6VA 3E5HA 5J4VA 1XCMA 4P4TA 4QRHA 3GLFA 2QUZA 4KFTA 4LY6A 4IFEA 5CLLA 1Q1QA 2C9CA 3MRSA 4OBEA 5HZHA 4KAXA 1NN0A 2NTYC 3AVWA 4Z1MD 1G9XA 1Z83A 4NE2A 1RZ3A 1II8B 1NBME 3W9YA 2WKPA 4ZI2A 2XXAB 4HDCA 2ZITA 4DEYA 1YRAA 3KUCA 4UQOA 1E2IA 5AUOB 3ND9A 4KYUA 1KSJA 2NQ2C 3EG5A 1LVGA 1Q1EA 1ZM4A 2R2AA 4WXPA 4WA7A 1BH2A 4Q1BA 2A5DA 3SBDA 4PHFA 4CYMA 3I3SR 1OFHA 3LFUA 4FINA 4TTRA 1W36C 5KU1A 4UJ5A 3KQUA 3EAQA 3I4LA 5FBWB 1AIPA 2A30A 5J40A 2IWRA 1RJ9B 3KKNA 1XXHB 1XTKA 4CVNA 1OH7A 2GXAA 5LPNA 4EPYA 2NO0A 5FOVA 4JKYA 4DSTA 3PXGA 2HLDA 3REGA 1EFHA 1NIJA 4BLQA 3ASYA 4NHOA 4QNRA 5DH9A 4HI0E 2JJ1A 4LI0A 4O2LA 2G1KA 3BK7A 3GEEA 1G291 3DDCA 2XNDA 2XZLA 4FCVA 2EQBA 4B3XA 3DEFA 1EFRD 2IK8A 4G5QA 3LA6A 5FL3A 3ZD6A 1CXZA 1K5GA 2VO1A 5DI3B 4C0BA 1BMFA 4QJ4A 2FZ4A 3U4QA 2O8DB 1XJCA 4P4SA 4UNSA 1E2HA 1GWNA 1OXUA 4JLNA 2ZYUX 4NKRA 5AWFC 2VP0A 1E9FA 3KX2A 2FWRA 4Q4AB 4QM6A 4TYPA 4HAYA 3ZDQA 3QNUA 4HB2A 4P3YA 4NYMQ 1NN3A 1G3IA 1ZD1A 2H5EA 1BIFA 1SVLA 4ZKDA 3TSWA 1GNQA 2GNOA 4EKDA 2O8EA 4B3GA 2BMEA 4URVR 1ZBDA 3TIFA 4PHHA 4K46A 2C77A 4AG6A 2YVUA 4B48A 4P4SB 4RVCA 4RZ2A 1YR7A 4XVQA 4L16A 4XSGA 2OSBA 3P20A 3LW8A 3LX8A 1OHHA 1CJMA 2R65A 3PVSA 4LHXA 2VPPA 2AKAB 2NO6A 4IJMA 4V0LA 4B43A 2F9MA 2OAQ1 1XMIA 2V1XA 2PT5A 5LB2A 1KO5A 2ZUCA 2LKDA 2OAP1 2O8EB 2FGKA 3SYLA 4Y0VA 4ASUD 3L0OA 4FMBB 4ERNA 4G5GA 5GADl 3ETLA 1NSFA 2I1QA 4ABYA 3ZZ0A 1KGDA 3KFXA 2CHQA 2TMKA 1W0KA 3UWOA 1N5IA 2AXPA 5UKDA 3U61B 1E2GA 1A7JA 4A8JC 2ZETA 1XZPA 4EFNA 3HWSA 2ZJYA 4KSBA 4TT3A 3T15A 3MD0A 2RGEA 2IUTA 4KFRA 4RD0A 4N3NA 1KOFA 2H7VA 1D5CA 1NL3A 2HJVA 4G3XA 1IJFA 3HPQA 3QBVA 3SYNA 3AP3A 4EJSB 1KI7A 3VX4A 1G18A 3QVVA 3H86A 1J8YF 4F92B 4AI6A 1DAEA 4HAWA 2O5VA 4QG7A 3U3JA
chains in the Genus database with same CATH superfamily
3DZ8A 4R1NA 4TKUA 4JUCA 2NSHA 3HP1A 3V4RA 1JALA 5F1OA 2Q49A 3G7UA 4D6PA 1FLVA 4DXAA 3EAGA 1Y1KE 4UHDA 1AO0A 4I36A 4DXDA 1INLA 2B8TA 2W2XA 3DCYA 1NW4A 3LVQE 2J9YB 4KTVE 4E15A 1PZFA 2G5PA 4YQFA 5A0TA 2H6EA 3MRTA 5AM4A 3DMRA 2YH2A 1PQWA 1GPJA 4KQ6A 5B37A 4GVXA 3F9IA 4FR5A 4JFAA 1CP2A 4QXQA 2VJCA 5DLDA 5JFGA 2LR0A 2Q0SA 1XVAA 4M46A 3ZEAA 2XQKA 2XKAA 1ATZA 3IUMA 2XPCA 3NBAA 3PI7A 2ZFUA 4M9RA 3T41A 4K6FA 2GM5A 4MDYA 5T6BA 3VTZA 4EP1A 5ICCA 1ZW6A 3GRYA 4WCFB 1FX0A 3W8FA 4B8YA 3CVVA 2R3SA 1JVBA 3H8JA 2GILA 1U98A 4L28A 2FZVA 2JGIA 4NFHA 1BJRE 4O4JB 1Z5UA 1U0SY 3UTDA 2ZUUA 4AJLA 5MFZA 3ZS9A 4ENVA 3IURA 3GAAA 4WKNA 1IEQA 5EL0A 3JQAB 4YV2A 2REQA 3BH7A 3UAYA 4F4JA 5DBFA 4X97A 4KXWA 4QKQA 2YWEA 3E35A 4RZUA 2NXNA 2D6FA 1EHCA 2EKLA 4FOTA 4IOKA 1ZKMA 2FMIA 5AJYA 1UDBA 1RQLA 3LHKA 1YE5A 4RDXA 2P2SA 4X91A 2PKQP 2I6XA 3TMYA 2B92A 3IC5A 2BTEA 3D4NA 4JJKA 3USZA 3ZY4A 4RESA 5FWAA 3INGA 4IHQA 4GRDA 3BULA 3IPRA 5FF9A 1OIWA 3LQRA 3VHXA 3IAS1 1EGAA 1SOMA 4LZLA 4PSUA 6PFKA 2IHYA 2GJ9A 4LVUA 3QOYA 1PJ2A 1XDDA 2CCKA 1U0FA 2WJHA 3GRUA 2EV9A 4FS3A 3V7YA 3WHKA 1UJ5A 4C0QC 2UZ3A 1KC1A 3MNFA 4LDPA 1JHOA 3QOFA 1NZDA 5E1BA 1NBHA 4Q9LA 3QIVA 1IAVA 5THXA 1JG2A 2HPVA 3F71A 5H16A 3A3PA 4QVIA 2O3SA 4X90A 5KNCH 3DMTC 1OSNA 4X44A 2ZU6A 4IUBS 3IQGX 3W04A 4BNJA 4UKDA 5CYPA 2VYFA 4BB5A 5J2UF 4MIOA 2P6UA 4H7HA 5KQLA 4N49A 3KJNA 4BGUA 3VUFA 4PPFA 2Y3IA 1DG3A 5C0OE 3T54A 3P96A 4ESHA 5IF3A 5BWNA 3RU2A 2NUPB 4CUJA 2G82A 1OBFO 1H6AA 5BV2P 2DQSA 2EQ5A 2E21A 4HNGA 3AU9A 3FTCA 2ZP1A 3TLBA 4ZN6A 1JQJC 1C4KA 1NKTA 4NNOA 4YK7A 5FJIA 2ARKA 3IT2A 4LAFA 5BURA 2CVFA 1GAEO 1HQCA 1SKYB 1VPWA 5AW4A 9LDBA 1E5LA 3P9KA 3PG5A 2H9YA 4JUIA 2IWHA 3RG8A 3NBXX 1R4ZA 4LZNA 4PZ9A 4DJTA 1OGJA 3H7AA 4HGRA 4Q4LA 3LUGA 3T5AA 1KC3A 2JCVA 3TGLA 1MRZA 3OESA 2FZCA 3IRVA 4PX9A 3OIGA 3TKAA 5FAKA 5IT0A 1W52X 4FDMA 2L17A 3UUEA 3UCXA 2PZFA 3T1HB 1QRRA 3QLTA 3A6JA 1E1RA 4NBTA 3WZLA 4CMKA 3HGTA 4LY3A 1Z6AA 3EIEA 3U7RA 3CMCO 1T43A 3G8YA 3HU1A 4MI3A 1E98A 1XRQA 1PR0A 1U0GA 2AJTA 3COZA 4LXYA 1FDRA 4QBTA 4PLPA 1ECPA 2HUPA 4QODA 3T7DA 4NYIR 4EL5A 2WFMA 1HRDA 4CL3A 2I6TA 2GTHA 3HRKA 4IHJB 1E4YA 2O7VA 4CBVA 4Y9UA 5KWSA 4F56A 1Y8RB 1FS6A 1K5DA 1T8PA 2WV7A 1JDNA 2CXQA 5E9WA 2ADOA 3D7LA 2WUEA 3FYUC 1IXRC 3A8TA 3ESCA 3C48A 3THWB 4P7BA 1P60A 2AOUB 2FKAA 5J4KA 1J0XO 2LTAA 4KKXB 4HDMB 4XJXA 3O8NA 4ZZIA 1I2CA 3ANNA 3BJZA 4Y9SA 2ZRKA 4FKZA 3UG7A 2WHQA 1MAWA 4A8JA 5AVOA 1IBMB 3L93A 1JIQA 2DJ5A 2BWJA 2O2ZA 1KK1A 5KWEA 3O9VA 3OPYA 3O0TA 4OXRA 4FNAA 3X1KA 1QK5A 2JARA 1HMYA 2P7HA 3O95A 4LCEA 4M0MA 3HI6A 3I9LA 2I91A 2YIDA 1ZD9A 2Z6VA 4GQAA 5IKXA 2PPLA 2JBWA 3QVUA 5LDGA 1JG1A 3ROEA 2RJ3A 4ALJA 4OHYA 1LFAA 4HXGA 4WOKA 5E6SA 1TPYA 3ENZA 4HBGA 4QYTA 3DHVA 3VPFA 5CYGA 3TEMA 3LKVA 2CVQA 5JS2A 5IJ0B 5FT9A 3AFGA 4S1TA 4F5DA 4N9QA 5E38A 5KYVA 3LYAA 2PL1A 4Z6KA 1Y8AA 4XX1A 4OAQA 4QHYA 1JEQA 4XLZA 4G0YA 3N8DA 3C6ZA 3ASUA 2XVAA 3OU7A 3EWNA 2A5JA 2ECFA 2KLBA 1O4WA 1SQFA 4Q48A 3S40A 1LNZA 1TYEB 2FPXA 2D54A 3WS7A 4ZU6X 2RI6A 3D7SA 3GJ5A 4YWHA 2WMNB 1NHWA 2G1UA 4OA5A 4QYWA 2JIQA 5LQJA 1YQ9A 3FCEA 1JHUA 2CFOA 4KYTA 1IYZA 2BEWB 2OMEA 2WE7A 1TCCA 3PFIA 3ZWDA 3AFMA 4FM9A 4OM7A 2BTQA 3JQ7A 3ABQB 2BHLA 3WGTA 1EWRA 4IL5A 1MIHA 2JIRA 3GPCA 3AG5A 4XPZA 1QJ4A 2R85A 2V3WA 2C97A 1AN9A 1VYTA 3PFWO 2VTBA 2JFQA 5H0IA 1PJ8A 2X7JA 3NWJA 1IOZA 4PZPA 1MO5A 1VBKA 3HBFA 3PXAA 3G1UA 4B7AA 2DRIA 1CNMA 4E0BA 2XGMA 4J9UE 3W5SA 5KVSA 3FUXA 3F8SA 2HHCA 2A1UA 4HAZA 5CJPA 1M1NA 1FP2A 3AYXB 1SIWA 3EWAA 3GJZA 4BY9E 4KNYA 3WAJA 1KH1A 1Q0RA 2H0RA 2Z43A 1ZN9A 2QTGA 3PGVA 5AR1A 2NM0A 5CLQA 4CM1A 4RIFA 5IULC 5KYYB 4TMYA 3PC3A 5FPYA 5J63A 3RSQA 3VHLB 2Q5QA 3SZGA 1VM6A 4ZYLA 1BW9A 3OE7D 1FXWA 2YC2C 1NW6A 4A73A 4GBJA 3NG1A 3JQRA 3W4IA 1CR1A 2IJGX 1DC3A 4FE3A 3ECSA 3ZVKA 4RHEA 2JFVA 1L5RA 1JSXA 5CIQA 1JDSA 4FX5A 4CLDA 1CQWA 2OO5A 2FFHA 2EERA 3AGQA 2FK7A 4JXZA 2BCJQ 2AFIE 5GWXA 1CS4C 3JRNA 3WGVA 4LSMA 1XMQB 1G8JA 3SJCA 1XP5A 4GP7A 2ASEA 4I08A 4HS4A 5CBPA 4CG2A 4PZLA 3KWFA 4ARZA 4TKVA 2G07A 4TQGA 1KYZA 3NJ4A 1TJ3A 3M1AA 3HWWA 4H7DA 5IWCA 1MNAA 4H0FA 3ZV5A 5LNK6 4M1OA 3T7IA 3WA7A 3C3AA 1Z4IA 3RU9A 3JZDA 3AJ9A 6LDHA 2WD8A 2Z57A 1M73E 2YJZA 4HGQA 3JTEA 1M8PA 1Z33A 1I8TA 1E4VA 2WF8A 3B1FA 2OMKA 4Q15A 5ER9A 5L53A 1SZDA 1TQ2A 2FSVC 3D1JA 2WUVA 4DV1B 3HGQA 3L1UA 4ECAA 1X15A 3UJPA 4D46A 5C52B 1JP7A 2F43B 1G4HA 1GZDA 2O20A 4NDZA 1EXNA 5HGJA 5KX5B 3DDHA 3BIFA 2KBEA 2QX4A 4TGLA 4B35A 2HREA 1E2MA 1LVHA 1B8PA 1O9BA 3B5IA 1K3UB 1VLMA 3AETA 3GRRA 4V39A 4EO7A 5IVHA 3FMOB 4WAUA 4D4GA 4BNIA 1IN4A 4Y6OA 1FFAA 3IQIX 5HA5A 1O97D 1R5JA 1I3NA 4C0HA 1SCUA 1O5TA 4R8LA 3LC0A 5FCDA 5CCXA 3U3MA 3V5NA 3I73A 3Q9SA 5K45A 2GAOA 1IG0A 4GI1A 5CGQB 4N41A 5CURA 1EK6A 3GNSA 3ROGA 4LNUA 3RUAA 2Q07A 4WN9A 3V8MA 3KQKA 2OWDA 4B76A 1YQGA 2RGAA 4N1AA 2XTMA 4FHDA 1FW6A 1WW8A 1DC6A 1Y80A 4CEIB 5LQUA 1P18A 2QG6A 4U00A 3U44B 1X87A 3IEMA 4C3VA 4G1EB 4AO8A 3CU5A 3RO7A 2W6IA 2ESRA 5IBQA 2QTCA 1KXJA 1CZOA 3M6AA 5LFAA 3QE2A 3SLKA 4QU0A 3P2YA 2W71A 2AN5A 2FN3A 2VPYA 5KVAA 2B4RO 4CTOA 2PMCA 1NOJA 1Z8FA 1IWPB 4IEFB 2NAPA 2FY8A 4NPHA 1GARA 3W2IA 3ZS8A 5B2EA 1XMJA 1NW5A 3I5UA 2H07A 4DM4A 2PWPA 1MX1A 4J4HA 3WWPA 1Z07A 1RKXA 3HXKA 1C14A 2X9GA 4Q21A 4QYXA 4X93A 3QBJA 5DRTA 5JDIA 1WSAA 1WDTA 4YWJA 2HRRA 2P2LA 2PQ6A 5FLKA 2QROA 1RYMA 3C4JA 5LIPA 3AF3A 2QT9A 3E18A 3KHSA 4MQEB 3H9BA 5B5SA 2NO4A 1I80A 3KYJB 2PZGA 3UA4A 4A0QA 1Z2CA 1KJ9A 1LJLA 2ECPA 3KU4A 5A7HA 4PCVA 4YCJA 4CN8A 1TOAA 1JQ5A 1KI9A 4KDFA 4EQ6A 1LSJA 2DBRA 1B0PA 2A92A 1FYWA 3HNRA 4H1UA 4W1SA 5DEIA 4M83A 2NUTA 1RWPA 2TYSB 3T34A 3B53X 4LEIA 5F2EA 3ADKA 4MMYB 3IP6A 4BZPA 2AFIB 4L8GA 3TK1A 3R6GA 2IBSA 1Q0PA 3GU3A 5HTKA 4RH3A 2QRLA 2Q1YA 3SBOA 2ZDGA 4BB6A 4FDVA 2F55A 1TCAA 4EQ6B 2WT8A 4PRLA 1ZMTA 2R84A 2MCFA 4AMGA 1GIAA 2XGGA 2YV1A 3GLSA 2PQMA 3AF6A 1T0BA 2VBIA 3DBHA 3H05A 3IL2A 3WNZA 1GZ4A 5TLSA 5IBPA 3O6VA 4PTLA 1E8DA 2B0JA 2DEUA 1SXHA 3ZE2B 2QM3A 4IXMA 2YNMA 2I2AA 2PMBA 3PX7A 2REOA 2DXIA 4KUEA 4RETA 2I2DA 4AUEA 4IDCA 2CVPA 4O3MA 3MMZA 1YQTA 2DR3A 2BFPA 3GOHA 4W8HA 4DA9A 4OB6A 1Y3AA 2C7RA 3IEVA 1TQ8A 3LUAA 2C2WA 2P9BA 5ER6A 1HTTA 1QHNA 3FTDA 1IUKA 2YVQA 1MH1A 1V8FA 5AM2A 4EMTA 3Q9LA 2BGIA 2HGSA 5DNYB 1XNJA 1NG1A 5TNXA 5KJ6A 4AKIA 3C6XA 4K9NA 1GUZA 1IAQA 4XGRA 5DFAA 4WV3A 1SIOA 3QJ5A 1SBQA 2EP8A 4B2LA 1Y6RA 1T5LA 2CMDA 3BSWA 4JNCA 5ALXA 2FSHA 3F6YA 3ME5A 2WF7A 3HJHA 2X22A 1N25A 3B6MA 2C8LA 1VFPA 1RQPA 3UKDA 4HDMA 2WTMA 4C01A 1I4DD 5GJCA 2ZPAA 4FGZA 3BWXA 2ZJOA 4ENQA 3WLJA 4PYJA 4KR0A 2EEZA 1YS9A 3T61A 1P4RA 4XLLA 1V71A 4ICIA 2DTEA 1YFJA 3HCFA 4YAIA 1J0DA 4FHEA 4H60A 4NOMA 4QX6A 4YRIA 2FSSA 2IS4A 4IV0A 3WB1A 1KGSA 2QYOA 4JXKA 3AR9A 1I13A 1ECFA 2HRCA 1HY3A 3DOIA 1JBEA 4L51A 1P7ZA 4HDKB 1KAGA 1L4HA 1QK4A 1SXJC 2Q8QA 3NU1A 1R8SA 3TM5A 5AJZA 1WU7A 4KTTE 4Z7JA 9GPBA 4M2LA 4K8OA 2Q9BA 5IW8A 1GTL1 3TAHA 4UHFA 2SCUB 3DBRA 5CVDA 5FTNA 3GLHE 4EW3A 1GITA 1KMQA 3BF7A 2HFKA 1YD7A 4XD7A 2UYQA 4JNKA 4XOIA 3S8YA 3J7AC 1Z36A 3PICA 1GQOA 2BJVA 4C4SA 4DV3B 3I92A 3WSTA 2ZPUA 1TA9A 621PA 2AB0A 4JS0A 3CLTD 4WZAB 1OFGA 4V0ME 4LGVA 1JZQA 4MVJI 2JGRA 1GYRA 1E6CA 3HKDB 4MIYA 4D82A 1U8FO 4GZ3A 3VZCA 2DBZA 1OIVA 2Z2KA 3P2OA 4BQOA 3NFRA 2X6RA 5F4BA 2Q5JA 2QRVA 5JASA 4KVFA 2CL7X 4CUZA 1QB7A 1Y3HA 5IAEA 3DXFA 2QTWB 4G4SP 4KLNA 2E7ZA 1WABA 5GGYA 4Z2AA 1CJSA 3NDBB 3TN7A 4NBLA 4EMUA 4U02A 3RGWS 3WKEA 1IQ0A 3PUJA 1PGQA 1L5HA 2WJ3A 5DK6A 1F51E 3U39A 1POXA 2JH3A 5IVPA 4XUDA 1QR6A 1E3WA 1XCGB 1YZVA 4F60A 5KO2A 4DLLA 5FI0B 1FLAA 3R9XA 2PZAA 3EFHA 1E7RA 3PQCA 4DCMA 2QAGC 1R0KA 4CNQA 3DA8A 2B83A 1AUXA 5LZ8A 4N39A 3WGMA 5KYYA 5KZMB 1LWNA 4GEGA 1KVTA 3TTSA 4QSHA 3ZHQA 1XEXA 1G5FA 4KEAA 3W06A 4BGIA 4HFMA 3NW9A 3RSSA 3L7CA 4DNOA 3E81A 4GOLD 3RADC 2RGUA 2P6OA 1DX4A 4RS4A 1NVFA 1QPGA 4DBZA 2BFOA 3HCRA 4OMUA 2QWXA 4TWBA 1SO8A 4URZR 3PUWA 4O3FA 1L5SA 2G76A 3G2KA 3LT4A 4LWQA 4PC7A 4ZCSA 2HPAA 3Q3CA 4KXFB 2DFVA 2OC4A 3LIPA 2VQFB 1SXJD 4AXBA 5ADVA 2C9MA 1JMKC 2XWJI 3AILA 4MX8A 1Y7TA 1QWOA 4YNBA 3N76A 4N3GA 4Q16A 1JMYA 1V4BA 2WIBA 4R8VA 2C92A 2YXLA 1Y7LA 2W9XA 4IHAA 3SC2B 3SBEA 3X2EA 1JH9A 4V1CB 4FI3C 5ALEA 3OZRA 4QEDA 4DLNA 4G8BA 3SZOA 3H2GA 5K3DA 1V2GA 5CJJA 4F1WA 2G77B 3OJOA 5DLPA 5SZHB 3S2SA 1P1JA 3G8AA 3U4QB 1ZC3A 1UT6A 4EG0A 2XAAA 2PKQO 1UZUA 1W94A 3DMHA 3BGVA 4HJXA 1DSSG 1H85A 3GUZA 4DM7A 2I7VA 1BKDR 5IKPA 1U3TA 3OU6A 4B2YA 3R0IA 1N3BA 3X3HA 3WNVA 2A9OA 1CP3A 3ZI7A 2OCGA 4RGQA 3R3WA 1E79A 4YUVA 4M0PA 4JI3B 3QPDA 1JE0A 3PHBE 5LNK1 3CUVA 2F3TA 2BKXA 4I9NA 3SZ3A 4K6OA 2BN4A 3AOGA 1Q7CA 2A0YA 1MABA 2M1ZA 4X00A 4CIDA 4N54A 4UXHA 3VSAA 5LZ2A 1X7DA 5IXJA 1Z06A 1SR8A 3VJLA 1MUUA 3DT8A 1TA0A 2H7YA 3Q2IA 2UXBB 4Y2JA 1FMCA 3H5LA 4M9CA 3DMDA 3SSAA 3ODGA 3PUXA 3LT5A 1ACLA 3NFYA 3RUFA 3KZVA 2GF2A 2EJBA 2W6JA 4G0ZA 8ATCA 5JPIA 4OOFA 3SXUA 3H84A 3EGIA 5KYNA 4UASA 4ZHQF 3CVWA 1T0HB 4FQ5A 1CY1A 2C0QA 3X1YA 1UKAA 3KOXA 1V7ZA 2QSZA 3I0NA 3RUEA 4U4AA 2J9RA 2P79A 4C1BA 1IN6A 5LQRA 4AS2A 4J0FA 4D8XA 4M6WA 4L1KA 5AVKA 1DKPA 4O29A 5TMBA 3IUBA 4OH1A 2Y1DA 3RBZA 3T1QA 3MWEA 1E9DA 2IHVA 3FPGA 3R3SA 1J06A 4L7VA 3EXG1 4NG4A 3RVLA 4E3ZA 4FHFA 4JGGA 3ROTA 2XQJA 2PR2A 2N1MA 2ZWIA 4KL8S 4XXHA 2I4NA 3CTPA 3BJEA 1QHIA 2ZBEA 3ONDA 1KO7A 2FR1A 2Z6UA 5K4GA 1E2JA 4U1RA 1WZ2A 3LTNC 1FFYA 1KFBB 3MSCA 2WSBA 2Y92A 3GT0A 4N0MA 1M72A 3MTAA 4NJMB 1DFGA 3OQJA 1I7QB 3VSBA 2NU9B 3NHFA 4RD6A 2OLEA 4QOIA 3L6CA 4YT2A 5T4FA 1CRLA 4US1R 1T6YA 5JFTA 5JFOA 2BBTA 3GGPA 2HY7A 2QXUA 1NF2A 9ABPA 2ZEJA 1UK8A 2WUWE 3HB5X 3MELA 1IM2A 3B5JA 2LIPA 2YWBA 4HWSA 4OA8A 2DH5A 4O0MA 3AF4A 3TTUA 3RBXA 1PV4A 1TKBA 1X7YB 1XTRA 4DDTA 4JUBA 1A2KC 1HO3A 3CLVA 4D9EA 4ZFNA 1Y9EA 4LXQA 4TMZA 1RYHA 5HJ2A 1EDOA 3DEAA 1JUDA 3RV4A 3AR6A 3QTBA 3GIWA 3CCCA 4CM4B 4D43A 5TRTA 2G0NA 4BIMA 2OGZA 4JOQA 4LN1A 3P94A 3CGWA 4IP0A 1UFOA 1GNSA 1ULBA 3HHPA 3I6YA 3ICCA 4L4YA 2RCYA 5JNTA 2M2IA 3I30X 2QRNA 1P5JA 3VU0A 1ENYA 4NWIA 1XMOB 5KUTA 1NPDA 1JB1A 2ZJZA 3VZSA 1JEQB 1A2OA 3FCAA 3L7JA 3CF4G 1WW2A 3HYCA 3WNBA 1AMUA 4J2OA 3EPLA 2WUFA 3PC8C 1RRGA 4LV8B 1C9KA 2WWGA 3FPKA 3HDVA 1D6MA 3ZZNA 3SR4A 4D9MA 4L5JA 4Q3EA 3UOAB 2IYEA 4XOUA 1YF3A 2ZSAA 5E9QA 1EM8A 2OGWA 5DCYA 3UQZA 1DWOA 4JL6A 3UYKA 3NDRA 3T9BA 1UZAA 3FI0A 3UW3A 4CKBA 5EUCA 2VSYA 3ZI4A 2CD9A 3CLUD 3C2QA 1QH0A 2L18A 2EZTA 1HUQA 2E4ZA 1N3YA 5JATA 1AG9A 2P35A 3EZNA 1U02A 3SOPA 5K99A 4W5TA 3PQ5A 3EXHB 4QELA 4UUOA 4LF7B 2XCUA 1WSDA 2FEWB 5CCBA 4YX9A 1NW3A 1ORRA 2FU5C 4IV5A 2R87A 4HYYA 3OHPA 3TB4A 5C8DA 4YRCA 3EJWA 4YCCA 5BW8A 2UYGA 2B7LA 1OU4A 2C8KA 2JGAA 3BMNA 3PGJA 3QUSA 4AFNA 4HEA6 2ZTUA 1Y89A 3EXHC 4GC9A 2WD7A 3AFOA 2F3UA 3DFFA 3G5TA 3S44A 4RYLA 4BBZA 2CD7A 1G0NA 3DE2X 3EIHA 2GTIA 1JFLA 1KNXA 2BI8A 2QVLA 2YW9A 5F7ZA 4ENSA 3DT6A 4XUCA 2P7IA 3QVGB 1UP4A 3NHAA 2O1XA 1PEYA 1AGPA 2XTZA 5FIUA 3UA3A 3CJTA 3G8CA 2BSAA 2ZVJA 1Q0SA 4UNPA 3A2LA 3NOOA 3WB0A 3EASA 2VK2A 3BWYA 2X0NA 5DTJA 3VPBA 4EHKA 3AJDA 1KSHA 2WUDA 5P21A 1YFKA 3D8NA 2O2JA 1QVZA 1SMKA 1M6NA 3NHYA 3DEKA 2M9MA 2Q28A 4YJ3B 1I30A 1EVQA 1AK1A 1N2EA 2JKVA 1HI9A 2JHFA 3LPNA 5K20A 1P81A 3JQ8A 1J07A 3FLBA 3FZNA 3W5UA 4Q24A 4MWDA 1GNVA 4PICA 3N59A 4TKLA 3PR1A 2XMRA 3PJRA 5TQ0B 4JJZA 3V55A 1ACMA 4EJ0A 1FJGB 5J3JA 3EYWA 3OJ0A 4EFDA 1H69A 5IXSA 2IITA 4GGOA 4WUTA 1WNFA 5K0GA 3AM3A 5CX1B 4AZWA 3LOPA 4MO2A 4R7ZA 4S0XA 5E9JA 2ZR0A 2WOOA 2MJLA 4AF6A 5AI9A 2DR2A 3C4QA 4REOA 2LWIA 3I5XA 1MJGA 2UXCB 2HC9A 3FZYA 4BNLA 5TVGA 3EGDA 3PHIA 5KKAA 1YBHA 1F6WA 2R11A 3SIRA 1YT5A 1V4NA 1AZWA 2D62A 4LRUA 3ZOZA 2CJFA 3X2FA 2VHWA 3WMFA 5K0FA 1W4RA 1ARZA 4UHBA 1MQ8B 3DDNA 1PHPA 4AX4A 1P8JA 3X1XA 2WTEA 3V7FA 2BSQA 1F4VA 4FLEA 4A2WA 1R4NB 2Y68A 1JFSA 2EKDA 2XX3A 1X74A 3RFCA 3H18A 3QKSA 3QX8A 2GETA 3T5DA 1P9OA 5LM3A 3W5AA 1G3MA 4EG3A 1UC4B 5LD2C 3ES9A 2V03A 2R8XA 3VKWA 2V7TA 4MB0A 2ZIZA 5FPQA 4BCCA 4BUJA 5EWMB 4CF3A 4EYEA 3BRQA 1G9SA 4FJ0A 3SDBA 3C3KA 5AOBA 4EO9A 4R2HA 3ESBA 4TVSA 4GX2A 2J5QA 5TJHA 1KTIA 2NUAB 1NPTO 2GESA 3EDOA 1MJGM 1W5TA 4BFYA 3AM1A 2VR1A 3SS8A 3ZY5A 1VPEA 5JNLA 1L7NA 4BQRA 2RHBA 5K8JB 4F0JA 3KUUA 5LN1A 2VDJA 3QGMA 1Y34E 5GV7A 5CXQA 3QBDA 1GPNA 3S0JA 1RQGA 3O4IA 1O4VA 3TQIA 2B5VA 4X7RA 4HH3C 2GVDC 4NCXA 4L9RA 4MGKR 1A8HA 1PO7A 1JQBA 5DI3A 3ZCXA 2BFBB 3X1DA 3F73A 3RYFB 1XNGA 1ML4A 2IW1A 2OENG 3EXAA 1DUVG 3EWIA 5JADA 3HTXA 1N5OX 2FZLA 2MMCA 2HU8A 1RI5A 3DE6X 1LQUA 3ESXA 3A4IA 4J7AA 5KJCA 4I1OA 4M9XA 4JI4B 3QV2A 1KIFA 1F8FA 2RGRA 1KSFX 3NV9A 2JNWA 2EF1A 4DCGA 1PRYA 1K97A 1I4OA 4JGIA 1C1XA 1W19A 4B4VA 2HNKA 2B82A 2YWDA 4XSVA 1OI2A 2QGFA 2ET6A 4KXUA 5BRJA 1BHJA 4F3KA 2VUUA 1JI0A 3Q7IA 4WCVA 1WULS 2GFHA 1LS1A 1AXGA 2B9EA 3F0TA 4GOOD 4IH1A 3ER9A 2RHOA 1KO4A 1ZO8A 3PGLA 1FDOA 1QQ6A 4BKQA 3M6LA 3PNBA 1NNUA 2FAXA 2LKCA 3HLYA 3OZCA 4PC2A 3ZZ1A 2G6BA 2Z2XA 3KKLA 3AKDA 3BTSA 4F5ZA 3NJ8A 3PA6A 3AKCA 4R8KA 4WA8A 3BMQA 3RSGA 3GZNA 1VE1A 3REQB 1RBYA 2WWXA 3NEAA 4M9ZA 5YASA 1EFLA 2BHNA 3IFSA 3A0UA 2P75A 1TZKA 3M3HA 1BA3A 2OY0A 3EN0A 3ONVA 3ZD7A 4KMOA 2WSSD 4LDJA 1W4AA 3R5JA 1P0FA 3A32A 1E6LA 1H0RA 1QE5A 3EOBI 4B7UA 2I33A 1R50A 5DYIA 2D2IA 2OCDA 2WIGA 3NT5A 4PSVA 5K8UA 4RHCA 1ZD8A 2AFHA 4X1IB 2GWRA 2A4KA 4PLZA 4QTXA 4DJJA 4LW8A 4OJQA 2BM0A 3ECAA 3ZI0A 5MHTA 4CKCA 5ESDA 1L7EA 4EW6A 1B1CA 2C42A 2ZSKA 3MB5A 4HSEA 1R6BX 5ELLA 1PW5A 2PBLA 3RAGA 5KJ1A 1T91A 1E59A 4H3VA 1UJ2A 1NGSA 1PJAA 1OPXA 3V8QA 1CR4A 2YQ4A 4C6HA 1NQUA 1ZVJA 4CF7A 1L9KA 3AP2A 2ZZKA 3QUCA 3CZMA 4OHUA 2AFHB 2CJXA 1IM8A 5B6IA 2D0IA 1BOFA 1PN3A 1DWPA 2CLSA 3DUFB 3F3SA 1WV0A 2R6R1 1JFFA 4UCXA 4R4JA 3P9CA 4OF4A 3RYCA 4OUDA 3UKOA 2ADFA 4E2ZA 4IOLA 1C30A 2YV4A 3M1LA 4G4JA 1T9BA 2OHHA 4XFJA 4E03A 2JRLA 1JQKA 1Q2UA 2XNHA 5JWHA 3STUA 1CJTC 1E2EA 5JBNA 1M2KA 2Q4EA 2JIPA 5JCOA 1V2HE 3SSOA 5ICFA 3T95A 4IHJA 3N75A 5DRYA 1H93A 5JYDA 5JMOA 5H82A 3LL4A 1AO3A 4ITVA 5JI2E 1OY1A 3VZRA 3H04A 2FEXA 2QF7A 1ZRNA 3CZCA 5IPFA 1W0JD 3KUDA 1Z5WA 2V7QA 2CGEA 4V0QA 3SF8A 3VTAA 3A31A 1CLUA 2BI7A 3P32A 5BRNA 4K9PA 2H2FA 1XRNA 2IUEA 3NHPA 3PDWA 1A9RA 1W48A 4G8CA 4JEIA 3G1WA 4KODA 4Q39A 3P4YA 5H5JA 3ROPA 4D8UA 1Z63A 3ZDAA 4MYSA 4XVCA 2CHEA 3LXXA 2DTDA 3FWPA 5LXTB 1EH5A 1YFZA 1ENPA 2JEYA 5B12A 4GUDA 2WR8A 5LJIA 3UUGA 1BAPA 1MFZA 3HKEA 4QDXA 3ZWAA 4D45A 4QQNA 1VL0A 3WV5A 4BNVA 1X8KA 2Q3BA 4MVYA 3QE3A 4C6SA 3W7VA 2ORWA 3D2LA 2QTLA 3HP4A 4NATA 2F9LA 1EB9A 3NI2A 2B3DA 3QU7A 4GPTA 4TTJA 5FL7A 3W8EA 3WLOA 4BTLA 4A0SA 5A5VA 4BAUA 1B26A 1VTKA 4D4JA 1IJEA 4UEOA 2NGRA 4LDAA 1E92A 1Z0JA 4OLAA 4UM7A 2CEAA 4AT1A 2PVCA 1Z29A 4WK4B 5EPUA 2I1VB 2P90A 3CLTC 3HJTA 3DPIA 2AR7A 5JJ5A 1AHIA 1OD6A 2FCRA 4RLSA 3W5DA 2QTVA 4J3JA 1HDXA 3K8YA 4LJ7A 4Q3AA 1B23P 3AEKA 4EAQA 1P1CA 1LSUA 1N75A 2Z83A 3K5IA 3DQZA 1I51A 1X1TA 1Z18A 3QYFA 4MCIA 3U26A 5IJ9A 1QYCA 1TXGA 2GRJA 3EQZA 3R9XB 1RLUA 3G9TA 2GN8A 3FCUB 1Z6YA 2QPAA 1PK7A 3UMBA 1JAHA 1UPXA 3CBQA 1ZC4A 4KO1S 1K8ZB 2J87A 4E2YA 3COSA 2EZUA 3RHSA 3K0AA 2IHTA 1UQRA 2VAXA 2GB4A 4MYUA 4RE6A 1G1MA 4DJDC 4OXIA 1DQNA 4DJAA 4HVLA 1ORDA 3OPXA 3SJZA 1GDHA 3AF2A 5AUPB 3HWX1 3GJ4A 4UJ3A 2BFDA 4Q47A 3ELUA 2CC2A 2DP4E 2EAUA 3ROFA 1JHYA 4U3JA 3HY3A 1RRCA 5TE9A 2DTXA 3JTMA 4GQIA 2C9DA 3GJ7A 1EB8A 3I83A 3SR3A 4DC0A 1NI4B 1MV8A 2R6GA 2NU8B 4PY2A 1Y42X 2VA9A 4U6QA 2CT8A 3OH8A 1KYQA 1ORWA 5IEJA 4TS4A 8AT1A 2VJYA 2ZIUB 4L6AA 4YMIA 1WD5A 3OZIA 3QEBZ 1IOVA 3OCZA 1GPWB 2EFJA 5G3ZA 4AKHA 2HA0A 4LFCB 1SBIA 4K81B 1NQTA 4M1EA 5LCXA 4I4LA 4UOEA 1M6WA 1RLIA 1IB6A 1FNBA 1ZUNB 1RQ7A 2Z1NA 3HVJA 1IMOA 2KX7A 2RGNA 3CLSC 3DS8A 3K9BA 3KOYA 4FONA 5JRJA 1PGNA 1R0YA 4GP9A 3T9DA 2NP6A 1VJGA 4TT3D 4PNEA 3UFBA 2PA0A 4I6JA 5JW6A 1JGTA 2OORC 5T4HA 4CEJA 1KZ6A 5B4TA 1I6WA 2IPAB 2D4HA 4G25A 4MWZA 3WVNA 3VNRA 3ZU6A 4RJLA 1U2GC 1RM4A 3SJ7A 3QA3E 5A7FA 2BRUA 2NYRA 4KR6A 5I3ZA 3EXFA 3NYWA 2VWPA 1N1DA 1Z3IX 2GEKA 4E1VA 3PDIA 5D3KA 4C78A 4XCVA 4LDQA 2YZGA 1ZVKA 2I67A 4NICA 1USIA 2ZB2A 4EDHA 3SQMA 3P4XA 3K16A 5ITZB 3VPAA 2ZJAA 5CBKA 5LKAA 4D26A 1Q0ZA 2H59A 4O2AF 5TS3A 4ER0A 1KK0A 4BV2A 2PK3A 4ZHQA 2DMRA 1G21E 1H05A 1NQXA 1YS1X 1C8BA 2E49A 1YR2A 1F9AA 2W8ZA 5JH7A 5BN3A 1F7UA 1NA5A 3HXOA 1TUBA 3DTVD 3TAUA 1UBHS 3TLYA 4LRSB 3BGSA 4IAOA 1DS6A 2FYTA 4WY8A 1N5LA 2W11A 5AOCA 1B43A 3UG6A 4NV3A 3NS7A 4DJ5X 1TE2A 2Y1OA 2KJQA 4I8IA 4ZGWA 3DOEA 4LDRA 4DQUA 5CDTA 1P0QA 4NU5A 4QUEA 6REQA 3NBQA 3SNKA 4MRPA 1SFRA 2EQAA 4WN9B 3V1LA 2X0FA 1TCVA 3KETA 1FU4A 4BVFA 3NORA 4E6PA 4X7PA 5BVHA 1XG5A 2WHXA 1WB4A 5AXAA 4AMBA 1PE0A 4KJZA 1SOAA 4LX8A 3P9NA 1M8FA 4RPJA 4KR2A 3VKGA 1GUFA 3IDQA 4YI3A 4EUFA 4U2GA 2H57A 1MXHA 2HIHA 2LDBA 3OIDA 4CRWB 5EJ8A 3KR1A 4D3XA 4DOMA 4YRZA 3RIHA 1IEWA 3DO6A 2J0QA 5AO9A 2V0CA 1QQ5A 1RJGA 1A88A 1Q95A 3R5SA 1A9XB 1D5WA 3VO2A 3VR0A 5I9NA 2YN2A 2J5BA 5JJIA 3EUAA 4WBNB 1MDFA 1QHFA 1P2BA 3GY0A 5BVGB 1MJFA 2QN7A 3B13B 1L7OA 2R6FA 3PIRA 4FEGA 4PQYA 5AI5A 1D9XA 1WTCA 4D9JA 2Z1MA 4DJEC 4JOSA 3TD2A 1WUYA 1ZXXA 3EQ6A 4JENA 3OJCA 3IIEA 4O8CA 4KNWA 4NOLA 1V9LA 4IVQA 3KTAB 1JB9A 3H5OA 3R6DA 4JB8A 5HZGA 4X6XA 1JV2B 3IHTA 1KEPA 2EJUA 4IUCS 2Y6UA 3HKBA 1F20A 4Q7QA 2PO5A 4INZA 1ISHA 1C3EA 1QIIA 3ZQ6A 3WTCA 2DYKA 3C7CB 3VXKA 4G0WA 2QLNA 4O8ZA 2UZ0A 1Z34A 1LBSA 2ZI7A 4RTPA 4F5EA 4TMFA 2FQQA 2MOKA 1B0AA 1CPYA 1XD9A 2WBLC 4MQUA 3PQEA 1NRJB 2C61A 3G2IA 5GPBA 1EK2A 2EX4A 4X1OA 2CL0X 3GLUA 2B20A 2Z8ZA 2DGDA 2JH8A 2X3UA 4JC8A 3RAPR 1E8NA 1K7SN 1RP7A 4I81A 4WADA 5CFNA 4QOHA 2PRKA 4WK2B 3G2PA 2VS1A 3L9XA 3TR5A 3TZHA 4ZIRA 3DBHB 1Q3KA 4H7FA 3PJDA 1B74A 1VSTA 4G1MB 2GVZC 4DIFA 2C4MA 4EKYA 1WHSB 5TMPA 1Q14A 3IESA 4GKBA 4XGNA 2EU8A 2R00A 5EZYF 4RSHA 2CXOA 4KQ2A 3WE7A 1X1AA 1J2RA 4OQLA 4F5YA 2XUOA 3UMVA 3O92A 1H1LA 1FBNA 1XB2A 2CNWD 4WNAB 2C7QA 1VMDA 2XD9A 5FUMA 2WWRA 4KE6A 4AUMA 4KI0A 1Y1RA 3RI3A 3GPBA 5LB4A 3QU4A 1O94A 3KVNA 4U2FA 4F4FA 4LQDA 2HQ1A 2DFTA 4P0PB 3LDHA 3ZVRA 1R64A 1N2CA 4ZV9A 4DIUA 1K6XA 1N8TA 3NB0A 1O94D 1OGIA 4KV9A 5C2JB 4DV2B 1LPMA 2K2QB 2MSCB 2W2LD 3M8KA 4C4RA 5JZSA 5KNBA 2WU4A 1RRKA 2IZOA 1XCBA 3PC4A 5A4DA 4I66A 1I7SB 3U60B 4LV6A 4H2DA 5EMNA 2FW1A 1CZNA 3PD1A 1IATA 4OP2A 4BWFB 1A77A 3HCCA 1D4ZA