1N6PA

Crystal structure of human rab5a a30e mutant complex with gppnhp
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
164
structure length
164
Chain Sequence
ICQFKLVLLGESEVGKSSLVLRFVKGQFHEFQESTIGAAFLTQTVCLDDTTVKFEIWDTAGQERYHSLAPMYYRGAQAAIVVYDITNEESFARAKNWVKELQRQASPNIVIALSGNKADLANKRAVDFQEAQSYADDNSLLFMETSAKTSMNVNEIFMAIAKKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title High Resolution Crystal Structures of Human Rab5a and Five Mutants with Substitutions in the Catalytically Important Phosphate-Binding Loop
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein transport
molecule keywords Ras-related protein Rab-5A
total genus 56
structure length 164
sequence length 164
ec nomenclature
pdb deposition date 2002-11-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1n6pA00
2C78A 2DWQA 3IGFA 4AD8A 3X1ZA 4DSNA 4LRWA 4LJ7A 5DI3B 3W8NA 4E07A 3KJGA 3LFUA 4NE2A 4YDHB 2Q9AA 4UNRA 4OJKA 3C41J 2FJUA 4M9QA 2FA9A 4HUTA 2CHGA 2ZQ5A 5FOTA 1Y63A 2QROA 1VCMA 1OXVA 4F93B 5L3SB 2C99A 2BEKA 4TYPA 3AM1A 2WPDD 3M0EA 1WE2A 3EW9A 3N2IA 1XJ0A 3AVOA 3I72A 4DDTA 2OBNA 1W4BA 1CJKC 3GD7A 5FTLA 3NBFA 1M6NA 3UXMA 1SKQA 1YZUA 1KO8A 2WSMA 1XRJA 4PSKA 3DKPA 3P26A 2OCAA 1JXMA 1VCOA 4AKIA 4WZAE 2B8WA 5EXSA 3IEVA 2NIPA 3U7GA 4GDFA 1IY0A 3BB4A 4CEHA 3VHLB 4S35A 2GZAA 1OXSC 1NVWQ 3U44A 3HJNA 1OE0A 1TQ4A 3DMNA 4D0NA 2OLJA 1E3MA 4MQBA 2WVJA 5EJEA 2IS6A 1JPNA 4LGMA 4DUGA 3V9PA 3X1WA 3NKVA 2XSZD 1X8JA 1R0YA 2H1LA 2O8DB 4MH0R 2HV8A 3MJRA 3SJBA 3SFZA 1SHZA 5FI0B 3LX5A 4BPBA 3ZQ6A 1SULA 4DSTA 1X8KA 2JLQA 1VG8A 4PSAA 4IVRA 1LTQA 4Q7MB 3FMFA 4B76A 4X8OA 4B73A 5H1YA 4QM6A 2V7QA 2V8OA 2JATA 1T9HA 1GVNB 1MO4A 2HT1A 1XXHA 5B2ZA 2WSSA 1GUAA 1H8HA 1XP8A 1XJCA 2JLRA 4HAXA 2J0SA 2VA8A 3IUYA 2GRJA 4IHQA 1UEJA 1SXJA 4PQFA 3Q9LA 4OHZA 4P4SA 3THOA 3FKQA 4Q21A 3LLMA 2W6JD 4UJ3A 3EIQA 2QNRA 4HB0A 2VO1A 5G3YA 3TAUA 4YQFA 2OAP1 5SZKB 4PPFA 2GBLA 4II7A 4Q7KA 2O8CB 3PV0A 4M1TA 5EE1A 1CRPA 1M34E 1G5PA 1US8B 2O52A 1YHNA 1GKYA 1NSFA 1ZD8A 2ASEA 2FFBA 2YV5A 1OYYA 3KXLA 5A0FA 1OFHA 3RC3A 1CBUA 1Z0KA 1HV8A 3KKOA 2OSBA 2C98A 1JB1A 3WBKA 3R8CA 1Q21A 1W36B 3G0HA 5DE3A 1U8YA 5KNDA 1ONBA 1QZXA 3CO5A 4PAMA 1G291 2XITA 3EA0A 1VYVA 3MWJA 5CB6A 2V54A 3UPUA 2KBFA 3K09C 3K0CA 5EP2A 2VPPA 3P4YA 5G40A 4F4IA 4NPHA 2NPFA 1LFDB 2QTFA 5IK2D 2H8KA 2C77A 1VIAA 3TJZA 1CLUA 4OJQA 1P9WA 1QG4A 2ZI4A 3B60A 4F4JA 4G5OA 1BO6A 1ZUHA 2A2ZA 2QAGC 5DYIA 1IHUA 3WMFA 3C4JA 2O8EB 2JAQA 2PL3A 5JSZA 1YZTA 4LWZA 1UDXA 3QY0A 3I4LA 4FIDA 4LCBA 1GITA 621PA 4AWXA 1A4RA 1P3JA 1ZD9A 3AF0A 3K0AB 3NEJA 2QN6A 1G7SA 3GFPA 3IO3A 1CULC 5LDDC 1JJ7A 4RKFA 5E95A 5L3VA 3CRRA 1EWQA 3VU9A 1GG2A 4NMMA 4IJMA 4LYJA 1OXUA 4V0LA 1WA5A 2LKCA 2VP4A 2ZR7A 2JLVA 4PPNA 1W44A 4P33A 1FP6A 5B57C 3ZS9A 4YONB 4JLVA 4URVR 5GJWC 2C95A 2GZHA 2AXPA 4D4MA 3CF6R 3A1SA 4NCIA 1P7CA 4MKIA 1OW3B 5ANRB 3GEEA 5JJLA 4PO9A 4LY6A 1E79A 2NO0A 1U0JA 4LHWA 2B7BA 2Q3HA 1GL7A 2QMOA 4R7ZA 2R6AA 4PHGA 3WYGA 2O8BA 1NJFA 1X3SA 3C16C 1US8A 3PJRA 4LOAA 3SHFA 2QQ0A 1L8QA 5BN5A 3E2IA 5EP4A 2FPLA 5FOWA 2GNOA 1G8HA 5A5GA 5BW8A 3CNNA 2F1RA 1BYIA 1Q3HA 4Q4AB 3S1AA 4JLAA 4TYNA 1TMKA 5D3QA 3MWKA 4QHYA 2V9PA 4Q9KA 3J81k 2RMKA 1K5DA 3FMPB 4PPQA 2P0EA 1N6IA 4D82A 1KI3A 4MRSA 1ZRHA 4M21A 3D3QA 1KDPA 2IF2A 1T3LA 1OLOA 2EQBA 1G4UR 4XWAA 4EPYA 2G3YA 3A8TA 1ZUNB 4Z8YA 2IXGA 4Q01A 4XTRA 3AKEA 3BH7A 4B44A 2ODWA 2HCBA 1G19A 2RGNA 2W83A 4GP7A 4PSVA 1A5TA 1BH2A 3I1FA 5KO2A 1NVUQ 1DTSA 2G83A 4NYMR 3VU9B 5TV2A 1ZCBA 1PZNA 5G3ZA 3OEHD 2YYZA 1UBGA 1B23P 1Z8FA 5FOVA 1IONA 2IYVA 2P6RA 4Z8XA 1P4SA 3QXJA 3RRNA 1GNQA 3WRXC 4GMXA 1MT0A 3TKLA 2ATXA 1IXRC 3VKWA 3O47A 4Q1BA 1F2UA 3A1WA 2PT7A 1GTVA 3HR8A 4HEJA 4KYUA 1QHNA 4BWYA 1Z63A 3GLIB 3NG1A 4Z1MD 4UXHA 1ZNXA 2CL6X 3CR7A 1N25A 4D26A 2ZUBA 5HCIA 1NMXA 2R2AA 3ZYCA 4DLZA 3U5ZB 4DLRA 3ZVNA 1EXMA 2R62A 3HPQA 3MD0A 4Q7JB 3PQCA 3L43A 4WBSA 4Q5IA 1UBEA 2QP9X 3WBJA 5FOUA 5DO9A 1MH1A 4DLVA 1FTNA 2WWFA 4MRVA 1KY2A 1TQ2A 3BXZA 1CF4A 3LX8A 3DHWC 3K0EA 3B9PA 1XXHB 2R6DA 4G3XA 4LBYA 2NZ8A 5JCZA 2WTUA 4FMCB 4ABYA 2IYQA 3OAAA 2A5GA 1QHHB 3IBGA 1Z6TA 4ZIRA 3TBKA 1L7VC 2Z6VA 3AB3A 1G4AE 4CRWB 4EQ6B 3OF5A 5G41A 2FOLA 2PMKA 1U2RA 4P4UA 3ZVMA 721PA 2NQ2C 2HLDA 5HZKA 1FOEB 1P2VA 3AVPA 1M74A 5DHAA 3SJCA 3OFNA 5JS8A 1NKTA 3MWLA 1XCPA 2A5DA 2QGNA 2VP5A 3BFVA 3ONWA 5JMTA 1FMLA 3OIUA 5BQ5A 1IY2A 2J59A 1I4LD 5KSZA 2OBLA 3MLEA 4Z54A 4XVUA 3VR3A 5HKKD 1R0ZA 2QP3A 3DMDA 2ZUDA 4GRAA 4LJ5A 1W0KD 4IDNA 4LSGA 4C3ZA 2PCJA 1GSIA 2ZRMA 4A2PA 1GIAA 2GCNA 1KAGA 4GOJA 3TLXA 1XEFA 1II9A 2ORIA 2ZE8A 3DOEA 3AUYA 4MDFA 2HYIC 1NLFA 5TMPA 3BBPA 4U00A 1DAFA 4JSYA 3WHKA 1G3MA 4OQXA 3CB4A 2R8RA 2O8FA 4WVFA 1UFQA 1N0UA 2EW1A 1RZ3A 2BBWA 2QM7A 3K8YA 1TF7A 3MMPA 4C2UA 1JAIA 1W5SA 1PLKA 1QHIA 2FSHA 4DLWA 1JQLB 2PJRA 1WB9A 4NCNA 5EXTA 4MKHA 1XX6A 3Q5EA 2PZGA 2ZE7A 4MRPA 3UG6A 3U3MA 2CNWD 4BZXA 1COWD 2Q9CA 2AD5A 2N42A 2ZVPX 3KTAA 4PC7A 4ZCIA 2DPXA 2W6IA 2A9KA 3ZLJA 2IYLD 3EZ9A 3B6EA 2BKUA 2ORVA 3KXIA 2I3BA 2KBEA 4NBSA 1XFAA 1EG7A 2G1KA 2CK3A 4KAXA 1Z6YA 4TYQA 3GPLA 1QBKC 3EPLA 5TB5A 5HZHA 3KQNA 1QHXA 1ZW6A 2D2FA 2ZU6A 5JSZB 4FN5A 2BBSA 4R98A 3QEOA 1ZNYA 2QGZA 3HPRA 3P27A 4DEXA 4IVPA 4BLPA 3ETLA 3T35A 1HQYE 1N0WA 1P9RA 4KLNA 4QNRA 4MA4A 3IIKA 1G1MA 5HE9A 5JLJA 1VYUA 3P4XA 3QKRB 4OYHA 3CH5A 1NSTA 1VCNA 2XJ4A 1T6NA 4JLBA 1R4AA 2WKPA 2ZAOA 3V4FA 1WDTA 1Q57A 1D6JA 1G3UA 1DBSA 4DCUA 2QBYA 4CEIA 2XX3A 4N0DA 3A4MA 4C30A 1I2DA 3AKCA 2AL7A 1KZ7B 4QGGA 2BMDA 2QPAA 3OHMA 4XH9B 2XXAA 1P5ZB 1JBKA 4LV5B 5FL7D 3EPHA 5AUPB 2E9SA 2YKGA 2FWRA 3CRW1 2NO7A 4L4UA 1XEXB 2AD1A 2Q3FA 3EC1A 2J0UB 4K8OA 4NZYA 4P3YA 2AN9A 3THWA 2JIZD 4G5GA 4R2HA 4JLNA 3QF7A 2BWJA 2QU8A 4BLTA 5CM8B 4RCZA 3AVUA 2FPMA 1SZPA 4GBMA 3HU2A 3NC1C 3RRYA 4ZCMA 1KSFX 1OPXA 3RRZA 1EX7A 2FGKA 2FMXA 2VHQA 4A36A 2ZJ8A 1TEXA 3FPAA 4BFTA 5CIQA 5CJ2A 1QHSA 1AA9A 3PUWA 2WZQA 2DWPA 3LXRA 4S2EA 4TSFD 3LAWA 2B92A 1KI4A 2JLSA 2AKAB 4URWR 3VKGA 4BRUA 2OBMA 2JJ2D 2QAGB 3DVLA 4PX9A 2QRZA 2DFTA 4RD6A 3ADDA 3FMOB 5KSOA 2OG2A 4CIDA 3BK7A 3GLHB 4TMZA 4Q9JA 3ZJYA 3QSYA 5FOXA 4B71A 2OFXA 1S3GA 5FBRB 1Z0JA 4MKGA 4GOKA 2X19A 4JL6A 3WMGA 2ZSBA 4DHEA 1L4UA 2MSCB 2VSXA 4LBVA 2GF9A 4LHZA 5AUNB 4JSTA 1C9KA 1E1RD 5JHGB 3GLGE 4FCTA 2GJ9A 5LD2C 2RGNC 2RB4A 1YZKA 1QRAA 4LJAA 1YU9A 2YINC 1YQTA 3EIHA 2GZDA 1ZYUA 2ZYUX 5CM9C 3IPYA 1CU1A 3B1ZA 4BLOA 3AF2A 3B78A 3KUCA 1YRAA 3SYLA 1KO5A 1EFUA 2REBA 2UZ3A 2ZRIA 3LBIA 4KFRA 5LB4A 1FPMA 3THWB 2D74A 2MSEB 3FHOA 4Q00A 4ZDIA 3CIOA 5EE3A 5C4MA 4JVMA 2ZJAA 3TNFA 4URXR 1IM2A 5C4GB 5FPHA 3E70C 1FUUA 1NRJB 1FL9A 3NHBA 4MITA 5FUWA 4B6FA 3SBDA 2CE2X 1M7GA 2OZEA 3W6OA 5K8LA 1NG9A 2PH1A 3B13B 4V03A 3CKLA 1E2JA 1KMQA 1RRPA 3B82A 4JKYA 1DS6A 4A4DA 4XVQA 4DBLC 2FF7A 3NIBA 4CEJB 3RRMA 1ELOA 4TT3A 4RFSB 1QVRA 2ZSDA 4Q4HB 1PUJA 4GNKA 1XPOA 3FVQA 2H7VA 4LUCA 1T4GA 2ZSAA 5JECA 1R2QA 4ESVA 2FE4A 4C0QC 4RD1A 1DAGA 1OKKD 1N6NA 2IF0A 3NEYA 1J8MF 4LPSA 2Z43A 1N6LA 5A4JA 1PV4A 1SVKA 2PCLA 4R71A 1C1YA 4EPWA 1AJEA 1GNRA 1NG1A 4PQYA 2FEOA 1ZMXA 4ON9A 2O8EA 2FEMA 4HLUA 3CPHA 2IYTA 5FTMA 4M2LA 4QBIA 3TIFA 4F38A 5LD2B 1AIPA 1NN1A 4QL3A 1RRFA 1H8ED 4QGHA 1E1QA 3KQHA 1N6HA 3I8XA 3ZZ0A 5TARA 3EWAA 2GTPA 3CUEF 3K1JA 5LB2A 4Q19A 2OFOA 5CK4A 4QM7A 1KDOA 3K9NA 1Q12A 3BB1A 1E98A 4M1MA 4B2IA 4D0GA 4P31A 3NBZC 1E2NA 3WNCA 1N2CE 3P32A 4QRHA 2IW3A 4K81B 4QFMA 2L0XA 3GLHA 1O3YA 2A5JA 3FDIA 2IS2A 4F92B 3AF3A 1YR7A 3JZMA 3GJ7A 2QPTA 4TMXA 3CRVA 4IXMA 2QL6A 2O8BB 2HJGA 1DG1G 4B34A 3O8BA 1AS2A 5JEDA 3K53A 2J1LA 2ZI9A 1DO2A 3LD9A 1DARA 4HUQA 4ASUD 5FI1B 4A15A 3MCAA 4A2QA 2WWIA 1E0JA 2C2HA 2IHYA 3I92A 3RLFA 3K9LA 3L0PA 1E2MA 1GAJA 2QORA 2F6RA 1DPFA 2XGJA 3GJ6A 3DO6A 1KI2A 1NF3A 2YVUA 4Q9IA 5BN3A 1KIMA 4RSGA 3KQLA 1AK2A 2FFAA 3AP3A 1Z2CA 1TU4A 1XPRA 2KE5A 1W46A 2RGCA 2W0MA 3AVQA 4AYWA 4F91B 5LPNA 2A78A 3P1JA 4CZ2A 1NNEA 1W1WA 5JI2E 3ICQB 4LJ4A 4BQSA 1F6BA 2C96A 2XSZA 2YOFA 4B3CA 2IT1A 4I81A 2OXCA 4K46A 1P2SA 2RGGA 3ZIAD 4FWTA 2GXQA 4DDVA 3QPWA 1IXZA 4US2R 4GFDA 4XD7A 1KK3A 4PZYA 3RC8A 3AQ4A 1TPZA 2DHRA 4YMWA 3IIJA 4JBWA 1PLJA 3AF1A 1U0HC 2NGRA 4RZ2A 2FN4A 4KSBA 2WSSD 1XPUA 2WIBA 2QM8A 1W2GA 2VP9A 1QG2A 3U4QB 4P32A 1S4QA 3GLGB 3AKYA 1P62B 1W0JA 3GP8A 1HA3A 4IOJA 1KDRA 2QQEA 1L4YA 1E0SA 4D4KA 5IRCD 4OI4A 4ZI2A 3MUFA 2IWRA 2O5VA 1VHLA 2ZRKA 1G21E 2O8FB 4B48A 3BOSA 4A0GA 4H1VA 4ERNA 4UXIA 4MRNA 5DH9A 1KSGA 4FI3C 1HTWA 2GK7A 1D2MA 5BWMA 3BGWA 1FQJA 4KYIB 4LJ6A 1NIPA 3QPVA 2BM1A 3O8DA 3LA6A 1N0VC 3DKVA 3PUXA 1W7AA 3C15C 4PQRA 2Z4SA 2BVNA 2HF9A 1ZCAA 2PX0A 5AJVB 2RHMA 4Q1FA 2LWIA 3SYNA 4YMUA 4IDPA 1JR3D 4JIMA 4QXAA 1KI8A 2B21A 2SHKA 5DYGA 3TK1A 2ZRGA 3KJIA 1C4OA 3C8UA 2V55B 4RY2A 4BFZA 5EE0A 821PA 1NIJA 5FPTA 4ACBA 2UZIR 4JYCA 5IT5A 2ZRCA 4XVRA 4DC9A 1CTQA 4ILEA 2EFDB 4I4LA 4WZ6A 5EUQB 3PUVA 4OI2A 3NDBB 2J7PD 4Q4JB 2QY9A 2BCJQ 4EFLA 4JBXA 3LW7A 3TR0A 4B3XA 5JJKA 3PEYA 2F9MA 2XAUA 4R2IA 3BC1A 5CJPA 2J0QA 3ND8A 4C4PA 4Q1DA 1DELA 1IAQA 4QOSA 1ZINA 5LBIA 1KI7A 1YVDA 3X1XA 2QRNA 2ZJ5A 4Y0AA 4YMTA 4U02A 4FCWA 4E03A 2BCGY 4TTRA 1ZIOA 1KGDA 1LNZA 5DI3A 2WOOA 1HY3A 5AJZA 3QPUA 2WM9B 1S0UA 5JHHB 3CONA 1JAHA 5L3QB 1G3QA 4D4JA 3EG5A 2FSGA 4CEIB 2XZOA 3AUXA 3GJ8A 4D0LB 3H4MA 2V6IA 4TL7A 1ZJ6A 5B58C 3W6PA 4GOXA 2BHRA 2CJWB 2GJ8A 3REFA 4M1WA 3W3AA 2BKEA 4B2LA 2FSFA 2P65A 4IFBA 2Z5FA 3HWSA 2W2TA 4HAWA 3MG9A 3VR5A 5HCNA 4C0JA 4FMCF 1TF5A 1D5CA 4HLQB 2F1JA 2BV3A 4KFTA 4L9SA 4PC3A 1KJWA 1R10A 1TUIA 3CBQA 3CF0A 3KUDA 4QC2A 1M1YE 3ZVRA 4AG5A 1VG9B 3EWSA 4O2RA 2QP4A 4BECA 2DFNA 2Q21A 3K0FB 3P20A 2FDCA 1E9FA 1FW6A 1U8ZA 1G3IA 3GJ3A 3THXA 1UKZA 3GFTA 5HTKA 3GJ0A 3BFXA 4EJSC 3QXXA 1E9CA 2BOVA 4DRZA 3UWKA 2FFHA 2YWEA 2ATVA 3FB4A 3OIWA 1G64A 1VTKA 2P5TB 2HEIA 4QGAA 2Z83A 3RS5A 1U9IC 1KAOA 2GWHA 1DAMA 2OLKA 1BMFA 1G7TA 3TVDA 1ETUA 2VRWA 3VHXA 3LQRA 2C03A 5F3WB 4RZ3A 2UVQA 3IHLA 1UKVY 2BIFA 1WCV1 5BXQC 3BJIC 1W5TA 1A2BA 4OK5A 3EX7C 1F60A 2JA1A 3VR4A 5FUVA 2QAJA 4MGYR 3CNLA 3T12A 3TR5A 2A30A 5DNYB 1JQJC 3ZD6A 1UJ2A 4QKQA 5KOYA 5KDDA 3AVXA 4GP6A 5GJVC 3E1SA 1QHHA 3A36A 2VHJA 1VMAA 1P6XA 2QAGA 1DOAA 3HYRA 3CX8A 1XZQA 4IDQA 4NHOA 2Z0MA 2WAYA 1AZTA 1J90A 2P5SA 2NMVA 1QHGA 4RD2A 5FBQB 4MDEA 1CJVC 3MWYW 3K0CC 3OE7A 2REOA 4IRUB 5DN6D 2JLYA 5TVKA 1J99A 1KO7A 3B5JA 3SS8A 1ZAKA 3OAAD 4JLKA 3LVRE 1KTVA 2YNMA 3HU1A 4LC1A 4M9XA 1E0AA 3QG1A 2IK8A 6Q21A 3AH8A 1HURA 2JJ1A 4FMBB 2FV8A 4D81A 2MMCA 4A82A 1D2NA 4HDCA 5H68A 2RAPA 3SZRA 4TL9A 3QKSA 1D2EA 4QHTA 2VP0A 3KZ1E 3THXB 3D31A 4GL2A 3Q3JB 4EJSB 1V43A 3CH4B 4KV9A 4M0LA 2X8AA 4FCVA 3M6AA 1XWIA 4D4LA 4OHVA 1YZNA 5BYJA 2CHQA 2NPIA 3ADKA 4GZMA 5E4FA 5HKKA 2ZS9A 4C2TA 3IIMA 2ZM5A 2H16A 2QMEA 2VTKA 3QXCA 3Q72A 3PCRB 4EPXA 5KSPA 1M2OB 2IYUA 2VP2A 3QKRA 4I1OA 2AFHE 1N5IA 5CLLA 1K8RA 3F5FA 4HB4A 2CCKA 1AZSC 3QBTA 1YR9A 4PZZA 3H1TA 1KKMA 2WICA 1TL7C 4IEIA 4DLSA 1KK1A 1ZIPA 1MABA 3JZAA 3KB2A 1DAHA 2H5EA 5JWHA 2ZRLA 5KPJA 3VNVA 2Q0HA 4RZUA 1RYFA 1SXJB 4AG6A 4OQMA 1ZNWA 2BBOA 4IOMA 2CL7X 1MO5A 2OESA 3RS3A 2PMDA 2ZRPA 4M9ZA 5F98A 1E32A 1S2MA 3KKNA 1COWA 3L82B 3AVYA 1AKEA 1LW7A 1MOZA 5AR1A 3RHFA 4TTPA 1R8SA 4NH0A 1OXXK 1YJ5A 1OFTA 2CL0X 5C18A 4DSOA 4EKDA 2O8CA 4JL8A 5EZ5A 2DCUA 2J46A 1DG3A 3B1VA 2DB3A 4HI0E 1XTJA 2OT3B 4RCYA 5JJIA 4DIDA 1DAIA 2DFLA 2WBLC 2PZEA 2GJSA 1S96A 1TQ6A 2GVZC 2OE2A 4P4SB 2FZ4A 4HUQB 1G18A 4HYYA 1EFTA 1YR8A 2IEYA 4V0KA 4BLSA 3EPKA 3PUZA 4JLPA 3WY9A 1E2PA 4EAQA 3U7HB 1W2HA 2ODEA 5FR2A 2RGAA 1G8FA 3X1YA 3B1XA 3UANA 2V1XA 4TYYA 3ZH9B 4M4SA 3PXGA 1D9XA 3JVVA 4A0FA 1E94E 2GXUA 3W8RA 1CJMA 5EE9A 2HUPA 1ESMA 2ZTSA 5CITA 4LJ9A 1W49A 2W6JA 4W5JA 1CR4A 2K5UA 3D8BA 1T91A 2XZLA 2H18A 1WBDA 4BLQA 5FL7A 4UNNA 4L15A 1T8UA 4FW9A 2AK3A 4BASA 3IILA 3K70B 3ZQJA 2QA5A 3PR1A 1FUKA 3BWDD 1YR6A 3QKTA 5D3MB 2QE7D 3BERA 1MKYA 1P2UA 1T8TA 2B7CA 4LC0A 4Q18A 4RFVA 4C0BA 3N70A 3RVBA 3I62A 2GEVA 2IYYA 1AKYA 4LPKA 2ODBA 1NN3A 3BS4A 1OV4A 3VTKA 1UDWA 2Y8EA 2ERYA 2X77A 2OAQ1 2CHVA 2VL7A 5K8TA 2H92A 4XOIA 1KDTA 4FMDF 2AWNA 1FMJA 1P75A 2C5LA 2LKDA 2IYZA 1WXQA 121PA 3FKSD 2E1RA 3QE0A 4EPTA 4HATA 4G5SA 4MYTA 5IK2A 3KJEA 3WRYC 3LWNA 4UNSA 4PC1A 1E2HA 1DO0A 1RPZA 3G5UA 1XEWX 3I8SA 3OIVA 3SC3A 2PEZA 1VG0B 1ZM4A 5EP1A 5L3SA 1E99A 4JLJA 1Q22A 5J4KA 4CEJA 1OH7A 5F9HA 2AR7A 3PENA 4L5BA 3KFXA 5EZ6B 4ARZA 2JDIA 2J45A 2ONKA 3W9YA 4C9BA 3LDAA 4NYMQ 3K0SA 4KI0A 3U3OA 2HXYA 4UQOA 2P67A 1VDZA 5SZJA 1N6RA 2W2VA 5HPYB 4W9MC 2RH5A 3QENA 3PITA 1AQUA 1QF9A 4DT1A 2HXSA 1Q1QA 1OFIA 3MSXA 3CX7A 3VKHA 4CF7A 3QG5A 4PO8A 3EZ7A 4ZKEA 2KJQA 3UK6A 1A82A 3LBHA 4GT1A 1OIWA 1SVMA 4GSYA 4V0NA 4A6XA 5B30A 1ZM9A 1E9DA 4AKEA 1Q44A 1R6BX 3QQ5A 2FH5B 2YOGA 1R0XA 4GZLA 4Y0VA 3FFAA 5KHOC 2FNAA 1EFRA 1P73A 4HAYA 4JVSB 1Q20A 5HR5A 1E96A 2ANCA 1IBRA 1LS1A 1T0HB 2OM2A 1FX0A 1UBCA 2G1JA 3U2QA 5JWRA 1XB2A 1G9XA 1AQYA 3N2EA 2B8TA 4NYIR 2ERXA 4AYXA 3C7KA 1UPTA 3NXSA 4Q48A 4XWOA 1CR1A 1Z0FA 2QMUA 4W5WA 4Q03A 1OYWA 5E3HA 5KNCA 2J87A 2F43B 3A37A 2CMKA 1N3BA 3BB3A 1SKYB 2PLRA 2VEDA 4PTLA 1I4TD 1XMSA 4KLZA 4XWKA 3SE0A 1BYUA 1KK2A 2J9RA 2OCYC 1W4CA 3QBVA 4A92A 4DLXA 4DZZA 1XBTA 3DDCA 4PO1A 2XNSA 4L9WA 3WP1B 2FG5A 3SU8A 3KDSE 2A5YB 1EGAA 2ZXUA 2QENA 4IDOA 4UXJA 1SHKA 4V0OA 1F2TA 2XNDA 4G5QA 1KK0A 4NYIQ 3VR2A 4ARZB 5FBVB 5JZVA 1TNDA 3T34A 1GRRA 2YWFA 3RS4A 2DWOA 1S9DA 3DEFA 3EIEA 4KVGA 4LI0A 1M8PA 3SR0A 5DHFA 4LYAA 2J7KA 1SXJC 2VSOA 2F7SA 2UKDA 2XB4A 3R20A 2YJTD 3PUYA 4ZI3A 5EXPA 2WWYA 2BJVA 2RGBA 3QVVA 2P6NA 3IQXA 3GLHE 4IKEA 4M22A 2CCJA 2IXFA 4U5XA 4OI0A 2BJWA 4RKEA 3CZPA 3U3KA 4Z1MA 3A58B 5GVRA 2WJIA 4ZDJA 1OB5A 1X1RA 1RRGA 1E4VA 3IKJA 4HAZA 1E6CA 3A1VA 2ZITA 3CNOA 4RVCA 4Q9LA 3ZDQA 1NBMD 1GZSA 1GWNA 1G5TA 3LXXA 4NCKA 1WRBA 3EZ6A 3D7MA 3TSOA 2YZ2A 3I73A 4JZKA 4HB3A 3RS2A 3ZD7A 2WWXA 2F3RA 4RD3A 1D8TA 1FTSA 1GDDA 4KO8A 221PA 4D6PA 3GFOA 421PA 4PC2A 4KFUA 5BYKA 2WPDA 3GJXC 4C0AC 1JR3E 4M1YA 1E9AA 1S3SA 5CYOA 1PVOA 2IYXA 2QUZA 3U4QA 1NL3A 3C14C 3DPUA 1LF5A 1FNNA 2QMHA 4B47A 4TL8A 3W90A 3UWOA 4ACAA 1B0UA 4IEEA 4BFYA 2D4HA 2NO6A 1XD8A 1EFCA 3FHCB 2V6JA 1U9IA 3TUZC 1IXSB 3NBYC 5TXGA 1OH6A 4D25A 3OEED 3SJAA 5H70A 3LRPA 1LB1B 3NDPA 3SNHA 5KUTA 1Z07A 1KMHA 1SVWA 3DOFA 4MYHA 3W5IA 4C0KA 4MKFA 4PFSA 1G20E 1U94A 4C0HA 1GKUB 4OHWA 2GXSA 1W0KA 4WW0A 2ECKA 1T3HA 1KOFA 3TE6A 4ZDWA 4B6EA 5E7JA 4NKRA 5DIFA 2WJVA 3PEVA 4DKXA 5JWOA 4YMSA 3SFVA 2D06A 4XD7D 1PJRA 4JLMA 3CRMA 4DUGD 1XDBA 2FZLA 4RJLA 1G7CA 2VF8A 2GJAA 4MUAA 5E7MA 1IOZA 3C5HA 4DCSA 4QJ4A 4JKIA 1W36C 2PBRA 4NTZA 2VSFA 2Q3MA 2IS4A 3AGQA 5K8UA 1JALA 2V7QD 2ZJYA 1U81A 1KKLA 2WMOB 4DCNA 3T15A 4DXAA 4M1OA 1T3SA 2QEQA 1AGRA 2CNWA 2RKOA 3PFIA 3IEUA 1DVRA 1H8HD 3GLGA 2EU8A 3SHWA 1Z28A 5J4VA 2GILA 3M4YA 3HYTA 4Q4LA 2EWWA 2WV9A 3NTUA 2A7QA 3EZFA 4H1UA 2VHUA 4I99A 4CEHB 1XU4A 2CK3D 3LW8A 4FWIB 3V4RA 3H0KA 5JRZA 4BEBA 2VQSA 4KU4A 4PZLA 3UG7A 3ZS8A 4IXNA 4LHYA 4BRWA 3U61B 4TLBA 3FWYA 1II8B 1NP6A 4V0ME 1JNYA 2JGNA 1E2IA 4MRRA 4Z51A 2V4ZA 1XTQA 1F5NA 1LS6A 5DI9A 3TGPA 1ZBDA 2G77B 5F2EA 1HT1E 1TAGA 2Z4RA 1SQ5A 4NONA 3ASYA 4NCHA 2BM0A 2OEPA 1E9EA 4OQLA 2N1BA 2OCBA 1ZM7A 2ZRFA 3ND9A 2CDNA 4BFSA 1XTKA 1OH8A 1GRQA 4CYMA 2BC9A 1SKYE 3MGCA 521PA 3EAQA 3TH5A 1XEXA 1YE8A 3EXAA 2C8VA 4ZCLA 1BIFA 3BD9A 4DT1B 2IYRA 3GLFA 2XTMA 4OQNA 3VMFA 4TN1A 2XXAB 2ZYWX 1G8GA 2ZSEA 3EARA 2IYSA 2IC5A 2HT6A 2WWWA 1JECA 3QI2A 3QKSB 4OL0A 1OHHD 3LH5A 3H2YA 3EPJA 4B35A 1A7JA 4LHXA 4DCTA 1RE0A 2CEAA 3GLIA 1CXZA 3TSZA 4CT4B 3GLIE 2CJWA 2GK6A 4AI6A 3L8YA 4A8JB 4OQFA 5CYPA 1WP9A 1NVVR 1TF2A 2XJ9A 4HZUB 1XNJA 2ZSFA 2WJYA 4TSFA 3WNBA 1G16A 5KPDA 3AGPA 5AUQA 1SVIA 1IN6A 3Q5DA 1R0WA 4PPGA 4AYTA 1KO4A 2F3TA 4FMDB 4H9GA 1OH5A 3UMSA 3QIAA 3PVSA 2PZFA 5E7IA 3RYTC 1AS3A 2YHSA 4QGFA 4DDUA 2OHFA 1I4DD 5UKDA 1OFUX 4U7DA 2D62A 2ONJA 3L0IB 1LY1A 3UIEA 2J41A 4HAVA 1RRCA 4GMDA 4Q66C 5D3MA 5EUMA 2W2XA 1TEVA 2XOKD 1R5OA 3MFYA 8OHMA 2EYUA 1F2TB 3CRQA 4TYWA 2NG1A 1XEWY 1IJEA 3PIRA 4O25A 4PAQA 1K5GA 1T5LA 3DM5A 1HUQA 4YXWA 4LZZA 3RNLA 1RJ9B 3RDPA 2D7DA 2VP6A 1G41A 4EIWA 1N6KA 4EFMA 3GQBA 3GJ5A 2ZRNA 4LYFA 2ZJBA 3LLUA 5C1BA 2ZI7A 1R7RA 4TTQA 1J8YF 2PLFA 3L0SA 4JLOA 1KNXA 4TQUS 1TTTA 3QF4A 3DL0A 1NN5A 2Q9BA 2R6GA 2WHXA 1KSHA 4JL5A 3W5JA 3BIFA 3KL4A 2ZAMA 3CWQA 3F8TA 5KYKA 3T06B 4UNQA 1Z83A 1Z3IX 4RFSA 2C9CA 1W36D 2CBZA 1BMFD 4X8LA 1KYIA 1W48A 2DYKA 2NOAA 4A6PA 1DEKA 3UMRA 3ZZUA 3SBEA 1E4YA 4OK6A 3I61A 4DDWA 3QKUA 4QNMA 2KB0A 3RWMB 1XZPA 1U0LA 3I5XA 2HJVA 1O87A 1FNMA 3GLFB 2EFHB 1EX6A 3IHWA 1VECA 4Q1EA 3LV8A 4TZ6A 4JBYA 2DFKB 2I1VB 4HLCA 4MYUA 1OKKA 2OV2A 2ZVQX 2VBCA 3LY5A 1G7RA 2ANBA 2B6HA 4HB2A 1N6OA 4LBZA 1NLZA 1AGPA 3BH6A 1U99A 1HE8B 5AK0A 2DY1A 3B1YA 3R7WA 3UATA 1OSNA 1IN7A 1UEIA 3LO5A 2GKSA 3QXSA 3WP0A 3OE7D 3CPEA 5L3QA 4DB4A 3SQWA 2QBYB 4Q1CA 3CZQA 2O0HA 2ZJOA 1VYTA 4KHZA 1SVLA 1Q3TA 1R5BA 2KSQA 3LBNA 2WJJA 1MV5A 2ZI6A 2ZRAA 4N0EA 1Z0AA 3JVUA 4M1KA 4WIAA 2RHDA 1FP7A 1P61B 4L8GA 3TW8B 4QHSA 4B33A 4NYJQ 2QSYA 2YC2C 5KDLA 1XCGB 4YC7A 3ECCA 4IFEA 1E0KA 2CVHA 5J40A 1X1SA 4A0RA 4M8NE 1XMVA 1KY3A 2OO7A 3L8ZA 3VR1A 1UBFA 3KB1A 1MRNA 2AKYA 3CX6A 2G6BA 4WZBE 2OILA 1BKDR 3NC0C 4TMWA 2ZRBA 2TMKA 2FX3A 1DE0A 3EZ2A 4NL4H 5JCPA 4HLUC 1V5WA 3T1VA 2ZYTX 3TMKA 1Q1ZA 2E87A 3AKDA 3OFND 3ZZTA 2F1HA 3SDZA 3O8RA 1ZD1A 3EC2A 5CB8A 1ZU4A 3HU3A 4MUBA 4AIIA 4EQ6A 3QEJA 3QJYA 1CRQA 5AJYA 2GETA 3KKMA 5KU1A 4ASUA 3BAFA 4AURA 3Q85A 3SEAA 1P9NA 3T61A 1E2QA 5L3RA 1TUEA 3FTQA 3RS0A 3MRSA 1DADA 2WMNB 4KODA 5FL3A 1U98A 5ELXA 3OIYA 3PEWA 3I5YA 2H57A 3K0AA 2YOHA 2JJ8A 1TADA 1KI9A 1G17A 1IN4A 5AWFC 3ADBA 3FMIA 4PC6A 3SOPA 2AK2A 2QT0A 2XZPA 4EUNA 4CW7A 2JLXA 3KKPA 4A8JC 5DISB 2A5FA 2IUSA 1JXOA 2WIAA 3FYHA 1U8AA 5FTJA 1YRBA 1UADA 1UKEA 1X8LA 1GOTA 2ZEJA 4JT2A 4NCJA 5SZIA 2D3WA 5CK5A 4ZIRB 3R8FA 2XTZA 1G8YA 2GESA 2KI5A 2CXXA 2HCJB 3BH0A 1GL9B 2R9VA 1G8PA 2ZIAA 3GCGA 3O8CA 1A1VA 3B85A 1EK0A 4MGZR 1ZUIA 2GCPA 3ZIAA 3KKQA 1YZGA 1Q1BA 1P60A 5KNBA 3R9WA 5CLQA 1R8QA 2EFEB 1Z08A 1W4AA 3THYB 3UMFA 4A8JA 1Q1EA 3U44B 1II8A 1UAAA 4X8MA 4JMPA 4TMVA 4UNPA 2PX3A 3CLVA 1TU3A 2CCGA 3ZVLA 1N6PA 1CKEA 1F48A 5F9FA 2AWOA 3A6PC 1EESA 4UJ5A 5FTKA 4BZPA 1GNPA 1E2DA 2XB2A 1GFIA 3RSLA 4CVNA 1HE1C 1SXJD 2HYDA 2CLCX 3KFVA 4ZO4A 2QG6A 5JI3E 4B3FX 2JEOA 4AKGA 2IBMA 5AJXA 2GCOB 4X8HA 2QE7A 4UKDA 2AX4A 4JVNA 1XJQA 3WNDA 3CF2A 4B3DA 1N5LA 4B74A 2VHCA 2QTHA 1NN0A 1G6OA 4IOLA 5C2JB 2QTVB 4B2PA 1GRNA 4IVQA 2G9NA 3OESA 4EDHA 3IBYA 1CP2A 4YMVA 1E2GA 4C7OA 2IEZA 3H86A 1TQDA 3NHAA 5KDOA 4LHVA 2IA5A 4JS0A 3ADCA 1JR6A 2EFGA 5DLQC 2QT1A 4OKSA 3BFKA 3U7EB 4JLDA 4M9SA 2F43A 3GJ4A 3B9QA 2QI9C 4PXAA 4MGKR 3B7GA 4BFWA 5EP3A 3ICEA 5EE5B 2JDID 4KBFA 2REXB 2I1QA 4P4TA 2J7PA 1G6HA 4CT5A 4KSCA 3GEIA 1FQKA 1S1MA 3FGNA 3RANA 1DAEA 1MR3F 2ZRDA 5EXXA 1KJYA 1XD9A 4M53A 4TLDA 3NH6A 2GBLC 4WXPA 1E9BA 4URYR 4QJ3A 3BE4A 3I3SR 1SXJE 3B8HA 3ZGXA 3SYKA 1NMZA 1WF3A 2RCNA 1Z6AA 2P6UA 3QNUA 1EWRA 1XXHE 4A9AA 1RC8A 4KXFB 3IO5A 2J5XA 4HSEA 4DLTA 1J2JA 4G5RA 2EFCB 4XTCS 2C9OA 3W34A 5FUXA 2ZYVX 5JBQA 1EFRD 3T1OA 1P2TA 3T5GA 5BN4A 1GKIA 3VX4A 1R5NA 3RABA 3LQQA 3THYA 2GAAA 4LDJA 4DEYA 3IQWA 4WA7A 4DIEA 1CR2A 4LK2A 3IPXA 1RW4A 1E79D 4YDSA 1KI1A 3AVTA 2JCSA 4DB2A 4N3NA 4QBHA 2GVDC 2X2FA 5C46F 3TSWA 1FFHA 3X2SA 1OJLA 1X6VA 2R65A 2LCFA 3E5HA 3A4LA 2ZR9A 1PUIA 1K6MA 1UM8A 1EFHA 1G5RA 5JRJA 1J70A 1Z47A 2VIIA 4G1UC 5J4LA 2FU5C 4TL6A 1CJTC 2GCOA 4URZR 3BORA 5HE8A 1MO6A 1CIPA 1Z6GA 1UF9A 1UKYA 1HT2E 2X2EA 4EPVA 5FPYA 3H84A 4XSGA 2QZ4A 4NYJR 3RS7A 3UKDA 1QDEA 2ZJZA 1Z29A 1ODFA 5DSZA 2DR3A 2XNDD 4P0TA 1P72A 1NY5A 2R6FA 4L16A 1ESNA 4QJ5A 5FOSA 1D9ZA 2RGDA 4TLEA 2ZS8A 1NMYA 4URUR 3SI7A 5TY0A 3VFDA 3AEZA 1WBBA 2ZI3A 3REGA 4D80A 4IW3B 4Q4HA 3VAAA 1QVAA 1LV7A 4TQAA 5KTYA 1Z06A 1WQ1R 5GJCA 5J5CA 3TRFA 3R9XA 4ITRC 2ZR0A 2EWVA 1W4RA 3U6BA 5EQTA 1XCMA 1Z0DA 5B64A 5CDFE 1E1QD 5AJWA 3AF4A 4C7OB 5GJBA 3FOZA 3OEHA 4DLUA 4JYBA 3U3JA 2R6CA 1OB2A 2D2EA 1VG1A 1YZQA 3KQKA 4HZUA 4D2IA 1OIVA 2IL1A 1NBMA 5JEEA 3T5DA 3AP2A 3OZXA 2NTYC 3KXKA 4J0QA 2WKRA 4KVAA 2G0NA 4V02A 1GM5A 2OFWA 1KSJA 1DAKA 2NO9A 2OCPA 1HYQA 1IJFA 3B1WA 1NLYA 4BFVA 4TZ0A 2FFQA 4M1SA 1M7BA 4Q7LA 5JFGA 2O0JA 2IS1A 4KBGA 3R9IA 3T1QA 1VHTA 1XMIA 3GLFE 2P2LA 4MGIR 4HAUA 5IHPA 3WXMA 1XTSA 1FX0B 1M7HA 5FBLB 3F3YA 3FFBA 2ZANA 4OBEA 3TQFA 1JJVA 4RD0A 3A4NA 3L0OA 2OUKA 4ZPXA 2WJGA 2WOJA 1ZP6A 3EA5A 1H65A 3KQUA 3KX2A 1MRSA 3N5CA 1QHYA 2CVFA 4QBGB 4DLYA 5FTNA 3GMTA 4KFSA 2J0UA 1E2FA 3GEHA 3OEEA 4US0R 5TDHA 2ZE5A 1N5JA 4B75A 1KZGB 4E09A 4OHXA 4A2WA 1RFLA 2PT5A 4JT4A 3G82C 2ZUCA 3K0FA 3U60B 1OT3A 4V0MA 1VPLA 4ZV4A 2HLDD 4FINA 4LJ8A 4NDZA 1Y3AA 3SN6A 2AFIE 4TWZA 4WOPA 2W0SA 4US1R 4E22A 3FHTA 4AK9A 3K9HA 1XMJA 1YKSA 1VCIA 3X1DA 1T0JB 4IOKA 1BS1A 5DGXA 1MO3A 2C04A 4WXRA 3CW2A 1S1CA 5GVSA 1S8FA 2IX3A 1KNQA 4BGDA 2OXRA 5GADl 4B3BA 1AM4D 2D7CA 1E2KA 3A1TA 1OF1A 4N1AA 4QBFA 2NZJA 1MABB 2AXNA 1KI6B 2EVWX 1L2TA 4O2LA 1ZC3A 1FZQA 4R9UC 4YLGA 2GEDA 4GI7A 4OI1A 1W0JD 1Z5ZA 2IHBA 1XTIA 2W00A 5FPKA 4BZQA 3LVQE 5J47A 4HZIA 4DVGA 1S9HA 2BMEA 5KSYA 3AVWA 4IDHA 2ZS7A 3QXHA 1GILA 1KHTA 2ZETA 3PEUA 2CLDX 2N46A 4TLCA 4ZDKA 4E5UA 1VIYA 2ZROA 3Q8XB 2W6ID 1CR0A 2WWHA 3K9GA 4MYCA 1NVXQ 4JVLA 1JPJA 1RIFA 1ZC4A 1NBME 1LF0A 2WWGA 5CIWA 2WJHA 3VX3A 2EYQA 3HP1A 1E9RA 4TQ9A 1AS0A 3WYFA 1RVDA 1SVOA 3CPJB 4B3GA 2VHTA 2BDTA 1TX4B 3RWOA 2KWIA 3EASA 5CDFA 1CS4C 4BUJA 4PHFA 3KTAB 3NBXX 2X1VA 3Q7QA 2GEUA 5JS7A 5FR1A 1ZU5A 4Q4AA 3S1AB 4EFNA 4LV8B 3SQXA 4B32A 1CEEA 1NKSA 3QUSA 3VNUA 3TUIC 3DZDA 2BMJA 2H17A 3WYAA 2JLZA 1JR3A 4XIGS 3F0TA 1I2MA 1IY1A 2MSDB 4A1FA 1E2EA 3MAAC 4FXPA 2CLSA 4B43A 1J7KA 4GPTA 1WMSA 1XTRA 2ZRJA 4G01B 1Z0IA 2ZPTX 5IDVA 2RGXA 4TLAA 3K09A 3L2OB 1RJ9A 4PHHA 3VR6A 1OHHA 3VQTA 3M1IA 4Q9HA 4F7WA 1RKBA 1SGWA 5G53C 2WAXA 3U3RA 2V3CC 3NWJA 4CGZA 2QSZA 1XD2B 3AV0B 2VYFA 1Z6XA 2G0TA 4HLDA 1JEEA 1Z22A 2JIZA 2O0KA 3HR7A 3NH9A 1A2KC 2ZI5A 1T5IA 2JLUA 4PANA 2FSIA 2ZJ2A 3FKSA 4JJZA 1F2UB 2G88A 2ORWA 2W58A 4W5HA 2BMFA 4TMTA 2FPKA 2GA8A 3IDQA 1E2LA 4PHTA 5FFMA 2XEXA 2GXAA 1KMHB 4KCGA 4QG7A 3AP1A 2IXEA 4POAA 2J3EA 1NJGA 1JI0A 2YWGA 4O3MA 3CWZA 2XTNA 1SVSA 1U90A 1ZNZA 5FBWB 2YC4C 1ANKA 4LX0A 3D6TB 2XOKA 3Q7PA 2JJ2A 2PEYA 3CM0A 1IN8A 3V00A 2QPOA 4DSUA 2BEJA 4Q1AA 1XD2A 1KJZA 4YXWD 4OK3A 1VKJA 4ZKDA 4BEJA 5FH9A 1RYHA 4G0NA 3WMEA 2HDNB 1KI6A 3LNCA 4I1UA 4NU0A 5J4YA 1ZM3A 3U6KA 4Q4JA 3C5CA 2VF7A 3QOFA 5P21A 1HQCA 4C0SA 4EJSA 4EPRA 2ZREA 2GAOA 2IUUA 2PJZA 3A1UA 4BFUA 1E1RA 3W3ZB 3I32A 1NI3A 2F9LA 3BRWD 4LV6A 2VLIA 2F55A 4CDGA 1IQPA 2GDJA 1IN5A 4BE7B 3K70D 5IF9A 4LBWA 2P3SA 1GP2A 5FPSA 4AC9A 4RD4A 3NVAA 3K70C 2J0VA 4KITB 1YZLA 2WKQA 4HDOB 4TMKA 5H8WA 3QF4B 2ZU0C 2R44A 4DCVA 2BBTA 3PG5A 5AUOB 3RAPR 1XF9A 3CR8A 3DZ8A 1PLLA 4DJTA 1Z2AA 1ZVQA 3B2EA 4DWJA 5J4HA 1AN0A 3TVTA 2Q6TA 3U7FB 4I1SA 3RSOA 4AKHA 3W6NA 2ZRHA 3QVUA 3TUJC 4O0MA 1NVVQ 4XSHA 2JLWA 2MMGA 4XJXA 2YWHA 1X86B 4HDQB 4Q02A 1ZM2A 1NY6A 4TT3D 2GJKA 4KJZA 1OXTA 3TQCA 1G3RA 2CE7A 2ZE6A 3ASZA 4LYHA 2F1IA 2JASA 3KJHA 2IWHA 5K8IA 3TAHA 2O8DA 2DBYA 2GF0A 4PR0A 3FE2A 5L8VA 1KO1A 2FGJA 1OIXA 3DM9B 4F4CA 2V1UA 1BOFA 2RGEA 1JEDA 2A3RA 1HH4A 4C0LA 5M04A 3R7WB 4BLRA 4RZXA 1E69A 5SZHB 3AVVA 4BFXA 1II0A 2C9YA 4A0HA 1E9SA 3WHLA 1N5KA 4Q47A 5DN6A 4WAUA 4AY2A 2GHIA 1CJUC 1LVGA 1W47A 2AHOA 1GL6A 4W7SA 3T1TA 4NP6A 4JJKA 1H8EA 4PAOA 2NO1A 4FD2A 5FUYA 3TW4A 3HDTA 3MJHA 2IUTA 2JJ1D 4LJYA 2IYWA 3SJZA 2HF8A 2ODNA 2VH5R 4ESHA 1F3OA 4OHYA 1Q0UA 4I1VA 2I4IA 1HEIA
chains in the Genus database with same CATH superfamily
3IGFA 4HPJB 4W8GA 4AD8A 3TNJA 3OQPA 3EVZA 4DSNA 3AL2A 5DI3B 4GW3A 4PG7A 1H5NA 1GG9A 3LFUA 4YDHB 3TJRA 4OJKA 1ZRSA 4B8ZA 1P19A 3AETB 4E4TA 1PL6A 3CUKA 2CHGA 2EKZA 1O08A 1Y63A 3HKDB 1VCMA 4HJRA 5AKYA 4C89A 3JZIA 4RAQA 1KARA 1KP2A 2BEKA 2YMLA 4MUEA 1WMAA 3DUFB 2X8BA 1RNLA 2WDZA 3N2IA 4KAFA 2DLNA 1FTQA 2XWJI 3AYZB 1PD0A 1CJKC 3O8LA 3GD7A 3E9CA 3NBFA 3KJZA 1E3EA 1OFGA 1WNFA 4L28A 4D8YA 5KWEA 1Q0SA 2CDBA 2FMKA 4FHGA 1SKQA 4O5OA 5T4BA 2XDQB 3T41A 4HL6A 5I01A 3RODA 5KHLB 3O4HA 1QB7A 5GAJA 2Z04A 2R66A 3SK0A 3EVBA 5DHQA 1TLFA 3K0BA 3VVLA 3L93A 1N1EA 3NHSA 1SPBS 5IJZA 4DR1B 2WUGA 3PWKA 4I55A 3ET5A 3U7GA 4BB9A 3NIDB 4X61A 1FP1D 4CEHA 1DJLA 1CYEA 4F96A 3WGNA 3WK7A 3FG9A 3Q3IA 1GCIA 3FVWA 1JHYA 1XZBA 3DE1X 5H4HA 5LLSA 3VOTA 3LDGA 2OUIA 5EJEA 5KNBD 4QODA 2IS6A 4RANA 4R81A 1ZCZA 2K4MA 3U0VA 1DX4A 4DUGA 4X3OA 5I48A 2YYYA 5JSFA 3HJUA 4HN2A 2O8DB 1AQJA 2JGJA 1ZI9A 4HKTA 3FUUA 2P6PA 4RKQA 1O1YA 4DSTA 1X8KA 2WYOA 2BHSA 3MOIA 3I09A 4PSAA 2FUKA 5IH3A 3VYRB 2V96A 2G28A 1OLSA 1YDEA 2X0IA 4X8OA 4B73A 4QM6A 1W59A 1NQOA 4UUPA 2Z09A 2V8OA 3ZHYA 2AX3A 1GVNB 4MLZA 3K2QA 4P4NA 5KREA 3MWDB 1H8HA 1YRLA 2CMHA 1IUNA 1XJCA 1JWBB 1WPGA 5EJAA 3NS7A 3QU2A 4PQFA 3Q9LA 4D5EA 2D54A 4IZ6A 3THOA 1IWBB 1YQGA 2ZCUA 3COVA 1XQ1A 1GNVA 2W2PA 3RREA 1SUBA 3BA6A 5CD1A 2LIVA 2W6JD 3M2PA 2FQXA 4YV7A 4YT4A 3TAUA 1E20A 1XAIA 2CDCA 3TKAA 1P0MA 4CKWA 3HXMA 2AVDA 1E1YA 3PFBA 2GBLA 4PPFA 4B7AA 1FBNA 3O4FA 2AC4A 4Q7KA 3MTJA 3EMDA 4M1TA 4RH1A 3N2NA 4BP3A 5DBOA 5ECDA 9LDTA 1LNSA 5FV7A 2DUJA 3E3AA 1M34E 1G5PA 1QWOA 2GWRA 3A6KA 3GPCA 3KXLA 3N86A 2ASEA 4K0RA 4RJKA 1V6CA 1BHO1 1XZCA 3H6GA 4BV3A 1OFHA 2G7MC 1HT3A 1WW8A 1Z0KA 2QYHA 2W6QA 3GLVA 1HV8A 4G4IA 2OSBA 2C98A 1JB1A 1MAVA 2PUTA 3KOZA 1CE8A 4NNOA 3H8VA 4WNAA 1Q21A 1W36B 2FE1A 2FW6A 5DE3A 1UANA 4KUGA 5KNDA 4QPDA 1ONBA 4LSMA 1PN3A 2XQGA 3S8EA 3AR3A 3K09C 3LP6A 2JFOA 2JNWA 4Q16A 5LOVF 4WBXC 5G40A 3QHQA 5TPWA 2PAAA 2XXBA 4MHOA 1GUZA 5L6LB 2C77A 1NZFA 3TJZA 2TS1A 1CLUA 3QWBA 2Q2VA 1P9WA 3WGTA 4B5LA 2ZI4A 3JAKA 4HRAA 4XGKA 5HM6A 2PIAA 1BO6A 1O97C 2QAGC 2A1IA 2Y0BA 4KRFA 1IHUA 3WMFA 3C4JA 2PL3A 3UTCA 3L8GA 2UYOA 2H2AA 1H2WA 4DJ5X 2R8ZA 8GPBA 3V9AA 3BK2A 2XKJE 4PGHA 3FPFA 1GITA 4MI3A 3SS7X 621PA 2I7DA 4I50F 5AHRA 3AF0A 3ZKAA 2PXHA 3NEJA 4TUYF 4ZVTA 2ZT7A 3IO3A 1JJ7A 4RKFA 5DRYA 1BCSA 1V2GA 3DL7A 1EWQA 2C0QA 4FONA 4BUCA 4D56A 4R2XA 3PNVA 3HBLA 1MPTA 2V98A 1T3GA 1WA5A 5AI5A 3WISA 1FSFA 3C24A 3KZMA 5C1OA 1C5KA 2VP4A 5JH7B 5KOIA 2VDJA 4A23A 1DEOA 2R5WA 4PPNA 3KQMA 5ISMA 2B99A 3T3EA 3ZZMA 4P33A 1NWHA 4YONB 4C7VA 1TIBA 1JLMA 1ATIA 3CF6R 2NUPA 2PS3A 4NCIA 1VSQA 5E7QA 4BDSA 4EF4A 1QQAA 5ANRB 4ZC8A 2R11A 4LY6A 1UM9B 2OBBA 3T7IA 2NO0A 3GT7A 2PV7A 1SQFA 3PNQA 2R60A 2WYVA 2QMOA 2CV0A 2XCSB 1UZNA 4PHGA 1H2AS 4XFJA 2JCGA 3COZA 1DFGA 3LBAA 1M73E 1US8A 2YMPA 5AK3A 3HYSA 3B5IA 3IH5A 3QOYA 1DJNA 1L8QA 4L5CA 3E2IA 4LOAA 1G2QA 5EP4A 5EXEA 3SHFA 3ZWXA 5BN5A 3CNNA 3G0OA 3RTDA 3TZHA 4B3RB 4X95A 1Q3HA 4Q4AB 3BWYA 4JLAA 1WU8A 4FQ7A 5ALMA 1X7ZB 3O82A 2CLOB 5A7GA 5IT4A 1ABBA 2Y67A 4JWTA 3DCIA 4Q9KA 3F74A 4GMHA 3UFXA 3WAGA 3J81k 2RMKA 2GPYA 2WNIA 4PSUA 3RG2A 5KVSA 4PPQA 1G2OA 3A06A 3B9RA 3ROMA 4MRSA 3ZV3A 2HO5A 1ZRHA 3ZQUA 2FJPA 2ZPUA 4MS1B 4XWAA 2G3YA 3A8TA 3ZE7A 1IPEA 1SUFA 2IXGA 3VHQA 1PVVA 4LJSA 5KYYA 2DT5A 1CNEA 1JRLA 3BH7A 1V3QE 4PYQA 1G19A 4Q66C 4LVCA 5AKGA 4GP7A 1EIWA 2IPXA 4HYTA 4MW4A 1HFEL 1HXHA 3EXHB 1RHKA 4EO9A 5KO2A 2W9XA 4FOTA 1GUFA 3MS4A 4TRNA 1WXDA 2J08A 2G83A 4CMJA 1XWFA 2B6NA 3EB9A 5A5DA 4QLBA 4ARCA 3L7KA 4PBRA 1PZNA 1I7NA 3OEHD 1ZOIA 3VDXA 2E5LB 5T57A 4LXUA 1PEDA 2P6RA 4PICA 4Z8XA 1P4SA 3U4IA 3WRXC 1GNQA 1Y9AA 2AN3A 4AJEA 2A0YA 4EKNB 4GMXA 2Q2NA 4Z4QA 1M1NA 3MS2A 2ATXA 4NV1A 1XTTA 3EUWA 1IXRC 1E7RA 1ZXLA 3VKWA 5B3JC 3QW2A 3GHHA 2PT7A 3D7RA 4OXIA 4R16A 4Y2JA 2VJKA 1DQZA 2JH9A 2Z58A 4YN3A 4BU0A 2GDZA 4MVJH 1K6EA 1VZ2A 1EEHA 4RL6A 4ZYXA 5HCIA 2Q1XA 4WY8A 3QU5A 3ZYCA 3F4LA 4DLZA 2F3QA 3K9CA 4G25A 1WCYA 3T52A 1TCCA 2FZEA 1VE3A 2I4NA 3HCRA 3ICVA 2GVNA 2R62A 3VSCA 4E2XA 4L9RA 4Q7JB 1N7GA 1TLLA 5EYPB 2D5LA 1W5FA 3QWAA 5E1DA 3PT9A 3G5LA 1VJCA 1YHZA 2XLBA 4DLVA 1MH1A 3BDAA 4DADA 5BMVF 4C76A 2W11A 2VNSA 4GXTA 1X13A 1XVTA 2FLWA 3MJCA 4NG5A 4YJ3A 1L5LA 3D8SA 1GXSA 4M6WB 2X0KA 3UJPA 4BGVA 4PGAA 2FVYA 3B9PA 4ZGBA 2R6DA 2DE0X 4HJXA 5ILOA 2NZ8A 4PQEA 3OJ0A 4FMCB 5D6OA 2A5GA 1CVRA 3AG5A 3C39A 4ZIRA 3TBKA 1L7VC 1Y6JA 2H4JA 2QTWB 3JD3A 3OO0A 1WL8A 1U5AA 1G4AE 4HDMB 3S44A 2IH2A 4CRWB 1BU5A 1Z5OA 5G41A 3RQIA 4BEWA 1M2FA 3OPMA 4IIUA 1BXKA 3QK7A 3QLUA 2C7PA 2C5BA 1T2NA 1T29A 2NQ2C 4M54A 1YQUA 1ZSYA 5HZKA 2Q4RA 4FYJA 3GRRA 3SJCA 4Y98A 5I3ZA 2L17A 4OHPA 2VP5A 2QGNA 2QNIA 4HWGA 1L9XA 2GAIA 1CUYA 1EXNA 1FMLA 3OIUA 1BVUA 4TSRA 4HDKB 5CDTA 2WFLA 3IOYA 1F12A 2WFAA 2JIPA 3AFGA 3JASB 4RENA 3I9V1 4FDVA 1NURA 2FQ1A 4OQYA 5TGDA 1R0ZA 2QP3A 3DMDA 4GRAA 2G5CA 1ZJZA 3GP3A 4LJ5A 4M8KA 1CW2B 1W0KD 2J85A 4IDNA 4LSGA 2PCJA 4KMMA 1GSIA 4AECA 4B6QA 1GIAA 2YXNA 4ZI7B 3DOOA 2FSVC 4RKRA 5BSTA 4MWTA 4HWSA 4YUZA 3DOEA 3WLRA 1FJGB 4MDFA 2HIGA 3ZE2B 1NLFA 3BBPA 4U00A 2KLHA 5MN4A 1VP3A 3ZWOA 4D6XA 2QJOA 3DEIA 4OQXA 3HCFA 3Q87B 3WHKA 5DNCA 5IG2A 4QWMA 3RTGA 3SOZA 3GGCA 2EW1A 3PUIA 4I6EA 2JKZA 2QM7A 4GD3Q 2XF8A 1YJCA 3LFHA 1ADGA 4L5IA 4F56A 1ZKDA 5B3LA 4G63A 1GTRA 1A9TA 2PJRA 4DLWA 1JHUA 3CZCA 3ZWQA 4NCNA 1E4OA 4BQQA 4QFDA 2H51A 3OQVA 4UDYX 2HN9A 3PGVA 3UG6A 1ZFNA 2CNWD 2H2HA 3DBLA 3KXDA 1COWD 4BZXA 4EYQA 1QP4A 3VU8A 2Q9CA 3J7TA 2AD5A 2N42A 3S2UA 2Q5EA 2QMYA 2ZVPX 3N8KA 2Z98A 2DPXA 3AETA 5E4JA 2W6IA 3UJAA 4QO8A 2SNIE 2E6KA 4IIBA 4J9UE 1AMNA 4S1TA 4E2YA 1RE1A 3EF3A 3GLUA 4BNYA 3X0DA 1VJGA 5LZ9A 4KAXA 1Z6YA 4TYQA 3VJKA 1JHRA 3GPLA 1I2ZA 1QBKC 5TB5A 4CM6A 1YCDA 2NNWB 1CQIB 2FZVA 4FGSA 3PL5A 2H2GA 3T5MA 4YYEA 4RACA 4UZEA 1LSJA 4BNIA 1TMGE 1EG2A 1I5RA 2DPHA 1F1BA 1CEXA 1ECBA 2QGZA 2ZIXA 1SHTX 1FFWA 3T35A 5TS2A 1J1ZA 1N0WA 2MR5A 1WW2A 4HFRA 4KLNA 1IVSA 1AK9A 3IIKA 2C9BA 1EJBA 1RJEA 5CVUA 1PZGA 1S2NA 1VYUA 4OYHA 1PS8A 1I3OA 3AI7A 1JEAA 2ZJ4A 1N9KA 5KYTA 1QYXA 3D4BA 5LP1A 2NSHA 3E53A 1KJQA 2C2GA 3PRYA 5D01A 3WVNA 2V7PA 3A4MA 1I2DA 1BEZA 5CEJA 1YASA 3DBOB 3EWIA 4J9VA 1XA0A 5JVDF 4NEGA 1WPQA 4XH9B 3EPHA 2XXAA 1JBKA 2G07A 4LV5B 1L4FA 1L6IA 1DBIA 1FFXA 1ULSA 2E9SA 2EWMA 3NWEA 2ZJ7A 4KX5A 5CMLA 1XLVA 2AC7A 3OWXA 3MWEA 2IV3A 2OBFA 3EC1A 2J0UB 5ER9A 4OQEA 2CZGA 2AN9A 1OT5A 4ZMSA 3CLRC 3PYXA 3B6IA 3QF7A 4Z9AA 4IWYA 4BLTA 1GEEA 2WNHA 5CM8B 1XKLA 3FOCA 3RU2A 3W2GA 1ZH2A 6PFKA 1SZPA 2ZUFA 2DH5A 1TO6A 1YL5A 2FMXA 1PS0A 4DC1A 2CW5A 2NLOA 3FPAA 4BFTA 1T1IA 1XZGA 1DBRA 2FOIA 2IH4A 1QC5A 1JVBA 2QUIA 4K0KB 1FSZA 1W4ZA 1GUDA 1GTMA 1NNLA 2NSDA 2Z2ZA 1CG6A 1NJ8A 1NUQA 3LXRA 4TXNA 3D5EA 5ALLA 5FQOA 1EBUA 3LAWA 2B92A 1ORIA 5CUQA 3ROTA 4JI3B 3SF8B 5DM70 2X1LA 2OBMA 3ETJA 4PX9A 1UOPA 4L02A 2DFTA 5B3JA 5CFQA 1LI4A 4OQZA 4GRDA 4HPWA 3FMOB 3ANSA 3AR4A 3BK7A 3GLHB 4TMZA 4Q9JA 4MR7B 4KREA 1CWUA 4XIJA 3DBHB 5FBRB 3S2YA 5ALVA 1F14A 3PC4A 2R6ZA 1Z0JA 4MKGA 3IBSA 2X19A 2PLNA 4RS3A 2GERA 1XF1A 3PPWA 5FP0A 2ZSBA 1KZ1A 3UXEA 4EJFA 1LQ2A 1Z2EA 2D0PB 3ZD8A 2JJMA 3GQBB 4EYKA 1B16A 3QV1A 5ESDA 4ZJYA 2G6TA 4LBVA 2HK9A 3J80A 4MW6A 2DXIA 4JSTA 1E1RD 3T95A 4IUDS 5LD2C 1YK1A 1BWRA 1KEWA 2IVFA 3T9FA 1MIHA 4B3HA 4YAFA 5EGNA 4IIDA 3ZJTA 1S7CA 4KRXA 1WSBA 4XX1A 5DBEX 1TK9A 4HGZA 4MQEA 4BLOA 1CU1A 4DIMA 4I55F 1UPXA 1YRAA 3Q4GA 1EFUA 3THWB 3D8RA 3LZDA 4IZHA 4MVJP 3T1NA 2XB9A 1T2VA 3TRDA 2D74A 3H7IA 4Q00A 4ZDIA 1PJ3A 4GE3A 5KB3A 1XRMA 2JVKA 2ZK7A 1GYRA 4JVMA 4Q37A 3GG9A 4PGGA 3RI3A 5K4AA 5J3JA 3I6BA 1O95C 3IDOA 5EQDA 5K3FB 1CS0A 1ZCFA 5FUWA 1JFRA 1M7GA 2CE2X 5K8LA 3MJSA 2PH1A 3B13B 3GPIA 1GQ2A 3MQFA 3CKLA 1SU7A 3OZCA 1O5TA 3IQEA 1NFFA 5EJ9A 3H5RA 2WJ3A 3CVYA 2DHCA 1M6EX 3N05A 3KYJB 3L0ZA 4G23A 3NIBA 1NV8A 2Q2WA 4EITA 4JFAA 4RHXA 1ELOA 2E82A 1U1DA 2PY6A 4WKPA 5JCJD 4Q4HB 4RVSA 1VE9A 3AL3A 3H5LA 3NPMA 3CVWA 1XPOA 3RIXA 3WIOA 1UXIA 4EX7A 4DYDA 2WIKA 3K94A 5KNCD 3K4HA 2FE4A 1CERA 3CLSC 3MT9A 2Y1FA 1OKKD 1FXSA 2MSKA 4FYVA 4X0EA 4AAYA 3H9CA 5I6DA 2D0IA 5ICCA 1SUWA 1PQUA 4LPSA 2ATCA 2JIMA 4EHAA 5A9SA 5BY2A 1PV4A 4PG5A 1J8VA 3COYA 4BTVA 1YHYA 1WZ2A 1ZMXA 1CUXA 2R7MA 4KQKA 3OCYA 5ABPA 2VDMB 4NBVA 2FEMA 2D0OB 4HLUA 5CNMA 3EDQA 5FTMA 4QBIA 1O2DA 3RS8A 4F38A 3ZHRA 3VR2D 3S27A 5LD2B 3H9GA 1O0CA 4QL3A 4FEEA 4QGHA 5BV0A 1E1QA 1VM6A 1N6HA 2FETA 3I8XA 4AWBA 4F5YA 3GN1A 2GTPA 5DM1A 3CZAA 3IDAA 2BFCB 3DFFA 5FWXB 3K71B 1BN6A 3ESRA 4F84A 1T9CA 1S7GA 2XBLA 4BNMA 4CLXA 3K5IA 2XUGA 2CDAA 4M1MA 2C7GA 4ZPJA 4ZZ1A 4JB0A 4P31A 2OPHA 2UXBB 2QF7A 2GPBA 3M33A 1WPRA 3FWNA 3VISA 3AJDA 3QFRA 2O1XA 1EDBA 3TTVA 5F21A 3RO7A 4K81B 1SPXA 1NOIA 2NXJA 4MJLA 4X1IB 3UMJA 4COKA 3HGQA 4U3JA 3OTOB 2DKFA 3DTVD 5FBHA 3OQMA 3UUFA 4JOCA 1NU6A 2GPJA 2CD7A 2JEZA 4HH1A 3UWSA 3SMVA 1UQRA 3GJ7A 1GSAA 3VZBA 3IBCA 4M0KA 1PR2A 2Y71A 2GCEA 2VPQA 3V2UA 3O8BA 1RJGA 2YY5A 3H2BA 2OGZA 4HUQA 4IZIA 1Z74A 3DFIA 2O7SA 3UAYA 5BVGB 3MOSA 3JAWB 2O3JA 1JEQA 1VP9A 3RLFA 4IQ0A 3EVEA 3K9LA 2J5RA 1KR5A 3G23A 4UM5A 3T5BA 3DZCA 1L7MA 3D8NA 1KPIA 2NZXA 2J31A 1DPFA 3ZU6A 4K8RB 3GJ6A 3K9FC 5CFOA 2GM3A 5GIPE 4TM8A 3R3YA 1SMKA 1R9GA 2C61A 1PT5A 1W46A 4FR5A 1NOKA 1VL1A 2G4CA 2ZIXB 3NYRA 3VKUA 1MFPA 2HSDA 3M83A 2HWUA 2DR2A 2GAFA 1N1MA 3GMDA 6CHYA 2XOXA 4MWOA 5DYNA 3BKXA 2DKOA 2YHBA 4JELA 2RIRA 4YTEA 4MB2A 4DCPA 1NNEA 3ICQB 4LJ4A 1F6BA 2YOFA 2ZCVA 4GR5A 3ZNNA 2IT1A 5E1OA 4UTZA 1JJFA 2OXCA 3AEUA 1RI1A 3EGVA 3PD7A 4IH1A 4JLWA 3ZK9A 4CHTA 5I51A 1P2SA 3F5SA 5TSDA 2RGGA 4FWTA 4IYRA 5U4XA 4CI9A 3AIKA 3WRVA 5AW1A 1W5BA 2AE2A 2BGLA 1IXZA 3GCZA 1DBPA 2HV9A 3ZUPA 4LJLA 2CMGA 4K05A 4XD7A 1B8NA 1KK3A 1ZW1A 2ACEA 3HDQA 4PZDA 3UH1A 3HABA 4FNAA 1TPZA 3QH4A 1P4GA 1C30B 1U31A 1V8BA 4IG9A 4KVZA 4K28A 5FLYA 4NFHA 3ESQA 3ICPA 4ZI7F 5I9LA 2FMHA 2WSSD 5M34A 1XPUA 5CYFA 5A02A 2WIBA 4U7FA 2VP9A 1W2GA 4JB3A 1QG2A 4PYLA 5LUBA 3U4QB 5ARCA 1S4QA 1TAUA 4EL5A 1OR8A 1IC6A 1N3IA 3GP8A 1K75A 1YZFA 1M0SA 1GFZA 2FFRA 2EW2A 3IRVA 1KDRA 5BMVB 1QP7A 1E0SA 4D4KA 1GZHB 2R85A 1ZL2A 1P17A 2IWRA 4E7OA 2GARA 4C5BA 4DV0B 4ZOAA 3O94A 1G21E 1QIGA 4QXPA 1QGZA 1SCBA 2H48A 5JJ5A 3W2TA 2XDWA 3NIWA 4X71A 1K8YB 1KDYA 3RFTA 3Q8MA 1PG5A 1FYWA 2EFYA 1UWVA 5HVNA 1UDBA 3LT4A 2ON6A 1FQJA 3G7NA 3VDRA 1NIPA 4B6JA 3E2MA 3O8DA 2JI8A 1DNPA 1ODTC 1N0VC 3DKVA 4LY0A 1LDGA 5M29A 2VDOB 4CFSA 4D96A 3IP9A 2V9ZA 3BN3A 4NBUA 5J1TB 3KVOA 1W7AA 3ZW7A 2BVNA 1JSZA 3ABOB 1ESCA 3O5AA 3WSTA 2DQSA 2PX0A 4S1OA 1HORA 4HUJA 2XQFA 3B3JA 3FZGA 3PFKA 5IAJA 5GZ3A 4F5WA 3E27A 3F2IA 1QR2A 2ZPAA 1TMOA 2H85A 4EK9A 3PXBA 5F23A 4A03A 3KJIA 4HCJA 2V55B 2XVAA 3FROA 1RPAA 1SEPA 1XZ8A 1NIJA 1NXVA 5EE0A 5AQEA 3IL2A 1LKZA 3ACCA 1YRQA 2ZRCA 4B46A 1H3FA 1CTQA 1FTWA 2HY7A 4ILEA 1CDZA 2VWGA 1LK7A 1EJ6A 1B42A 3OT1B 4LDQA 2AI1A 1LVUA 2C2ZA 3KV3O 4WBNA 2J7PD 3NDBB 4Q4JB 1H1LA 4JBXA 5K7SA 1SCNE 3A1NA 1I2BA 4FFNA 1PWXA 2PQ0A 4OHRA 4JDUA 2RK3A 1VA5A 3PX3A 3ITKA 1DKUA 2QIOA 3JQFA 1KMIY 1Y34E 2YV1A 4L95C 4PNZA 3ILVA 4QOSA 1GJRA 1PHRA 1ZINA 3IMCA 1J39A 5LBIA 3X1XA 4AMBA 4YMTA 4M86A 2XB6A 4MPJA 1GGJA 2RHRA 3LOPA 1UC5B 3PWSA 4TTRA 4XVHA 4IH9A 1EFVB 1ZIOA 1KGDA 3ORFA 1GKKA 4G5HA 4NX2A 3RAJA 4C4SA 1Q0RA 5JNLA 1HY3A 4WESB 2XUHA 5AJZA 1IK6A 1FUEA 2QD4A 5FWYB 5LA6A 1QGED 3VH3A 4BB6A 1P2BA 1SUIA 4B4DA 1P0QA 4J3FA 4LMBA 4GBGA 3ZTTA 4BU1A 4RVGA 5L3QB 3FSGD 5H5JA 4X5OA 2FSGA 5IAEA 5EJ7A 3BEOA 1H4VB 3OJEA 4D0LB 1UUFA 1VRCA 2V6IA 4FLMA 4TL7A 2H8GA 3TLAA 2GJ8A 4EABA 2D1QA 3REFA 4PG6A 2ZJFA 1QZ3A 1Q7RA 1NATA 1UC8A 1MW9X 4JJ7A 4BNDA 3CF4G 2R6HA 4MV7A 3P45A 4B2LA 4R0VA 5THXA 2P65A 4KZKA 2B83A 4MR9B 4ED9A 2EQAA 1CFZA 4IDEA 2N0SA 2WFMA 3HWSA 3T5CA 1IBCA 5HCNA 1PBTA 3W1WA 5JSUA 1OTXA 1PDWA 5I9IA 4NC9A 2A88A 5FYDA 3PFWO 1FXUA 1YH3A 3B70A 4QDOA 1IN1A 3CBQA 3CF0A 4AG5A 5A1TA 3KUDA 1D1PA 3PDCA 4IXDA 2R2GA 5KNBH 3H1GA 4IBOA 1DGQA 1V37A 2DFNA 1Y4UA 3K0FB 2WG0A 1E7YA 3E82A 4PNPA 2P4SA 4Z3DA 5ESRA 1U8ZA 1G3IA 1NYRA 3F3KA 3GJ3A 1ID1A 2W8BB 3OC6A 2HU8A 1NUSA 3AEKB 4HWOA 3PIDA 3H87A 4ZXPA 4ZN6A 1C3OB 1KHHA 3JATA 2DBVO 4P3OA 5HTKA 4B6GA 2A0FA 3BFXA 4EHLA 1E9CA 2BOVA 2QD5A 4CKWB 5H59A 1B1AA 2I6FA 3R3JA 1WNTA 2B8NA 2Z83A 4U7JA 3RS5A 1U9IC 2AEJA 2QWXA 1GPDG 2HF7A 3PKZA 4UEKA 1L8LA 3WMXA 4A6DA 4C04A 1NNSA 4EUHA 2GWHA 1MFZA 3Q1LA 2PVCA 1I7QB 3H1PA 3IV9A 5L51A 5FA6A 3V1TC 3WA6A 3JWEA 2EG5A 3IT1A 4ESOA 2VPIA 4DQUA 3WGLA 5BXQC 1K0FA 2O2YA 3AB7A 4KDRA 4OK5A 1APBA 4F9EA 3S2FA 2RAUA 3VR4A 4DQVA 5KYWA 4LE1A 4X94A 4AMYA 2VP3A 3OWOA 4NQZA 3TTSA 1TJNA 5HRAA 3LQFA 1UJ2A 3K1AA 1FFDA 3A6EA 4TKMA 4EW1A 3E1SA 1Y4SA 3A36A 1SWVA 3F1LA 2VHJA 1W30A 3CINA 2QAGA 2Y2VA 4S1NA 3HYRA 4BNGA 4EGJA 1T0UA 1XZQA 3I76A 3WJ7A 1SK8A 1UBUS 5TR9A 4D9GA 2W6NA 3UYLA 4MW7A 4OIFA 1M6WA 2Q5CA 1JHQA 2BY4A 1CJVC 2QS9A 3K0CC 2COUA 3LUGA 4PLWA 2REOA 1GZ3A 1VMDA 4YUYA 2BCEA 1KO7A 2G36A 1PR3A 4LXIA 2BSQA 3BXEA 3NNNA 4M83A 3GFGA 1YZVA 1Z7EA 2WI8A 3IAUA 3OAAD 3JWGA 3NTQA 4MA5A 1SCUA 2EIHA 4M9XA 1TIKA 4ZVUA 3AH8A 1GUYA 1HURA 3QYAA 4FMBB 5A3VA 3RC9A 2MMCA 2Z3ZA 3MQ2A 4MDHA 1VLHA 4O0LA 4RY9A 1N75A 1QU3A 4NF2A 4JGBA 1TTHA 1UMCB 2EP8A 4UEQA 1XPJA 5KTRA 5H3CA 1J07A 1FVOA 1Z8DA 2QZ9A 4FUQA 4UASA 3THXB 4P9NA 2FPXA 2CXRA 1E6MA 2VZEA 2C00A 4ZTZB 1A98A 1DL5A 4RPHA 4YT8A 5JH7F 4EEZA 4RKYA 5BYJA 2PFSA 2W98A 2C2MA 2NPIA 4JGIA 3STHA 3M3HA 4YUVA 1QG6A 4CFZA 1KTIA 1WU7A 4DIBA 5CIYA 2W42A 1EGMB 2QMEA 1RWNA 2VTKA 1QCDA 3CRNA 5HMMA 3S2ZA 1IZ0A 3PCRB 3MGAA 2DY0A 4RGBA 1PX2A 1YB1A 1MNAA 5KSPA 2O2IA 4C2AA 3IPCA 2VP2A 1A95A 2GLTA 4RTLA 2FEXA 1L7QA 1N5IA 3DA8A 3PHGA 1QFYA 4UCFA 3QBTA 4DMCA 1YR9A 4W5NA 2G17A 3U40A 2FPIB 3KR2A 5AHOA 3HI6A 1YZ3A 1TL7C 3AR5A 1B8PA 1KK1A 3LPDA 4IEIA 5DHPA 1MABA 4I1YA 3T3PB 1KL7A 2H5EA 1LDYA 4AP6A 3VNVA 4RZUA 1NUUA 2VDLB 4C7JA 3UJCA 1U2DC 3D8HA 3VR4H 2RK6A 5B2FA 1N3YA 3NKLA 1S2MA 4ZT2A 4B9AA 3AVYA 3A0UA 3RHFA 5AD1A 2P40A 1TM1E 1R8SA 1TVEA 2WZBA 4YIKA 1YJ5A 1OFTA 4OKNA 4B80A 1U2PA 2C2KA 1GAEO 2BAGA 3GNQA 1RC0A 2Y92A 4BMCA 2DCUA 5HXAA 1QQ5A 1DG3A 5CW2A 1DKRA 4MWSA 1XTJA 3M5CA 3MMSA 3QELB 1LDNA 3VPDA 4ZYTA 4JP2A 4NVRA 2AEEA 1ODIA 1V11A 3OCUA 3DF9A 1S96A 2D1YA 4IZOA 2I65A 4E13A 2Y1EA 6GPBA 3ABQB 4HUQB 2LD4A 3JYOA 3LRTA 1G18A 2I33A 3OZUA 3TIGA 1EFTA 4L76A 4C4YA 4RLFA 1EUCA 2I2FA 2J9ZB 3ENNA 1CUGA 1ZVKA 2R8PA 3CF4A 5CLGA 4ND7A 3UUWA 1DAOA 4DQ0A 4EAQA 3U7HB 5KTOA 5EHZA 4DMKA 2BTQA 2I8AA 3NWPA 4Q4CA 4OSPA 2H1SA 3B1XA 1J2EA 3K6KA 4OEHA 4ECEA 4LQDA 4M4SA 3GRKA 4IWNA 5LWHA 2QLFA 1D9XA 1MF7A 5IJ9B 4MQ4A 5EY5B 5EE9A 2YWCA 3IUPA 3ECAA 1E1CA 3OU2A 2XT6A 3U7RA 3NUGA 4W5JA 3ZOKA 4Y9UA 3L84A 4CM8A 3TTUA 2GN9A 2IVZA 3HUEA 4QQFA 3RSGA 1BFDA 2CYCA 3WLOA 1LU9A 3GVIA 3VO2A 4C5AA 2QA5A 3B53X 3HFSA 1PS9A 4I4IA 2B94A 4UBKA 1Z4IA 4YV0A 5DW3A 3BWDD 3PCXA 2FZKA 2RG7A 1SCKA 5D3MB 1ZJYA 2QE7D 1VBKA 1T8TA 1EFLA 3IJRA 1CDDA 3BM5A 2IYYA 2C07A 2ODBA 3E23A 3T4PA 3VTKA 3V2HA 1N2ZA 1MN6A 2Y8EA 2EJWA 3W9UA 1JSCA 1YI1A 2O23A 2AFHB 5JV5A 2CHVA 2VL7A 3I28A 5KQGA 4JBIA 2QRVB 1FMJA 2EGHA 5AI6A 3ZE9A 1USWA 3QFSA 2COEA 3TW6A 1Z4NA 2E4XA 2VQ6A 1CE8B 1SHUX 1JDSA 1XP5A 4IV5A 4R8MA 5CAEA 1R1DA 1NPTO 2PLWA 2O0MA 3DFKA 5EMJA 3FDXA 3O73A 1CZLA 3G5UA 4AJJA 1NP3A 3O1HB 3K92A 3K96A 5JH7A 4IHKA 1E99A 1Q77A 4JLJA 3N76A 4Z7NB 1Q22A 2X4IA 1FVFA 1LQUA 3CZRA 3FIJA 1K4MA 2AJBA 3KFXA 3GDGA 4ANFA 4YAOA 4RJTA 3LDAA 4IG4A 4NYMQ 5KX5A 4KI0A 3K0SA 2PUFA 3KUXA 1J0XO 3QYPA 3ZV5A 1L7DA 4O2BB 5LP6C 5SZJA 2W2VA 3PITA 1QRRA 4XLLA 2IZ1A 1Q19A 1AQUA 1EM8A 4JFRA 4AZ3B 1QANA 3NJ8A 1GPLA 3GD5A 1EU1A 3CX7A 4GLLA 1DXOA 3DD5A 3QG5A 5DVZA 2GJ4A 2HX1A 5JD6A 3EVFA 3QQPA 3UK6A 3HA2A 3GFVA 4GT1A 3RVSA 1SVMA 1IG0A 3BMXA 5AVJA 5G0TA 4EO4A 3O8OA 4XKJA 2GPNA 4WXHA 4AKEA 4DCCA 2AG5A 1T6YA 5JRDS 4KK3A 2E1PA 1B14A 4INOA 4C01A 2WT8A 2FH5B 2YOGA 1XRNA 2PJDA 2QW1A 4HRXA 4N39A 3KETA 3FKJA 1F0YA 2IUEA 3B1JA 3W8FA 5KJ6A 1AXGA 4C78A 1TYDE 1IBRA 3ABIA 5EESA 3V1LA 2VJYA 5B57C 5DU2A 1UBCA 3UWPA 5T3YA 2G76A 2R1TB 1G9XA 5K5EA 1XU7A 3R7AA 1GEGA 4G41A 3IQHX 2GNPA 1TC2A 4NWIA 2UUOA 3BTVA 3LFTA 3DCNA 4R7TA 3EK2A 1UPTA 3FI9A 4DJDC 2VAPA 1MJFA 4MMXB 4EA9A 4XWOA 1K92A 1XZLA 1Z18A 3M1AA 2QMUA 2A9OA 4NMWA 4BNFA 4GZ3A 1KXZA 1EVQA 4QGBA 3A37A 3TRIA 3EW7A 1JS1X 1N3BA 4LXQA 1SKYB 2PLRA 2DFPA 3MMNA 3PA8A 1NQTA 4PTLA 4CMAA 1TPYA 4MKRA 1KK2A 2AMJA 2HA2A 1QTRA 3VO8A 2OCYC 2XCUA 1M0TA 3FWZA 3JD1A 4R2WA 4MVJA 4ERXA 4D0RA 3GV0A 1ONSA 1RZRD 4MICA 1U7PA 4WCDA 4QVKA 1BN7A 1BD4A 2A5YB 1EGAA 1IM8A 3C97A 3DNFA 4V0OA 1F2TA 2Q50A 2XNDA 1KK0A 3DF7A 1FYDA 1YB2A 2CNOA 3JZDA 4I9NA 4M9CA 4ZI5A 2W70A 4NFYA 1C0PA 5ALKA 4F6CA 1QFZA 2AQ8A 2YWFA 3RS4A 1ZPDA 4PLHA 4KVGA 3QWHA 4HXGA 1M8PA 4CXMA 4D9BA 4WFIA 1UMDB 3DDHA 2ZB8A 2JZNA 2UKDA 4LQ4A 4BE4A 2ZJ6A 1SXGA 2O05A 3EVDA 1X8XA 1ZGBA 3PJDA 4DV6B 4FSHA 3RE1A 2RGBA 2O8NA 5G4KB 3I45A 3EXEA 3QVSA 1RBZA 1OXKB 2CCJA 4WX2B 3HXPA 1E6UA 1XDUA 2BJWA 3DTYA 5KQPA 2OXTA 3A58B 5C1IA 1GGHA 4DNXA 5AT1A 1YUMA 1JG2A 2WJIA 4FFDA 4A27A 1HETA 4L08A 4NZOA 4JBNA 1T36A 4RA6B 4PCVA 4AZVA 4HAZA 5I7FA 3ER9A 1P0IA 2AW5A 2ZITA 2LTAA 4RVCA 4Q9LA 3ZDQA 1D1QA 2BGMA 4NCKA 4JY7A 1WRBA 1JG1A 5SY4A 2HB6A 2Z4TA 4BKOA 2YZ2A 2Q4TA 2JI4A 4M55A 3AX6A 2RC6A 3RS2A 1EWYA 4FYKA 4OX9B 2C3MA 3GYGA 1QYCA 1D8TA 4YAJA 1GDDA 5T5QA 2FW8A 3H75A 3PGJA 1QQTA 5EINA 2Q7OE 5HJ5A 3K20A 2JANA 4I4CA 4PC2A 3WWCA 1K7YA 1UJ4A 2OOSA 1V25A 2XYQA 2WPDA 3GCXA 4C0AC 2PZMA 4M1YA 1S2IA 5REQA 2A9JA 5HK9A 5KMGA 4RTOA 2QUZA 5AKZA 1NL3A 4KXUA 1LF5A 1MB4A 4Y2VA 4C06A 4TL8A 3W90A 3UWOA 1MEJA 4C4AA 3FOWA 1B0UA 2G80A 4Z9YA 2X7XA 1QJCA 1X38A 3SJ7A 1IJKA 1GN8A 1L5ZA 1SA0B 1A1SA 1R0KA 3EWNA 1B15A 2AN1A 2C5SA 3FHCB 4MUIA 1KYZA 1NW3A 3GVXA 2CEKA 4NE9A 2GM5A 1OH6A 4RJ2A 4UDXX 1USGA 1PNQA 2FX5A 2ECPA 3BMQB 1WZCA 2GLXA 3BHNA 3OEED 2SKCA 2R00A 2XZTA 1XCLA 4MVJE 1BMDA 1WDMA 4KG7A 4NENB 5T4EA 3RROA 3PKJA 4DLNA 3H42B 2HPAA 1Z07A 1SVWA 2WT4A 3YASA 1X7YB 4CMCA 4Z0TA 4C0HA 1DKPA 1N92A 4AO8A 2GXSA 3L7AA 4DM3A 1L7NA 2VDKB 4RZSA 1E1CB 1FFSA 2BFMA 2Z2KA 3FPEA 3PQ4A 4GO1A 2WJVA 1H66A 3FGPA 5CFNA 2O7QA 2D06A 3E9RA 5ENDA 4KQEA 1XDBA 2FZLA 3ZXIA