1N6RA

Crystal structure of human rab5a a30l mutant complex with gppnhp
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
167
structure length
167
Chain Sequence
GNKICQFKLVLLGESLVGKSSLVLRFVKGQFHEFQESTIGAAFLTQTVCLDDTTVKFEIWDTAGQERYHSLAPMYYRGAQAAIVVYDITNEESFARAKNWVKELQRQASPNIVIALSGNKADLANKRAVDFQEAQSYADDNSLLFMETSAKTSMNVNEIFMAIAKKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ras-related protein Rab-5A
publication title High Resolution Crystal Structures of Human Rab5a and Five Mutants with Substitutions in the Catalytically Important Phosphate-Binding Loop
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein transport
total genus 55
structure length 167
sequence length 167
ec nomenclature
pdb deposition date 2002-11-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1n6rA00
2AHOA 3CH4B 1RIFA 1U8AA 4LBVA 3CR8A 3FPAA 1TMKA 4TTRA 5D3MA 1CJTC 4A8JC 1XTSA 2ONKA 3M6AA 3P1JA 1TQ2A 2QL6A 3W5JA 4EPWA 4RKFA 1N5KA 1ZM2A 4D6PA 2QP4A 4ACBA 3VR1A 3AB3A 4URUR 5BN4A 5FL7D 2AN9A 2LKCA 3BORA 1CJUC 5JMTA 5JRJA 2HF9A 1U0HC 1NLYA 3CLVA 1P75A 1WBDA 1W4AA 2O0JA 2YWEA 2ZJ5A 2PT7A 4UNNA 5FUXA 1R8QA 1CJMA 1HT1E 3SHFA 5EUMA 3RRMA 1TQDA 1X3SA 4JL8A 2XX3A 5F98A 2HCJB 1ANKA 1NN1A 3AKCA 4NCJA 4U02A 5CJ2A 4B3BA 2OV2A 2WPDA 1HV8A 1T8UA 3QI2A 4FI3C 5CLLA 1AJEA 2Y8EA 3QKTA 4A2WA 1XU4A 1MV5A 4OK5A 2O8BA 4MRVA 4WXRA 1IXZA 5DYGA 3B1XA 2J59A 3X1XA 4HDQB 3TR0A 1XPRA 4DJTA 3GQBA 3FKSA 3H84A 1RPZA 1UDWA 3L0OA 3AEZA 2WSSD 5SZHB 2ZYTX 4NE2A 5JRZA 1ETUA 3CIOA 2J0VA 2PZFA 1PVOA 1EGAA 1YR6A 3IUYA 2FSIA 1G18A 1NKSA 2ANBA 5DSZA 1H8HA 4A0RA 3E1SA 4JKIA 2CL0X 4PPQA 4DSOA 2AWNA 1IOZA 1KIMA 1I2MA 4QRHA 3U7FB 4LOAA 3L43A 1IY2A 2ODEA 2XEXA 1LF0A 3TRFA 3JVUA 2HDNB 4QJ5A 2P67A 3VR2A 4Q9HA 1S96A 1D2NA 4JLBA 2QAJA 3GFTA 1KK2A 4TQAA 4FCTA 3AGQA 5B64A 2YV5A 3EXAA 3QBTA 3HJNA 2J0UA 2IUUA 3EZ7A 3QXHA 4LCBA 1HUQA 3MRSA 1RRPA 3C5HA 1CIPA 1X8LA 2XTNA 3AF3A 1F2TA 3Q9LA 3P32A 4V0KA 2A7QA 1HH4A 1SVKA 4Q47A 1WDTA 4NCNA 4G5QA 2FOLA 4R98A 1E4VA 4DUGA 2VHUA 4URXR 2EFCB 3QNUA 4LJ8A 3FFAA 1R0ZA 4QJ4A 2H16A 3RWMB 1Q1BA 2VF7A 2W00A 3EIQA 3W3AA 3PJRA 1E2NA 3OIYA 5AJVB 4TYQA 1BH2A 1VG0B 4UXIA 3DPUA 3VHLB 1L7VC 2A5JA 4L15A 2XTMA 1P72A 2EU8A 2ZRGA 3WBJA 1NN3A 4MYTA 3THYA 1IN7A 2R2AA 2Z83A 2ZRIA 5FBQB 5TV2A 1E3MA 1TAGA 1NN0A 2Z0MA 1FP6A 1OH7A 1OB2A 1XCGB 3Q72A 3T1TA 2ZPTX 1BMFD 1KY2A 2GDJA 3VU9A 1A5TA 4OBEA 1XTJA 2KB0A 2QMHA 3KXIA 1AM4D 4BFZA 4HUTA 3FWYA 3PUWA 1R0WA 3AV0B 2GXAA 1EK0A 3QPUA 3CX8A 3FMOB 5F3WB 2Q3FA 2QBYB 3WRXC 2FFHA 3WMEA 3GLGA 2W58A 4OHVA 5E7JA 1IHUA 3LQQA 4P4UA 3U4QB 2H8KA 2JIZA 4NCKA 3OE7A 1PLLA 4EPYA 2XZOA 2FF7A 2B7BA 1FL9A 3GJ8A 1XDBA 4LJ5A 2FSGA 5FBLB 1E6CA 1XRJA 4D0GA 4RD0A 1IXSB 4QBHA 1G7RA 1ZD1A 1P5ZB 2JEOA 4KODA 1W0JA 2CLSA 3IDQA 4MYCA 3TAUA 5KOYA 2WBLC 2N1BA 4EUNA 3RDPA 1KO1A 2I1QA 5FOTA 3B1WA 4JS0A 4QC2A 4B73A 1Q12A 2H1LA 4GSYA 1G64A 1IBRA 3KX2A 3AF1A 2FV8A 4PZLA 4HSEA 5LDDC 4EPVA 2OAQ1 4XVUA 3RAPR 3CZPA 5DHFA 2ZJBA 3W6NA 4OQNA 4C4PA 3VR4A 2GNOA 2QPOA 2ZRNA 4C0SA 3FGNA 3KB2A 5KU1A 2D3WA 5EP4A 5H70A 3TSZA 2IEYA 3BS4A 3A1TA 1UBFA 3W6OA 1NRJB 4EFLA 1QG2A 3K0FB 4US0R 4ERNA 2ZI6A 3QG5A 3BXZA 5KPDA 4HUQB 4DDTA 3RRZA 1VKJA 2JDIA 5SZIA 4QOSA 3WY9A 1KI9A 3MWKA 4O2RA 4QNRA 4IDPA 5FBWB 3CBQA 1G3UA 4XD7A 1GKIA 2QAGB 4BFYA 4KO8A 1TEVA 1ZD9A 2BEJA 4C0BA 1QRAA 2DFLA 4A82A 2WWYA 4JVMA 4OK6A 2JLXA 1MT0A 4BLOA 2A5DA 4Q1CA 3P27A 3GJXC 4PXAA 1W36C 2L0XA 4PSAA 3OESA 3RSLA 1I4TD 1G8YA 1MOZA 2GKSA 3BAFA 4ZCLA 5KDDA 2YWHA 4MGZR 3U61B 1A1VA 3LBIA 1W49A 5DIFA 4KFRA 5TARA 1KJZA 3ICEA 1TF5A 4JLAA 1NG1A 3JVVA 2XJ9A 4RSGA 2BM0A 3C41J 5D3QA 1XPOA 4JZKA 4TYYA 5IRCD 5IT5A 3ZGXA 3TW8B 5JS7A 5F9HA 1DEKA 2QPAA 4LYAA 2AWOA 4GNKA 4XSHA 2OSBA 3ZQJA 2C9OA 3THXB 1MRNA 1GTVA 1D2MA 3CRW1 3KKMA 3LX5A 1GL7A 1T0HB 5BWMA 1D5CA 1SKYE 5J4HA 2NO7A 1KO8A 3MSXA 3S1AB 5FH9A 1JJVA 2J3EA 2C77A 4RCZA 2JLYA 1UPTA 1P4SA 1CXZA 4NCIA 4XWAA 1QZXA 5F2EA 3EZ2A 2QNRA 4GOJA 1PLKA 1HT2E 2C98A 4DSTA 4BFTA 2ZS8A 3TK1A 4CEIA 2E1RA 2DWPA 2ECKA 2FZLA 1W7AA 1T3HA 2QROA 4M4SA 5TXGA 2G0TA 4M2LA 2GEDA 3F3YA 2ZAOA 1XEXA 2IS1A 2G0NA 1Z07A 4H9GA 5L3SB 1CR2A 5DI9A 2A78A 3U2QA 3VKWA 2R65A 521PA 1E69A 3VKGA 4Y0AA 4XWKA 2MSEB 4NDZA 2OHFA 4OL0A 1R0YA 3BWDD 4TYPA 3QXSA 4D4LA 4M53A 2YHSA 1A4RA 1G291 2CNWA 4JVSB 4XJXA 4US1R 3TUIC 1ZC3A 5UKDA 3RABA 1G6HA 2WAYA 1DG1G 1U99A 3A4NA 3I1FA 2OBLA 1LW7A 2HV8A 4I81A 1KJWA 2FFBA 1KTVA 3TNFA 2GESA 2WOJA 1NMZA 1PUJA 4B3DA 4LHXA 1WF3A 3TQCA 4AYXA 4B43A 4Q19A 4TQ9A 4TL7A 2EYQA 2BEKA 1PUIA 2GJAA 4KHZA 5LPNA 3WYFA 1P62B 2ZSEA 2A5YB 1QF9A 1T91A 1V5WA 4LBYA 3ICQB 4P0TA 5DISB 3MUFA 2TMKA 3BD9A 2FGJA 2CK3A 2VTKA 2NMVA 3P26A 3N2EA 3KJHA 5JHHB 2WZQA 4WXPA 5DNYB 3SJCA 4E22A 2C8VA 1I4DD 2OUKA 2OXCA 1NMXA 1YZNA 4FW9A 4PQFA 4WA7A 1GSIA 3RNLA 4Z1MD 2YINC 4PC6A 2JJ1D 5E4FA 2REBA 1UFQA 4ABYA 4PHTA 5GVSA 5TVKA 1UEIA 2OE2A 1EWRA 4A4DA 2PCLA 3K0CA 1Z5ZA 3G82C 1ZUIA 2C78A 3K53A 1U98A 2QZ4A 1E1RA 2ZUCA 3CX6A 3L8ZA 1E79A 5KDLA 4YC7A 5FUWA 5FOXA 4OI0A 4RJLA 2A2ZA 5FUYA 1OIXA 3AKEA 1TL7C 4PPFA 1VCIA 3DOFA 1COWA 1N0WA 2BCJQ 3OZXA 4CEHB 3SN6A 2ZE7A 2AKYA 2I4IA 5JSZA 1NBMD 2DR3A 4JLPA 3EX7C 2IYRA 4OJQA 5J4LA 5IK2A 2GAOA 2P65A 1N0VC 2QE7A 3BGWA 2QRNA 1UBGA 3EWSA 3HYTA 3G5UA 5BN3A 4DKXA 2EQBA 1OH8A 5TMPA 1P6XA 1W0KD 4A2QA 2FDCA 2WJGA 1KZGB 4LBWA 1OW3B 4Q7MB 4B2IA 3C15C 2DPXA 2J46A 1E9SA 5C4GB 1BYUA 1QHIA 4MRPA 2VP0A 1WXQA 5CYPA 1ELOA 3DKPA 3K9NA 3OEHA 4OHYA 3NH9A 3KQHA 5G53C 2QEQA 1Z6GA 4R71A 2W2XA 5EXSA 2QTVB 3OEEA 4IEIA 1B23P 4CDGA 3B13B 4AURA 1SXJB 2AX4A 2XTZA 4V0ME 1QHGA 5FPHA 2O8FB 4XVQA 2OBNA 1G7TA 4KBGA 1LNZA 3IEUA 3A1SA 4EPTA 1JQJC 4QNMA 2XZPA 3U3OA 2G1JA 3VX4A 1XTIA 1ODFA 2VP2A 4EJSB 5CYOA 1YZUA 4HLQB 2ZRJA 1GIAA 1CJVC 1FTNA 1SQ5A 1N0UA 1XXHB 1E9CA 1AQUA 3FHCB 3QF4B 4Q1EA 1DG3A 2VL7A 4JLVA 4RD2A 1E98A 3KTAB 4AY2A 3NBFA 1KSHA 3R8FA 3QJYA 3EPLA 2D2FA 2FZ4A 3ZS8A 5HCNA 3LVQE 3LW8A 2R6FA 3BRWD 2X1VA 3ZVLA 4BPBA 2JCSA 1EG7A 3CNOA 3LDAA 2BJWA 3DZ8A 3RS7A 1P73A 1Q57A 2GXSA 3WHKA 4EQ6A 1TNDA 2J7PA 1RZ3A 1NP6A 4OHWA 2OLKA 4N3NA 4TWZA 5EQTA 3U7HB 1YR9A 1KKMA 1T6NA 1SGWA 5DI3A 1T3SA 4A36A 2BBSA 4RKEA 3T1QA 2QGNA 3SYNA 1A2KC 3GJ4A 4JLJA 4BLRA 4O0MA 2A5FA 1OXTA 4OI4A 5AUNB 3GPLA 4YQFA 2V7QA 3A37A 4F92B 4AKHA 2NO9A 4B44A 4BEBA 1P3JA 1XNJA 3NVAA 1WQ1R 4QGGA 2GA8A 1KOFA 1KI6B 4FMDB 4DLUA 3ONWA 3LBNA 2VP9A 3NEYA 2C2HA 3FMPB 3RC3A 5DLQC 1KI2A 2XITA 3KKPA 1SVWA 5EXXA 3CWQA 1JI0A 5FR2A 2Q3MA 3W34A 5JEEA 3P4YA 3K9HA 2ZJAA 3OF5A 2BBWA 1TF2A 2AK3A 4PZZA 4YMWA 3TGPA 4M1WA 5JI2E 1E2EA 4LUCA 1GUAA 5CDFE 1XPUA 1EFHA 2XB2A 5AUOB 2BHRA 2ZRPA 2WIBA 4Q1AA 4OQFA 3I4LA 3K0FA 2ODBA 3W8NA 2VSFA 1G4AE 2IYYA 3SFZA 2WMNB 2F3TA 2PLFA 2A30A 1VECA 4NH0A 2IL1A 2ZE6A 3SBDA 1NN5A 1U9IC 3B1YA 1PLJA 2ZS9A 2GCPA 4ZDWA 3W8RA 1DAEA 3OFND 1JAHA 1ZC4A 4XVRA 1T5LA 4YDHB 4HAUA 5FPKA 1KSFX 5FI0B 4B3CA 4P31A 1BIFA 1AZTA 1JR6A 5CM8B 1U2RA 3I5YA 3B2EA 4U5XA 2WV9A 4CVNA 2CCGA 2ORVA 2V3CC 1IY1A 4LJ4A 2PT5A 2QPTA 3QEOA 4YDSA 3FYHA 4NU0A 1M8PA 3BFKA 4P3YA 4TMXA 5L3VA 2P6NA 4IVRA 4JSTA 3V00A 1QBKC 3RSOA 2WWGA 2P6RA 2J5XA 3UMSA 3LXRA 2J0SA 2O8EB 3R20A 3DM5A 5DN6A 2C04A 5HE9A 1FPMA 4ON9A 4DDWA 4WZ6A 1U8YA 5AJYA 1N3BA 1XTRA 3JZMA 3SJBA 4HDCA 2HCBA 3A4LA 4WVFA 3Q7PA 4NKRA 5JEDA 3THXA 4OKSA 2CHGA 1DO2A 4GMDA 3L0SA 2OBMA 4YONB 3S1AA 2D2EA 4JYBA 5IHPA 2ZU6A 1PZNA 4POAA 2BBTA 2REXB 3U44A 5J4YA 3VR3A 4IVQA 1C4OA 1ZVQA 1J2JA 1Z08A 4DSUA 1S1MA 3TJZA 4D4MA 3GLHB 4RFVA 1ZU4A 1SXJD 3BH0A 3SS8A 2IYWA 4KVGA 4HAXA 1K5GA 1QHHB 1ZP6A 3GEHA 4LDJA 4V0OA 2QG6A 4FD2A 1OXXK 4PAOA 3NEJA 4TSFD 4TN1A 5L3SA 2JLUA 4V0MA 3VX3A 1D9XA 1M7HA 4FMDF 4F38A 2ZRHA 5JCZA 3QENA 4NHOA 4KXFB 4B2LA 2W2VA 3EWAA 3HR7A 3B5JA 3X1WA 1EFRA 3UIEA 4PQYA 1E9AA 4AG6A 2AD5A 4CW7A 1W4RA 2VQSA 1OHHD 2X8AA 4ILEA 4NONA 3T1VA 1OJLA 3U7EB 1KAOA 2FSHA 3AP3A 1H8EA 3AF0A 4ARZB 1E9BA 5JBQA 3AH8A 2QSZA 1VYTA 4GP7A 2V1UA 2HEIA 3NIBA 4EFMA 2DFNA 2Z43A 2UZIR 1ZNZA 4PHGA 2ORIA 1Z29A 2ZEJA 1KSGA 1GITA 3SE0A 1K6MA 4CEJB 5CITA 1X1RA 4QHTA 1UKYA 3H86A 1KNQA 2VPPA 4MQBA 4K8OA 5EE1A 3TBKA 4HLCA 1E2JA 1BOFA 1LFDB 2IYTA 3LO5A 3PCRB 1NL3A 2ZREA 2P0EA 4L9SA 4R7ZA 3SJAA 1CRQA 4MKIA 1TUIA 3E5HA 1YQTA 2C5LA 1AQYA 2BCGY 4FMCB 4LV8B 4PSKA 3WP0A 2GVZC 1X8JA 3GEIA 4XSGA 3RS3A 4GDFA 2YWGA 1CU1A 3LX8A 4TYNA 3K70C 4FCVA 1OKKD 1OT3A 2J1LA 3K0AA 5AUPB 5KPJA 4JJZA 4CYMA 1TQ4A 4ASUA 2WAXA 3ETLA 3VKHA 4M21A 3A1UA 1OV4A 4MYHA 1JECA 1RJ9A 4I1VA 3HU3A 3F8TA 3CH5A 2IT1A 2UZ3A 4L5BA 1G16A 4HLDA 2ODNA 2P5SA 3PFIA 2NTYC 3B9PA 4CZ2A 1TX4B 3T1OA 1RVDA 4JBWA 1R5NA 3KKQA 2OESA 3C4JA 1CR4A 1Z8FA 3FHTA 5CB6A 2BC9A 3MG9A 3ND9A 4U7DA 5AUQA 1D2EA 2F1JA 4B35A 3AVPA 1W47A 3QUSA 3KXKA 4NYJQ 4P4SB 4NCHA 1GAJA 4RZ2A 5CDFA 4B76A 3OAAD 2JIZD 3RYTC 3SBEA 1XD2A 4IOJA 1IAQA 4HDOB 1YKSA 4MRSA 3DDCA 5EP3A 3X1ZA 3TQFA 1FMJA 3IEVA 1JR3D 4UJ3A 3DO6A 2CJWB 4BFXA 3PV0A 3H1TA 2Z4SA 4A2PA 5KTYA 3SI7A 1IM2A 2O8CB 3TE6A 1KMHA 1HQCA 4BLPA 4DLVA 2BM1A 4F4JA 4F93B 1LY1A 1Q1ZA 1W36D 2RGCA 4ZDIA 2GXUA 3EW9A 3AF4A 3TLXA 3Q5DA 2CMKA 1N5JA 3FTQA 3ZIAA 3H4MA 3DEFA 1W2HA 2OFXA 4IHQA 4B6FA 8OHMA 1XMSA 4OQXA 4DT1B 4C0KA 2OM2A 3CF2A 2JATA 1Q21A 1E0KA 2JJ2A 1G5PA 3LV8A 1BYIA 4DCSA 4HB0A 2GF9A 1JEDA 2ZJOA 3HR8A 1NIPA 4D82A 3KZ1E 1Z0IA 1N2CE 3CPHA 2O8FA 2HJGA 4A1FA 1XBTA 1JB1A 3B60A 3ZVNA 3BERA 2BJVA 3SZRA 2GJ8A 3CPJB 4US2R 3ZVMA 2FJUA 4LV5B 2H57A 1KI1A 2OAP1 5BXQC 2X77A 2ZAMA 1P2TA 1XTQA 2VHQA 1N25A 4HYYA 3PEUA 4XD7D 4TMWA 3I3SR 4HAZA 3KTAA 5EP1A 2IYZA 2WJVA 4Z51A 2O52A 1J90A 3VNVA 4XH9B 1F6BA 4X8HA 3BIFA 5H68A 1U81A 3UWOA 2CL6X 2JLRA 1AGPA 2EFDB 1OLOA 1US8A 2DCUA 2ZYVX 4GOXA 4RZ3A 4C2UA 1CR0A 2FFAA 3VHXA 4PAQA 3U60B 2FPKA 1N6HA 4HZUA 4Q66C 3ZZUA 5C1BA 3CO5A 1ZNXA 5FTKA 4B47A 1J70A 1Z6AA 2WWIA 3NC1C 4E03A 3EC1A 1IJFA 2EVWX 3ZLJA 2Q9BA 4OI2A 4NL4H 1G17A 4B34A 1DAFA 1FTSA 5FL7A 2NOAA 4CT5A 4O3MA 2HT1A 1CP2A 4DLRA 5GJBA 2ZROA 2XSZA 1AN0A 1WRBA 5HTKA 4OI1A 1W5TA 3TH5A 3QF7A 4P32A 3GJ7A 4A92A 1UAAA 4DXAA 1KDRA 1SZPA 4Q4AB 4GZMA 2XNDD 2JAQA 4F91B 4J0QA 5CB8A 4M1KA 4KV9A 1R8SA 1KAGA 4C0AC 4TMTA 4UNRA 2WJJA 3DVLA 1KMQA 1E2MA 4PSVA 3EAQA 4IKEA 4JLMA 2GWHA 2D06A 3MJRA 4KCGA 5FTNA 4Q5IA 4B74A 4HAYA 2Q9AA 4RFSB 3WHLA 1AZSC 5EXPA 1F3OA 1WB9A 3K0SA 2ZIAA 4DSNA 4P33A 2Q3HA 3ADCA 5FOWA 5KUTA 1F5NA 1Q3TA 4KITB 3GLFB 4GPTA 3ECCA 4M22A 3TSOA 5KNBA 1Q1EA 5J5CA 1CBUA 4DIEA 2NZJA 2QQEA 1GNPA 3EIHA 1XEFA 1KO4A 3LRPA 2KSQA 3B85A 3EZ9A 4M1MA 2ONJA 3KDSE 4DLTA 2LCFA 3X1YA 4JIMA 4A6PA 1FUUA 1Q0UA 4GRAA 3EA0A 4LK2A 3EPKA 3K9LA 1TADA 3B82A 2OCPA 5DGXA 3C5CA 4B3FX 1JPNA 4A0FA 2W6ID 3J81k 4PANA 3UMFA 4TT3A 2AFIE 3QVUA 4BFUA 4DEXA 3ADKA 3QG1A 2ZYUX 3LBHA 5AJXA 5G3YA 1SVSA 5C18A 2PJRA 1KO7A 2G9NA 5KSYA 2FG5A 4QBIA 4OK3A 5GJVC 3IHWA 1Z0AA 1GKYA 1NVXQ 4WZAE 3ADDA 3LWNA 1OFUX 4PQRA 1YJ5A 3T34A 4IOLA 3KJEA 4IEEA 1KK0A 4Q00A 1E99A 4LJ7A 5FPSA 2QM8A 2V54A 4AKIA 2CK3D 2CLDX 1DOAA 2GCOB 2HT6A 3FFBA 1XMJA 2O8DB 2BMJA 1M7GA 1MABA 1DPFA 1P7CA 3PUYA 4MKGA 1R2QA 2JASA 3LFUA 2IYLD 5K8LA 1JJ7A 2VBCA 3VQTA 3DZDA 4MGYR 4K81B 3FOZA 5SZKB 1GZSA 1IN4A 4LHYA 1VG9B 2WJIA 2F43B 3B78A 3LXXA 2CL7X 2FA9A 1NLFA 3SR0A 3CRQA 3AVUA 1C9KA 3BOSA 2VIIA 1V43A 3BK7A 1P2UA 4KYUA 2HJVA 3D7MA 4YMTA 2VF8A 1ZIOA 1G19A 1ZJ6A 1NY6A 121PA 4YLGA 4LY6A 3ZVRA 2ZJ8A 2GEUA 721PA 4LSGA 4HB2A 3ASYA 3KUCA 3AVVA 4ITRC 2V6JA 2HUPA 3K8YA 2BIFA 2JLVA 3AVOA 3GEEA 5FR1A 1BMFA 1OH5A 5CM9C 5LD2C 3AVXA 2VA8A 2A5GA 3UMRA 4TLAA 3C7KA 1Z6YA 2GJSA 1Z2AA 4QJ3A 4HI0E 4OHXA 3A58B 1ZM7A 2VHTA 4IDQA 2HYIC 3UWKA 3TVTA 2QORA 3Q7QA 1CR1A 5BQ5A 4I1SA 4C7OB 1NIJA 2N46A 3WXMA 3PENA 1YU9A 1S4QA 1GRQA 1FX0B 1OPXA 1VIYA 2BKEA 2WKRA 3N2IA 3QPVA 4MUBA 2MSDB 5HE8A 1SHKA 4CEJA 2PX0A 4A8JB 3NKVA 3V4RA 3ZD7A 4EFNA 1XJ0A 1S8FA 1P61B 2OZEA 2OEPA 5CJPA 2C96A 5E7MA 1ZUNB 3H2YA 2YJTD 2VYFA 1UF9A 4LV6A 1IONA 1KHTA 1ZM3A 2NO6A 1TF7A 1R5BA 1X8KA 2OFOA 2PH1A 1VHLA 1NY5A 4D81A 3EPHA 4EDHA 3AVYA 4IW3B 3GLFE 3EASA 4M9QA 4DWJA 4Q9IA 3CZQA 1W4BA 5EE9A 1RKBA 2DWQA 3QKSB 1OF1A 3R8CA 1G4UR 4BRUA 4B3GA 4CRWB 4UNQA 3LLMA 2QP9X 2KI5A 2J87A 4C9BA 4PTLA 3AGPA 2ZRCA 3D6TB 5EP2A 3RS0A 5EZ6B 2HF8A 4XOIA 1GILA 4L16A 2ZSBA 1OE0A 2B7CA 4NYIQ 2IXGA 3O8DA 2WTUA 1JQLB 1S0UA 4WW0A 4P4SA 5FI1B 3JZAA 1YZLA 4V03A 3P20A 3AF2A 2IEZA 4NYJR 4QHYA 3THWB 2ZSFA 3KB1A 2CJWA 3KQUA 1NBME 3WMFA 2EYUA 2R6AA 5DO9A 4AC9A 2W2TA 5K8UA 1G7CA 2YOGA 2GZAA 5CLQA 5AR1A 4Q02A 4HEJA 1Y63A 1YZQA 2DHRA 2QMEA 4ZIRB 2IX3A 1W4CA 3BB3A 5HR5A 2QQ0A 3T5DA 1NVUQ 5HPYB 1YE8A 2IK8A 3PITA 4LPSA 3ZDQA 1MKYA 3GLIB 4G1UC 5GVRA 4DT1A 4BUJA 5BW8A 3D3QA 1N6LA 1DAGA 4TLEA 4XIGS 1TU3A 3KKNA 4U00A 4Z8XA 1NF3A 2QGZA 1XTKA 2HLDD 2RMKA 1FUKA 2RCNA 3FMIA 3K1JA 1N6PA 4M9XA 3W90A 1OB5A 4CGZA 2IS6A 3WBKA 1XFAA 3UATA 3SYLA 4IOMA 5KSOA 1FQJA 2A9KA 4H1VA 2CVFA 2RKOA 2I1VB 1CLUA 2WWFA 3SNHA 1E9FA 1IJEA 5HCIA 1NG9A 2O8BB 2JLWA 4ZV4A 4RCYA 1SVLA 1QHSA 4KYIB 1VCNA 1YZKA 3GMTA 1GNRA 2NO0A 4B2PA 4GZLA 5FTLA 2D62A 2NIPA 1EX6A 3B9QA 3QXCA 1GG2A 1AS0A 3WYAA 3RC8A 3KUDA 1VMAA 2ATVA 2QA5A 3QY0A 4JVNA 1G41A 4K46A 4B75A 3WRYC 2MMGA 1E2GA 3QIAA 1IY0A 3L2OB 4KU4A 2RGDA 2VSXA 3K0CC 1BS1A 1VYVA 4C0LA 2F55A 5HKKD 2ZVPX 2A3RA 4NMMA 2RGBA 4TL8A 2CCKA 1M74A 2WWWA 2LWIA 3RRYA 3PG5A 3A36A 3IILA 1JPJA 4I99A 5KYKA 4Q9LA 2IYXA 4YXWD 2ORWA 1QDEA 2CHQA 1VPLA 4LJ6A 1B0UA 5SZJA 3T06B 5FBRB 4C0QC 1RYHA 2KJQA 1OXVA 2W6JD 3PUVA 4G5GA 4AD8A 3NWJA 4BZPA 3PUXA 4UQOA 2AXPA 3RWOA 1VHTA 3PVSA 4TMVA 1E1QA 3DHWC 3AQ4A 2PCJA 2NPFA 2QBYA 4JKYA 2GJKA 2NG1A 4A0GA 3D8BA 1DE0A 1UADA 2H5EA 1WMSA 4PHHA 4DDVA 3U4QA 3EC2A 2AR7A 2ZI7A 1N5IA 2BOVA 3UG7A 4DB2A 3IIKA 3GFOA 1FOEB 3T12A 1I4LD 4Q7LA 4IXMA 1E32A 4Q4AA 1ZM4A 5DH9A 2CE2X 1FP7A 1F60A 2ZI5A 2FPMA 1N6NA 2VEDA 1YR7A 3KFVA 4QXAA 4EIWA 2QP3A 3PEVA 1Q1QA 3HP1A 4ZI2A 4ZDJA 1Z6TA 2ZR7A 3ZQ6A 2CDNA 1DVRA 2PJZA 3V4FA 3CB4A 3EPJA 2J41A 1WCV1 3IHLA 1XF9A 4IDOA 1KO5A 2VHCA 3GFPA 3KKOA 1XZPA 4L9WA 4S2EA 4KBFA 3KQLA 1AS3A 1E4YA 1EFCA 3THYB 3LNCA 4TTPA 1ZYUA 3CRRA 3GLFA 1IQPA 1XD8A 1A2BA 1U8ZA 1VG8A 1YRAA 4Z1MA 4E09A 4URVR 3KQKA 4LJ9A 4QM6A 4RD3A 1Q3HA 2PMDA 2JJ1A 3GJ0A 3I73A 3VU9B 2V9PA 2QT0A 1HA3A 3T5GA 3NDBB 4AKGA 1H8ED 3E70C 4B48A 2VRWA 2ERYA 1OXUA 2WVJA 1R6BX 4AKEA 3GLIE 2VP5A 3SHWA 5A5GA 2ZUDA 2BKUA 1QHXA 5FOSA 4HUQA 1GL9B 3RS4A 1ZRHA 3O47A 3QPWA 4F4CA 1CTQA 3A1WA 3UXMA 2EFGA 4IRUB 4LX0A 4QFMA 2NZ8A 3SU8A 5KNCA 3E2IA 1MO4A 2QAGA 4Q18A 2R6DA 4NP6A 3ND8A 1N6OA 1NBMA 1W5SA 1TTTA 1E96A 1OFIA 1BO6A 3QVVA 2PMKA 1MO5A 1E2IA 1W36B 4TMZA 1UKVY 2RGXA 2GCOA 1OH6A 3MCAA 2O8DA 1S9DA 3LLUA 1W0KA 2YVUA 4LWZA 2GZHA 3GJ3A 2ZXUA 4KLNA 3VFDA 3SQXA 2R62A 3CRMA 2R6CA 3QE0A 2FMXA 1VCMA 4B71A 3ASZA 4M9SA 3PUZA 2F43A 1SXJE 2D7CA 1O87A 3U6KA 1ZU5A 2Q0HA 2WPDD 4JMPA 3AVTA 1HE8B 2F3RA 2G3YA 5DYIA 1MO6A 1NSTA 3BC1A 4BFWA 5FBVB 1W44A 5LB4A 5GJWC 2RGEA 2BBOA 5TY0A 3UANA 3TUZC 1HTWA 1MO3A 2ZANA 4QM7A 3EARA 1ZIPA 4GBMA 1XXHE 4H1UA 3W9YA 1RRCA 3FKSD 3U3JA 1J99A 2EWVA 4ZCMA 2B21A 1DELA 1KNXA 2CE7A 4W5HA 2QAGC 4Q03A 1T3LA 4HZIA 1NVWQ 1SKQA 3FHOA 4QGAA 3TVDA 4BE7B 1MH1A 3KJIA 1O3YA 4DVGA 2FPLA 1H8HD 1NKTA 1IN5A 2GEVA 4HB3A 3TUJC 3IPYA 4PC1A 1SVOA 1YRBA 3IIJA 4Q48A 2RGNA 4C7OA 2FE4A 1SULA 4KAXA 2ZRLA 2GF0A 2DFTA 2GBLA 3VMFA 4DCVA 3IO3A 4FIDA 1G8FA 1KZ7B 1DAIA 3O8CA 3Q3JB 1P9RA 2IS2A 1KDTA 5EUQB 1Z63A 1OYYA 4BLQA 4V0LA 3UKDA 4F7WA 5K8TA 2ODWA 2IS4A 3TR5A 2AK2A 3L0PA 2KWIA 4DIDA 5KO2A 1G8HA 4RVCA 4X8OA 4W9MC 1LS1A 2WJYA 3IBYA 3NHBA 2VH5R 3Q8XB 4PC2A 4B33A 4HAWA 2BMFA 2YYZA 3N5CA 5AJWA 2R8RA 3CKLA 4GP6A 1TUEA 4LZZA 5EXTA 3X2SA 1JXMA 2G77B 4W5WA 3ZH9B 4N0DA 4DUGD 2F1RA 1LF5A 3O8BA 3BJIC 4R2IA 1LB1B 1P60A 4QBFA 2GCNA 2RGAA 4ZI3A 4MITA 1II9A 1KK1A 1NNEA 1DBSA 1Z06A 2I3BA 3MWYW 2KBEA 4C0HA 2FNAA 1OIWA 2FH5B 1A7JA 1Z3IX 4BWYA 2BMDA 3KFXA 1G21E 4IFEA 4KSCA 3SFVA 5GADl 421PA 2R44A 4NYIR 1Z28A 2QMOA 2GBLC 1JR3E 1XEXB 3QSYA 2C03A 1E2DA 4E07A 1GRRA 3EA5A 2GXQA 3THWA 2BWJA 5FTMA 5FL3A 2OXRA 3U7GA 1KK3A 2JGNA 2IF0A 5JWRA 4LYHA 1E2LA 1ONBA 3HU1A 4IXNA 1DO0A 1RE0A 3FMFA 4D0NA 1Z6XA 4F4IA 1UJ2A 221PA 3BFVA 4TYWA 1P9WA 3OFNA 2Z4RA 2ZM5A 2XXAB 1RFLA 5B30A 2F9MA 2XSZD 4ZIRA 4MDEA 5FPTA 2O0KA 1E9EA 1YHNA 4AYTA 2CHVA 1Z0JA 3OE7D 3GLIA 2DWOA 1GVNB 4RD6A 3CNLA 2JLSA 3X1DA 4OHZA 1M1YE 4NTZA 3QKRB 3RS5A 4CEHA 1YR8A 2IHBA 3BBPA 4GT1A 5IDVA 4NYMQ 4URWR 1W0JD 3L0IB 1Z83A 3I62A 5E7IA 1G8PA 4OQLA 2V1XA 2IF2A 4B6EA 3DM9B 4ZKDA 5HZKA 1EX7A 2ZUBA 3R9WA 4D25A 5L8VA 4PZYA 1KJYA 1NJGA 5AK0A 2FGKA 5J40A 4IDHA 4Q1FA 1Z47A 4Q4LA 2IWRA 3BE4A 4M1YA 2XJ4A 3GLHE 4JYCA 3TW4A 1F2UB 1EXMA 1JNYA 2QENA 2ZE5A 3CF0A 1GM5A 1Q22A 2YWFA 4B3XA 1GOTA 1LVGA 5KHOC 4RD1A 4YMVA 3KJGA 4TLCA 1SXJA 4D0LB 1RRFA 4L4UA 5FTJA 4DCUA 2EWWA 2NGRA 1N6IA 4JBYA 5AWFC 4PHFA 5B2ZA 4RZXA 3DMNA 2AKAB 1CRPA 1FQKA 3QQ5A 4O25A 2WWXA 4TT3D 4TSFA 4I4LA 3EZFA 3NG1A 2JDID 4A9AA 4QHSA 4EJSA 2P5TB 4MRNA 3U5ZB 2B92A 4MH0R 1XMVA 2Q6TA 3KXLA 2KBFA 3V9PA 4D4JA 1XXHA 2GJ9A 2XOKA 3QF4A 4QGHA 5JJIA 2F6RA 4I1OA 4Q4JB 5JWOA 5JSZB 1OHHA 4FMCF 3SYKA 1HURA 3RANA 2FEMA 4Q9JA 2IBMA 2WSMA 3CX7A 1JBKA 1S9HA 3QKUA 2RH5A 1KI8A 4YMUA 1ZCBA 1ZW6A 4BLSA 1R4AA 3DOEA 3OIUA 4Q01A 4PC3A 3UG6A 1L8QA 2W0MA 4KI0A 1II8B 3FE2A 3VR5A 1L2TA 3CNNA 4ESVA 1J8YF 1P9NA 1CS4C 5KSPA 3WNDA 2PBRA 1E9DA 4DHEA 1XD9A 3DL0A 5P21A 3LQRA 1CULC 3TKLA 4BFVA 1OFHA 4LHVA 4Q21A 3CUEF 3L8YA 4QG7A 1W46A 1VG1A 4TL9A 3VR6A 1Z0KA 4CT4B 1XJCA 5ANRB 3LA6A 5KDOA 2FFQA 2HXSA 2ZI4A 2OG2A 1E2HA 1SXJC 2J9RA 5JJKA 3M1IA 3WMGA 2AXNA 2QTHA 4M8NE 2NO1A 1OKKA 1GP2A 1W1WA 1XCPA 1TPZA 2JA1A 1KI6A 5JJLA 3ZJYA 1U90A 2PL3A 1XCMA 3K9GA 4EJSC 3LAWA 3CONA 3AVWA 4ZDKA 5JZVA 1HE1C 1HQYE 1SKYB 4G01B 4AIIA 2Z5FA 1L4UA 2F1HA 4JJKA 4B32A 3RHFA 2OCAA 4Q9KA 2B8WA 4FN5A 4P4TA 4ZKEA 3K0EA 3ZS9A 5B57C 1DADA 4JBXA 3NC0C 1W48A 1OSNA 2BV3A 2ZTSA 2ZRFA 4FCWA 3WNCA 4LC1A 4WIAA 4DLWA 3CW2A 3MAAC 4C3ZA 4ZO4A 3TAHA 1R10A 1GFIA 4MGIR 1PJRA 3OAAA 4N0EA 1DTSA 2IHYA 1SVMA 4LJYA 3MJHA 3RS2A 2HYDA 4EQ6B 1JR3A 1NVVQ 2OT3B 4EPRA 2IXFA 3NDPA 3WP1B 2WSSA 1XP8A 3QXXA 1G3IA 5E3HA 2CNWD 4LI0A 3RRNA 3FVQA 1NMYA 2K5UA 1DARA 1KY3A 2ANCA 2W0SA 5DI3B 1R7RA 1KDPA 2D74A 2WICA 5G3ZA 2YKGA 5E95A 3NBZC 2Q21A 2G6BA 4N1AA 1AS2A 1YZTA 2YZ2A 3B1VA 3U3RA 1GNQA 1Q44A 2B8TA 621PA 4LBZA 2X19A 4PO1A 4UXHA 3AP2A 3BB1A 2ZQ5A 4WOPA 4JL5A 5HZHA 4UJ5A 4FWTA 1NJFA 4Q4HB 1GDDA 1J8MF 3MWLA 3NBYC 3M4YA 3PR1A 1QVRA 2GHIA 2FN4A 1G3MA 1KSJA 2ZE8A 3A1VA 1JAIA 3CF6R 3MFYA 4RY2A 4UKDA 1C1YA 4DCNA 5C46F 4KJZA 4L8GA 5FUVA 4D26A 2O8EA 5DE3A 4MKHA 3CPEA 1K8RA 1AIPA 3F0TA 2FWRA 3WNBA 1JALA 3FDIA 3MLEA 3CM0A 4FMBB 1KGDA 1ESMA 1WA5A 2P2LA 4PAMA 4TMKA 5DHAA 2ASEA 1EFTA 2G83A 1ZINA 2IYVA 3W5IA 4Y0VA 4DZZA 4DEYA 4QL3A 2YC2C 2OLJA 4A15A 4MA4A 2XNSA 1XX6A 1ZNYA 1U94A 4LYFA 4KSBA 4ZCIA 3AM1A 4C30A 3EZ6A 3ZYCA 1OFTA 3GLHA 4IDNA 2D4HA 1N5LA 2JJ8A 4XTRA 3R7WB 2IC5A 4HATA 5L3QB 1X6VA 1QHHA 3OHMA 4LRWA 1OXSC 1E1RD 1AK2A 1E79D 3O8RA 1DAMA 2ZI3A 4AYWA 1KI4A 1X86B 3AUXA 3PQCA 2KE5A 3RVBA 3I61A 5C2JB 1CKEA 2QRZA 5TB5A 4ACAA 2VSOA 3FKQA 2IW3A 3NH6A 4TQUS 3L82B 1COWD 2ZITA 4FWIB 4DCTA 1H65A 4Z8YA 4KFSA 1IN8A 5IK2D 2QE7D 1XJQA 2JLQA 2MMCA 4TTQA 2XB4A 4ARZA 4Q7JB 4NBSA 4BZQA 2IUTA 5EE5B 2ERXA 1K5DA 3LW7A 4ZPXA 1JXOA 4URZR 1VIAA 4AG5A 4BEJA 1XWIA 4G5SA 5A0FA 3BB4A 4M1OA 5K8IA 3SQWA 3VTKA 3F5FA 4LHZA 2J45A 5CIWA 3GJ6A 3GCGA 3UK6A 3THOA 4JL6A 1G7SA 1GKUB 4JVLA 3OEHD 3CR7A 2SHKA 2DBYA 3U44B 3R9XA 3GD7A 1RW4A 2GK7A 3UPUA 2XNDA 3TMKA 1BKDR 2P6UA 4XTCS 2RB4A 1AGRA 2WIAA 3I5XA 1S1CA 2R9VA 5BN5A 1N6RA 3OEED 4DRZA 1NI3A 5CK5A 2VP6A 4FXPA 4Q7KA 2WWHA 2IWHA 3U3KA 3MWJA 6Q21A 3K70B 2JLZA 4GL2A 5BYJA 2RGGA 1LS6A 2ZU0C 1E94E 2BDTA 1DS6A 3EG5A 5ELXA 3NXSA 1UM8A 4JLDA 2PZEA 2OILA 3BH6A 2RAPA 2IYUA 1KI3A 1DAKA 2MSCB 4V0NA 3R9IA 3T61A 2EW1A 5H1YA 1LTQA 1II0A 3T15A 2ZR9A 5AJZA 1Z0DA 1D8TA 4CF7A 2C9YA 3QBVA 1Z2CA 1E1QD 4A6XA 2XXAA 2CLCX 1E0AA 4DLYA 3KQNA 1QVAA 2VO1A 4PPGA 3A8TA 2CEAA 2ZRMA 2GZDA 2QN6A 2W6IA 4JT2A 1NSFA 3NTUA 4D2IA 1G5TA 4AK9A 1RC8A 3PEYA 5D3MB 3IKJA 2J7PD 3D31A 4C2TA 5GJCA 5JCPA 821PA 4II7A 1TQ6A 3QKRA 4FINA 5LB2A 3NHAA 2BMEA 1VTKA 2V8OA 2GILA 2WKPA 2O8CA 4KVAA 1XEWY 1S3GA 1FFHA 1G1MA 2H18A 3Q85A 4DDUA 1E0JA 4NYMR 1D6JA 2PZGA 2V7QD 4DC9A 1CJKC 2AFHE 3C16C 3Q5EA 5JFGA 1S2MA 2UVQA 5JECA 2W83A 3K0AB 3GJ5A 1FNMA 2ZYWX 1TEXA 1TU4A 1GWNA 1UBCA 4UNPA 3QOFA 3OIWA 2QI9C 1G20E 3I32A 2EFHB 1RJ9B 2F9LA 1F2UA 2OCYC 4OQMA 2G1KA 1E0SA 1WP9A 4MDFA 1UBEA 3AP1A 4JLOA 4WZBE 2H17A 2F1IA 4LPKA 4GFDA 5FPYA 2ZRBA 2P3SA 1KYIA 1T0JB 3AVQA 1R0XA 5FOUA 4DLZA 3LY5A 2OO7A 4G5RA 2F7SA 4HLUA 1U0JA 4PC7A 4JLKA 2DB3A 4BLTA 1XD2B 3B8HA 2WOOA 3MGCA 1A82A 3HDTA 1S3SA 4JLNA 4BZXA 4X8MA 3BFXA 3GP8A 4D80A 5M04A 5J47A 4GOKA 4RZUA 4EPXA 4W7SA 4KLZA 1X1SA 4Q4JA 1AA9A 3IIMA 4MUAA 1JEEA 4DB4A 1I2DA 2QUZA 4MYUA 5L3RA 1KMHB 3ZD6A 4AI6A 5G40A 4EAQA 2GTPA 2GAAA 5CIQA 1G3QA 1OYWA 2CBZA 3HU2A 4BQSA 4TLBA 1MR3F 2EFEB 5EZ5A 1Y3AA 2ZSAA 1II8A 2FX3A 1PV4A 2QMUA 4URYR 3ADBA 3TSWA 3I8XA 1ZNWA 2QT1A 1EFUA 1YZGA 4PO8A 4W5JA 2CCJA 5EE0A 1ZUHA 3DKVA 5JHGB 4LC0A 2V4ZA 3I92A 4G5OA 4M9ZA 1F48A 2ZS7A 3A6PC 5DN6D 2J0UB 1QHYA 2PEYA 3IQWA 4NZYA 2PX3A 3FB4A 4C0JA 1KI7A 3QXJA 1UKEA 1N6KA 1UEJA 1F2TB 1E9RA 2J0QA 4RD4A 2O5VA 5H8WA 1Q20A 1WE2A 1XB2A 4BRWA 4HLUC 2XAUA 3K09A 3C14C 4QGFA 5F9FA 1ESNA 2VP4A 4IFBA 1XZQA 3WYGA 1CEEA 2H7VA 2X2EA 4NPHA 1P2SA 4IOKA 2REOA 3TIFA 4BGDA 1FZQA 1L4YA 2ZRDA 4M0LA 2IYSA 2ZJZA 3SEAA 2FSFA 3AKYA 2WJHA 3H0KA 3P4XA 1G6OA 4IJMA 1FMLA 4E5UA 2CXXA 4QKQA 3K70D 2J7KA 2VLIA 4I1UA 4UXJA 2IA5A 4RFSA 1U0LA 2LKDA 3MD0A 1OIVA 1M6NA 2ZRKA 2ZJ2A 1RRGA 1G9XA 2V55B 2PEZA 1M2OB 1QG4A 2GRJA 2R6GA 1T8TA 1US8B 4LHWA 3VNUA 3BH7A 2QTFA 2XGJA 1MRSA 4TL6A 1U9IA 2FEOA 4HZUB 3HPQA 1M7BA 1EFRD 4TZ6A 1NVVR 2ZVQX 3DMDA 2ZSDA 2WHXA 4ESHA 2QM7A 1NLZA 3SDZA 1P2VA 3KL4A 3HWSA 3ZZ0A 2QU8A 5KSZA 4JSYA 1SHZA 3CRVA 4MKFA 2YNMA 3GLGB 2Q9CA 2OFWA 5J4KA 4X8LA 5A4JA 4Q4HA 2ZJYA 4KFTA 3K09C 2PLRA 1RYFA 5CK4A 4M1SA 3U6BA 3AKDA 4BECA 3HYRA 2H92A 2RHDA 3A4MA 2RHMA 4JT4A 2FU5C 2QY9A 4PPNA 4D4KA 2HLDA 4KFUA 1HY3A 1ZCAA 4LGMA 1D9ZA 2Z6VA 3G0HA 5JI3E 3PIRA 4MGKR 4BASA 1VCOA 2IYQA 5B58C 5KNDA 5IF9A 3CWZA 1VYUA 2GVDC 4IVPA 4GMXA 3OIVA 4DLSA 5JWHA 4PX9A 2YOHA 4ASUD 2BVNA 1E2PA 1AKEA 1SVIA 2O0HA 3LH5A 1E2QA 3IGFA 4QBGB 2YOFA 1M34E 1Z0FA 3N70A 2C9CA 4PR0A 3IQXA 2WM9B 1KDOA 2C95A 2V6IA 3LVRE 4M1TA 4PO9A 5J4VA 1ZD8A 2XZLA 4TZ0A 5EJEA 1EWQA 4GI7A 3B7GA 4PFSA 4YMSA 4WBSA 3R7WA 2B6HA 2GK6A 1UDXA 5L3QA 4MRRA 2ZR0A 2QSYA 1IXRC 3PXGA 1E2KA 1YVDA 3C8UA 1HEIA 1W2GA 4LJAA 4BFSA 1DAHA 1FNNA 1R5OA 1G5RA 5HKKA 2X2FA 2ATXA 3U3MA 4HAVA 4OJKA 2GETA 4R2HA 3HPRA 1J7KA 1G8GA 5BYKA 3I8SA 5JLJA 1AKYA 1T9HA 1XMIA 2E9SA 3I72A 4G0NA 4HB4A 4TLDA 5LD2B 1CF4A 4YXWA 1GL6A 3AUYA 2DYKA 3W6PA 3NBXX 3SC3A 1ZMXA 3IBGA 4XWOA 2W6JA 2CVHA 3LD9A 2WMOB 2ZI9A 3SJZA 2VHJA 1UKZA 2AL7A 3REFA 1E2FA 1HYQA 1T4GA 3ZIAD 1FX0A 1MABB 1VDZA 2D7DA 1QHNA 3MMPA 1T5IA 4A8JA 2ZETA 4V02A 4G3XA 2E87A 3IPXA 1GRNA 2UKDA 2WKQA 5TDHA 4DLXA 4Q1BA 4LYJA 4AWXA 2JJ2D 4WAUA 1Z22A 2NPIA 2ZRAA 2AD1A 1LV7A 1ZM9A 3SOPA 1KKLA 1WBBA 1XEWX 2IXEA 2N42A 5LBIA 3B6EA 2NQ2C 4Z54A 1ZAKA 3ZZTA 4EKDA 5JS8A 1FW6A 1G3RA 3W3ZB 2HXYA 2C99A 4S35A 2YC4C 3PEWA 2DY1A 3EIEA 3QKSA 3RLFA 3QEJA 3VAAA 2XOKD 3T35A 4OYHA 4R9UC 1IN6A 5FOVA 5G41A 4CIDA 2IUSA 1EESA 4A0HA 3GLGE 2G88A 2OCBA 3IO5A 4Q1DA 1ZBDA 4CEIB 2DFKB 4DBLC 5FFMA 4O2LA 3M0EA 3REGA 2RGNC 5EE3A 3B1ZA 4UNSA 5C4MA
chains in the Genus database with same CATH superfamily
2AHOA 1NOKA 4Q3NA 4E5VA 1YNSA 1RIFA 3FAKA 4IWXA 1QFJA 3WDSA 1MZVA 3F71A 3MZ0A 1V2HE 4KC0A 2Z04A 3PGLA 1XZ8A 1CJTC 1XTSA 5DLEA 3Q4GA 4RVOA 3ZGZA 2O2GA 2QLMA 2ZXEA 1TQ2A 1WXWA 3A26A 4LG1A 1FJGB 3PFKA 2WPNA 1A3CA 3O1HB 1OCEA 3CUYA 3O2QB 3G17A 3FTNA 4YMHA 2G63A 3H3XA 5DXJA 2P9BA 2QP4A 4OIMA 3VR6D 2AH5A 2B35A 4URUR 5C52B 2Z5GA 1OQAA 1YB7A 2ZPUA 4N6GA 1QGZA 2AN9A 5EIAA 2MR6A 4Y6RA 1YI0A 5IVPA 1J0CA 2VA9A 2VZ9A 3MGBA 5JROA 4P38A 1U0HC 2FW9A 1SXQA 1IL0A 2C2WA 1UBNA 2H63A 1ZRMA 1JILA 4YRKA 2Q6LA 3FCAA 3L92A 4ABTA 2O0JA 2I34A 3LQKA 3JYLA 2YBEA 3O3NB 4YQEA 5U1PA 4ROTA 1OX4A 5EUMA 3UQYS 4EO7A 4EL0A 2XUZA 3RRMA 2QVLA 5DNWA 3W6ZA 5F98A 5IFLA 4PCUA 3SX0A 4L85A 1M2KA 4Y2RA 1INLA 2IU6A 4NCJA 3DDUA 3ND5A 2H1VA 4OA8A 5FTWA 3UB4A 2BHNA 1A5ZA 3HJRA 2WHPB 4ND5A 1NVGA 2OV2A 2V74B 5E3JA 1T8UA 3AK4A 3QI2A 4JJFA 4WBXC 3VNAA 4CR7A 4GS5A 1CEQA 2JH8A 4REOA 3UGTA 3ZE9A 3O82A 1XDZA 4IXWA 2Z09A 3FJ1A 3WL5A 1E3TA 4WXRA 4XGNA 5CX4A 2OZKA 3P5BA 5DYGA 3ZTWA 3VOSA 5DASA 4YRAA 2QD2A 3NLLA 2PMEA 1HLPA 2ZYGA 3QELA 4HOYA 5AK4A 1T6ZA 2JG3A 2VH2A 3H84A 1PGOA 5KNBD 1ULBA 1PYGA 4WSOA 1TTPB 3AEZA 4Y1FA 4BWGA 4RVUA 1YULA 4NE2A 5IH7A 3WGOA 4PZ0A 2PZFA 3OM0A 5TLSA 1PVOA 1VIVA 2HU7A 2H9AA 4UU1A 3UHAA 1JAZA 1NAHA 2R00C 1UODA 5EIBD 1NKSA 1ID1A 2ANBA 4OMCA 1U3UA 4IUCS 5DSZA 4V39A 1H8HA 4DIMA 3FPKA 3H9QA 4UMVA 2BEUA 1HLGA 1P0IA 2EBUA 5KYXA 3FHJA 3PPVA 3Q9NA 2PKRA 3U3DA 4JD5A 5DSXA 3V9AA 3WGNA 1KIMA 1I2MA 2AG0A 2HO4A 3U7FB 4LOAA 2WT4A 2C0PA 3VR2A 1LF0A 3LSTA 3JVUA 2HDNB 5CFZA 4Q9DA 1ZOLA 4DUYB 2IDJA 2QW8A 1S96A 3GT4A 1ISGA 3JQ6A 1C3OA 2IEGA 4PEVA 3UHPA 4AU1A 4FCTA 4R81A 1CFZA 2YV5A 3EXAA 3DYVA 1I2ZA 1WU8A 2BTQB 4LCBA 1V8OA 1PP4A 2YHBA 4RWZA 3RK0A 3MRSA 4JWTA 2JAHA 2NV6A 3H7AA 4KQMA 1F2TA 2BD0A 2AOTA 4ISCA 3P32A 4HDSB 4S0XA 3N87A 2G5PA 1I24A 4BX3A 2XRFA 4EARA 3TLYA 1B0AA 1ZWKA 3IS3A 4OKNA 4G5QA 2HA6A 3CNQS 3D6JA 4R98A 4DUGA 3SOZA 5K0SA 4TMFA 4YV2A 4URXR 2OM6A 2C8KA 2AYXA 4G8BA 5ARCA 3GZNB 4CF6A 1YFJA 2G0AA 2G76A 3LKBA 3QNUA 1LPSA 4HEA6 4OQEA 3ZHYA 4AP9A 4G81A 1RI1A 1M2NA 4XXHA 3EPJA 3OSZA 1Q1BA 2HA4A 2VF7A 3PJRA 2NXEA 4XYEA 1DZ3A 3FPHA 4JHLA 1BH2A 3RYIA 2NWQA 4Z9BA 2PU7A 1UIMA 4CTKA 4JELA 3T38A 1C8BA 2XCLA 2HJHA 3PI6A 3UGQA 3S8MA 5EERA 2JAPA 4L15A 3R7BA 1P72A 3M33A 2P27A 2VTEA 4DLNA 5DXAA 2ZRIA 3DWEX 4P34A 4RGQA 4XB1A 4BQPA 1TAGA 2XGSA 2ZUUA 1PFWA 2Z0MA 3MJFA 3WTCA 1OH7A 1EFPA 5TR9A 4TVOA 5EJ6A 3T1TA 5TGZA 5DW0A 4Z1OA 1NUTA 3VU9A 1A5TA 1ZL0A 4ZOLA 1XNRB 1RWXA 3C4VA 4EG6A 1A98A 4LYGA 1KVSA 2Z2IA 1AM4D 1WP4A 4PZEA 4BFZA 4HUTA 2P62A 5ISMA 4N3AA 3AV0B 4NI5A 1SBZA 1T29A 2XQFA 3GLSA 4S1WA 3R7LA 3CX8A 3R7AA 1ZG3A 3FMOB 2EX4A 1C8LA 3PK0A 3OMLA 4JSRA 2GASA 2JKZA 4JB8A 4QODA 2BJHA 3A3OA 4X24A 3WMEA 3WRXC 2WUVA 2W58A 2W98A 5E7JA 3WG9A 2QTRA 3LQQA 1DBQA 5A04A 1V37A 2WYVA 2QE6A 3E8SA 1E3JA 4EAAA 5T7BA 3S2EA 1DXYA 1Q0LA 1EVKA 1PLLA 2VJMA 3TSCA 2DBQA 4DC0A 5B36A 3FYTA 3TLBA 3ESXA 1FL9A 1RHJA 3JQQA 2N3ZA 3OQVA 4LJ5A 2FSGA 5KTRA 2ZYRA 5IM5A 2JFXA 3WAKA 2QPLA 1E6CA 4R2LA 5ALHA 5EWMA 1QUEA 2RHTA 2JBAA 2YWJA 4U7GA 4D0GA 5EJ4A 5LL6P 3F7NA 1Z74A 2DY0A 4EI8A 3QJGA 5B7NA 3C5EA 2RBKA 5A9TA 4MYCA 3RAJA 5KOYA 1THZA 1Z13A 1ZLXA 2WBLC 1SY7A 2VJDA 1YDEA 3RDPA 1TIKA 3QE9Y 4UBMA 4B73A 2EATA 4GSYA 3L4SO 2ZTVA 2A0WA 3GRPA 2HKIA 4PZLA 3UCEA 1PG2A 1QE3A 4HSEA 4UU0A 4BX9A 5LDDC 4KRFA 1XKXA 1OWOA 4EPVA 3NT2A 3D9QX 3LYAA 3RIHA 3KYDB 2O8EA 3FZEA 4OQNA 4C4PA 2ZRNA 4J0IA 2BFDB 1SEVA 1ZH6A 3GDFA 4C0SA 4GXNA 3FGNA 5CT9A 5AM1A 4KR9A 2OVFA 4NE7A 5HILA 4WNYA 1T2VA 5K0TA 5G2OA 5AVOA 5H70A 2IEYA 1T1EA 3TSZA 3BS4A 3D7RA 4QFCA 5G0VA 5JY1A 4TWRA 5MGBA 5DNEA 1UBFA 1RWBA 3W6OA 1NRJB 4CN8A 3K0BA 2TRSB 3K0FB 4ERNA 4MQMA 3ZI4A 1XZJA 3BXZA 4GEKA 1QE5A 2WD9A 3GX1A 2XMZA 3PFWO 3UFBA 1P1FA 4DDTA 1G9TA 2PAFA 3RRZA 4Q7QA 2W2QA 1BHJA 1K89A 1KI9A 1X1BA 2ZLBA 1H2ZA 4ENRA 1VP9A 1Y3HA 1GUBA 3KZOA 4I55B 4I1YA 2V7GA 4KI7A 4KO8A 4RENA 4FHDA 1J8QA 1KC1A 1UKCA 1Q7EA 5KQMA 4DM7A 4K3UA 1J0BA 1OZGA 1VJCA 4JVMA 2LCQA 4OK6A 4CKXA 1JHMA 3L40A 2GRUA 1OZAA 4WN9A 5GGXA 5GM2A 1T1GA 2OZPA 3DLCA 3C43A 2Q7OE 2CUNA 3RSLA 4GX5A 4YFYA 3SIXA 1USGA 5ALUA 3K9FC 3H87A 5KDDA 3WADA 2BR5A 5HUQA 3FKJA 1CRZA 1Z2OX 3GUCA 2GBCA 4QATA 4DWOA 2ZBEA 5I9NA 5JH7F 4FFLA 1W49A 2CLHB 3COYA 2IY9A 4UAVA 2ON6A 3K5HA 5EIHA 3TM4A 3TS1A 3ICEA 9ABPA 3SBOA 1NG1A 3JVVA 1M33A 1F8UA 3F5QA 3LYUA 1H93A 3WWOA 3JVIA 4JQYA 1XPOA 4TYYA 3FA2A 2J30A 4KX3A 1T2DA 4UHBA 5KKNB 4BZZA 1VFNA 1VPEA 1JKIA 1DRJA 4MDYA 1UT8A 3UJ9A 3E35A 3HO6A 4BFYA 2E2WA 2N9UA 1QGOA 3PNPA 4XSHA 5IUKC 1CUHA 3PXCX 2XMQA 3VOAA 4MWCA 4BBAA 4YYZA 1DJLA 2C9OA 2FN9A 1UXGA 5JANA 3KKMA 1DEAA 1YNOA 3ETJA 3HBJA 4L22A 3T95A 1JXQA 1P8AA 5I7VA 2BF7A 1HYHA 2NO7A 4CDRA 3PIDA 2G80A 3O1IC 1QGDA 2FMIA 2C77A 2J3EA 2Z2ZA 1UPTA 4GVLA 1BX3A 2JLYA 1PNTA 2JPDA 3VVCA 3OQNA 1OPRA 1QFZA 1T26A 1JUDA 2EJVA 2H4YA 2QX4A 3L18A 4I1RA 3VUFA 2QNRA 5TQ2A 2Z58A 4MAAA 4KGXA 4JLUA 1YJQA 2BKAA 2V3VA 1BGWA 4ZGWA 4F56A 4PXSA 1OX5A 3PSHA 4BNJA 2B2NA 2O20A 5JNVA 2DWPA 4Y9RA 4ZQFA 3V97A 2Y6UA 4B6PA 1LV8A 5KQLA 3V7UA 3C5VA 2WYUA 2ALJA 4M2LA 1GEEA 3IP3A 1N9KA 3EVZA 5TF0A 4DMUB 1BDBA 3FNBA 2PQ0A 1CR2A 5EMHA 3ZJVA 5DI9A 1WHTB 3TTXA 4BJHB 5A4AA 3VKGA 2OCKA 4Y0AA 1TK2A 1Y81A 4KRGA 2X8BA 1GPJA 4FFNA 4TYPA 5JSUA 2VWGA 5DGHA 3Q41A 2ATEA 1L9XA 3A7EA 2IPNA 4M53A 3DLBA 2CNWA 3KFLA 3OKFA 1PSZA 3NIGB 1RS0A 3TUIC 1HTTA 3C0KA 3R44A 5B53A 5UKDA 2WF9A 1ZSVA 1NE2A 2ZPAA 3T7EA 1DG1G 1JQEA 1YQWA 1Y8ZA 3P2OA 3I1FA 2OBLA 1T36B 5C80A 3E9YA 3ORRA 3QOYA 2HV8A 4QDOA 5CX1B 1QRDA 4E6PA 2CHUA 2R4UA 2WOJA 4O1IA 4AG3A 4B3DA 1TYZA 4YT2A 4QJBA 1WF3A 4K6GA 4B43A 4Q19A 2CWDA 4TQ9A 1CSEE 1HL7A 1YBFA 2BEKA 3EXFA 3TMAA 3UK2A 3BCRA 4NCAA 3N2GA 1D5WA 2AQIA 2GJAA 2IEDA 2VT6A 2HPAA 3F9RA 3HYLA 4K9PA 5LPNA 5L6LB 5KNLA 4GKJB 1QF9A 1MB9A 1UFOA 2P4QA 2Y1CA 4OGGA 3BHMA 4A6DA 1ODIA 3DDSA 1RFGE 3G7SA 5DISB 3AI2A 2RC6A 4LTNA 3QFHA 1PHPA 3LXMA 4GRDA 4MROA 1MTOA 1PJSA 1ECPA 2TMKA 1DX4A 1YBMA 2FGJA 2GPBA 3CGWA 1PI3A 4LGCA 4W99A 5J5AA 3X1JA 2I6GA 5AI9A 4WXPA 4F5DA 3SEZA 3TPZA 3H1AA 1U0SY 4FW9A 3T1NA 1YZNA 4OAPA 1NZDA 2XMRA 4N65A 2XE7A 4PQFA 3ZDFA 2PUDA 2C9ZA 2JJ1D 5E4FA 2CLKB 1WTAA 1ICIA 3EPPA 4PHTA 5AYVA 3WLHA 1MORA 5A4FS 2FW6A 1VA4A 3L9WA 4AJPA 4I19A 5JJCA 4FLMA 5F21A 4MW1A 3A04A 4J07A 5T4EA 4PRLA 2PCLA 4A4DA 3E82A 3VPDA 2C83A 2QUHA 4LDAA 4R6XA 1H2EA 5BSGA 4TUYA 3JQ7A 1PGNA 1X7YB 4NCXA 4FZ5A 4BV8A 1Y8QA 3N58A 1LH0A 3CZMA 3IALA 3OLVA 1H6CA 1ZQ9A 1JV2B 1M10A 1N1DA 1W0CA 1FYXA 2A2ZA 2CMHA 2GLUA 2WIKA 1IWBB 3DMFA 2A4KA 3FLMA 3ZLTA 2GO7A 4BMOB 4AMVA 1QKKA 3BRQA 4W5RA 3BXOA 4IDEA 4RXUA 5KNCD 3ROGA 3HFGA 4J6FA 4W8OA 1COWA 1KEKA 2BSQA 3SN6A 3PL5A 5COQA 3D4IA 3RUHA 5CBPB 5J4LA 1WCXA 1MPTA 4QYXA 1N0HA 2GAOA 3EWSA 5IK2A 5L4NA 1UMCA 4D9EA 1L5VA 1UBGA 1WV0A 3PTZA 3WA6A 4QGSA 1SD1A 3IEPA 1VIDA 1EUDB 2PUGA 4R1QA 1XCOA 4Z4CA 4KE6A 4F11A 1H2YA 1IRXA 5CG1A 4B3MB 2P2CA 4MMXB 3BGDA 2O54A 5CDHA 4JGIA 4GKKB 2WJGA 1QH1B 4B2IA 2J6IA 4IZIA 4CLHA 2NZVG 5C4GB 3RT7A 3G8AA 2C5EA 4JFAA 3B3JA 2VP0A 5HIKA 3DZCA 2GN8A 3DKPA 2ZWOA 1U7OA 3GOQA 3HLTA 3NH9A 4JP1A 4YRCA 2WABA 4E6EA 3CZCA 4W9NA 5G53C 4DREA 2QEQA 1RRKA 4R71A 2P3QA 3OEEA 3PC7A 1K6IA 5AKGA 1ECCA 1JZQA 2IDZA 3B13B 5LQAA 2AX4A 4JEMA 1DDIA 4V0ME 3U7RA 1JI3A 3OCWA 1DC6A 1GTMA 2X41A 3EVNA 1Y5NA 4RIFA 3ZHSA 3KQPA 4ZANA 1M6VB 1L1EA 1JQJC 3CN7A 1J7JA 1GGFA 4M3NA 2XZPA 3Q1LA 2X6TA 4FUQA 3ELUA 3N76A 5E0KB 4AN4A 3IURA 3H05A 3FTFA 3PQ4A 1YAJA 5CYOA 1IVNA 5CXSA 1IQ0A 1T2UA 3AR5A 5H59A 2ZRJA 5HRCA 1CJVC 1FTNA 1N0UA 1NURA 4G0PA 1X19A 2YJZA 3E18A 3FR7A 1E98A 4ZYTA 1KSHA 4P7BA 3E48A 3QJYA 5KWJA 1MX1A 2D2FA 4LIPD 2OD7A 1KAQA 3ONVA 1XO1A 3PA8A 4X1OA 1MDBA 4PZ9A 2X1VA 4P08A 5DULA 1YHZA 2Y05A 3AFNA 1EG7A 1ISHA 2CY0A 4WADA 5AKIA 5E4YA 2UAGA 4RZSA 2OOKA 4TZTA 4JYPA 1P73A 2EFJA 4NU8X 3W8EA 4ZZ2A 4EMBA 3AR7A 1TEZA 1NP6A 5IH3A 3C85A 4JQZA 4P7GA 4N3NA 5BNFA 1QG6A 1XSEA 3G9XA 3LVBA 4GC9A 3KNZA 3C6YA 3WLFA 5KJEA 4OX9B 1YR9A 2P41A 3K92A 4PGMA 1T6NA 4GWGA 1C41A 1D0SA 1T3SA 4KWEA 5E1BA 3VC7A 4RKEA 4BX2A 3T1QA 4CCYA 3OPQA 4X1KA 3SYNA 3P96A 4NEHB 4BNVA 4N5HX 4WI1A 4CIXA 4DMMA 4OI4A 2A5FA 4S24A 4YQFA 3USES 4EABA 1O58A 4B44A 3OG9A 1P3JA 3HCFA 1WQ1R 4J1QA 3HO1A 4QDJA 4ZJPA 3KL2A 1KOFA 1CY2A 5ABPA 1Y6RA 1M3SA 3DHYA 4DLUA 4FMDB 2IH4A 3CUKA 4I4CA 2F62A 3RC3A 1VLJA 1KI2A 1D7AA 4HEA1 2IYAA 1SVWA 4FMPA 4HQRA 4K8RB 5EXXA 1JI0A 4YH1A 1F7VA 4WKGA 1NLUA 2FX2A 3OF5A 1L4KA 4F3YA 2NW6A 4PZZA 3TGPA 1OXBB 4UEJA 3K16A 2EZ4A 4LNHA 4RVGA 1Q0QA 1U2TA 3W1WA 3UKJA 3A3PA 1AKQA 1MMFB 4B4WA 1GD1O 2ZRPA 4Q1AA 5AUOB 3LYHA 4FC6A 2BGIA 1GRVA 1O7JA 1OLUA 1R9MA 1V1JA 2BFOA 2ODBA 1LCIA 3CVJA 3M5WA 5LLTA 1C80A 4BB0A 3HA3A 4UC0A 2C61A 4FP9A 1U8EA 2BKVA 3AU8A 1XHFA 4D4HA 1PW5A 2F64A 3BL8A 3VZQA 5JVDB 2VJOA 5COBA 5BT9A 3RJZA 4C3VA 1N4AA 3B1YA 3IBSA 2GCPA 3MELA 2CKMA 2HTFA 3L8FA 4OFWA 3OFND 4A2CA 4BPRA 4FEYA 1ZC4A 2QVCA 5K45A 3AUAA 5IAEA 2VT3A 5AW5A 5FPKA 1KSFX 1Q3KA 1QHEA 1JW9B 1ULUA 2G4CA 2VJCA 4EHLA 5D2CA 3E1KA 1V16A 3N05A 3Q9SA 3T5PA 3I5YA 1DQZA 3GDGA 4ISBA 2WKSA 2PT5A 4C87A 5KU7A 5EHIA 4BLWA 4ZV9A 5DOVA 3ZNQA 1JLSA 2Y0DA 4TMXA 2EGHA 2QL5A 2WTBA 4IVRA 3EXIB 1HEYA 3ICVA 4EG7A 2WWGA 3I6YA 5AM2A 5IJ9B 1T9CA 4XCVA 3RIGA 2NO5A 4NPCA 4L6IA 1XJWA 1E6EA 1R8JA 4E2XA 3EDOA 4U0JA 1QZZA 2FPIA 2ZTHA 3U49A 3ELYA 3JZMA 3SJBA 4HDCA 3FPJA 4MAMA 4OUKX 3HR4A 2IBSA 2Q5CA 1GSHA 1XZFA 2B9VA 4GDMA 4FGLA 5JRDS 3NMUF 1KJIA 3NHWA 4C88A 3WIUA 3KT0A 2Q5OA 1LUAA 4MICA 4D9BA 2VWPA 2WIFA 1EUQA 3F6CA 4IINA 1VL6A 4GYYA 4N47A 2D2EA 3PC8C 4BMCA 2EHJA 2PUBA 1RABA 1PZNA 4IS3A 4POAA 3VU1A 2B99A 5KOJB 3KYCB 3RPEA 5CDGA 3U44A 5J4YA 1NI4B 3OZAA 1SEPA 3DJYA 3ZWVA 2R47A 5D3KA 4MTLA 3VH4A 4BQRA 2HHAA 3Q88A 1S1MA 4D4MA 3H2IA 4CUKA 3GFBA 5A1TA 5A3JA 2UXBB 2IYWA 2DLDA 4U5QA 4HAXA 4QAJA 4BEWA 4DR2B 2B4TO 4LDJA 1R88A 1OXXK 1BEUB 2A0UA 4ZZ0A 4TSFD 4W6QA 5L3SA 3HDGA 2YFQA 3DZBA 3RC7A 4F8YA 4F8JA 4UTOA 2CT8A 5HF9A 2OFFA 1M0EA 5KWIA 1IY8A 4KXFB 1TFUA 3PYXA 3PNQA 3EWAA 4OYYA 4LZNA 4OBBA 2FQWA 1ZD3A 2ZXUA 4CW7A 4OHCA 1W4RA 3F98A 3JY6A 2X8AA 4GXRA 4RF4A 4BEVA 4AAYA 5EJIA 3DOOA 3PQ7A 2FSHA 2BEWB 5T6BA 2FZWA 2FJPA 1F1BA 3RW9A 1WQ3A 3IKVA 2M1ZA 4E2WA 2QSZA 1P3Y1 2DKNA 2I67A 2YY6A 3MTQA 4GP7A 1Z5OA 3NIBA 4OL9A 5JBIA 2DFNA 2Z43A 5J2TF 1DCTA 5DFAA 3A9SA 2BYTA 2R8PA 3X0DA 1C0PA 4FILA 2ZBUA 3I42A 3VR5D 5AXDA 4Z4HA 4YUVA 3JD0A 4IFIA 3SE0A 3L93A 2VPXA 3ACCA 2W4QA 3QLUC 3AERB 5JFTA 1R6AA 1CUYA 3H86A 4G5FA 1TVEA 4CKYA 4KE8A 2Z9CA 4H7HA 4PM4A 3CYFA 4DNXA 2F3QA 3HV2A 5IDQA 1BOFA 1ZSNA 5ENZA 3KHTA 1LFDB 1MVNA 2IYTA 3LO5A 1NL3A 3MRTA 3PCRB 3SJAA 3W3AD 2WC1A 3TQTA 2Y0CA 4R8RA 4ETNA 1K08A 1YQTA 5DKFA 1AQYA 4FMCB 1ZMTA 1C30B 1UP4A 2DWUA 2P9GA 2PX4A 3IJRA 1XYGA 4G09A 4GLJA 2OPBA 4RF5A 4XSGA 4BTLA 4D6XA 4MS4A 2HDOA 4O2BB 4HEQA 1CU1A 3K70C 4GBJA 3UH0A 3FROA 1NUQA 2C3YA 1OKKD 2E55A 3G2IA 4ZICA 2J1LA 2UDPA 1V26A 1JAXA 2JAXA 4CYMA 2IXDA 1BG6A 4IV8A 5COAA 4LMPA 3OQPA 3ETLA 1DTWB 2DOKA 4RFLA 3T5CA 2WQ6A 4M21A 4W7IA 4JUDX 4DV6B 2A9JA 3NKFA 3WK8A 1JECA 1Y6JA 1PRYA 1JA1A 2Y1GA 3HU3A 3CH5A 3BFJA 3QPBA 4XASA 4L5BA 1G16A 4S1PA 1DQYA 1QO0A 5DLPA 2CXPA 4JOCA 4L8LA 3HB9A 3E9RA 3T1OA 1XC7A 3EN0A 3KKQA 4KDCA 2V7UA 4N3CA 1JYEA 3T3GA 3FHTA 5E2BA 4U7DA 4R6WA 1U5BB 2I5PO 3MUEA 1D2EA 1VXRA 4L2IA 4YP5A 4B35A 4CV2A 1XZAA 3QUSA 2R60A 1SUFA 4RZ2A 4NCHA 1GAJA 3TOVA 2AOUA 1F38A 3OAAD 1H0HA 5CH3A 5T4HA 3RYTC 2FRVA 3JQFC 4RVNA 3SBEA 2XVYA 2NVUB 2FPPA 5EP3A 4XCQA 2WVGA 1OT5A 3ADPA 1W25A 4NZOA 4YJ2A 1JR3D 2ZUTA 3DO6A 3JAWA 4LZLA 3IV6A 4HY3A 5D5HA 4E11A 3P0IA 4CMGA 4MA0A 3GGCA 3W5SA 4AMBA 3SI7A 1IM2A 1VCHA 1MX9A 2BKXA 3HE3A 1IUNA 1GPYA 1KMHA 1UM9B 3TE6A 3IP7A 3D4OA 4OX9Y 3LHDA 3NASA 4KMMA 3NEAA 2H5LA 4DJJA 4S05A 1W36D 1RXWA 1HDCA 3LIIA 5K0EA 3EW9A 3AF4A 4HDMA 2RCYA 2D8AA 5BSVA 1NU6A 2R4TA 2A9PA 2CMKA 4K6KA 3NUGA 4BAGA 5BV2P 2Q6KA 3KOXA 1VBKA 1SWWA 1WSAA 3KLOA 2EWMA 4Z2AA 3K6JA 1CB7A 1M76A 3NXKA 2WY2D 1EI9A 1AK1A 3ZNOA 4B6FA 2AF4C 1XMSA 4WE3A 1YVUA 3WLNA 3NHUA 2WYHA 4C0KA 5EJMA 1JHPA 3ZY2A 1H23A 3FWPA 4JI8B 3CF2A 2BMVA 3V4SA 3WV5A 3I9LA 4GSKA 4KAJA 4QBKA 2ZZKA 3A28A 4MV1A 2AFIB 1BYIA 2YWDA 3I76A 3LV8A 5EGSA 1TLFA 1FYEA 2F8LA 1XZCA 2JGEA 2QTVA 3D8TA 1H2RS 4HB0A 1YCGA 1JEDA 1OASA 1V8PA 3HR8A 1FSFA 4Z3DA 4A27A 4D82A 4Y2UA 2DUJA 2JIRA 3WOVA 1G2OA 5F52A 1DJPA 1N2CE 4HN2A 3WV4A 1G8MA 2PT6A 3FYSA 2H59A 2O8FA 2HIGA 2E1PA 2PLNA 3NHKA 1XBTA 2JI8A 2NXWA 2DT8A 1GFWA 3BERA 1VL0A 3CPJB 4R1OA 3H1EA 2FJUA 4EHNA 2NU7B 4LV5B 2XYVA 3GLVA 2OAP1 3G0IA 2C4HA 2X77A 3N5KA 3ER6A 1QV7A 4V0QA 1N25A 3VXKA 4DRXA 9ATCA 1LPPA 2YHUA 3I3SR 4HAZA 1C7ZA 1RTKA 2PKQP 4MR8A 3FOAA 4RZIA 3WLRA 2ZGVA 2WJVA 3ZY3A 5EMMA 3C3EA 5C9ZA 2O52A 4RHFA 1J90A 5KTMA 3VJKA 3B7WA 4HH4A 2QIOA 4U1RA 4E51A 2MTBA 2CB9A 3ILSA 1CUGA 1F6BA 2VBFA 3WDLA 2VS1A 3E7WA 3H2SA 1QNFA 4XPIB 5AW9A 4RK1A 1AGPA 1PCXA 2EFDB 1OLOA 5AKLA 3STYA 5BNWA 4RZ3A 2I7VA 1T3TA 2VLBA 4FBGA 3VHXA 3ZCSA 4EKYA 2B1QA 4G56A 2W8ZA 1PL7A 5AMXA 2FPKA 1N6HA 1XDUA 2RJOA 3LWDA 1U3TA 2H2IA 3F6YA 3ZZUA 4BQOA 3CO5A 4JYZA 2GSDA 3LT2A 4R5HA 4R0MA 4B47A 1J70A 2LDBA 3OP1A 1D2GA 1L7AA 3M3DA 3ZLJA 2Q9BA 4OI2A 4NL4H 5H3LA 1G17A 1L5ZA 1FTSA 4U2EA 5FL7A 4H6WA 3L4JA 3S2GA 4YRRA 2R1VA 4DLRA 2Z2YA 4ZV7A 2XSZA 3GLTA 5AW4A 1AN0A 4WACA 1TM2A 1L4FA 2ZVDA 3TLMA 1GQYA 3PXDA 2OV6A 5JCJA 4GI3A 5GV8A 2ODTX 5EWJB 3D4LA 1OC4A 1ZK3A 3DTYA 2R7LA 2J48A 4LJRA 4AICA 2C5HA 5ECWA 3RVJA 3U17A 2XNDD 3LDUA 4YRNA 1ZVKA 1PR1A 2OO5A 1QK4A 1E4EA 1DXOA 1PJQA 1R8SA 1VLMA 3KPUA 1Z62A 2Z2JA 4HYQA 4KH0A 4TMTA 1JEQB 2YFHA 4YEDA 4IUDS 1K7EB 4IJ5A 3ZWNA 4JLMA 3B20A 5FLEX 1KS2A 3MJRA 4KCGA 2PG3A 3OPVA 3U13A 2NU9A 4JYMA 4PZDA 4EWLA 1MJGA 3G59A 4G23A 5EXPA 3UENA 2ZIAA 2XWSA 3F67A 4TUYF 1Z82A 2EP8A 4ZI7F 3RI3A 1EGMB 1YCFA 3AHFA 5MN4A 5CFLA 4Y1RA 4Z53A 2OHIA 4CQJA 4CQLA 1ZA2A 3FFWA 3P2KA 2ZKIA 3LOQA 3L7KA 2XWPA 1Q3TA 2UUBB 4KIFA 4NBUA 4GPTA 2FMUA 4Q3KA 3V2GA 1S2LA 2HMYB 2YIDA 5J5CA 4IGFA 5DW3A 4YHHB 3NM5A 3DDZX 3LRPA 3EZ9A 2ONJA 3DOCA 3PGKA 3STVA 3X1YA 2I2FA 5KOHB 3EA0A 2BRUC 4X94A 3K9LA 2HHHB 4BMZA 4ZI5A 1RLTA 4UVIA 3V3TA 4OF4A 1MOPA 1JF8A 2WTAA 1JPNA 3AUTA 2W2OA 5KWVA 1RRMA 2G4LA 3GWGA 4FQ5A 3ZNPA 7AT1A 3H5AA 4DEXA 1VHWA 1MJ5A 2Z6QA 3QG1A 2FLKA 2ZYUX 3HWWA 4IUBS 1QM5A 1SVSA 4MV3A 5C18A 4F3CA 1KO7A 5HS4A 1XAHA 1E6UA 1M72A 3ZN2A 4KZPA 4OK3A 2XYQA 3IHWA 2Q6IA 3P71T 1E3WB 3RTBA 3FDFA 1UAGA 3T34A 1L7BA 1M1YA 3LOUA 4IOLA 4OGLA 3KJEA 4R69A 1GAXA 4MLZA 3ZY5A 4H17A 3TOZA 3H5WA 5FPSA 5MFPA 5DX0A 2APJA 2A58A 2XCIA 2V54A 3GMIA 3Q1KA 4J94A 2GCOB 3JWJA 3ZJUA 3HA7A 2NLOA 4LF4B 1XMJA 1G55A 1NV8A 4IIVA 4FS3A 3ORFA 1F06A 2FN3A 2OK7A 2QMZA 2IYLD 3ME5A 1ZKDA 1BEZA 5CW1A 4F4HA 4IJVA 3ILHA 2BONA 2IP1A 1DUVG 2NUTB 3DLTA 4MGYR 5AO9A 4BY9E 1IN4A 4LMBA 4G0UA 4QO8A 3KOZA 3SMQA 5HR5A 1CE8A 4DAEA 2WJIA 3UHJA 3DWIA 2I4MA 3BOSA 1LQ2A 2GN1A 5KYWB 3HCCA 1V43A 2OV1A 3AZQA 1P2UA 1MEOA 2IHUA 3EXEA 2HJVA 4KYUA 4MV6A 4OREX 3DG9A 2XCQA 1DKUA 1RXCA 4H7KA 4R8MA 4MZXA 1G19A 1ZJ6A 3T7AA 2ZVJA 3H9UA 4CCWA 2GHTA 4YLGA 3WAJA 1R8YA 1SBYA 5CLGA 2HRCA 3RVOA 1L1FA 2F3PA 4EGCB 1R6VA 1E3EA 1YONA 4Y6GB 1J23A 2EW8A 2GD6A 3M3PA 3N3BC 3DVAA 4LSGA 4QXPA 1E9VA 2D4AA 3O2NA 4DLLA 3WIEA 1GKLA 1RJWA 3K8YA 3L7BA 3JVDA 3R0ZA 4DA4A 2BP7A 1RJDA 1VJDA 3AETB 4A8PA 3UGKA 3AVXA 1EDEA 2XE6A 3LL4A 3EQ6A 3NWPA 5JZ9A 2GJSA 1EA5A 2VYNA 3OOJA 1V0JA 4BJ5A 3IUPA 4IDQA 3ELBA 1C0KA 5ALPA 1UUFA 2A59A 3DEYX 2K7ZA 5AOBA 3SZGA 3TVTA 4AY5A 5BQ5A 3BL5A 4I1SA 1KPGA 5EXEA 4C7OB 1NZJA 3TTYA 1AMOA 2HV9A 3OM9A 3I53A 3IODA 3INYA 1OPXA 1EE1A 1A69A 3QVOA 4G5XA 4GLOA 2WAAA 1P1RA 1OI3A 4GX0A 1SHKA 4MUBA 4WLVA 3RU2A 4ER6A 5HKAA 4A8JB 1Y8CA 1YACA 4RZHA 1ONNA 1T9AA 2FZCA 5AT1A 4EFNA 1XJ0A 1CQXA 2P9FA 2C96A 3MINB 5CJPA 3FWNA 3OH8A 3OMWA 1N1MA 3S40A 3WGJA 4FYJA 4LV6A 3DT9A 4TGLA 1IONA 1KHTA 3MD9A 1ATIA 3AXSA 5HFJA 4YLYA 3SAJA 1FTWA 5D87A 1JKMA 3PNVA 4UUNA 5DTEA 2BE7A 4J75A 4ZVQA 5JD3A 4WKCA 1P19A 2KHZA 1NE7A 4IQ8A 5JBNA 2G70A 1TPYA 2CXQA 1X2EA 4G85A 2BDUA 2GKGA 2EGUA 1GTL1 2O2HA 3AT1A 2XADA 3CZQA 4HQNA 5B3AA 3R8CA 1OF1A 4NR0A 2Y2UA 3HJTA 4YI3A 1UPUA 3T3OA 5EHGA 2ZJ4A 1MBZA 4C9BA 2BR3A 3AGPA 4UDOA 3UJPA 3W7AA 1QQ7A 3WGYA 5EZYB 1GPMA 1UH5A 2HF8A 3RC9A 4B4DA 5EWLB 2H2HA 4NECA 1A72A 1M66A 2B7CA 1QC5B 3QMWA 2GTIA 2WTUA 3PFGA 1Q91A 2FXIA 5A6VA 3TIIA 3KOUA 5JDIC 3NHJA 3S1LA 2PZ8A 3QHPA 3OHSX 3P20A 1BVRA 2JEYA 3GOHA 2XQKA 1PL0A 2CD7A 4MRMA 1CVRA 4QHYA 5AI4A 3ZX5A 4NXMB 1F1JA 2ZSFA 3O8QA 4N39A 4MV7A 4UATA 3KQUA 1POWA 2ABWA 4O4LB 1M2VB 4RK4A 5FI5A 4AZ3B 3KXDA 1I01A 3R9KA 5C81A 3I28A 3TZLA 2LCIA 3LKVA 3THRA 5J43A 5DO9A 3ER8A 4EX6A 3CSDA 4GPAA 3WRYA 2W2TA 2PRSA 3AY0A 3DBOB 3G9QA 4OFXA 4QPJC 4QYTA 1J1UA 1RXVA 4Q02A 1LTKA 4HEJA 5F51A 1KOLA 3KQYA 2DHRA 2VSYA 5ALQA 3OECA 1W4CA 2OZLA 1JMVA 2AX3A 3R6TA 4HGNA 2IX3A 3F6SA 3FUCA 3T5DA 1N2EA 1S2DA 1D4ZA 1IPEA 2IZZA 3OCYA 1R37A 1Q92A 2HBRA 1L4BA 2J5RA 2OECA 3ETGA 4IH4A 4LPSA 4P2BA 2WJPA 5GVRA 4DT1A 2YYAA 4BU0A 1UINA 3MT0A 3D3QA 5FO1A 5CR9A 5FWAA 4FHZA 3EZLA 4P36A 1SUEA 4IF4A 4J1TA 4XIGS 3TKAA 3URKA 3W90A 2XQIA 2J3DA 2CNBA 2CYBA 2NT4A 2RCNA 2IS6A 4RA6B 4NZMA 1XFAA 1NAIA 1K68A 4KXMA 4QEKA 3SYLA 5KSOA 2CVFA 3BTOA 1NATA 1WB6A 1CY4A 4WZAA 3V8NA 1IJEA 2PV7A 1EM6A 2O8BB 4MUEA 2JLWA 4ZV4A 1SVLA 4RSHA 3WNZA 3GT3A 1GY8A 1VCNA 1YZKA 1L4HA 3ZDBA 5FIUA 1IFXA 2B8JA 3Q8MA 1NSYA 3AYZB 3B9QA 4QPCA 5FX2A 3QXCA 1GG2A 1AS0A 1YJCA 1XE3A 3LG2A 2VF2A 2RI1A 3AOEC 3R41A 1P1CA 2IV7A 1HT0A 1YB6A 3ROFA 4UUBA 3P19A 1KAHA 1G41A 4PX2A 4LQDA 2M98A 3ZDCA 1A8PA 1ZMRA 2MMGA 2SCUA 2X9QA 1GO2A 4RQTA 4H3VA 3L6UA 3V80A 1M5UA 1IY0A 3OCVA 4IZHA 3EEOA 2P69A 1WXDA 5J1SB 1ZEJA 4HDRB 1DMRA 1TJ3A 5DT9A 2SKDA 3EEIA 3IQDB 3RJMA 6REQB 4NMMA 1QF7A 4B9AA 1FVOA 2B34A 4TL8A 1XRNA 2CCKA 3REQB 2FKNA 1J22A 4KN8A 3AY3A 3U0BA 2LWIA 1SRQA 4MR9B 3A36A 2ZG6A 3E23A 1JPJA 1CVLA 4I99A 4LOKA 4R8SA 3T99A 4QPNA 2E4YA 1QDEA 2CHQA 2ORWA 3A0UA 1VPLA 1BGXT 1BU5A 4W1PA 3RM3A 4A5SA 2MSNA 4BAUA 4Q3CA 3LUBA 1EB9A 4HV4A 5SZJA 3FTEA 1TKBA 4A1OA 3F3MA 1KVRA 3QW2A 1P0FA 2DM6A 3PUVA 4AD8A