1N6LA

Crystal structure of human rab5a a30p mutant complex with gtp
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
168
structure length
168
Chain Sequence
GNKICQFKLVLLGESPVGKSSLVLRFVKGQFHEFQESTIGAAFLTQTVCLDDTTVKFEIWDTAGQERYHSLAPMYYRGAQAAIVVYDITNEESFARAKNWVKELQRQASPNIVIALSGNKADLANKRAVDFQEAQSYADDNSLLFMETSAKTSMNVNEIFMAIAKKLP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ras-related protein Rab-5A
publication title High Resolution Crystal Structures of Human Rab5a and Five Mutants with Substitutions in the Catalytically Important Phosphate-Binding Loop
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein transport
total genus 58
structure length 168
sequence length 168
ec nomenclature
pdb deposition date 2002-11-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1n6lA00
4WVFA 4MRRA 2AKAB 4P32A 4HAUA 4OJKA 5FTKA 4D4KA 2OUKA 5J4VA 1AKEA 1E9CA 4H1VA 4KV9A 4QC2A 3W90A 3AVYA 1G19A 1G6HA 3KTAB 4F4CA 1KDOA 3FHTA 2F9MA 2W0MA 2HEIA 2XNDD 4IW3B 4HLUC 3IBYA 4ZI2A 2ANCA 3WMEA 1TF7A 2BVNA 4DCNA 2NPIA 2NZJA 2TMKA 3NBXX 2IS1A 2AWNA 4YMTA 3KJGA 1E2GA 3FB4A 4HSEA 1X8LA 3MUFA 2JGNA 4B2LA 2QQ0A 4PC7A 4Q1FA 2ZUDA 2JATA 3CRVA 1E9RA 1V5WA 4OI0A 5AUQA 1OXTA 3PV0A 1VIAA 4DIDA 3MGCA 2PT5A 4B34A 1F60A 1RJ9A 2DFKB 4B43A 2WICA 5FOWA 4QBIA 2J0VA 4ZDIA 1HYQA 4KITB 3PIRA 1XXHA 1MRNA 1EFUA 2YOGA 1GKYA 1HH4A 1E9EA 1P61B 1EFRD 1YR6A 3SHFA 4A2QA 5FBLB 2V8OA 1CXZA 3JZAA 1KI6B 3VX3A 5FTMA 5JWRA 3SHWA 3AV0B 2IEZA 2W6JA 4LJ9A 1GOTA 2ZI5A 1ZINA 2ZS9A 4RD3A 4BFWA 121PA 1SHKA 1LF0A 3P32A 4OQNA 5HCIA 2OXCA 2QG6A 2B6HA 2MSCB 3W3AA 4MGIR 1T3SA 2G0NA 4A6PA 3IILA 2CMKA 4AWXA 2P65A 5D3MA 2A78A 4C0JA 5J4KA 2GXUA 5DI9A 1F5NA 2GWHA 4LBZA 3U3OA 4G3XA 4Q66C 4MGKR 4B35A 2QUZA 1FOEB 1RKBA 3E2IA 2V7QA 2YWEA 5E95A 3PEVA 3W6OA 3U6KA 4EQ6A 521PA 2MSDB 1KDTA 5TB5A 3NHBA 1W1WA 4OQXA 4YQFA 1I4LD 4GOJA 2QBYB 4IKEA 2OCYC 2ZSEA 4ESHA 1E4VA 1XP8A 2IYTA 3D6TB 1YKSA 4YDSA 2ORIA 1P5ZB 5LB4A 3GLHA 2D06A 3CW2A 5CM9C 2HF9A 3C14C 1G8FA 1W44A 4JMPA 1J90A 3EZ6A 3LQQA 4E09A 3MWKA 4BPBA 4ASUA 1OLOA 4GDFA 2R65A 3PXGA 2GJ9A 4MRSA 5F2EA 1E0KA 1OIXA 5AR1A 1Q44A 1IJFA 2VTKA 4WA7A 2BC9A 4NDZA 2OXRA 3U60B 1Z0IA 1N5KA 1TUEA 1XEFA 5LDDC 2IYVA 3QJYA 1QHIA 2VH5R 1DAMA 3BAFA 3TMKA 3ZD6A 1CJTC 4ZV4A 1Z28A 2BMFA 4AG6A 4QHTA 1VDZA 4BLTA 1X8JA 2R6CA 4KO8A 2BM0A 4XVQA 1E1QA 1M6NA 4ZIRA 1KJYA 2F3RA 2J3EA 3P4YA 3KUDA 3A1SA 1VCIA 1R7RA 3EG5A 4OKSA 3ZDQA 2XJ4A 4B2IA 5CB6A 1C4OA 1EGAA 1OH8A 3OEHA 2EFGA 5JRZA 2YZ2A 1QHHA 4OK3A 5GJVC 2NGRA 2FGKA 1R5OA 1MH1A 3EWSA 3K9GA 3MCAA 3B7GA 2L0XA 3LX8A 3TJZA 3UPUA 2W0SA 3L43A 2WJYA 3ND9A 4FWIB 4PHHA 1AA9A 4KFRA 3TE6A 4DZZA 1N0WA 3RWOA 3U7FB 2NZ8A 2CVHA 3EC1A 4UQOA 5DN6D 1PLKA 1VTKA 2OFXA 1NVVR 4A8JA 4PC3A 4C3ZA 3RRNA 4KLZA 2NO1A 2R6AA 4DSTA 1P3JA 4O25A 1HTWA 2P6NA 3UG7A 1XB2A 4HATA 4DLXA 1BH2A 4LCBA 3PUVA 3AKCA 3SOPA 4US2R 4PC2A 2ZYWX 1HQYE 3OHMA 4EPYA 2CE2X 2VF7A 1JQLB 3CR7A 1UM8A 2O8CB 4F93B 5B57C 4MGZR 1N6PA 1AJEA 2O0JA 1MT0A 2ZRDA 3KB2A 4V02A 3DZDA 4BLOA 4N0EA 2EWVA 1K8RA 4LOAA 3NBFA 2CL6X 5K8LA 1GILA 2YINC 4AD8A 1M34E 1IOZA 1TU4A 5IT5A 1G7CA 1XXHE 5BN3A 2FN4A 3FE2A 2ZITA 2CLDX 3Q8XB 1F2UB 2FGJA 3K09C 1MOZA 1ZRHA 1N6IA 3LA6A 4Z8YA 4IDQA 2LCFA 1DBSA 1ZM7A 1KSHA 2UVQA 1NN5A 1P9RA 1YZQA 3C41J 5EE1A 1NIJA 2PMKA 1W4RA 4UNQA 4DDVA 2ZI3A 4LC1A 4AIIA 4LX0A 1DAEA 2QAGC 2J0SA 1YZGA 2VBCA 2WJHA 1JQJC 4A36A 2OCPA 1GNRA 1YR8A 4DLWA 5L3SA 4EJSB 2IYUA 1NMXA 2KBEA 3BIFA 4JLPA 2XTZA 1JAHA 4Q47A 3DHWC 2JJ2A 3C16C 4QGFA 4B2PA 5AJZA 1JPJA 2VHCA 3KL4A 3MLEA 3KKPA 3NIBA 4KJZA 4M1WA 3TVDA 3KQNA 1FPMA 3C4JA 5K8UA 621PA 4DUGA 2C5LA 4PO1A 1VIYA 4PQFA 3RHFA 2HYIC 1TF2A 4KLNA 3RSLA 5F3WB 2A2ZA 3FMOB 1GSIA 3GLHE 5FOVA 2XZOA 3OIVA 1Z2AA 1R0YA 5JS8A 2PX3A 2IL1A 1P72A 4X8HA 3DOFA 3QI2A 4AI6A 3CKLA 4C0QC 3Q3JB 5HKKA 3L8ZA 2ZREA 3NVAA 3H84A 5G40A 2FEMA 1ZJ6A 5FTNA 3LW8A 1GRRA 5EP2A 1E98A 4LYJA 3EPJA 4KAXA 2O8DB 2DPXA 4JBXA 2Z0MA 3UMSA 4URXR 3D8BA 1AIPA 3CRW1 2XXAA 2O8BB 1RIFA 2V1UA 5JHGB 1LW7A 2W6IA 3IQXA 3OF5A 2NTYC 1T8UA 3GLFE 1A2BA 1WXQA 2FX3A 2ZRPA 3VHXA 3T34A 1A4RA 1E79A 1P7CA 5DISB 3AVTA 1ZIPA 3NEJA 1MABB 3ONWA 4W5WA 1ZU4A 5AJYA 4HDOB 4PSAA 1QVAA 4TT3A 3ZVMA 1P2TA 2VSOA 4UNRA 1XCGB 4UJ5A 3T1OA 3GLIA 2WMNB 4HLQB 5FL7A 1Z63A 3GEEA 5L3VA 4Z1MA 3KQUA 1KI8A 1CJVC 4AG5A 2WWYA 1ZUHA 2PL3A 5KNBA 4M1MA 4F4IA 5BN5A 4B48A 2J7KA 4TL8A 4TYQA 1JECA 4CDGA 4V03A 1PUIA 1GNPA 4CZ2A 4G5OA 2QROA 2CNWA 3KTAA 2IXGA 4LUCA 4CGZA 3WBJA 2ZSAA 1ZC4A 3DL0A 1KSJA 1X3SA 3TSOA 1Z6GA 2K5UA 3RABA 3RVBA 1NJGA 4NCIA 1DTSA 2UZIR 4I1UA 1W36D 4OHZA 3LX5A 1ZNWA 3CNOA 4GNKA 5EZ5A 1UBCA 4URYR 2YKGA 2A9KA 2CHGA 4PC1A 1IM2A 4MYTA 1CR0A 2BMEA 4DLZA 2GESA 2VSXA 1O87A 2FG5A 4JBYA 3U61B 2BEJA 3RNLA 1SXJD 2IX3A 2FJUA 3U7EB 1G3RA 1DARA 1U81A 3I4LA 3VQTA 3MSXA 4LJAA 4JT4A 5HTKA 2AXNA 4Q19A 1JXMA 1LFDB 3AF2A 4TQAA 1KSFX 4W5JA 4A82A 3H86A 1NVWQ 1KI6A 3WNCA 2P2LA 1KY2A 4LJYA 1TEVA 2ZRFA 5GJWC 2JLRA 3QG5A 4JSTA 4LHYA 2GJKA 2WJVA 2F43B 5FI1B 2QQEA 2GF9A 4PHTA 4TSFD 2NO0A 4U02A 3GJ4A 3IKJA 4JLJA 4C30A 3TRFA 1U2RA 5L3QA 2IYZA 1RC8A 2YWFA 4TLAA 2KE5A 3AF4A 4BZQA 3AEZA 5CJ2A 1GL7A 3L0PA 3KJEA 1FQKA 1T0HB 1N2CE 1E2KA 2EQBA 3I8XA 1XTQA 5KSZA 5AWFC 2G9NA 5LD2B 2CVFA 5BYKA 4A9AA 2WJJA 1VG8A 1GG2A 1WMSA 2Q9CA 3QXSA 4HAXA 3QXHA 5FFMA 1U8ZA 2W2XA 4XWOA 3AGPA 2CLSA 4MKGA 1FQJA 3K9HA 3B1WA 3RDPA 4ARZB 2BMJA 1QHGA 2C9CA 2J46A 5JCZA 2WKRA 1RRCA 421PA 2JJ8A 1W0KD 1GRQA 1ZYUA 4LBWA 3A1TA 5EUQB 4MRNA 3T06B 4CEIB 4K81B 4RJLA 2EW1A 1F6BA 3B8HA 4IVQA 4AK9A 5FBRB 4BEBA 2PZGA 721PA 1G8PA 4D25A 4A2WA 4M4SA 4F91B 1G64A 4PQRA 1CJUC 1T8TA 3A1UA 4X8MA 1WB9A 4EQ6B 4CIDA 3NEYA 4NYJR 1TNDA 5BW8A 4AYWA 2WVJA 2ZS7A 3CNNA 3CUEF 3THWA 4HLDA 5TY0A 1UBEA 1NL3A 2Z5FA 1E69A 1HY3A 1E2PA 1E1RA 1ZCAA 3T1QA 1XTRA 3QF4B 4B6EA 5DHFA 4TYYA 3DMNA 2IUSA 2P0EA 2ZSFA 4GRAA 6Q21A 3TR5A 4DEYA 3T5GA 4ITRC 1YHNA 2VF8A 2F9LA 3SI7A 4OI2A 2ZAMA 2JLVA 1ZM9A 3DDCA 1KY3A 2JDID 4IHQA 4FMBB 4A0GA 2VP9A 2QSYA 1GAJA 1KNXA 1F3OA 2ZJAA 4JKIA 4JZKA 1N6LA 2HCBA 4FIDA 2BJWA 3B1VA 4NZYA 2D7CA 4F4JA 4BGDA 4GBMA 1TAGA 2BMDA 4Q1AA 1W46A 4W9MC 1HT1E 4X8OA 3THXB 2O8FB 1EFRA 1GKIA 1P2VA 4PAQA 1IN7A 1G7SA 1US8B 3VR6A 5EP3A 1A1VA 1D9XA 4XD7A 4MYUA 2ZRJA 1IJEA 3AP2A 3NH9A 3TH5A 1R8QA 4JYBA 5K8IA 5E7JA 2I3BA 4C0AC 5FPYA 1YZNA 1SKYB 3IPYA 1KMQA 1QHHB 2ZJBA 4WXPA 2JLYA 4DB2A 4QM6A 3I61A 2YHSA 5CK4A 2O8CA 5FH9A 1TX4B 4Q1DA 3SJAA 2R2AA 4U7DA 3VKWA 1U94A 2ERYA 3FKSD 5DIFA 2OE2A 2A5FA 2LKCA 4G01B 4HAWA 4MA4A 1HUQA 3DM5A 2RCNA 1G3QA 4PO9A 4ZKDA 2Q3MA 3AP3A 2OBLA 3TSWA 1Q1QA 2ZVPX 3ADDA 2ZR0A 4M1YA 4RD6A 4LJ4A 3K0FB 4CVNA 2HV8A 1F2UA 4NCHA 4LJ8A 3ZVLA 2ZS8A 4A0HA 2HYDA 2WKPA 3ZS8A 4HAVA 2IHYA 2ZYUX 5CDFA 4I1OA 1G3IA 5CJPA 3PEWA 1E9AA 1OSNA 4R2HA 4JJKA 3AH8A 3I32A 1S3SA 3P1JA 5CK5A 2VP6A 2FV8A 1XJCA 5FUVA 1SHZA 5KYKA 2OZEA 5JRJA 1G8GA 2WZQA 3CX8A 3T35A 5G41A 4DDTA 4EJSA 4QBHA 2VIIA 4XVRA 221PA 2QENA 5CM8B 4NYIQ 4MRPA 1BIFA 2W2VA 5KPJA 4Z51A 2JLWA 1IN6A 2H17A 3CRQA 4EKDA 3SQWA 2XTMA 4MDEA 4TLEA 3VFDA 2QMEA 1XFAA 2CHQA 1G5TA 1Z07A 2J59A 2I1VB 2P3SA 5D3QA 1VYVA 3NBZC 3NC0C 1E2DA 4Q48A 3ND8A 2X1VA 2ONKA 2QMHA 4M53A 5L8VA 4E22A 4PANA 3D3QA 2G1JA 2Q6TA 1TQ6A 4RZUA 2XNSA 2R9VA 4GOXA 3V9PA 1OKKA 2R8RA 3GCGA 2IK8A 2FSGA 1H8HD 3GEHA 1AS3A 5HR5A 4HEJA 2JIZD 1MV5A 3VR2A 1GP2A 4D26A 1HEIA 2ODEA 2O8DA 5TVKA 3RAPR 3I92A 1OHHD 2O8BA 2P6RA 2ZUBA 1U99A 3BH0A 3REGA 1OW3B 2RGNA 4HDCA 3B2EA 3KKMA 3MG9A 2QPTA 4NYMR 2CL0X 5JLJA 2CK3A 3I62A 1SVOA 4L15A 2ZJOA 1U90A 4UNNA 2IYQA 4DBLC 1DAFA 2VPPA 4KSCA 3PVSA 1I2MA 2IW3A 1N5IA 2WMOB 1CF4A 1WA5A 1MABA 2OFOA 3PUWA 1VECA 5JEEA 1OFUX 3G5UA 3SJCA 2KWIA 1T0JB 3KZ1E 3MD0A 3ADKA 2H8KA 2ZANA 2GXSA 2FE4A 3PUZA 3QY0A 3IIJA 5H8WA 1KJZA 3OIWA 4M9SA 2VA8A 2ONJA 1ESNA 1U0JA 3UANA 4B3XA 1WCV1 1Q3TA 4DHEA 2IUTA 1AQYA 2P5TB 4XOIA 2NIPA 4EPRA 1XCPA 2Q3HA 1NLFA 5JMTA 2ZJYA 5FOTA 3AVPA 2PEZA 2GDJA 5C4MA 3PEUA 3QKSB 1M7HA 4Q4HA 4LHVA 4WZBE 1OH7A 2QI9C 4V0OA 4DC9A 2WSMA 2HJGA 3IO5A 1UBFA 1NBMA 5LB2A 3Q9LA 2ZE7A 1KDRA 4B74A 3B82A 4QJ5A 4V0KA 1XD8A 3REFA 3W34A 3ZIAA 3ADCA 4OI1A 1Z0JA 2Z43A 1AQUA 4TL6A 5CLQA 4R9UC 2C2HA 4Q9JA 1TL7C 4M22A 4TTPA 2J0UB 3O47A 5C2JB 4XWKA 2AL7A 4B73A 1UF9A 1KK0A 4P0TA 4TMKA 5DLQC 4RY2A 3GFPA 3J81k 4KYUA 5FPHA 5TMPA 1JBKA 2W58A 3B60A 2I1QA 4CT4B 4TYWA 4D0LB 4TQUS 3LLMA 4R2IA 2H5EA 2DFNA 3QSYA 2OESA 3P27A 2F43A 2WPDA 2ZR7A 5EXPA 4BFVA 3E5HA 5AJVB 4EIWA 3R9IA 2RB4A 1JR3A 3RLFA 2RHMA 4B33A 2O52A 2C96A 2ANBA 1PVOA 4CYMA 1OFTA 4MYCA 4YMSA 2B7BA 3QEOA 2GETA 2V6JA 2C9YA 3CF6R 2VHUA 2AN9A 2GK7A 3EWAA 1YZTA 3F3YA 4ESVA 1M8PA 1V43A 4HAYA 4P33A 3QVUA 5IK2A 5CIQA 4PXAA 2OLJA 1SVIA 2D2FA 4YLGA 5FPKA 4ACAA 2IYXA 2A7QA 3QEJA 4V0LA 1EWRA 1NG1A 2HUPA 1UEIA 5SZJA 4AY2A 4MYHA 3CRRA 4ARZA 5AUNB 3K70D 3X1WA 4D80A 4A8JC 1G3UA 1TEXA 4M1KA 3A1WA 3JVVA 2VP0A 2DBYA 3GLGA 2Q0HA 2J9RA 1KK2A 1UBGA 2IEYA 3IIKA 4MDFA 1H8ED 4CEIA 1A5TA 3WYFA 4Q7LA 5L3QB 4AKEA 3W8RA 4GP6A 1TQ2A 4LRWA 5DH9A 3TW8B 3LW7A 2GRJA 2QEQA 2GCOB 1UEJA 3FTQA 3VTKA 2GZAA 3K0SA 4FI3C 1JALA 1N6KA 2NOAA 2R6DA 3VMFA 3TKLA 4JLVA 5A4JA 2GEUA 1P4SA 5J4HA 4Y0VA 2QORA 2P5SA 2ZI7A 2DWOA 2KSQA 2FPLA 5KTYA 3OIUA 3DVLA 3QF4A 1W0JD 2QRNA 1NMZA 3ZS9A 1D2EA 1R2QA 2QPAA 4MKIA 3GP8A 2BIFA 1FL9A 2GBLC 1CS4C 2VEDA 3CWZA 1QBKC 3IUYA 4Q21A 3BS4A 2WAYA 3T12A 3CX7A 4UXJA 4TTRA 5JFGA 4RCZA 5G3YA 2ZRBA 1JR6A 4FMDB 1SXJA 1NY5A 1PLJA 3DOEA 2HF8A 2H1LA 1RW4A 1KTVA 3KX2A 3EARA 3IPXA 3TIFA 3THXA 2O8FA 4E5UA 4DJTA 4KBGA 3SS8A 1R5NA 1US8A 4C9BA 1CJMA 1G7TA 3OAAA 3QKRB 4C0BA 2FH5B 3RC8A 3F0TA 3THWB 3SYKA 3ZLJA 1OJLA 3W5JA 1IXRC 1OT3A 2G83A 2H7VA 3LBNA 4FCWA 1DEKA 4TYPA 4Q9HA 1IXSB 1L2TA 4WAUA 4D0GA 4E07A 4PHGA 2R44A 1XPRA 3VKGA 4YXWD 3I72A 1G4UR 1EESA 4MITA 4C0SA 4ZCIA 3B1XA 1QHYA 1DPFA 1U8YA 4OJQA 2VHTA 4HDQB 2AK3A 2HLDA 4HI0E 4B3DA 1KNQA 1OE0A 1VHTA 1TQ4A 4QHYA 3CIOA 2OLKA 5AUOB 2D62A 3PEYA 4BLRA 5DNYB 2QT1A 2NO6A 3NHAA 2ZU0C 1K6MA 2CCGA 4OHXA 4V0ME 1OIWA 3QBTA 3TVTA 4URVR 3OFND 1XBTA 3BB3A 3K0FA 1M2OB 4HZUB 5C4GB 4QJ3A 2QPOA 1W2HA 2ZAOA 2QTFA 4JLAA 4M0LA 1SGWA 2ATVA 1TU3A 2IYLD 3EIQA 4XSGA 1G6OA 5E7MA 3IBGA 5HE8A 2O5VA 3OEED 5JHHB 1FMJA 3BGWA 4P4UA 5KDOA 1RZ3A 4BWYA 5FTJA 3QBVA 4AKHA 3BORA 2WSSA 2MSEB 2IS4A 2JJ1D 3TSZA 2ASEA 3KUCA 3X1XA 1Q12A 1GWNA 3EIHA 5IHPA 1EWQA 3U3RA 3PJRA 2GJSA 3TUIC 3KB1A 4D4MA 5JJIA 2RGXA 5FBQB 2Z4SA 2GCPA 4G5RA 5B58C 1AM4D 3LWNA 4DDUA 1GL6A 4I81A 3RANA 2ZRAA 3DPUA 2V1XA 4NL4H 1P62B 1T3HA 4FWTA 3L0IB 2WHXA 4GI7A 3FHCB 1T4GA 3K9LA 2ZVQX 3RS2A 1ZC3A 1B0UA 4RFSB 2NO9A 1MKYA 1OV4A 1QDEA 4US1R 4XSHA 3T61A 4L9SA 4BFSA 4URWR 3QNUA 3ZH9B 4LBYA 4TMZA 3RRYA 4AYXA 1S3GA 4QRHA 4PFSA 4QKQA 1MO4A 1G3MA 4PPFA 5G53C 1BMFD 1RRGA 1AN0A 2EU8A 4PZYA 4CEHB 1XJQA 4W7SA 2F6RA 2WOJA 4GSYA 3TAUA 5DI3B 3PQCA 2NMVA 2GHIA 5BN4A 3WYGA 5GJBA 1BO6A 1F48A 4C0KA 2WIBA 4A15A 2XGJA 3D31A 1XTKA 1CJKC 2V3CC 3X2SA 2FFBA 1FZQA 2H92A 3K1JA 4NP6A 4EAQA 1XPUA 2DR3A 4ACBA 4LYAA 1X1SA 4HUQB 5DYIA 2XAUA 1OFHA 2VO1A 1XZQA 2QE7A 3FWYA 4FCTA 4NBSA 2WTUA 4URUR 1QVRA 1J2JA 2ZE6A 4AC9A 4R98A 5H1YA 3S1AB 1YR9A 2GJ8A 1COWD 2JLZA 5TARA 1KKLA 4IOMA 2PCJA 1NN1A 1NY6A 1N6NA 4ZCLA 1YRAA 1UAAA 4Q4JA 4JT2A 2CCJA 1RYFA 1X86B 4ZDKA 2WWHA 2ZRLA 2RH5A 2D2EA 5JWHA 4TLBA 1YZUA 2C04A 3WHKA 4LBVA 2JCSA 2E9SA 1RRPA 5TXGA 1ZBDA 4NH0A 2GK6A 1RE0A 3BC1A 3MFYA 5CYOA 3IEUA 3OE7A 3K8YA 1G8YA 4HLCA 4TWZA 3X1YA 4O2RA 3I8SA 3R7WB 2PJRA 1NIPA 3RRMA 1E32A 1R0WA 3QKSA 4YMUA 4UKDA 3M4YA 4FMCB 4IDOA 1S4QA 1ZNXA 4BLQA 1D2MA 3UK6A 5GVSA 3GJ5A 8OHMA 3TGPA 4HZIA 1R8SA 3A4NA 1KI1A 4GZMA 3UG6A 1N25A 4U5XA 1IONA 4US0R 5EE5B 2WJGA 3TUZC 4IDHA 1E4YA 3B78A 1NI3A 1E3MA 1Z06A 3SR0A 3AM1A 2ZRKA 3AUXA 2YYZA 1II9A 2BWJA 4KU4A 3SNHA 1JAIA 2J0UA 3SFZA 4QM7A 3G82C 3U4QA 2W6JD 1YRBA 3WMFA 2ZPTX 3GEIA 4JL5A 4QGGA 4LDJA 1TTTA 3L0OA 2RGBA 2LKDA 4C0LA 1XTIA 4IVRA 1W49A 2YJTD 1Z6TA 3SBEA 3U3KA 1NLZA 3M6AA 4L4UA 4Q4HB 3AVQA 4MH0R 4UNPA 1Y63A 4Q1EA 2QMOA 3EPLA 1OPXA 3C15C 1XDBA 1B23P 3GFOA 3LRPA 1UJ2A 4PPGA 3ETLA 4QGHA 3OESA 2LWIA 1A2KC 1RRFA 3R9XA 1Z0KA 2V7QD 3B5JA 3JVUA 3EIEA 4IFEA 2X77A 1VKJA 2AR7A 2XX3A 4GT1A 1CU1A 2B92A 3UIEA 5FI0B 1NG9A 4JLKA 2WBLC 5H68A 4AYTA 3GJ8A 4B3BA 1AGRA 3V00A 1EG7A 1ZAKA 1NSTA 4I1SA 3HR8A 2QP4A 4ZDJA 1NVXQ 3SQXA 3BXZA 1II8B 3IDQA 1D6JA 4QNMA 4B71A 1GL9B 4ASUD 1J70A 3K70C 3A6PC 1FUKA 4N0DA 2FZ4A 3Q7QA 3PENA 4KHZA 3TLXA 1IY2A 1JXOA 4G0NA 3BB4A 1TADA 1K5GA 1Y3AA 2C78A 2J5XA 3B9QA 3EX7C 5JCPA 1YQTA 3CNLA 1Q20A 5KO2A 2NPFA 1ZM4A 1J8YF 3X1ZA 5GADl 3GJ6A 2J0QA 3QOFA 4TMXA 1XD2B 4P4TA 2V55B 4M21A 1QHSA 2XJ9A 3CX6A 4LK2A 1F2TB 2DYKA 4LPKA 3KXKA 4UXHA 5J40A 2FSHA 1DELA 4X8LA 1E1QD 4A4DA 1AKYA 1MRSA 2RKOA 5KNCA 5KPDA 2GCOA 3KQKA 2VP4A 2IYRA 3EC2A 2Q21A 3P20A 2GXQA 2ZTSA 2VRWA 1NLYA 2ZRMA 3ICEA 3WYAA 4A1FA 2B8WA 1DVRA 2XSZA 1XF9A 3H4MA 3AKYA 3IQWA 3A8TA 1XTSA 3U6BA 2V6IA 3WNBA 2GF0A 2EWWA 4PQYA 4WZAE 3AKDA 1G9XA 3GLGB 1VCOA 2BCGY 1ODFA 4BZXA 4DEXA 5FUWA 4DSUA 1DOAA 1KO8A 5HPYB 2ZRIA 1W48A 1OXXK 2DWQA 2J1LA 2PLRA 4N3NA 4TLDA 2F3TA 1ONBA 2D4HA 4MKFA 1GNQA 2G0TA 1P73A 3O8DA 4JSYA 1NKTA 4JLOA 3VR3A 1S1MA 5JECA 3LNCA 2XB4A 1KI2A 1FTSA 2NO7A 3FMIA 5EXXA 2O0KA 3UMRA 3RS5A 3QKRA 1U0LA 4L8GA 2CCKA 1AS2A 1KZ7B 4ON9A 5BQ5A 4EJSC 4YDHB 3NH6A 1E2JA 2XNDA 3LXRA 3QE0A 3EASA 3KFXA 5E7IA 4RD0A 5EE0A 5JWOA 1HURA 4OQLA 4OK6A 3LY5A 2Q9AA 3K0AB 2R6FA 5KUTA 4OHVA 1VYTA 2BBOA 2CLCX 4P31A 1SZPA 4BRWA 1IY1A 3ECCA 2OHFA 4BFUA 2G1KA 1W36B 3K0EA 1Q3HA 3UMFA 4UXIA 1BYIA 4ERNA 2J7PD 1G18A 1IN8A 1KI4A 3V4FA 3GJ3A 5FOUA 2QAJA 1P9WA 3GLIE 1SXJB 2FPMA 2IYYA 2EFCB 2BOVA 3FYHA 3ZJYA 4HZUA 2ZE8A 2IUUA 5HE9A 5JZVA 3LLUA 4I1VA 2XEXA 4PSKA 4LPSA 2FFHA 1II0A 3NWJA 4M1SA 4OHWA 2Z83A 3SYNA 1CR2A 1U9IA 5ANRB 3IHWA 1KO7A 1LY1A 2AHOA 4QL3A 3O8CA 3A37A 4ZI3A 1UDXA 3PFIA 3TAHA 2RGNC 1EFHA 4OQFA 5JEDA 2JJ2D 3I1FA 1H8EA 2ORWA 1E2IA 5IRCD 2C03A 3ASYA 4JVLA 4DUGD 3GLFB 2F1IA 2GAOA 4WBSA 3TUJC 4Q03A 2QP9X 3P26A 1K5DA 3B13B 3SFVA 5FTLA 1Z0DA 1ZD8A 2BBTA 3HU1A 3KQLA 2BHRA 2C95A 3GJXC 4C4PA 5C1BA 2P67A 1A82A 2V54A 2QGNA 2R6GA 3PCRB 4QFMA 4RFSA 3Q85A 4CRWB 1ZUNB 2ECKA 1TMKA 3AVWA 4B32A 4JVSB 3LAWA 3QKUA 2YC2C 3BK7A 3DZ8A 3FDIA 2WKQA 1EX7A 3ZGXA 1SULA 4DLYA 4CEHA 1IBRA 1VMAA 3EZ9A 3K53A 3RRZA 4AURA 5DI3A 2QTVB 4QHSA 5JBQA 1TF5A 5SZKB 1FNNA 3V4RA 4U00A 3B1ZA 1CKEA 3FGNA 4Y0AA 2W6ID 1FUUA 1G1MA 1ZM3A 2W2TA 1S9DA 5JSZB 2ZYTX 3AF3A 1ZNZA 3THOA 4JL6A 4PPNA 3QG1A 1XEXB 3A4MA 3U3MA 4GMDA 3VX4A 3LXXA 3HU3A 4II7A 1LNZA 1E79D 2ZEJA 4HUQA 3LH5A 2OT3B 4LV8B 4NU0A 4PTLA 2BCJQ 4XIGS 5BWMA 4TZ6A 1LS6A 1NVVQ 3CR8A 3T5DA 4M2LA 2AD5A 4Q4LA 4Q9KA 3HPQA 4TT3D 4XJXA 1G41A 4TL7A 3CPHA 3S1AA 4ZKEA 4PAMA 1GKUB 3CB4A 1EXMA 3R8FA 5FL7D 5H70A 4Z1MD 4LYHA 2WV9A 3LDAA 2DWPA 2N46A 2QM8A 2YOFA 4YXWA 3QIAA 4IEEA 1YJ5A 3TR0A 4M1TA 3SBDA 1S8FA 2CNWD 5UKDA 3KFVA 2ZI4A 2FU5C 1T5LA 1IAQA 2X2FA 1U98A 4Q02A 4DWJA 2XITA 1Z8FA 2GCNA 5EZ6B 5DN6A 3QENA 4D4LA 1ZP6A 4Q00A 4BLSA 3R7WA 4TZ0A 3KJHA 5KDLA 2XZLA 1RYHA 3VNUA 4WXRA 1W7AA 3U44B 1R4AA 5LD2C 4IVPA 5FR2A 4GZLA 4KODA 4N1AA 2WAXA 3ZZUA 4B75A 1EX6A 3HDTA 1E2LA 4IJMA 3WP1B 3MMPA 4CEJB 4OQMA 4Q4JB 1C9KA 1CP2A 3R8CA 4A92A 4FMDF 1YVDA 3G0HA 2JASA 3L82B 4PZZA 2FPKA 2JJ1A 1KAOA 1FP7A 1Q1EA 4LHZA 3LV8A 2QTHA 4GOKA 1LV7A 4DLRA 1CIPA 4H9GA 2C98A 3AVXA 1S96A 2KI5A 5HCNA 2OAP1 4BRUA 5LPNA 3AKEA 3I73A 5DSZA 1CR1A 3OIYA 3ICQB 1XRJA 1I2DA 1M74A 2ZSBA 5DGXA 1AS0A 1BYUA 4JS0A 1VG0B 4HYYA 2N42A 2FFAA 2CEAA 2O8EB 4POAA 1XCMA 2GJAA 1Q57A 4HB4A 1DG1G 1P75A 2JLSA 4KFTA 1LS1A 4ZDWA 1N5LA 2CDNA 1FNMA 1QG2A 2AWOA 3ZD7A 1BMFA 2GNOA 2CBZA 3CH4B 3EZ7A 2OAQ1 2REBA 2R62A 2EYUA 3SN6A 3QQ5A 3QXXA 2CJWA 2IWRA 4DSOA 3FPAA 1FFHA 2ZJ5A 2UKDA 4DCSA 3N2EA 4LY6A 3NC1C 3THYB 1W4BA 3B9PA 5SZHB 2QY9A 3U4QB 5A5GA 2QZ4A 4HB2A 1NKSA 1TPZA 3WBKA 4FD2A 3A36A 2HJVA 1II8A 1KHTA 1JNYA 2DFTA 1N0UA 2ZE5A 4QJ4A 3UWKA 2ATXA 1R5BA 3FKQA 1XPOA 3Q7PA 1DO0A 2CXXA 3U7HB 4ABYA 5B30A 4BECA 2P6UA 2CL7X 5EJEA 3CF2A 5EUMA 3W8NA 3PUYA 1T91A 3EW9A 1AGPA 1L8QA 1KO4A 5EXSA 5J47A 2OEPA 5CDFE 1XD2A 1WDTA 4DIEA 1AZTA 4IDNA 4EUNA 5C46F 1F2TA 3P4XA 4JIMA 2VP2A 3FOZA 2IYWA 1JEDA 3MWYW 4LGMA 2FDCA 3MWJA 4GMXA 4QNRA 3AUYA 3DMDA 4TL9A 4TN1A 2ZRNA 4EPWA 1E0SA 2YNMA 3QXJA 4EFNA 1WBDA 1NVUQ 2QMUA 2C9OA 1GRNA 4FW9A 5IF9A 4DVGA 1E1RD 4QOSA 2BKEA 1E9SA 4JJZA 2QAGB 3DM9B 4ZPXA 2XZPA 2BEKA 4NPHA 1ZU5A 3U3JA 4BUJA 2JAQA 3BE4A 3C7KA 1JEEA 1HQCA 2AXPA 1PUJA 3DO6A 2EFEB 4BFYA 4DCTA 4DB4A 3C5CA 3T1VA 1R0ZA 2D7DA 2BBSA 3E1SA 1I4TD 1NJFA 3WRYC 2AX4A 4KVGA 2RMKA 1CEEA 3H0KA 1XNJA 1G21E 4O0MA 4A6XA 4IRUB 2OBNA 4XD7D 1EFCA 2FA9A 3QPVA 3FMFA 2CHVA 4KCGA 3BOSA 4MUAA 1X8KA 1Z08A 2VL7A 2OV2A 1JPNA 1ZW6A 4JL8A 4KFUA 1KSGA 2ZI6A 1XTJA 2H16A 4LJ7A 4G1UC 2V4ZA 3DKVA 1PZNA 2PH1A 5TV2A 4D81A 5KOYA 1GVNB 4KFSA 3EZFA 4LWZA 1G17A 3K0AA 3TQCA 4F92B 3SE0A 4Q01A 5FL3A 1E94E 5KSOA 2AD1A 1OXUA 1XJ0A 4P4SB 4BFZA 4ZO4A 1XMIA 3W9YA 1G4AE 4HUTA 3K0CA 1OYYA 1IY0A 2OSBA 4JLMA 2XOKD 3B6EA 3LVQE 1KI3A 5K8TA 1Z0AA 2BJVA 2VHJA 1HA3A 5P21A 4FMCF 2FSIA 1DE0A 2QT0A 3CPJB 1IHUA 4S2EA 2OCAA 3OZXA 4KSBA 4JVNA 1NSFA 4FN5A 2E1RA 1T5IA 3RS3A 3I5YA 2JLUA 1KJWA 1WQ1R 1ZVQA 1CLUA 1D9ZA 2EFDB 4FINA 2DB3A 4M1OA 1CR4A 4NKRA 3FFAA 1P9NA 1VYUA 1G20E 4JLNA 4HLUA 3SYLA 4TYNA 1NBME 1OYWA 2GVZC 3PG5A 1NMYA 4QBGB 4TSFA 4PO8A 1GM5A 4D6PA 2PZFA 3GLFA 2F7SA 3BRWD 1Q0UA 3VU9B 3CLVA 1WF3A 2PT7A 1Z6YA 1T6NA 1M1YE 2A3RA 3U5ZB 5M04A 5BXQC 2ZXUA 2KB0A 4OL0A 5EXTA 5JI3E 1KK3A 1J99A 5KHOC 4D4JA 3AB3A 2B8TA 4LHXA 4NYJQ 5AUPB 4ZCMA 2WWIA 5FBVB 1OKKD 3CRMA 3Q5EA 4K8OA 3BBPA 4EFLA 3ZVRA 3BH6A 2E87A 2Z4RA 3NXSA 3K70B 2QGZA 3IIMA 3HYTA 2RHDA 2A30A 4NYIR 5KU1A 1JJ7A 2SHKA 3QKTA 2EVWX 1T9HA 1R6BX 1W0KA 4OYHA 1PLLA 3LBHA 4PPQA 1KZGB 4M9ZA 1JR3E 3H2YA 5JSZA 1XWIA 3PR1A 4OHYA 1XU4A 1GUAA 2CK3D 1NF3A 1J8MF 4KXFB 3RS7A 1XEXA 1QZXA 5JJKA 2BM1A 3GMTA 4QGAA 4W5HA 2HXYA 2PZEA 3K9NA 4G5GA 5FUYA 4AKIA 1D5CA 4Z8XA 3MAAC 1E2EA 2G3YA 3HR7A 4EPTA 3EXAA 1NN3A 1SKQA 2J87A 4C2UA 2N1BA 1MO5A 2MMCA 3EA5A 4Q7JB 2Y8EA 3IO3A 3PITA 4D82A 5F98A 1CBUA 3CH5A 4Q4AB 1S2MA 1NP6A 4PAOA 4B44A 3GLGE 3BFKA 4PHFA 4HAZA 5FR1A 2B7CA 2X2EA 1NN0A 2J7PA 4WOPA 3DKPA 4GP7A 2HXSA 3AVOA 2JDIA 4IFBA 3HU2A 1OB2A 1Z6AA 4C7OB 2HDNB 1FMLA 2GBLA 1Q1ZA 1NBMD 1Z29A 2WM9B 1WE2A 4Z54A 2F1HA 3LVRE 3C8UA 3W3ZB 3U44A 3ZIAD 1SVMA 4DXAA 4IDPA 4DDWA 1IN4A 2JLXA 5GJCA 1Q22A 1KI9A 1ZD1A 2IYSA 2PEYA 4JBWA 2XB2A 1VCMA 1XEWX 2DFLA 1YE8A 4RSGA 1MO3A 4CW7A 3RS4A 5IDVA 1E96A 4CEJA 1C1YA 4JKYA 3TK1A 1Z83A 3SZRA 2I4IA 4EPXA 4HB3A 2ZJ8A 5F9FA 2IWHA 5CLLA 4DT1B 4K46A 2IT1A 3L2OB 3WNDA 1N6RA 3FKSA 4TMTA 4YC7A 2O0HA 4HB0A 4L16A 2IS2A 3WY9A 2QN6A 3EPKA 3SJBA 4NCNA 1G5RA 1CRQA 4XTRA 2WPDD 4NONA 3HWSA 4QG7A 1YR7A 1SXJE 1JR3D 2ZRGA 2ZSDA 1CULC 1JI0A 1PV4A 2BKUA 2O8EA 4KBFA 3QUSA 5J4YA 4FCVA 1OH6A 2GZHA 3HPRA 4LC0A 2IA5A 3W6PA 4B3FX 3ASZA 1E2MA 1UDWA 1Z2CA 3TW4A 3EAQA 4BE7B 4OBEA 3SEAA 4B76A 2BDTA 4BZPA 3GFTA 2AFIE 2PCLA 5IK2D 4GL2A 1S9HA 1SKYE 1N0VC 3CO5A 3BFVA 4NTZA 2JEOA 3THYA 1VG9B 3QVVA 1KAGA 4Q1CA 3FMPB 4NE2A 3LQRA 3AVVA 1Z5ZA 2VSFA 3AP1A 4RFVA 2YC4C 1XD9A 4KVAA 4YONB 2EYQA 1O3YA 4TLCA 3R20A 2WJIA 5CYPA 1DS6A 1ZD9A 1L7VC 4JYCA 3AF0A 3T1TA 3M0EA 2GKSA 1W2GA 1UFQA 4TQ9A 4DKXA 2GAAA 2YOHA 2Z6VA 5B2ZA 1J7KA 3IEVA 2ZU6A 1E99A 4NYMQ 1ESMA 2ZIAA 1QHNA 2ORVA 3QXCA 5CITA 3K09A 1FW6A 1FX0B 1D8TA 4DCVA 1SVLA 1Z47A 2VP5A 2KBFA 3CZQA 2WWWA 5DYGA 4B6FA 2CJWB 2OCBA 1LTQA 1N3BA 1DADA 2WOOA 4Q18A 2GZDA 2A5GA 3AF1A 1H8HA 2ZR9A 1EFTA 4Q7MB 2JIZA 4RD4A 2IF0A 2ZI9A 1Z6XA 2QAGA 3RYTC 3B85A 4LV6A 1OHHA 1W5SA 2G88A 1R10A 3WMGA 2DCUA 2A5DA 1DAKA 1KMHB 3L8YA 4DSNA 4J0QA 3KKOA 4Q9IA 3ZZTA 2BV3A 3GJ0A 4XH9B 3UATA 1FP6A 1P60A 3HYRA 4BQSA 1XX6A 1I4DD 1R0XA 4DLVA 2EFHB 2HCJB 4DRZA 4UJ3A 1W47A 4AKGA 1UADA 3BJIC 1KK1A 4LSGA 1VG1A 1U9IC 1HE1C 3WP0A 3EPHA 1IN5A 2W83A 3OAAD 2D74A 4JVMA 4OK5A 3VR5A 4RD2A 3WXMA 1E2FA 1UKEA 3I5XA 2HT6A 2FSFA 3ZVNA 1U0HC 2GA8A 3W5IA 2YV5A 5FBWB 5JI2E 5FOSA 4IXNA 3OEHD 1ZCBA 1IQPA 2V9PA 4WZ6A 1MO6A 2ODNA 3U7GA 4RZ2A 4M9XA 2WWFA 1H65A 3SU8A 4ILEA 1Z3IX 3RS0A 3GQBA 2HLDD 3VAAA 3VHLB 3JZMA 1RJ9B 3RSOA 4D2IA 1LVGA 4DCUA 2X8AA 1CRPA 1W4AA 5AJXA 5AK0A 2OM2A 1XXHB 1QHXA 3L0SA 4P4SA 3NKVA 1SVSA 1QRAA 2QU8A 5JJLA 2QSZA 1E6CA 2IHBA 1DAIA 3MJHA 2QBYA 1X1RA 1E9FA 2A5JA 3ZYCA 2QNRA 5B64A 3KKQA 3NTUA 3SC3A 5HZKA 5FUXA 4DLUA 4WIAA 4NHOA 2XTNA 5TDHA 4MUBA 1L4UA 4PSVA 1RFLA 2ZROA 1N5JA 1T3LA 4YMWA 2PLFA 2UZ3A 2WSSD 3BD9A 5KDDA 2FOLA 4G5QA 4RZ3A 2ODWA 1ETUA 2ZJ2A 4TMVA 5EP4A 2DHRA 5EP1A 3T15A 5J4LA 5FPSA 4F7WA 4YMVA 1QF9A 1UKZA 1XEWY 2ODBA 4QBFA 2FZLA 5D3MB 4Q1BA 2H57A 3UKDA 4R71A 5FPTA 1KO5A 2QL6A 2OG2A 2RGEA 3ZQ6A 1E0JA 4WW0A 5KNDA 1KOFA 3BERA 4LI0A 3HJNA 3U2QA 4TTQA 1EK0A 1SVWA 5DE3A 4NMMA 2GXAA 3UXMA 1S0UA 4GPTA 1KI7A 3VU9A 3EA0A 3I3SR 1Z0FA 4IOKA 4PZLA 5E3HA 821PA 4BASA 2GEDA 3GLHB 1XMVA 4IXMA 2C77A 3VNVA 1JJVA 4DLTA 4RVCA 3CM0A 5CIWA 1Z22A 3KQHA 3AGQA 2RGDA 4MQBA 4S35A 2HT1A 3NBYC 2W00A 3R9WA 2RAPA 1XZPA 4RKFA 2H18A 3WHLA 4OI4A 1BS1A 3VKHA 5FOXA 4PC6A 2FFQA 1G291 2NG1A 3O8BA 1GIAA 1BOFA 4B3CA 2KJQA 1ZMXA 1E2NA 4GFDA 1KIMA 5EQTA 3O8RA 2F55A 1XMJA 4BEJA 1NRJB 4B47A 2VLIA 1D2NA 1G8HA 2C8VA 4PX9A 4I99A 2YWHA 2CE7A 3TQFA 2QE7D 1NNEA 1N6HA 1DAGA 4LYFA 2OBMA 4ZIRB 2G77B 4KI0A 3GD7A 4BFXA 3CBQA 3MRSA 4D0NA 2RGAA 4KYIB 1ZIOA 1OF1A 3KKNA 2IS6A 2ZJZA 3LFUA 3ZZ0A 2OILA 1ELOA 2VQSA 4Q7KA 4CF7A 5E4FA 4JLDA 5DHAA 5SZIA 3BH7A 1BKDR 5GVRA 2ZETA 5HKKD 3SDZA 1CTQA 5J5CA 3QPUA 3LBIA 3N5CA 2AK2A 2PMDA 1W0JA 3OE7D 4MKHA 2ZM5A 2G6BA 3QF7A 4Q4AA 4IOLA 1E2QA 4R7ZA 4XWAA 3IGFA 1L4YA 3AQ4A 1HT2E 4PR0A 3F8TA 4A8JB 2YWGA 4E03A 4IEIA 3LO5A 4L9WA 2F1JA 2QP3A 1OIVA 2XOKA 4C7OA 1W4CA 1KGDA 4EPVA 5AJWA 5L3RA 3Q5DA 1UKVY 3BWDD 3X1DA 3ADBA 4UNSA 1WRBA 3FVQA 3H1TA 3A58B 1YZKA 2ZYVX 3N2IA 3Q72A 4I4LA 4XTCS 5CB8A 4G5SA 3KXLA 1GITA 2ERXA 5EE9A 1ZM2A 1WBBA 2WWGA 1OB5A 4C2TA 2ZUCA 1G16A 2IC5A 4A0RA 3RC3A 4FXPA 4TMWA 2IBMA 3IHLA 1W5TA 5JS7A 2REXB 2WIAA 3KJIA 2YVUA 1DO2A 4LHWA 4RCYA 1U8AA 4M8NE 1LF5A 4XVUA 1IXZA 1YU9A 2C99A 1E2HA 3M1IA 3BFXA 4DT1A 4L5BA 5F9HA 2GEVA 5EE3A 2DY1A 4BLPA 1KYIA 3CONA 2JLQA 4EDHA 3HP1A 4H1UA 3FFBA 3TNFA 3W6NA 2Q3FA 1PJRA 4RZXA 3GPLA 2J41A 3MJRA 1Q21A 4LV5B 3FHOA 2FWRA 3UWOA 2D3WA 2IXFA 3OFNA 1UPTA 4A2PA 3DEFA 1HV8A 3BB1A 2GILA 3D7MA 3KDSE 4Q5IA 3VR4A 1SQ5A 4LJ5A 3NDPA 4B3GA 4RKEA 5A0FA 5KSPA 1P2UA 2F1RA 3CPEA 3OEEA 1OXVA 3MWLA 4JLBA 1XMSA 3PUXA 3E70C 2A5YB 1E0AA 3A1VA 2Q9BA 2WWXA 4O2LA 3WRXC 4CT5A 1M7GA 5L3SB 1ANKA 4NCJA 1KO1A 1AZSC 1OFIA 1Q1BA 4MGYR 4LZZA 5DO9A 1JB1A 3RWMB 4A0FA 2JA1A 4V0NA 4RD1A 1UKYA 3TBKA 1E9DA 3N70A 1GZSA 2QRZA 3SJZA 3GJ7A 2AFHE 2MMGA 4M9QA 5LBIA 1E9BA 5ELXA 1YZLA 2AKYA 1P6XA 1G7RA 2REOA 1X6VA 5KSYA 1KDPA 5HZHA 1HE8B 4DLSA 2RGGA 3QPWA 2GTPA 2FF7A 3ZQJA 2QA5A 2PX0A 3NDBB 2ZQ5A 4O3MA 1ZUIA 1LB1B 4IOJA 1P2SA 2QM7A 2ZRCA 4P3YA 1FX0A 1A7JA 1S1CA 3NG1A 1QG4A 1SVKA 1N6OA 1DG3A 2J45A 1MR3F 1WP9A 4URZR 1GDDA 3LD9A 1FTNA 1AK2A 1ZNYA 3CF0A 5G3ZA 4BFTA 3KXIA 3AVUA 3CZPA 1VPLA 2FNAA 2XSZD 2IXEA 1G5PA 2BBWA 2X19A 4QXAA 1OH5A 2XXAB 1W36C 2IF2A 2FMXA 3C5HA 2B21A 2VYFA 1KKMA 2OO7A 2OFWA 1OXSC 2ZRHA 2FEOA 3K0CC 1RPZA 1TUIA 1VCNA 1VHLA 1TQDA 3A4LA 2VHQA 4F38A 2GVDC 1M7BA 2RGCA 4EFMA 1KMHA 1SXJC 3VR1A 1RVDA 4NCKA 4LJ6A 3F5FA 1GFIA 4C0HA 2PBRA 4MRVA 4Q9LA 3EZ2A 3B1YA 1DAHA 1COWA 5BYJA 3GLIB 4V0MA 2NQ2C 3CWQA 1GTVA 5C18A 2PJZA
chains in the Genus database with same CATH superfamily
1ZW1A 4WVFA 1WXFA 4WY5A 3T7CA 4MWBA 2PUDA 3AVYA 5CEJA 4XLLA 5TMBA 1G6HA 2QLNA 3KTAB 1J2YA 1YGYA 2W0MA 1P29A 5EESA 2XOEA 1V95A 4OA8A 3JQ7B 1RRMA 3JASB 4DCNA 3L3BA 1O4WA 5CFQA 1GQQA 3FB4A 2RKWA 1AD2A 1X8LA 2ATEA 2VYQA 3I09A 3JAKA 4TTJA 4WN9A 2Q2QA 4B2LA 3JQ8B 3TTTA 3F7OA 1X9HA 5JNVA 3DE1X 4F2PA 3G8BA 1KDVA 1E9RA 2QUHA 4C4XA 3R3VA 3Q7EA 4H7KA 4J1SA 2FSVA 2YWXA 3K3PA 5PGMA 2DQ4A 2DFKB 3I6QA 5EMKA 1A27A 4TYMA 2OP0A 1HYQA 5SV2A 3ILYA 3PIRA 4KNVA 2QYHA 3D5QA 1BEUB 4BMSA 2MIIA 4O4LB 1XXHA 2KW5A 4RQUA 4XB6B 3O1IC 5ELLA 4CKXA 3OZRA 3L4JA 1PS9A 1UQUA 4OQQA 1HH4A 2AMVA 1E9EA 1V45E 4LTMA 4NAHA 1WXHA 1TM5E 4UVEA 5L6MB 4MHSA 3SHFA 4HBZA 3JZFA 2XNCA 1X7DA 3M1LA 4INOA 2ORYA 1MPXA 2HHCA 5BV7A 1E61A 2ZSJA 3JQAD 4XPIB 4ENWA 3AV0B 3DDWA 3DKIA 1O1YA 2W6JA 4UMVA 4LJRA 5AKHA 1E6WA 1ULTA 1UEXC 1IOVA 3A9VA 3NHZA 4NABA 3C97A 4O63O 2VDWA 4LHSA 2MSCB 4U2EA 1MCZA 4CDMA 4WLEA 4Z4IA 2OV8A 1SQ0A 2CMHA 2P65A 3QVXA 4C0JA 3MTEA 2RBGA 5DI9A 4YLYA 1I8TA 5IANA 2GWHA 1DQNA 3U3OA 4G3XA 4PZ0A 4CN8A 3O2NA 1A4XA 4DV1B 2ID4A 2PUEA 1Y1SA 1U3CA 2BW0A 2WIJA 1R9MA 3W6OA 4EQ6A 3U6KA 4RHCA 1PDOA 4XD2A 4OQXA 4XQEA 4GOJA 4RDCA 4IKEA 2OCYC 2YIVX 4EYEA 2I9KA 4QFBA 3OU2A 2WU3A 2XTJA 5HK9A 1I01A 2ORIA 1QVWA 3GLHA 1I5OA 3N0RA 1RZVA 4YCJA 3UYKA 4HEQA 2HF9A 4BNTA 4J03A 1B3BA 3LQQA 4HP8A 5DXFA 5EIBC 4ASUA 1OLOA 1YHZA 3U1VA 3DMPA 1G2IA 2VH2A 1G5FA 5CU7A 2P68A 3FBWA 2HQ1A 2GVNA 2GJ9A 3MT7A 1OIXA 1U0TA 1E3LA 4EEXA 2APJA 3HKCA 4L6AA 3BXOA 3JQDA 3KQYA 4RZHA 2VTKA 3BGSA 5BWCA 3K5IA 4NDZA 2EKQA 1X9GA 3ROGA 4YT4A 1Z0IA 5IKEA 1N5KA 2ZAYA 3TM5A 1XEFA 2ZZKA 2BELA 3GRAA 3TMKA 1JG1A 2VH5R 2WF6A 4D8VA 4BFLA 4ZV4A 4AW9A 1LNQA 1H23A 3RFUA 2BMFA 2NU6B 4AG6A 1JEQA 4QHTA 4TS1A 1D6NA 3ETJA 4FGKA 4X44A 2R6CA 2BEVB 2BM0A 4Y7DA 4BLTA 1C1HA 4EEZA 1ZGHA 3D6UA 2H1HA 5CX1B 2J8ZA 1XDSA 2UUPA 4KO3S 1I3MA 4TVBA 3TZ6A 1WTCA 1SWWA 2OHJA 5CVDA 2CFRA 2QIPA 3P4YA 3KUDA 5DM60 4CV3A 2H2FA 2J5RA 3ZDQA 4JXZA 3BAZA 2BKVA 2W43A 1U3TA 2W37A 2LCIA 1SCJA 3L5OA 2IGTA 3OEHA 1TLLA 3MGGA 3N2KA 1QHHA 3QPDA 3VPSA 1YZHA 3HBFA 3W4KA 4OBXA 3EWSA 3K9GA 4TTVA 3UFXA 1Z2DA 5LA6A 3P2MA 3TJZA 1T0IA 4JJFA 1Z0UA 1AOXA 2XUGA 4G0XA 5DXAA 3L43A 1JG3A 2R11A 3ZK8A 4JENA 3VH1A 4C05A 2FW9A 1N0WA 3HKEA 3RWOA 3JR3A 4G4SO 1X1EA 2CVHA 2NZ8A 2DTXA 3EC1A 4LVUA 3BTVA 3ONNA 3ZWWA 2HK9A 4FX5A 2ARKA 1C2YA 2D00A 5L7WA 3TKYA 3WLJA 1NBOA 3I01A 4J6EA 4XJSA 1HKHA 2NO1A 4Y3UA 1E59A 4C3ZA 1P3JA 5F76A 2UV8A 1HTWA 3RJMA 3JD0A 4P34A 5GM1A 3SDSA 1L5FA 3E35A 4YJFA 4F56A 1MJGM 3LDUA 1P39A 1WZIA 1BH2A 4CLEA 4KIWA 1N7JA 2V3WA 4ZCMA 5IH7A 3K1ZA 1PFYA 4IILA 2XBLA 2FAXA 2JI8A 1HQYE 3WB1A 3AETA 3I8OA 3V4OA 2F2TA 2HOQA 2O8CB 2PTHA 4U7HA 1AT1A 1HNZB 4JITA 1N6PA 1YZVA 1SQFA 5TRTA 3AF6A 3L0BA 1KDZA 4HGQA 4X6YA 3KB2A 1AJEA 1N9KA 4UBNA 4BLOA 4MS4B 4LOAA 1K8RA 2VDKB 3N1UA 3NBFA 2G82A 3DHEA 1D5WA 4DY4A 3PC2A 5K8LA 4MTCA 4AD8A 2OMKA 2EJTA 3IUBA 2HNAA 2NU8B 3F98A 5D87A 3Q8XB 5K51A 1F2UB 1GG8A 1MRZA 2WT9A 4QGSA 1K3TA 5EJ9A 1K5HA 1RADA 3AW8A 4P4LA 4DBLE 2O4CA 4XIFA 3P9YA 1E64A 2J3QA 2ZJ0A 3QW4B 4WX2B 2R6JA 1UJ4A 1Y9JA 2H63A 2OAEA 1XRSB 2DR0A 3HCRA 3IAXA 4R3NA 2EARA 3G9XA 1K3UB 3C41J 1DO8A 1NIJA 1Z0SA 1U31A 1BA2A 1W4RA 3CLTC 4KQHA 4HNGA 1OAOA 4Y18A 4CIVA 1KMCA 3L7MA 1A9PA 2ZI3A 5BO5A 2DMRA 3FF4A 4YJ2B 3QX9A 1Z6PA 4GR9A 2J0SA 1ZBQA 2C0QA 4UAUA 1YZGA 1EBBA 4E5PA 1QZZA 2I2DA 2OCPA 2X8LA 2Z2IA 4OOFA 4UTXA 5L3SA 2KBEA 3BIFA 4D9BA 3DLPX 2X5JO 4YJ3A 1W73A 2XTZA 2GNAA 3RSHA 3D0KA 4RTOA 1SUBA 2RI6A 3C16C 5KVAA 1S8OA 5GQSA 2VHCA 3KL4A 2GX6A 3MLEA 3NIBA 3HH8A 4JQOA 4M1WA 4U2DA 3ZJVA 1FPMA 1U3UA 4RJKA 3UK7A 3TGWA 3IP6A 1KRHA 1GGVA 4DUGA 4DUZB 2C5LA 4PO1A 4QQRA 2OBYA 3EA4A 1S2NA 3VKUA 3DA8A 3GL9A 1QGUB 5EJIA 3ICWA 5F3WB 4I46A 2A2ZA 3CUVA 1UBNA 2QJWA 4NE7A 2Q4DA 5AMXA 4RHFA 5LBUA 3HXLA 3R6WA 1ZA1A 2PX3A 3B1KA 4MJLA 4B09A 1IBKB 1ZOPA 1BE0A 3QI2A 3KOXA 4YIKA 4GP9A 1DV1A 4G25A 1SURA 5GONB 3UAWA 1PWYE 1T5BA 3L8ZA 4RTNA 1L8AA 2BT4A 2WKSA 3H84A 2Z04A 1ESCA 1SG9A 3W8FA 2VNIA 2CKMA 2R00A 4KXNA 3LW8A 1QV9A 2C7VA 1PT6A 2CXUA 1E3EA 4KAXA 4FB4A 2EQ5A 2XYHA 2GOYA 3UMSA 3LUPA 3D8BA 1G5QA 3CRW1 2O8BB 2V1UA 4MW4A 2A1TR 3IQXA 3RU2A 1NBWB 4KR2A 2P4HX 1XZBA 4ZQFA 2NTYC 5CR9A 2XGSA 3DMYA 4BNJA 1VMEA 3T34A 1Y6GA 5B5SA 4LIPD 1P7CA 5HHTA 4DCCA 1J1ZA 5LP1A 3AVTA 1ZIPA 3FYSA 4D8WA 1FYWA 2F1OA 3U37A 4F46A 4AAYA 3SX2A 3E8MA 5F4BA 3MTDA 4PYKA 4PSAA 1QVAA 3I6IA 3PF9A 3RFVA 1WOMA 2X4GA 2ZAIA 1JYEA 5DNUA 3T1OA 5CT4A 3TNJA 5D8DA 3PE4A 3H65A 5FL7A 3GEEA 2ZSHA 3BRSA 4GF5A 1RIIA 1KI8A 4KXWA 4L5CA 5D01A 5B3AA 4Z1MA 4AG5A 2WWYA 3E03A 5EZQA 4C5AA 2PL3A 1QGAA 5KNBA 4M1MA 4F4IA 1POWA 2C8LA 2XPCA 4TYQA 4TL8A 4B48A 1RMQA 3A3OA 3GB9A 1PUIA 1E8MA 2FP4B 4CZ2A 1KYZA 2QROA 1WXIA 4CGZA 1LPSA 2DKFA 3WBJA 1EHCA 1EM6A 3NYQA 4BV9A 3TSOA 4LWQA 1MA3A 3GGCA 4FZJA 3RABA 2OPHA 2PFGA 4RGYA 3EVEA 3QLEA 4I4NA 1DTSA 1ZN9A 2UZIR 1WMDA 4UUBA 5T41A 1KFBB 3PC3A 1HDIA 4RMGA 3NPAA 2PVCA 1ZNWA 4JOBA 2G70A 4AP9A 5IW8A 3DF9A 3ROFA 5HZGA 3K2EA 2YKGA 2HQOA 2YW9A 4UULA 1JQKA 1C7FA 2CW5A 2ZWAA 2D4AA 1FLDA 4IIXA 2DF8A 1CR0A 3GBVA 4UHFA 3WLEA 5JH7B 2VSXA 2I71A 1BE8A 3OF3A 4A23A 1PT7A 4DANA 1J97A 4LA4A 3U61B 1BX0A 3FNRA 3ZOZA 2WG0A 4BTLA 1EVQA 1DARA 1K1EA 4L0QA 1U81A 4NOLA 1GEGA 3I4LA 1IZ0A 1O97C 2N0SA 4MQ4A 1QSGA 1IBMB 2I4RA 5HTKA 1K9VF 3AHCA 1SC6A 3VYTB 4UOEA 4CKZA 1CZLA 3OZWA 3AF2A 1NPYA 1KSFX 2BKAA 4J0JA 2BGIA 3RVQA 3H86A 4DYDA 1GZDA 2PX4A 4M8LA 2P2LA 3QVOA 4CL0A 1B8UA 1CP3A 4JA0A 2RAFA 1Y1QA 3LE8A 1PL0A 1S2DA 2BL4A 2ZRQA 1YO6A 3EVFA 4JSTA 1I94B 1VJCA 2C31A 1AB5A 5FJJA 1KMIY 4BO7A 1PEKE 3MCUA 1F14A 4Y6LA 1QLHA 3UGKA 3ROPA 4PEVA 1J2RA 4OFZA 4UHHA 1GZUA 4PHTA 3GJ4A 3IKJA 4C30A 1U6JA 4ZEOA 1NNSA 1PX0A 1U2RA 2IVFA 3FFWA 2WJWA 5EEGA 1ULHA 3EY9A 4JP5A 5KTMA 3O8QA 1UH5A 2AMYA 1GUFA 4D56A 2MWMA 1U3GA 1X1DA 2SCUB 4RIGA 1MQSA 3COSA 2XH8A 2FZKA 2OFPA 1TUBB 2HDHA 3C3CA 1B00A 3PQ4A 4HSGA 2EQBA 3KO8A 2G67A 2VF2A 1GTSA 2NTJA 1O9GA 2HF7A 2FQYA 1VG8A 2VJPA 1R0LA 1GFSA 1L9XA 2X86A 3ENZA 5I51A 1AKUA 1AF7A 1GJRA 1JLMA 1Z8HA 4EOGA 1C3EA 5JXJA 3EH1A 2VP3A 1QYIA 2CLSA 1U1DA 4MKGA 3CYFA 3IP7A 2GYYA 3VSBA 3K72B 3K9HA 1ENOA 1Z26A 1Z4PX 3T5PA 3CLRD 4O4JA 1QHGA 4W4TA 4C14A 2J46A 1JHPA 3LSTA 1JHDA 3R1IA 2JJ8A 1L7DA 4K03A 3K5PA 4JBLA 4MP6A 3T1YB 4LBWA 1PFWA 3A1TA 4GR5A 4H15A 3A1CA 2A0YA 4IWYA 4K7JA 5F5LA 4D7AA 2ZBPA 3NFRA 1NRXA 4ZVOA 3FCCA 5E4JA 3VU8A 4YRDA 3I2GA 3JWHA 2I6GA 1G63A 5T6BA 5DCYA 1JTFA 4E6EA 3WGNA 5ESDA 3PQ6A 1B1CA 5KYNA 1R64A 3HLTA 4DBVO 2X5NA 1CJUC 1UM9B 3A1UA 1JUDA 4EHLA 4EY6A 3NBQA 4EQ6B 1AA6A 2J32A 3FW1A 4KYVA 1T3ZA 4IY1A 4JWTA 4PGMA 5CGZA 4DMHA 1TNDA 3MQ4A 5EJ5A 4M7WA 2QLJA 3QK7A 4HLDA 4GOOD 3QITA 1RWOA 2Z5FA 1ZLYA 1DDGA 1PJCA 2VHVA 4WWHA 1ZCAA 4DWVA 1R8XA 5ALMA 4D57A 2P0EA 4WTOA 3LDFA 4C1BA 3TR5A 2AN1A 1XMQB 4RAOA 2X42A 2HA5A 3N76A 4UU1A 5KAMA 4CM4B 5CCEA 4J07A 3QLJA 3DR5A 2JLVA 1HNNA 3CR3C 2JDID 1VB5A 2K87A 2YVKA 4NENA 3O94A 3QPBA 4RUKA 4BQOA 2FETA 2VP9A 4XJVA 4FDVA 1GAJA 3K1YA 4UDOA 4YEDA 2A0FA 5TC4A 1T5OA 3KAQA 1T0BA 2OGUA 3O8OA 3NXKA 1F4VA 2MT9A 4W9MC 4GBMA 1TAGA 2BMDA 4Q1AA 1W46A 4MW2A 3NALA 1A1VA 4PU0A 1UDRA 3B53X 3BCRA 4CKEA 2HU2A 4LZLA 3TH5A 1SHLA 2DH6A 4BVKA 3T52A 3Q6IA 5JNRA 4O02B 4RVUA 3BTUA 4GX1A 1P1FA 1R18A 3QH4A 5INTA 3J81A 2ZIUB 3O03A 5FPYA 3IPYA 1SKYB 3GC6A 1DJPA 1QHHB 2VK1A 3D6AA 4RF3A 3S2EA 2XDYA 2JLYA 1B0ZA 4RTKA 3CJRA 4B8ZA 1XV5A 2QM3A 3UFXB 1N34B 2NU7A 2IXDA 5LA6B 4O2BF 4QTTB 4DF3A 5KOJB 1YFKA 2Y0CA 2O0MA 1U94A 1ZKMA 2D1FA 3FKSD 4I55A 2A5FA 5F12A 1X1BA 4BNYA 4BTVA 5IPFA 1ZN2A 3REQA 2O54A 1XUOA 1Z7WA 4HAWA 2WWTA 3DM5A 3TZEA 1I0LA 1G3QA 3L4EA 4POOA 3DMTC 4M98A 3U4MA 2F64A 2YMPA 5DIZA 1OGJA 2ZR0A 5CLHA 5E9JA 5J1TB 1PHRA 3L40A 1E1CA 5AKXA 3CH7A 1YNSA 2HMWA 4UM8B 5KNBH 4I50F 5JR3A 3TR6A 1PJTA 4A0HA 3LKDA 1A98A 1FU7A 2PSDA 2W4QA 2WKPA 3PGA1 2FN9A 3MCWA 3PGXA 3E5RA 2ZYUX 5E6RA 5CDFA 1GGFA 4I1OA 4AS1A 1TQ8A 2D1TA 1FZTA 2VN8A 2H0AA 3A05A 4Y9DA 5BSVA 1E9AA 3L7AA 4BMVA 5FX2A 3OE5A 3PEWA 1HORA 4JJKA 4JOSA 3P1JA 1XJCA 5AHWA 3D3WA 1SHZA 5ARDA 4DPMA 1Z4LA 5D5QA 3OOJA 5KREA 1BVRA 2OZEA 3LKZA 4BZWA 5JRJA 3WXBA 3A9RA 3T35A 4QO7A 5G41A 1PJZA 2Q8NA 3MC1A 5M2QA 3KB6A 4XVRA 5DYYA 3RJZA 2JHPA 3CLUC 2OGSA 2QENA 1SC4A 4ROSA 2FZCA 5CM8B 5FLKA 5JJBA 1T4BA 2R6HA 4MVJF 2J07A 2Q3LA 3GRZA 2W2VA 2Y66A 4HVAA 5E4TA 4AJLA 5EWLB 5KX5F 4YXFA 1ISPA 3CRQA 3CEJA 5AHKA 3KR0A 4UEJA 3VFDA 1EHYA 4TT8A 3NHJA 2OVFA 1GLVA 1M0SA 4BAUA 4C2BA 3JCZA 3CZ5A 3DV0A 5D3QA 2VBIA 3M33A 3SPXA 4BX9A 3NBZC 4P8RA 4KBYA 4LQLA 3VNSA 3T54A 1N1EA 3VDQA 5K3EA 1UC8A 3K96A 1TMYA 1X0VA 4V1CA 4F6LA 3Q1KA 3D3QA 5G2OA 3SCZA 3UAGA 2EZ9A 1S8NA 2Q6TA 3ZYZA 4FD3A 4D4HA 5CFRA 1ZSVA 3DTVA 1JDBB 1RACA 2N1MA 1NW7A 1OKKA 1QC5A 4INPA 1VE9A 2AEEA 2P9GA 2Z2XA 3GCGA 1JHYA 2FSGA 2JCXA 2NUPA 3BSSA 4FP9A 3ILVA 4TXHA 2ZIGA 1AS3A 4HEJA 5C80A 1MV5A 3VR2A 1KVQA 4I7EA 4JLWA 1RCTE 5B3JC 1GP2A 4D26A 1OBFO 2O8DA 1OTXA 2QRKA 1KBZA 4N03A 3OZGA 3JQFC 1N2IA 1QJ4A 3TTSA 1KWKA 1WXDA 3BH0A 3LKVA 1J9EA 4OQEA 3KKMA 1OD6A 3MG9A 4NYMR 3AI7A 3CGWA 3VDMA 5JLJA 3I62A 4UNNA 2DEUA 3B20A 3EG9A 1APBA 4KSCA 2HD4A 1OGIA 1I2MA 1N5IA 2UUOA 1OAKA 3IMGA 3T41A 3TL3A 4CIYA 2J85A 3WK6A 4J7AA 1HRKA 3E61A 3LP6A 3PUWA 1VECA 4XRRA 5AM1A 5WRFA 3DEZA 4O2AF 3OPVA 3RG8A 1XQ1A 3MD0A 3S2GA 2XV1A 3AOGA 2H8KA 2ZANA 2GXSA 2QX4A 4HXGA 3QVSA 4ENSA 2VA8A 2QLFA 3E8SA 4FE4A 1PJ3A 3GJTA 2ONJA 1N4DA 3D3NA 4B3XA 1I6MA 3IHTA 1VPEA 1Q3TA 2DPGA 1U8XX 1KZ6A 1T2DA 1NRWA 2IUTA 2P5TB 2PM8A 1OWPA 1NLFA 3BN3A 4XOIA 3I2KA 3EE6A 5FOTA 5C5EA 4MAFA 1Y3DE 3L6UA 4J7UA 2GDJA 4K86A 5C4MA 2J4DA 3WE7A 2FOIA 4CQJA 5C52B 1M7HA 4LHVA 1OXBB 3KPUA 4X24A 3PNOA 5IEBA 1UDAA 2GZRA 4QTXA 3SQLA 1S5PA 3AB8A 2CLMB 2PU7A 2XWSA 3HO8A 4R9SA 1UBFA 2ZVJA 4IDEA 4CCYB 1Q6YA 1XZNA 1ZD5A 2WC1A 1PWZA 1ZMOA 3D1JA 1TVMA 3Q9LA 3L7NA 4ZZ2A 1XKLA 5A5FA 3B82A 1XD8A 1BVUA 1Z7YA 5D7BA 4FDLA 3W34A 3BK1A 3FWHA 4KVZA 2Z43A 4BATA 2HH9A 2V7UA 1I1NA 5DYTA 3DYIA 4R9UC 2HU8A 2ZUUA 4Z3OA 4Q9JA 4R7GA 4RK5A 1KR2A 2C2BA 2CLLB 1RNLA 3LOPA 4J2OA 3MJTA 3T5CA 2JCGA 4XJTA 3KYIB 3LY7A 4MCAA 3IUSA 1OPRA 5BRJA 3H9EO 4UAVA 1L7OA 4LRUA 3NDIA 4LDZA 3W2IA 1KK0A 2QJRA 3KM0A 2IUFA 5DYWA 4E1AA 3ECSA 4KYUA 3LQ4A 4JH0A 5FPHA 4D8YA 3E6AA 1IBCA 1I32A 1TC2A 4CT4B 3TLCA 5DU2A 4TQUS 2EG5A 2WE8A 2Y1LA 3CT4A 1F0YA 4FQ7A 4R2IA 4TVOA 3WGQA 3IBTA 2OKGA 2F43A 2KLHA 3ZDEA 2ZR7A 4BFVA 2XZTA 5AJVB 5BR7A 3JWGA 5JQWA 1A9YA 4HXYA 4WCFA 2PVSA 1OI4A 5DHSA 2ANBA 1PVOA 3MJEA 4FLEA 4YJDA 1EQ2A 4D9NA 3NT2A 3IPCA 5KWVA 2V74B 1D04A 2GETA 2C2MA 2VG8A 3QEOA 4Y6PA 5F2NA 1B8PA 4FONA 2AN9A 3EFOA 4H18A 1TU0A 1CDEA 1B43A 1MXFA 1EH5A 3VC3A 1WHSA 1DKNA 1K7EB 2GMWA 1V43A 2VI5A 4P33A 3Q8LA 1OTYA 1PKEA 2UYHA 3V4SA 2H65A 1QP7A 1JG6A 3FMGA 3CEHA 5J5AA 3M3DA 4ACAA 1EWRA 1NG1A 5FDFA 4KWIA 5H9VA 2IRWA 1LDBA 3DL4A 2IV2X 3DXXA 4MUJA 4AY2A 5LQRA 3Q6MA 4MUFA 5AO9A 1ULSA 5B7PA 1TEXA 1HFEL 2PVPA 1SXHA 3JVVA 4M1KA 4BJHB 4ECAA 3BCSA 2W8ZA 2DBYA 2Z95A 1QG0A 3WAJA 2W6MA 3QA3E 1ZAYA 4BJ5A 4I9NA 3T4XA 2GPYA 4YMLA 3K6KA 5CTJA 5L8VA 2BSXA 4GBED 2H1IA 3TZHA 3W05A 4HWSA 2IYPA 4AY4A 1C7RA 5GY7A 4HWKA 5JARA 2I1LA 3AHIA 4FYMA 4J1TC 3TCXB 5TLSA 3AU9A 2WMYA 1L7BA 1DZIA 2QEQA 4OMCA 2GCOB 5DSXA 3CX4A 3V8MA 1N3YA 2VHXA 3ULKA 1U2TA 4UOQA 4EGSA 1ID8A 2GEFA 2JF0A 4P53A 3I42A 4LG1A 4CIWA 5TS2A 3NNNA 1FLVA 3WDSA 2YH2A 1DHTA 2R7AA 4KMRA 1CQZA 3WIEA 3D8TA 2GEUA 2VLBA 3OFSA 1V5EA 2PA0A 4RWEA 4ITVA 4JR0A 3D6HA 1GYRA 1PQYA 1V1JA 4EG1A 5KTYA 2QVCA 3ZHYA 1GSOA 4XR4A 3V3TA 5FOQA 2FK7A 5CVUA 1W0JD 1EZ1A 3O1LA 4O4JB 2QRNA 3TEFA 5C4IA 3QKWA 3FPLA 5EHNA 3ZUGA 1XKQA 4MKIA 1PSZA 4B6OA 3FUTA 2VEDA 3RTGA 2OY0A 4XEUA 4I9GA 3BS4A 1YKGA 3X1MA 4AVYA 5L40A 5JFGA 3KQMA 3BMNB 4TTRA 5JATA 2O2IA 2D8MA 1JR6A 3JRNA 3GLRA 3U3DA 4B4KA 1ZD2P 4ZYUA 4CQLB 1JA1A 3W5UA 1HSOA 1ZN7A 3DOEA 4EHBA 1FXSA 3AXTA 1NVFA 1IHYA 4ZVLA 3ANNA 1USUA 4G6ZA 4D4IA 3F1LA 1U4NA 1TA4A 1UPAA 1XNHA 3F6CA 3IP5A 3THXA 2ZUEA 2O8FA 4DJTA 4LQ4A 1H42A 4UE2A 5AT1A 1WW2A 2PSFA 3Q4GA 1US8A 1UAGA 2V3VA 2R8OA 3RC8A 4C0BA 4BEWA 1L6IA 3F0TA 2H4HA 4GYKA 3IKVA 4MS3B 3KHKA 2JH3A 3W5JA 3OWXA 3R0XA 3CVUA 3DQPA 4BRSA 5BWOA 1KJNA 4WAUA 4PHGA 4RNDB 4HNAA 3VKGA 1VZ3A 1Y8RB 4J75A 1EDOA 5K3BA 2B99A 4UUQA 4DCMA 4YXWD 3FPFA 5K05A 1EESA 3LT5A 1BMQA 1Z3CA 1J8FA 2F17A 1ACJA 4OJQA 3SHVA 4HDQB 1SQGA 4EYQA 3D6MA 1Y6ZA 5ALJA 1IMOA 2HU7A 4NENB 4YRFA 4MZXA 4LCJA 2Y92A 4Y2PA 4BU1A 4NMXB 1BDIA 2G71A 2BHLA 2D62A 5BVHA 5DNYB 2QT1A 4E30A 4GM4A 3V4PB 4WBXC 4YCNA 1HK7A 1RAAA 2CCGA 4OHXA 3TVTA 2R86A 5DWDA 2FEXA 1U2ZA 1R88A 1XBTA 2VT7A 4EYOA 1M2OB 3IHKA 4HZUB 4UU0A 4WBNA 2OO5A 3EZLA 1P3DA 1TD1A 2AV6A 2ATVA 1ZHOA 3EIQA 1G6OA 3IT3A 4AF7A 1DIGA 4CKEB 2VNAA 1BMDA 2R87A 5HE8A 2O5VA 4J9VA 4BVFA 4BQEA 8ABPA 1ABBA 5EIWA 3P97A 2WSSA 4D0RA 2FEPA 4XM2A 1IIRA 4DR5B 3W78A 2Z3VA 3KUCA 3X1XA 1SHTX 3CUYA 2OHHA 4BNGA 7AT1A 3FFTA 3ZC3A 3V32A 1R5JA 2F8TA 3C6KA 4JHXA 3REQB 2GCPA 5KEIA 5B58C 1RJWA 4C6RA 1GL6A 3RANA 3DPUA 2QIOA 3IDAA 1T3HA 3PUKA 2WHXA 3L7IA 3SLGA 1T4GA 2H4FA 2J9YB 2BISA 3RS2A 2H2WA 3TE7A 4B3HA 5JD6A 3CC8A 4G84A 1QDEA 2IDZA 4Q3NA 5GV8A 4US1R 3T61A 1YTUA 1EE9A 3NV7A 2ONYA 1WSAA 5KCMA 2ZSKA 4LBYA 4ZAGA 4TGLA 1FVXA 1XHFA 3F7NA 3IAHA 4WK0B 4QRHA 4WKCA 4PFSA 3TD6A 5EFZA 1HYEA 3L6RA 4PPFA 3TMYA 1NE7A 2EU8A 1TEHA 1VIDA 4MW9A 4ANFA 3SQNA 5BSGA 1XJQA 3V8RA 1P2GA 2WOJA 4GSYA 3W2TA 4D6XA 4XVHA 5DI3B 3MIIA 3QA9A 4MWCA 5B58T 1RE1A 4Y67A 3COYA 3MYRA 4ENVA 4TPKA 5IVIA 5BN4A 5JW6A 2YVLA 2WIBA 3HRKA 3HE3A 3M1YA 4E70A 4WVLA 1TYZA 4PCUA 1CJKC 4IJQA 3X2SA 3QY9A 1BHSA 1FZQA 2XUAA 3NOVA 1UWVA 5CVEA 3PLRA 4Y1EA 1XU7A 5DYIA 1RKVA 3VDXA 4ND4A 3CEAA 3W5HA 2VO1A 4WZAA 1JZQA 3MLBA 1OT5A 2ECFA 2EBHX 3S1AB 2DWCA 1COWD 5C5IA 2PCJA 1A2OA 1A8HA 3DV0B 1N9GA 4PX5A 4MB2A 4U0JA 2J3DA 1J00A 1UAAA 4BQQA 1YFLA 5HP4A 2CCJA 2YWBA 3O2QB 4CMHA 1JB9A 3HVJA 4B1FA 3SKVA 4ZDKA 2VJYA 2ZRLA 3FSRA 2BDEA 2RH5A 3HP7A 4I6EA 4NH4A 3RC7A 1NR1A 1RYZA 1UPBA 2O2ZA 4AXBA 8GPBA 4RU1A 1E20A 5AI0A 5K0GA 4LBVA 1HMPA 2E9SA 1L8XA 3TIVA 2OK7A 1WEKA 2NUPB 4NH0A 4F71A 5JFTA 5CYOA 2J5BA 2QW8A 3IEUA 1YDHA 1S01A 1WB5A 1IEVA 3UB3A 1ML3A 1U2EA 1PO7A 3O6VA 1R50A 1NIPA 2X22A 4E4TA 1E32A 4GOLD 3QKSA 3VUEA 3M4YA 4LTDA 2HA6A 3ANSA 2VJCA 2DY0A 1ZNXA 4L57A 5A6SB 2W48A 1UP4A 4QT0A 3WKEA 4CM6A 3H2IA 1FCJA 3P2EA 3WMWA 1KI1A 1V5GA 2ZJ3A 3H2BA 4D5EA 1B1AA 1OLUA 2H4ZA 3KPVA 4N5HX 5EE5B 2WJGA 3PI7A 3ZHCA 5U9CA 4KWEA 1YBFA 4LXGA 3B78A 2RC6A 3HVKA 2YMLA 3FPHA 3EN0A 3AM1A 4RPJA 2ZRKA 3PQ5A 2I67A 2YYZA 3PTZA 2BWJA 4L4ZA 3KWLA 4JT9A 1W5BA 1JAIA 3DONA 3ZDYB 5JBNA 3U4QA 4KQFA 3VM6A 3EQ7A 2W6JD 4IR7A 1A9XA 2M1XA 2Q4TA 4W82A 1SUFA 1SUSA 5DM4A 2WU1A 3L0OA 5AVUA 2GLXA 4IHKA 1MX9A 3E58A 4YRKA 1O94A 2BE9A 4ED9A 3ICCA 5A3QA 4O29A 2Y99A 1UMCB 4L4UA 3V7YA 4DXDA 3Q8MA 4MH0R 4AF6A 1H2YA 1Y63A 2QMOA 3EVAA 2P78A 4IHJB 1M76A 3ZIUA 1WU7A 2ZBEA 3LRPA 2WYWA 1UJ2A 4YAUA 5HYVA 3GOQA 3A9UA 3UTDA 1UBOS 2QRVB 2A9QA 1A2KC 4MARA 3PD1A 2ZIXB 3QMPA 3MINB 1DAPA 1KORA 3KYCA 4J1NA 4BY9E 2O8VA 4PVCA 1J20A 1WQ3A 1QQ5A 2NW6A 4BP8A 2WYUA 4AYTA 3GJ8A 3SBXA 5MFPA 1M1YB 3D5EA 1D7OA 1SIOA 1IZ7A 2AHRA 1ZAKA 1QB7A 3GW8A 3HJUA 5JYDA 2QP4A 3ZLTA 4A16A 1IOLA 1YUNA 1NVXQ 4F5WA 4HGOA 1DTEA 4KE9A 3KKEA 3K6SB 1CIVA 4E2ZA 3ER8A 2ABWA 1CVIA 2HLHA 1ODSA 1D6JA 1GCUA 1ZUD1 3BCHA 3BXZA 1GL9B 2R96A 3FR7A 3MUEA 4ASUD 2XMZA 4HCJA 1FUKA 2XF2A 3Q7QA 3L8DA 1A95A 4OFXA 4I36A 1IY2A 5JASA 1U8CB 1K5GA 3LFTA 3I5MA 1SIWA 3FAZA 1NU8A 3K2BA 3EX7C 3F97A 4XDYA 4X7BA 1MC4A 1W1IA 5GADl 4Z4FA 2EW8A 2ZBQA 2HY7A 4B82A 2V55B 2XJ9A 3KLNA 1F2TB 1NPTO 3KXKA 2BHTA 1QX4A 2M1ZA 2FSHA 1EZ4A 3DL7A 1EXDA 3EIUA 2BFAA 4DBZA 3K6JA 3OKCA 5CH3A 5AHRA 1DXHA 4WY8A 5EJ6A 3PFFA 1CUBA 3EFOB 5KPDA 3KQKA 4OAQA 4B0PA 4BLUA 1M72A 1MNQA 4MROA 1H9BA 3CMMA 4IDDA 3VZRA 1KEEA 1R6XA 4J8PA 2CHEA 4UFNA 5BSWA 4D44A 2QN8A 3AY3A 1NZFA 3KQSA 1BWSA 1ICIA 1NLYA 1XU9A 1CQJB 3OLVA 1U2GC 4YYZA 3H1BA 2B8WA 3ETEA 4A1FA 3IQIX 1XF9A 4FDUA 2I62A 3AKYA 2HQSA 3DT6A 4W5TA 3U6BA 4RC9A 5AK6A 1GZ7A 4GSLA 5G0VA 5TS3A 5LUAA 3WOHA 4Z9YA 4N39A 4J4BA 1E1KA 1TRKA 1Z4KA 2P3LA 4BNZA 3UJDA 5LOVF 5KYUA 3P9NA 1ODFA 2HSGA 3V8VA 4BZXA 1SA0A 4CLOA 4DSUA 5IZ4A 1CVRA 2FZVA 1A96A 1J21A 3CXUA 1W48A 4V3CA 2DWQA 2J1LA 2PGIA 3BL6A 3EFHA 3ZJ4A 3ISTA 3GMSA 3IP1A 4K9MA 3RGGA 3G1UA 4MKFA 3HXMA 1I3LA 2G0TA 2V03A 2GFHA 3HDVA 4G63A 4G0QA 3T7TA 4X00A 4TQGA 3EEQA 4K3VA 1LJLA 1MDBA 5J2UA 3GPCA 3HWX1 1O95A 2RDMA 4RJJA 5EXXA 4O1MA 3UMRA 3SQDA 4CF6A 3RS5A 3QKRA 1MOSA 5BQ5A 4EJSC 4JEUA 3QU2A 5JU6A 5ICGA 3ZNQA 3OTHA 3WDLA 1LWOA 3HVRA 1ZXLA 1T3GA 2AQHA 2IIPA 5FUQA 3B7WA 5JWOA 2RH4A 5BR4A 1XCJA 5AVOA 2R6FA 4LECA 1U5BB 1P7PA 2O07A 4OHVA 5EHGA 1ZJYA 4P31A 1IY1A 3ECCA 3QLUC 4PLZA 4LDAA 4W1RA 1RU3A 3K0EA 4R16A 4AWBA 2HGSA 2PRYA 2WAOA 4HEHA 2PQ2A 1RM3A 2J7PD 3TZBA 1F9AA 1G18A 5AW6A 1EPUA 4N8SA 1WKCA 3BZBA 1E6UA 1CZNA 2V4MA 2ZSIA 1YDEA 1CZKA 4FDMA 3WIOA 2Y1DA 4COOA 2VYCA 1V9CA 1KAHA 5KBYA 2OHIA 3CUKA 4LGYA 1J8DA 2IYYA 3U7RA 5LDHA 2H4YA 1HKUA 4YALA 4MKRA 2QTCA 3IXQA 1IYZA 3S3TA 3UCXA 1RM4A 4FFBA 3BWVA 2IUUA 2P30A 5FHQA 4X1IB 4S24A 5BP7A 5JZVA 1KQNA 3LLUA 3C0KA 4NQZA 2XEXA 5CTAA 4WZZA 4XFJA 1RKQA 4R8SA 2G06A 4AG3A 4R3WA 4KK3A 4PFJA 3NWJA 2Z83A 5BR8B 5ANRB 2AHOA 4NAVA 3PPIA 4PVDA 3A37A 2VAWA 3MTAA 2HCFA 1N9ZA 2RHOA 3FI0A 4DDMA 4ZI3A 1PZHA 3TAHA 4DIOA 3L41A 3MK31 2ROQA 1EFHA 3R3YA 3TLJA 1IY8A 1NF8A 3ROKA 4BNXA 4MUKA 2JAOA 3AEQA 2ORWA 4EVSA 1E2IA 3WL4A 3S70A 1KL7A 5B7GA 4ER3A 1JWBB 4JVLA 4DUGD 4ZHQF 5AM2A 2F1IA 4O1IA 2VQFB 3ITDA 3P26A 5F5XA 4X97A 2BBTA 3MTIA 2QTTA 2C95A 1Q7RA 3GT7A 4HDMB 4GKKB 4C4PA 3FSJX 4GMFA 2P67A 1UMKA 1VL8A 2QGNA 2R6GA 3P9XA 2R7LA 5DNWA 1BGXT 1ARZA 4QFMA 4YO8A 4ZV9A 3CRZA 1V96A 3AVWA 1TE2A 2Q4BA 4B32A 1E3JA 3AZQA 1XRLA 3COVA 4JVSB 1CK4A 3A14A 4PFKA 3LAWA 2ZKLA 1KZ4A 1AU9A 4L50A 3AJ9A 3BK7A 1KVRA 4NNPA 1J39A 3PUJA 1JBEA 2ID8A 2XUIA 2HJHA 1K5PA 3PE6A 1TEZA 3VJRA 3IEKA 4WN3A 3VO1A 4DLYA 4UTVA 1C3JA 1KU0A 1L3CA 1LI5A 4KOAA 4IX1A 3K53A 3O95A 3RRZA 4F6RA 1HZZC 1TVCA 3QYJA 4EHNA 3DPSA 2QY6A 4U00A 2QRJA 4D9EA 4S2UA 2I66A