1N6RA

Crystal structure of human rab5a a30l mutant complex with gppnhp
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
167
structure length
167
Chain Sequence
b'GNKICQFKLVLLGESLVGKSSLVLRFVKGQFHEFQESTIGAAFLTQTVCLDDTTVKFEIWDTAGQERYHSLAPMYYRGAQAAIVVYDITNEESFARAKNWVKELQRQASPNIVIALSGNKADLANKRAVDFQEAQSYADDNSLLFMETSAKTSMNVNEIFMAIAKKL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ras-related protein Rab-5A
publication title High Resolution Crystal Structures of Human Rab5a and Five Mutants with Substitutions in the Catalytically Important Phosphate-Binding Loop
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein transport
total genus 55
structure length 167
sequence length 167
ec nomenclature
pdb deposition date 2002-11-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1n6rA00
1M6NA 3CRQA 3CRVA 4Q9IA 3NEYA 4RCZA 1N6KA 1EX6A 3DM5A 3RRMA 2X2EA 1G7RA 3QKRA 2ZSEA 5E3HA 4M4SA 3LXXA 4Z8YA 3ZVMA 2VBCA 3HYRA 3G5UA 4HAVA 3J81k 5GJBA 5F9FA 4E22A 1KK2A 2F3RA 5DLQC 1JQJC 2XJ9A 1VHLA 2CHGA 4EFLA 5GADl 3R9XA 4WVFA 3FMPB 1ZW6A 4NKRA 5TVKA 1R0XA 3BB1A 4LV8B 2PJRA 4AYWA 3NBZC 5HTKA 3HU1A 3TGPA 2JJ2A 3MWYW 2X77A 2IXEA 5EXPA 4CT4B 4HAXA 1E98A 2JLQA 4CYMA 2V54A 5HCIA 1J99A 3GQBA 5LDDC 3U7EB 3WRXC 4A0HA 3K09C 4LJ6A 5AJVB 4Q19A 4URZR 1TF5A 3M4YA 4R71A 5KDLA 2CNWD 1YJ5A 5BWMA 2QU8A 1DAFA 2WJJA 3DPUA 4C0SA 2VO1A 1W49A 5FOVA 3ZQ6A 3LQQA 3SHWA 1SVLA 4C0LA 1AS2A 1GL9B 4BLTA 3CW2A 4A8JC 1Q12A 2CE2X 1QHYA 1W5TA 1P5ZB 1W4BA 4DCUA 5BN4A 3U6BA 2H16A 1Z0IA 2IYRA 2QM7A 2BBOA 3TUZC 2XZPA 2REXB 3KJGA 3HPRA 2WWYA 4PHGA 1S1MA 4EPRA 2J0UA 3LBNA 4LY6A 1U98A 2ZRJA 4OKSA 4A15A 3ND8A 1G9XA 3KKNA 2QE7D 4NE2A 5EE5B 1IY2A 2IS4A 1OYYA 3K0CA 2Q3FA 3F8TA 2ZETA 1A1VA 2F9MA 4Z51A 2ZRCA 2KBFA 3ZVLA 4Q48A 1RC8A 2NO1A 3LV8A 2QL6A 1AM4D 2IW3A 4BZXA 1G7CA 1G8PA 1N5LA 1T3LA 4Y0AA 3VMFA 1VG1A 4URUR 1G6OA 1VPLA 3I8XA 1DADA 4ZDJA 4L15A 1CJVC 4C0QC 1L2TA 4EFNA 1DBSA 3SYKA 4F38A 5GJWC 1G8YA 4F4JA 1OH5A 3AQ4A 3U60B 2YC4C 4C30A 3IPXA 1U81A 1MRNA 3A4MA 1XWIA 4KFUA 1WB9A 4JLDA 1TUEA 1GNQA 2QA5A 1EFHA 2DPXA 5KU1A 5D3MB 3RS3A 1MV5A 2JJ1A 5KPJA 2JJ2D 1XJCA 2VTKA 4P4TA 3QXSA 4QGAA 2IC5A 1E9SA 1EGAA 2OG2A 5J4LA 3W8RA 1ZYUA 2H7VA 1RVDA 4G01B 4N0DA 4DCVA 2XTZA 1N6HA 4K46A 3Q5DA 2GAOA 2IXGA 1P2TA 4BRUA 3EPLA 1AS3A 4Q66C 1XD8A 5BN3A 4B2PA 2PT7A 2A5YB 4DZZA 1E2JA 4FCWA 4PO9A 4DSNA 2ORIA 2WJVA 4LUCA 3WP0A 4KO8A 3PJRA 2B21A 2G83A 1M34E 4P4SA 2H5EA 4EKDA 2ZSFA 3WNBA 2GCNA 2ZRIA 4V0LA 3LA6A 3H4MA 1ZP6A 3GLFA 4OHYA 2FSHA 3OAAA 1XTIA 1KZ7B 1FQJA 3THWA 2R65A 5J47A 4TL9A 3C15C 2HJVA 1W0KA 4JSYA 4NCNA 4Z54A 3RDPA 1E2QA 1TQDA 4W9MC 3A1UA 3VR5A 1KO8A 2VF7A 4ZO4A 3UG6A 2DYKA 3EC2A 4FIDA 2HLDA 3MWLA 4A82A 1JJ7A 2ZI3A 3DVLA 2PLFA 4C0HA 4D80A 2A5JA 3CIOA 4DRZA 3SJAA 4F4IA 3U44B 2YOHA 1G5PA 3M1IA 4U02A 3KXKA 1K5GA 2WAYA 3GP8A 4GPTA 2H18A 4ITRC 5JCPA 1QHIA 4EPYA 4LBZA 1EESA 4TTQA 1XMSA 1XPRA 3B1YA 1YR6A 2PH1A 3THOA 2D7DA 4LV5B 4A2PA 2ZYWX 1OV4A 3GJ7A 3K9GA 1BYIA 1DTSA 2WMNB 2F1IA 4EJSB 1QHXA 5D3MA 1ZM2A 2JJ1D 4PHHA 5A5GA 3EPKA 2G1KA 4GSYA 4KSCA 2WVJA 5CM9C 5D3QA 3WYGA 3K0CC 1VYVA 2YVUA 2QTFA 5E7MA 1TU4A 2BMJA 4B76A 1S9HA 1E1RA 3TQFA 1E2LA 2VP5A 3Q7PA 3LLMA 3SQXA 2MSEB 1UDWA 4I1UA 2E87A 2FFQA 2DWQA 4BLQA 2IUUA 2O8FA 3W5JA 1FP7A 1M7HA 1E9AA 2FMXA 2IBMA 2WWHA 3VX3A 2V1UA 2ODNA 2EWWA 2HV8A 3N5CA 1ZM9A 4V0KA 3GEEA 2QAGA 2GJ9A 2P67A 4LYAA 3RS5A 1Z08A 4FMCF 5EXSA 2ZXUA 2ANCA 1CJTC 2GZAA 4O0MA 1CP2A 1VIAA 2JJ8A 2NO7A 3SJCA 2ZR9A 2ECKA 1T5IA 2GESA 4HLDA 3SU8A 1P73A 3T06B 4OQNA 4DCNA 2VSFA 3OAAD 4G0NA 2GVZC 2XITA 4JLNA 1LFDB 3AVOA 1HE1C 3WNDA 1IN5A 1N6PA 2WWIA 2BEKA 2ERYA 3L82B 1VG0B 1E4VA 3RRYA 3CWZA 3W3ZB 2HYIC 5HR5A 1CJKC 2R6FA 4OHVA 2GJ8A 1FW6A 3U4QA 2SHKA 1E9CA 4R98A 4LX0A 2HLDD 4QL3A 2ZYTX 1KMHA 3RABA 1I4DD 1MRSA 4MRVA 5SZHB 2J0VA 5FPYA 4ZCLA 2WJYA 5FUXA 5BN5A 2REBA 4LPSA 4M1YA 3U44A 3R9WA 4DSTA 1QF9A 1NL3A 2VQSA 4Q18A 5KSOA 4OK6A 4E09A 4C2TA 1AQYA 1Q3TA 3CKLA 4AYXA 3K0FB 4QM7A 4WAUA 1WXQA 4KXFB 4V0ME 4B74A 1ZM7A 1N5JA 4M1WA 4DDWA 4ZKDA 1QVAA 1R0YA 4MYUA 1A2KC 1LTQA 2K5UA 3DOFA 2FSGA 1Q1EA 2QSYA 4UXJA 4TMVA 4ARZA 4DT1B 2P5TB 4EJSA 3CF2A 4HUQB 2QPAA 2QT0A 3ZIAA 1RJ9A 3ZZUA 5CITA 1VMAA 3WMGA 2GK7A 4GP7A 4ESHA 4PPQA 3UG7A 3AP3A 1E1RD 4TQAA 4UJ5A 4MA4A 2JLWA 4MRRA 2A5DA 4BASA 1A4RA 3IIMA 4E07A 2CEAA 3EA5A 5EP2A 3BXZA 4B3BA 1TADA 2OV2A 3IQWA 5EXTA 2H8KA 1P9RA 4XVRA 2BOVA 2OO7A 1DO0A 1X8LA 2XOKA 3EWAA 4YMWA 2IHBA 4B73A 4ZCIA 2A30A 2IA5A 2F43A 3GLIB 1NLFA 2PMDA 4B2LA 4HZUB 1H65A 1G4AE 3IBYA 1OIWA 1EG7A 4RD1A 4BUJA 2ZJ2A 4PSAA 4JL5A 3UIEA 1KOFA 4QNRA 3NDBB 1XMIA 2H92A 4UQOA 3UK6A 1RE0A 2EYUA 4NH0A 1IN8A 4LJ4A 4AURA 5AJWA 2BHRA 2ZM5A 1OB2A 1TQ6A 1D8TA 4NCHA 1GRNA 1R6BX 4CW7A 4PO8A 2QM8A 3OE7A 4ZCMA 3AUXA 3KZ1E 2RGGA 4HLQB 1KYIA 1G291 2QEQA 1OF1A 3BGWA 1Z0JA 2FFAA 3CR7A 4W5HA 2GVDC 3GJ8A 1SKQA 1IXSB 4TTRA 1XD2B 1HURA 1LF0A 4S35A 2IXFA 4TMWA 3SDZA 3ZS9A 2F7SA 2YOFA 2BM0A 2QAGC 3M6AA 4JVNA 4GZLA 2R6DA 1KI2A 4RD3A 5EZ6B 2FNAA 2OFWA 3QKSB 3CRMA 3IDQA 4XTRA 3T34A 5FOWA 4B43A 2VP9A 1AZSC 4QXAA 2CL0X 2I3BA 5KHOC 1G16A 2V8OA 1E79A 2ASEA 2ODBA 4AG6A 4FMBB 1PZNA 4A6PA 4HUQA 4QM6A 3QXHA 3WYFA 5AJZA 1YU9A 4LHWA 1KK3A 2QUZA 4LI0A 1KAGA 4JT4A 1J8MF 1ZNZA 5TB5A 5DI3A 3TAHA 2ZANA 1SVSA 4C4PA 1HH4A 2DHRA 4PQRA 1CXZA 3THYB 1E2MA 3VHLB 3DL0A 2FX3A 1D9ZA 2JDIA 1GIAA 1LS6A 4DUGD 1HEIA 1AS0A 4URVR 1W4RA 2V3CC 3QXCA 2XOKD 5DE3A 5FR1A 2W2XA 3CLVA 2V6IA 3GLIA 3IO3A 3FMFA 3LY5A 3N70A 1KK0A 4PAMA 3ZZTA 2PX0A 3I5YA 2KJQA 3MRSA 4DLYA 1X1RA 4IXNA 4NYJR 1DAHA 4ZDIA 4A6XA 2BMFA 4RD0A 4EJSC 1D2MA 4ZDKA 2YWHA 1FFHA 1KKLA 4RVCA 3GFTA 4Q02A 2C78A 3AM1A 2QZ4A 1Z2AA 1NLZA 3CNOA 2CMKA 4V0OA 5DN6A 2ZU0C 3CR8A 5IHPA 3A37A 4D4KA 3OE7D 1G6HA 3C7KA 4ZIRB 3VR4A 3MLEA 1GL7A 3N2EA 3SFVA 2ZSDA 4XTCS 1Z5ZA 3B85A 1OXSC 1RKBA 2O52A 5EXXA 3I73A 3BC1A 4MRPA 1NSFA 4YC7A 3PIRA 3LD9A 3TE6A 2P3SA 2OM2A 1UM8A 1S8FA 3RNLA 1J8YF 4Q21A 2VA8A 1P3JA 5JEDA 4Q1BA 1GNPA 2HJGA 2OE2A 2ZRPA 4FWTA 1HUQA 1MO6A 1DAGA 1JNYA 2CBZA 2WM9B 4EDHA 5F3WB 1OW3B 1CR1A 4MITA 4TLEA 1DEKA 2ZRBA 4IEEA 2JA1A 3VKWA 1SVMA 4O25A 3AVXA 3IILA 4BRWA 2ZS8A 4KBFA 3R7WB 1E79D 1TUIA 1Q57A 4MKGA 3U3MA 3B9QA 4M2LA 2VP6A 1CS4C 4MYHA 1L4YA 3VR6A 1JAHA 1S3SA 1AA9A 4QFMA 3VX4A 4Q1FA 3DOEA 1CRQA 4C2UA 3I32A 1IJFA 4M53A 1KGDA 3P32A 2WOOA 1NRJB 2FPMA 1XEFA 4JKIA 4QHTA 4FW9A 2GKSA 3R9IA 3OEHD 4DDTA 4D6PA 3THYA 2HT6A 4DEYA 4AKIA 1YRAA 2FZLA 1SGWA 4NTZA 5FBVB 1OLOA 2JDID 2BVNA 1P62B 4TMZA 3L2OB 4QJ4A 2GJAA 3K70B 3KFVA 2GDJA 3EIQA 1KZGB 5TXGA 2WSSA 5JZVA 5B64A 1GRRA 1YE8A 1XU4A 1N6IA 2VLIA 4RKFA 2O5VA 2QBYB 2J59A 4JL8A 5FTNA 5JWOA 3I61A 3IEUA 3DKVA 3WHLA 4LZZA 2FN4A 4TMKA 1JECA 1G5RA 1QDEA 1ZIPA 3IUYA 5DN6D 1FPMA 3TVDA 2J3EA 1E99A 1PLJA 2RGAA 2Z83A 3WBJA 1R0WA 2WKPA 3FFBA 1N25A 4ZIRA 4CGZA 4IDNA 3FHCB 1NMZA 3EZFA 4IRUB 4LV6A 2JLRA 3X1XA 3L0IB 1KJWA 1M1YE 3UWKA 4BFYA 4C7OB 1A5TA 3O8BA 4RZ2A 4A9AA 4JS0A 2A3RA 821PA 1CEEA 4AI6A 2QMHA 4FWIB 4BEBA 2UZIR 2OHFA 1LV7A 4BFSA 2A78A 3WMEA 2WAXA 2CVFA 1FUUA 3AP2A 2GBLA 4XVQA 1KSHA 2RKOA 3GLHB 3PUXA 4G3XA 4CEIA 3R8CA 3VR3A 3WMFA 3I72A 3C4JA 1E9BA 2OFOA 1I4TD 3QEJA 4ON9A 1J90A 2KI5A 2V4ZA 2PZEA 4TSFA 1SKYE 1G3MA 3T5DA 4C0BA 1KJYA 2YZ2A 4DLUA 4GMDA 5FOUA 5FL3A 1T0JB 4YQFA 2NG1A 4R2IA 4W5WA 3WNCA 3H2YA 3A4LA 3NEJA 4TLBA 1D2EA 2AWNA 2GXUA 4NYJQ 3PFIA 1MR3F 5DYIA 1CR0A 2QRZA 2C2HA 1N2CE 1LB1B 1S2MA 4P32A 3GFOA 1FTNA 1KKMA 4WOPA 2WSSD 1FMJA 2VP0A 3QBTA 3K09A 5KDOA 2EW1A 1MO3A 1UBGA 4EUNA 4YMSA 3ZVRA 3GJ5A 4IHQA 5FL7A 2QN6A 1YZQA 3LVQE 5AUNB 4MKFA 1T8UA 2BMEA 2HXSA 3E5HA 5G3ZA 2VHJA 5K8LA 3B1VA 1G19A 2YC2C 1HT2E 2YHSA 4KV9A 2R44A 1ESMA 1T91A 3FGNA 4HSEA 1R4AA 4L16A 2BJWA 1QHGA 1N5KA 3AF4A 3B2EA 4AYTA 5TDHA 5C2JB 4BFXA 4JSTA 3H1TA 4C7OA 5EP3A 3P1JA 4OK5A 5FUVA 2Z5FA 2GJKA 1P9WA 5LBIA 2TMKA 2BCJQ 8OHMA 2ZRDA 4L4UA 4RZUA 4EPTA 3BB4A 4M22A 2ZJBA 2IYZA 5EQTA 1WMSA 2QQ0A 1KK1A 1ZNXA 4BFVA 2AX4A 4Q1DA 1Z0KA 2FSFA 2KB0A 1YHNA 2Z0MA 3RSLA 3AVVA 3V00A 2WBLC 3GLHA 2LKDA 5EE0A 4EIWA 2D06A 2C96A 4PFSA 5KO2A 4QHYA 4TTPA 3AVTA 4OQMA 3GJ6A 4Q00A 1XEWX 2FSIA 3B78A 5EP4A 1E0KA 1E2NA 1TQ2A 4MQBA 2DR3A 4TSFD 4B3XA 2FDCA 2WIBA 1FOEB 2FGJA 4CEHB 1GG2A 2W00A 2LCFA 4JL6A 3MG9A 4QBHA 2NOAA 4CVNA 2IYQA 3SJZA 2J5XA 3PUVA 1WP9A 2IYVA 1SKYB 2IYWA 5KDDA 4FI3C 4TQ9A 1I2DA 3W90A 1SXJE 2ZROA 3K70D 5ANRB 4UXHA 4HB2A 4QOSA 4JLPA 4LYJA 1JPJA 1T8TA 2QGNA 2GBLC 2ODWA 5CYPA 3EIEA 2ZI6A 1E96A 4HLCA 5FPTA 1VKJA 2CK3A 1Z06A 4DXAA 1GFIA 3DO6A 1CTQA 5E4FA 2JIZA 3H86A 5FL7D 5HPYB 2WWXA 3D8BA 1IOZA 4BLRA 4OQXA 1M7GA 3GJ4A 3TBKA 3KKPA 3TRFA 3N2IA 2FF7A 2QENA 1SHKA 3OIUA 2F9LA 3C14C 5CJPA 5H70A 3KXIA 5L3VA 4G1UC 4LC0A 4O2LA 3SJBA 4LJYA 1P2VA 3CX8A 4GNKA 3RYTC 3Q85A 4ESVA 5L3RA 1F5NA 4Q1EA 5FOSA 1OXVA 1TEVA 3RS7A 3UXMA 4CIDA 1KDTA 1S1CA 3FYHA 1XDBA 3ASYA 3I3SR 4BZPA 3K70C 3B1WA 2G77B 4QGGA 4DVGA 1S96A 4DLWA 3H84A 2QORA 1G3RA 2CL6X 3AKYA 1SVKA 1C9KA 1EWRA 3E1SA 4LJ8A 1KDOA 2IT1A 1BYUA 4DJTA 1F3OA 5FUWA 4EAQA 5FR2A 4LGMA 5JI2E 1G8GA 1OSNA 2ZJ8A 3C5CA 4CT5A 4TYYA 3FTQA 3IHWA 4LHYA 5KSZA 1II8B 2BEJA 4YMTA 5HE8A 4OHZA 2CCJA 2VPPA 3HR7A 4Q4LA 2YWFA 1KI7A 4OI2A 2P0EA 3SNHA 1NVXQ 1RRFA 1X8KA 1L8QA 2AN9A 2OCAA 4IW3B 1XB2A 2P5SA 5G41A 1GL6A 5FOTA 4OQLA 2C5LA 4IVRA 1DE0A 2OCBA 3SI7A 3RS4A 4QNMA 4RJLA 5IF9A 1W7AA 4HAUA 2ZJAA 3BD9A 5DIFA 2L0XA 2P6RA 1CJUC 1H8EA 3DMDA 4ZI3A 2PCJA 1IXRC 3EW9A 4LCBA 5G40A 5HKKA 5FPKA 1G17A 1HTWA 2CK3D 2XX3A 2IWRA 1SXJB 3UWOA 5M04A 4D4MA 2OCPA 3BFVA 2JIZD 3NHBA 1Z3IX 2ZRFA 1RW4A 4D25A 4OHWA 4JLMA 5L8VA 1DG3A 4URWR 3I5XA 3NHAA 3NH6A 3RWOA 1JB1A 3U2QA 4IJMA 1U2RA 1F2UB 3B6EA 4LJAA 4RFVA 4B3FX 2GRJA 1FL9A 4DC9A 4GOJA 3O8RA 5H8WA 2QP4A 1ZRHA 4C3ZA 4ILEA 5CLQA 4MYCA 4M1SA 2KBEA 2X19A 4JLAA 4JIMA 3LX5A 5K8IA 1OXTA 1Z28A 4MKIA 2ZSAA 4LC1A 4A0GA 2KSQA 1KSGA 3TSWA 5FBWB 1HYQA 3WP1B 4M0LA 2DBYA 4KI0A 3IGFA 1F2TB 2NTYC 3MFYA 1Z0FA 1WCV1 2BCGY 4KLNA 3SZRA 1VIYA 4GOKA 4P4UA 1NMYA 1MOZA 1ONBA 4JLBA 5EE9A 3KUDA 3NIBA 2D7CA 3QG5A 1V5WA 2EYQA 1II8A 1ODFA 4DEXA 1H8HA 4MH0R 4XIGS 2I4IA 3TVTA 2B8TA 3LRPA 1NIJA 1SZPA 3KQUA 2RGEA 2GILA 4MRSA 3BH7A 4IXMA 3I4LA 3LVRE 3RS0A 1FTSA 1JAIA 4ZPXA 2QGZA 1R8QA 2Q21A 2OAQ1 4G5RA 2C03A 4Q01A 5AJXA 1U0JA 2JASA 1HQYE 1LY1A 4C0AC 2O8CB 1T4GA 3KB1A 3A4NA 2IWHA 1X1SA 5JMTA 4IVQA 2NZJA 1KIMA 3SFZA 3U5ZB 1H8ED 1R2QA 2JATA 3HJNA 5HE9A 3WBKA 3I92A 2FFBA 5HKKD 1TAGA 1RZ3A 4DLVA 1ZINA 2D3WA 4QJ3A 5J40A 1E94E 4UNPA 1SXJA 4Q5IA 4KVGA 5CIWA 5JS7A 2ZUBA 3U61B 2YV5A 2IL1A 2D2EA 2ZS7A 1QBKC 4WW0A 4KYUA 1GKUB 1WE2A 3MAAC 1YR7A 1G7TA 3T12A 2OILA 2OZEA 3ZLJA 3U7GA 4GT1A 3GCGA 4WXRA 4F91B 1P2UA 4TLAA 2GK6A 1OFIA 5L3SB 4JT2A 1JEDA 4AK9A 1QHHB 1ELOA 3SEAA 3HP1A 4D82A 521PA 1KI6B 1AK2A 3T35A 2C98A 4MUBA 4BE7B 2R6AA 2YKGA 3TW4A 3TSZA 4IVPA 1GVNB 4XWKA 3OHMA 1Z0AA 2PEZA 3T5GA 3BAFA 3ZS8A 3ONWA 4WZ6A 3RANA 2NIPA 2Q6TA 1IN6A 1GAJA 3KKOA 3ZGXA 2OBNA 2ZE8A 2CVHA 5A4JA 3O47A 3V4RA 2GHIA 3LBIA 4X8OA 3BRWD 4HB0A 3W34A 1H8HD 2ZE6A 2XTMA 3U3RA 1D5CA 1SQ5A 3LBHA 3SBDA 4XJXA 2N42A 3I62A 3EZ9A 4URXR 2ZJ5A 3NKVA 2QMOA 3D31A 3FOZA 2JLVA 1YKSA 1SVOA 1XNJA 3KJHA 1Z07A 2C77A 1RIFA 5GJVC 2ZRKA 4V02A 4U7DA 2VSXA 3EZ6A 4US0R 1OH7A 2F1RA 3AF2A 1U8YA 3CRRA 3BFKA 4NYIR 4JBYA 4R7ZA 4EQ6B 2O8CA 4A0FA 2IX3A 4KBGA 2DFTA 3MGCA 2X8AA 1IBRA 2WOJA 1CRPA 1D6JA 4PTLA 4LYHA 1FNNA 1SXJD 2EFGA 3FDIA 4H1VA 3VU9B 3RWMB 1S4QA 1US8B 2WZQA 3GPLA 3LW7A 4FD2A 3OZXA 1U0LA 3QEOA 3IPYA 1K5DA 3QJYA 4M8NE 5JBQA 1UBFA 2FGKA 1XTRA 4PC6A 2G0NA 2A5FA 1Z6AA 1OIVA 3QQ5A 2EFEB 4MKHA 3EPHA 3O8DA 4TL8A 2ZQ5A 1NP6A 1QHHA 3FKSA 1NIPA 1R5OA 3IBGA 3JZMA 1ZD8A 4I1SA 5CLLA 2PX3A 4FN5A 1A82A 1RYFA 1XEXB 5JWHA 2EFHB 5JI3E 1SXJC 4DUGA 4DLSA 2YNMA 3GLGE 5EE3A 1IHUA 1ZM3A 4MRNA 5FH9A 2CLDX 3U3OA 3T15A 2D62A 2R6CA 3IEVA 4QGFA 2PT5A 1WF3A 4G5SA 3R8FA 1W36B 3FFAA 1YZGA 1IAQA 2ZUCA 4MGIR 1ZMXA 5KOYA 1FUKA 2MSDB 4MGKR 2WWGA 3PUWA 2G3YA 2IUSA 3ECCA 5CK5A 1N0VC 4TT3A 3TIFA 1XMJA 2XB4A 3QPWA 1P4SA 1VCNA 3ASZA 1X3SA 4RZ3A 1AKYA 4LRWA 4EQ6A 2J7KA 5C4GB 1XXHE 1CBUA 2P65A 4FCTA 4JYBA 5JJIA 1HE8B 3OFNA 221PA 2O0KA 1OKKA 2RGNA 3QF7A 4E03A 1BIFA 2V55B 4PHTA 2DCUA 1JXMA 3VU9A 1UPTA 4C9BA 2YOGA 2IYTA 1XJQA 4P0TA 3K0FA 2HXYA 2BM1A 1NI3A 2ZRNA 4OYHA 1EK0A 4AG5A 1NBME 2EWVA 2ZRMA 3KUCA 3OIYA 5BQ5A 1XRJA 4CEJB 1BH2A 1IN4A 5EE1A 1XCPA 4RD2A 5HZKA 2R6GA 5JJLA 1WA5A 1VDZA 3TQCA 4DT1A 4HATA 1I2MA 2ZI5A 2GTPA 3NBYC 4A4DA 3ZZ0A 3QUSA 4KVAA 1NY5A 1SHZA 2Q3MA 5DGXA 3TLXA 1CIPA 3CBQA 4B3GA 5EZ5A 2RGCA 5JFGA 3FKSD 1N6OA 4DIEA 4D2IA 2WPDA 3THXB 4I4LA 3OEHA 1NN0A 3RVBA 1BS1A 2EU8A 4OL0A 1VG9B 1VYUA 2BKEA 4KSBA 5HCNA 5P21A 5JWRA 1KSJA 5TV2A 1XEXA 5CDFE 2RAPA 5DHFA 4OI0A 5C1BA 3RSOA 2BDTA 5AR1A 2G1JA 4WZAE 3VHXA 1UADA 2GXAA 2AL7A 2AD1A 2UKDA 2W0MA 3DZ8A 2OSBA 4D4LA 1YZNA 1ZVQA 5KSPA 4HZUA 2J1LA 1G20E 2GCOB 3GJXC 5CK4A 4B34A 3FVQA 1Z0DA 4NYIQ 4JLJA 3GEIA 4FCVA 3GLGB 4GI7A 3C8UA 2NMVA 5IDVA 3KQNA 2HDNB 1W0JA 5FI1B 3B60A 2ONKA 2GEVA 4B6FA 1DARA 4X8HA 1YR8A 3C41J 2ZS9A 4TT3D 5AUQA 4POAA 3KQKA 1XPUA 1X86B 2VHTA 1MO5A 4WA7A 2PEYA 3W5IA 2OLJA 2IF0A 3BH6A 4LJ7A 1E0JA 4PC1A 2QTHA 2JLYA 2OXCA 3IIKA 3OFND 3T61A 1OKKD 1XD2A 4GMXA 1Q21A 2ZRLA 1QVRA 1TQ4A 4RKEA 4XSGA 1T0HB 1EWQA 3FWYA 4B3DA 3EC1A 2GZHA 1XXHB 3W8NA 1OXUA 3R20A 3QI2A 4BQSA 3QKSA 3NDPA 2BKUA 1RRGA 4IOKA 1YQTA 4N0EA 421PA 3LDAA 2V7QA 3AF3A 5CB6A 1YZKA 2G0TA 4TLDA 4YMUA 2R62A 4UKDA 2OESA 1E4YA 1ZD1A 3LX8A 3SN6A 4V0MA 1E69A 2FEOA 3KQLA 1U94A 1ZC3A 4LSGA 4ACAA 5AUOB 3GD7A 1LVGA 2OFXA 3SBEA 2WPDD 3THXA 4WIAA 1GZSA 4ZKEA 3EZ2A 3AF0A 3NC0C 4KFTA 1II0A 1YZTA 1Z6TA 3DEFA 2RGNC 2CXXA 4L9WA 1EFUA 5JHHB 3AGQA 3LH5A 1RRPA 3W3AA 4BFUA 1LF5A 1GUAA 3ADKA 4M9SA 4TMXA 2ZVQX 3TUJC 3ZD7A 4HI0E 1UBEA 2Q9BA 5H68A 1PJRA 2IEZA 4TN1A 2AR7A 1Q0UA 3GEHA 1E0SA 2EFDB 3RS2A 2VHQA 2XGJA 4KU4A 3LLUA 1T9HA 5FUYA 5SZJA 1OFTA 3FB4A 2GCOA 1L7VC 4NONA 4L9SA 2QSZA 3LWNA 1UEJA 5DSZA 5B30A 4F7WA 4I81A 2ZRAA 1W0JD 1FX0B 2IS2A 4YXWA 1NF3A 1VHTA 5JRZA 4PQFA 3JZAA 4WBSA 4XWAA 1CR2A 1XZPA 2JGNA 1ZUIA 3OESA 5KSYA 1FQKA 3ZDQA 4Q7KA 4FMDF 3L8YA 5IT5A 2RHDA 2IYXA 4PSKA 3OIVA 4PSVA 2AKYA 3VQTA 3KFXA 1GWNA 2VEDA 3HWSA 2LWIA 1E0AA 5IRCD 2XAUA 1YRBA 1NVVR 3BOSA 1ZU4A 3ZJYA 4DSOA 4G5OA 1VYTA 3UMSA 4DCTA 1TF7A 1X8JA 3MWJA 4UNSA 4AKHA 1SULA 4F93B 2O0HA 2WSMA 2F55A 4B71A 1XBTA 4UJ3A 1XPOA 1C1YA 1M7BA 1GITA 1E1QA 3WHKA 2VRWA 1AN0A 5HZHA 2AWOA 5JSZB 3TNFA 3MCAA 2ZI4A 3R7WA 1CR4A 2QPTA 1JBKA 2FZ4A 4IDPA 2V7QD 1R5NA 4YMVA 2GEDA 4Q4AB 2XB2A 2O8EB 4B33A 3BH0A 4HDQB 1DAIA 1COWA 1G21E 4BZQA 1LW7A 4B6EA 1KI1A 5A0FA 4RFSA 4HAYA 4BWYA 1Q22A 4TYPA 3B82A 4D0LB 4MDFA 4US1R 1WBBA 1WBDA 2CCKA 2JLXA 4Q9HA 1KNQA 1TNDA 3A1VA 4M9QA 4Q4HB 3CZPA 2C04A 2FU5C 5F9HA 1QRAA 2R8RA 4FMDB 5KNDA 1MABB 4JBWA 2ZAOA 5TY0A 2W6JA 1NNEA 2CCGA 2ZJOA 4Q4JB 1VECA 2QI9C 3KB2A 4JLOA 5FBQB 4JVSB 4EFMA 4Z8XA 3KJIA 5JECA 3UKDA 2QBYA 4A2QA 4JZKA 1ZUHA 3AVUA 2GJSA 3NBFA 2QMUA 4OBEA 4YXWD 1YZLA 3LFUA 3U7FB 2QRNA 2MMCA 2ZAMA 2GCPA 4P31A 4Q9KA 4IDQA 1GRQA 3DZDA 2XZLA 4GL2A 1FMLA 1IONA 1IY1A 4CF7A 1UAAA 2XSZA 2ONJA 2V1XA 4DLTA 2ZYUX 1VCOA 4NMMA 4Q7LA 4EPVA 2OLKA 4A0RA 5H1YA 3REGA 2QPOA 1W46A 3EAQA 4KYIB 3KKQA 1E1QD 3MD0A 2ZR7A 3L8ZA 4NPHA 3U6KA 1A7JA 4B48A 1KDPA 2OT3B 1ZU5A 1FNMA 2NGRA 3WY9A 3AP1A 4RSGA 3FPAA 3X1ZA 2WMOB 3QVUA 3S1AB 5TMPA 2V6JA 2QNRA 4H1UA 2FG5A 3PXGA 1RFLA 2H1LA 4Q4AA 4DLXA 4RCYA 3FMIA 1DVRA 2IHYA 3VKHA 1Z6GA 1COWD 1RRCA 1UKEA 3P20A 4IDOA 3F5FA 4KCGA 4MUAA 4UNQA 3NTUA 3W6OA 1E9DA 1UEIA 2V9PA 4Y0VA 3A1TA 3GMTA 2WIAA 4NZYA 1E9EA 4A1FA 4GZMA 2NO6A 2RGXA 3GLFE 5E7JA 5KYKA 1ZBDA 3SHFA 2VF8A 1Z8FA 2BWJA 3BERA 1Y63A 3DMNA 1VCMA 3KL4A 4RZXA 5J4KA 2R9VA 1P9NA 2W6JD 2ZJYA 3IIJA 1N6LA 3PUZA 4Q4JA 2WTUA 4TL7A 3KDSE 2A2ZA 4BFWA 1GILA 5F98A 3Q72A 1NN3A 2YWEA 4KJZA 5E95A 1NKSA 1J70A 1XTJA 4QBGB 1F48A 3LXRA 3Q7QA 3QKTA 1HY3A 1KHTA 3WXMA 3W6NA 2ZPTX 4UNRA 3A6PC 4U00A 4X8MA 1BO6A 2PCLA 1JXOA 4RD6A 4D81A 1MO4A 1NVVQ 1P72A 3A36A 2F3TA 4LHVA 4V03A 2WKQA 2IF2A 3UMRA 1HA3A 2ATXA 3CPEA 4ABYA 3CM0A 1EFRD 1GKYA 2C9OA 4M1MA 1EX7A 4MYTA 4OJKA 5FTKA 5CB8A 4TL6A 3CF0A 1K6MA 3QOFA 4M21A 4V0NA 2VSOA 1F6BA 3EA0A 1M74A 2LKCA 2XTNA 2XSZD 4PAOA 5DYGA 2JEOA 1CJMA 1P60A 4XH9B 5ELXA 3ZQJA 3K9HA 5BXQC 1OFHA 1T5LA 4PANA 4GDFA 1ZD9A 3OIWA 4AD8A 4TYQA 3WRYC 3B5JA 2I1VB 2NPIA 3FHOA 4QHSA 5B58C 2AK3A 1K8RA 1KDRA 2YYZA 1XMVA 1ZNYA 4NDZA 1KO7A 2YWGA 3I1FA 2GNOA 2FPKA 3E70C 5CYOA 3S1AA 5CIQA 1JPNA 4GOXA 5G53C 1IJEA 1KI3A 2QG6A 5TARA 1W4AA 1MKYA 1D2NA 2AXPA 1W47A 1YR9A 3I8SA 3VR1A 4CEHA 3TJZA 4XWOA 3L0OA 4G5GA 4LHZA 1QHNA 1VG8A 1T3HA 3CUEF 2J41A 3QENA 1SVIA 2VP2A 5KNBA 1UDXA 2JLSA 3PEVA 5LPNA 4TYNA 2ZVPX 2BJVA 4LJ9A 3D6TB 1AIPA 2QROA 3KXLA 1W48A 5GJCA 4GFDA 3PEWA 1SVWA 4P4SB 1FZQA 4PZYA 1ZNWA 3NWJA 4D0GA 2O0JA 5BYJA 5FTLA 4DDVA 5LD2B 2GETA 4ZDWA 4B3CA 3GLFB 1DG1G 4TYWA 4OJQA 5KUTA 3THWB 2ZE7A 1Z2CA 5DISB 4ERNA 1W4CA 1O87A 2ZRHA 4PC7A 3T1OA 2D2FA 2WHXA 1E32A 4HLUC 1OPXA 4W7SA 5EUQB 3VNVA 4K8OA 3UATA 4ASUA 1S9DA 4YDHB 4AKGA 4KFRA 2W83A 4PQYA 3EG5A 5E7IA 3NG1A 3M0EA 3AEZA 3WYAA 5B2ZA 4JKYA 2QP3A 4Q47A 3Q3JB 3PUYA 4Z1MA 1LS1A 2IYYA 2W58A 4WZBE 2EFCB 2PBRA 4I1OA 4CRWB 1E2FA 3ADDA 1OH6A 2WJIA 2NO0A 3V9PA 3QE0A 1OFUX 2OCYC 3EZ7A 2N46A 4AKEA 2B92A 2DWOA 1JR3E 4LYFA 3L43A 2MSCB 3NBXX 1CKEA 3X2SA 5B57C 5J4YA 4CDGA 4AY2A 1GKIA 1N0WA 1Z29A 2FPLA 1G7SA 3UPUA 1GTVA 2IEYA 1G3IA 5FTJA 4BECA 3HU2A 2GZDA 2HF8A 3A58B 2HCJB 3AKDA 2ANBA 2FWRA 1OB5A 2XXAB 1GSIA 3ZD6A 2O8FB 3KX2A 1FP6A 2QT1A 3QPVA 1PV4A 2CHVA 5IK2A 2X1VA 1W5SA 1HT1E 4WXPA 3FMOB 2CLCX 1Q1BA 1W1WA 2ZR0A 4DLZA 2QAGB 4JJZA 4JVLA 4HUTA 1G64A 4XD7A 4LBWA 4DWJA 1E9FA 3ADBA 2ZJZA 4BGDA 4MGZR 4J0QA 2C8VA 2RMKA 1GP2A 5KNCA 1G3QA 3K9LA 3SE0A 5C18A 4BEJA 2WJGA 1KI9A 3VR2A 3PQCA 2HT1A 4H9GA 1E6CA 1JR6A 4KLZA 3TSOA 2JCSA 3HDTA 1QZXA 5DI9A 3PITA 4PC2A 4JBXA 1XJ0A 1ZCAA 2AHOA 2IUTA 3ETLA 3TW8B 1UFQA 3X1DA 4LJ5A 4YLGA 4ASUD 2W6IA 3U4QB 3MJHA 3U3JA 1UKYA 1F2UA 1KI4A 3TH5A 1KO1A 2C9YA 1XEWY 1KMHB 4R9UC 2QAJA 3IO5A 3P4XA 1HV8A 1G41A 5BW8A 3QY0A 2CL7X 4RD4A 1G3UA 3A8TA 1OYWA 5C46F 3K53A 4Z1MD 1KY2A 4NCKA 2C9CA 1E3MA 4TWZA 1N3BA 3NC1C 3ADCA 1E2KA 3KTAB 4QJ5A 3BFXA 1A2BA 1DELA 2F1HA 4PPGA 3EPJA 2VL7A 2OBLA 4L5BA 4F92B 3ND9A 1N6RA 4B75A 4DLRA 2W0SA 1F2TA 1NLYA 4ARZB 4Q03A 2EQBA 4I99A 2MMGA 4M1KA 1VTKA 2GF0A 2Q3HA 3TR5A 1RJ9B 3VTKA 1XTKA 3CWQA 2UZ3A 2O8DB 1Q44A 2ERXA 2CJWB 3CH5A 1IN7A 3LW8A 3MSXA 4NHOA 2GAAA 2FA9A 2HUPA 4DBLC 4LDJA 5FPHA 1NY6A 4DSUA 2AK2A 3GLIE 3L0SA 3Q9LA 2XXAA 2J0SA 1NG1A 3CX7A 5IK2D 2ZI7A 1CF4A 3BB3A 4PR0A 1J7KA 4HAWA 1OE0A 1QG4A 3VAAA 4DB2A 3EARA 2F43B 3AB3A 4XD7D 2ZREA 3MMPA 2H17A 1XP8A 2HYDA 2ZYVX 1R7RA 2ZEJA 3EXAA 4LBVA 1JI0A 1U0HC 2GA8A 2A5GA 4QC2A 3MUFA 1NVUQ 2DY1A 1W0KD 4OK3A 2ZRGA 5CJ2A 3D3QA 5KPDA 4RFSB 3K0EA 2DWPA 2W6ID 3DDCA 3F3YA 2WWFA 2KE5A 2GWHA 1S0UA 2J7PA 1F60A 3ZYCA 3CPHA 3B8HA 5L3SA 1T3SA 5EUMA 2FV8A 3NVAA 3QBVA 721PA 1R5BA 1Z22A 2G88A 1KI6A 2Z4RA 2KWIA 3C16C 3FE2A 5JHGB 1ZC4A 3KTAA 3U3KA 2J87A 3NXSA 5G3YA 4JMPA 3X1YA 5LD2C 4IOJA 1IXZA 1TEXA 1TX4B 3W6PA 2OUKA 1BMFA 2JAQA 4TZ6A 2ZI9A 3CO5A 2DFKB 4E5UA 4O3MA 4N3NA 4PZLA 3AV0B 2F6RA 4O2RA 4FMCB 2C95A 1E2GA 1NN1A 4MDEA 2OXRA 3ICQB 4HB4A 3FHTA 2QQEA 2C99A 2O8DA 1ZUNB 5DI3B 1JR3A 2CJWA 1TPZA 3AGPA 3QXXA 1IQPA 3LAWA 5LB4A 3Q5EA 3LO5A 4Q9JA 2G9NA 4OHXA 4TQUS 4PPFA 4ZV4A 1Z6XA 1N0UA 3K0AB 5J4VA 1BKDR 5DH9A 2NZ8A 2VIIA 2XZOA 4M1TA 1OHHA 2ZUDA 3CZQA 1Z6YA 1ETUA 2P6UA 1JQLB 2FE4A 3CNNA 1II9A 2RGBA 3BORA 1E2IA 3X1WA 3T1QA 1UJ2A 4IFEA 3TUIC 1GNRA 3VNUA 3E2IA 3QIAA 2ORVA 2E9SA 4IOLA 2ATVA 1NG9A 1US8A 2Q0HA 4KHZA 3C5HA 2FFHA 4L8GA 2DFLA 3OEEA 3KJEA 2HEIA 1OT3A 3B7GA 4N1AA 4B44A 1NJFA 2IYLD 4TZ0A 2BC9A 4JYCA 3CF6R 1KAOA 3QKUA 1G8FA 2PZFA 3RC3A 1ESNA 2J7PD 4NU0A 1KMQA 1U8ZA 2FEMA 3SC3A 1W44A 1CU1A 1M8PA 1DAKA 3BK7A 4KODA 4G5QA 2PLRA 3RRNA 4PPNA 3K9NA 6Q21A 1KNXA 1G1MA 1U9IA 4AWXA 5AWFC 2OAP1 3O8CA 3B9PA 1BMFD 2Q9CA 3HU3A 3NH9A 2WJHA 3MJRA 4D4JA 3EIHA 4KAXA 2RCNA 5BYKA 1ZIOA 5FFMA 4HDOB 3ZIAD 2XEXA 1VCIA 1W2HA 3SYNA 1RYHA 3G0HA 1Q1ZA 2UVQA 1NMXA 1X6VA 1JR3D 2CLSA 4GRAA 3EASA 2REOA 4RY2A 3T1VA 1I4LD 4Q1CA 3W9YA 2GXQA 3KKMA 5CM8B 3BJIC 2AXNA 4DKXA 1G4UR 1DAMA 4XSHA 2HCBA 1LNZA 2QY9A 2IYSA 3K8YA 1IY0A 5JCZA 3QF4B 2WKRA 3K0AA 2P6NA 1V43A 2RGDA 2AD5A 1ZM4A 1OHHD 1XD9A 4W5JA 3AVPA 2XNSA 4LBYA 4QBFA 2NQ2C 2XJ4A 1OIXA 1XFAA 4F4CA 2BBWA 2NPFA 5EJEA 4HB3A 1TMKA 4OI4A 3AF1A 5F2EA 5AUPB 1XCMA 3PEYA 3PENA 4YDSA 4HYYA 2Q9AA 4TMTA 1YVDA 1R0ZA 3SS8A 1R10A 4PAQA 4OI1A 2VYFA 3OEED 1E2HA 4BLOA 1OXXK 4A36A 4CEJA 2DB3A 3BIFA 1KY3A 3CONA 1N5IA 3P27A 4MGYR 5DHAA 4B35A 4PX9A 4XOIA 2AKAB 5L3QB 1O3YA 4LOAA 3AUYA 5AK0A 2A9KA 2ZITA 4DB4A 2CHQA 1E2EA 1QHSA 2CE7A 2W2VA 2PZGA 3EWSA 2G6BA 3HR8A 4P33A 3K0SA 1PUIA 3BE4A 1S3GA 2GEUA 2IS6A 1KO4A 2GF9A 2O8BB 3GLHE 1XCGB 1P7CA 1KSFX 3JVUA 4NYMR 4D26A 5FTMA 1KTVA 3Q8XB 3D7MA 2OEPA 4II7A 3QG1A 4DHEA 4PXAA 1GOTA 4DCSA 4CEIB 2Z6VA 2BBSA 1QG2A 2Y8EA 4R2HA 1AGRA 3SR0A 4EPWA 1M2OB 4IKEA 1AQUA 4IEIA 2BV3A 4Q7MB 4PHFA 1W36D 3AVQA 2XNDA 5JJKA 5K8UA 3GLGA 1P61B 3H0KA 5AJYA 2QTVB 3P4YA 2B7CA 3IQXA 5UKDA 1GM5A 2OBMA 2D74A 2QP9X 3CX6A 4HEJA 4JJKA 1D9XA 2WV9A 3EX7C 3QF4A 3MWKA 5JLJA 1UF9A 2VP4A 2B8WA 4KITB 2A7QA 3SYLA 4HZIA 4BLPA 3RRZA 5K8TA 5JEEA 1JJVA 4Q7JB 1Q20A 4LPKA 1U9IC 2WICA 5J5CA 4JLVA 1UKZA 4QG7A 5FOXA 4NP6A 1UKVY 5JRJA 3RAPR 4US2R 3DKPA 2J46A 4NCIA 4D0NA 4U5XA 4GBMA 4NL4H 5GVRA 3B1XA 1XXHA 1W36C 4TLCA 1B0UA 1P6XA 4BFZA 1B23P 4GP6A 1Z47A 4A8JB 4BLSA 2IS1A 1DOAA 4I1VA 3BWDD 1W2GA 3TAUA 1ZAKA 3FKQA 2IK8A 3F0TA 4ACBA 2BIFA 1Y3AA 3VFDA 1PVOA 3RHFA 3TK1A 1N6NA 5L3QA 2ZU6A 3HPQA 3QXJA 2WWWA 3B1ZA 3K1JA 2DFNA 3ZH9B 2ZSBA 4BFTA 3TKLA 3UANA 1NJGA 2FJUA 1NBMA 3U7HB 2BBTA 4M9XA 1AKEA 5DO9A 4C0KA 4M1OA 2VHUA 3SOPA 4AC9A 2O8BA 4PO1A 3G82C 5FI0B 3PVSA 4LK2A 3TMKA 3CNLA 3T1TA 1JALA 3QSYA 2B7BA 2W2TA 1MH1A 3UMFA 1YZUA 1XF9A 3IHLA 3LNCA 4OQFA 4A2WA 1NSTA 3PG5A 2VH5R 2YJTD 4B32A 3GJ0A 2VHCA 1CLUA 1P75A 1BOFA 1WDTA 3CPJB 5FBLB 4HDCA 2Z4SA 3A1SA 4P3YA 2RHMA 2X2FA 2ZTSA 4UNNA 1AGPA 2B6HA 3DHWC 5J4HA 5CDFA 2R2AA 4AIIA 1Z83A 2FOLA 3IKJA 4QBIA 4A92A 1DAEA 1HQCA 2XNDD 3P26A 2PMKA 1L4UA 4PC3A 2H57A 1XZQA 1JEEA 1FX0A 1XTSA 4Q1AA 2CDNA 1TU3A 3JVVA 2NO9A 4LHXA 1U99A 3AKCA 4CZ2A 2HF9A 3PCRB 2JLZA 1P2SA 1CULC 1EFRA 1XTQA 4B2IA 3SQWA 2Z43A 4EPXA 1ANKA 1NVWQ 2AFIE 2PJZA 2J45A 2F1JA 2E1RA 5C4MA 1DS6A 1E2PA 5DNYB 4B47A 5KTYA 3BS4A 1KJZA 3QKRB 2YINC 1U90A 4Q9LA 4YONB 3ZVNA 3V4FA 1G8HA 1EFTA 3KQHA 1R8SA 3AKEA 1ZCBA 2EVWX 1C4OA 1KO5A 3PR1A 5GVSA 1E9RA 1J2JA 4A8JA 2I1QA 5JSZA 2FH5B 4M9ZA 3OF5A 4KFSA 2JLUA 1OH8A 4C0JA 4NYMQ 2IYUA 4URYR 1PLKA 1GDDA 4JLKA 1TTTA 3BBPA 1G18A 3PV0A 4BPBA 4IOMA 2O8EA 1WRBA 1NBMD 4XVUA 2P2LA 4LWZA 4UXIA 3A1WA 2QMEA 4NCJA 3RLFA 3REFA 1NKTA 1T6NA 3PEUA 4HLUA 2ZE5A 1DO2A 1KI8A 2ZIAA 3CH4B 1MT0A 3CRW1 3QVVA 2CNWA 4FXPA 1Q1QA 4QRHA 1Z63A 1UBCA 4K81B 4QGHA 3AVYA 3VKGA 2RH5A 4ZI2A 2BMDA 2D4HA 3L0PA 5FPSA 3RC8A 4Q4HA 2J9RA 4QKQA 3TR0A 1TF2A 3AVWA 4S2EA 2GXSA 1PLLA 1IM2A 1MABA 2ORWA 1DPFA 4NBSA 3ICEA 1E2DA 3HYTA 3QPUA 5FBRB 621PA 3QNUA 5LB2A 4DIDA 2J0QA 5JS8A 1XX6A 4JVMA 3DM9B 1AZTA 1OJLA 3GFPA 5SZKB 1EFCA 3LQRA 121PA 2J0UB 2RB4A 4IDHA 1TL7C 4X8LA 4FINA 3CB4A 4HAZA 4PZZA 1Q3HA 2N1BA 3B13B 2AFHE 5EP1A 1G5TA 1PUJA 1ZJ6A 2QE7A 5SZIA 1WQ1R 1RPZA 1EXMA 2ODEA 4DDUA 3GJ3A 1AJEA 2PL3A 1U8AA 3AH8A 1NN5A 4IFBA
chains in the Genus database with same CATH superfamily
3CRQA 3HJFA 4MW5A 2TMGA 2JFZA 4RCZA 1PIWA 4IPTA 1EX6A 1SHJA 4MZXA 1ZK2A 1V6AA 2YIDA 3L5KA 1N1MA 2JFWA 2BSXA 1P0FA 1SNYA 4V2IA 1F1JA 1Y6JA 2VBCA 2XODA 4HAVA 5F9FA 4EUHA 1MJFA 1V71A 4K40A 3W8EA 3INYA 3MJSA 2R5NA 5DLQC 4U63A 1JQJC 3GLQA 1HF3A 3HLYA 1VHLA 2CHGA 3OIGA 3AUFA 1S2OA 1I3CA 4HWSA 1UJNA 3KOUA 3BB1A 3QV2A 1CF2O 1RXIA 1Z4JA 2Q3BA 4L85A 1BVYF 5T57A 4EEZA 3TFQA 3NBZC 3RKUA 1A8IA 3HCDA 3JR3A 5HTKA 1ND6A 5FLXA 1S7GA 5EXPA 3I6BA 1TIPA 5A1TA 1FFYA 1NP7A 2GOYA 1J99A 2V54A 2B2NA 4C6RA 2Y6VA 4TVOA 3UV6A 4A0HA 2Q4EA 2P5UA 1UZLA 3ZBPA 4BVKA 2BL4A 4HJRA 1EK1A 1HXHA 3KWMA 3WTBA 5KDLA 2O9JA 3MMNA 4TWBA 1DAPA 5K6RA 3W0LB 4B85A 1G21A 5BWMA 2QU8A 4E51A 1KC3A 1RBMA 2P9ZA 4BN0A 1W49A 4C0SA 1BZYA 3HDVA 1EUDA 3W78A 4C0LA 3AHEA 1XCLA 3VVLA 2LV8A 2NVWA 3VAYA 2D13A 4YT4A 1GUDA 5BW5A 2QVYX 1XNRB 1JFFA 3RAEC 1B1AA 3U6BA 1RLOA 3BPSA 4WLOA 5BN4A 2QM7A 1Q2XA 1LPSA 2P41A 4ALKA 4TGLA 5FRDA 1XE3A 1Y82A 1S1MA 3LBNA 3MGBA 5LWHA 4HY3A 5DM60 5CNKA 1ENOA 2R3SA 5JZMA 2NU6A 2FW9A 4CMGA 2GBCA 1G9XA 2UYGA 3KKNA 4LJSA 3UA3A 2IS4A 1DFGA 2IZZA 2YV3A 1DCMA 4UE3S 4JP3A 2ZRCA 1UC9A 4Y7CA 1JKMA 4DABA 1WVMA 4FX5A 3C3WA 1GXSA 3MOGA 4RMHA 4UMVA 3U4DA 4MUMA 4MEAA 4BZXA 1G8PA 1XAHA 2OKCA 4IS3A 4EVIA 1FJGB 1R4ZA 2IXTA 4E2YA 4LXHA 4Y0AA 3VMFA 3WKEA 4FNGA 4RTLA 2CXTA 2FPXA 5AI6A 5BSUA 2OXEA 3QWAA 1L2TA 2WWRA 3PQ5A 4EFNA 4F38A 1VIDA 3OLZA 1G8YA 4O08A 4U2BA 2WUWE 4YQZA 1EX1A 1FYXA 3IPXA 1JJBA 5AW3A 1MRNA 5FYQA 1QQTA 4KFUA 4NAHA 3T9DA 4JLDA 3CEHA 2JGDB 4W8GA 1WB9A 1GNQA 2QA5A 1EFHA 1I80A 4JYAB 3DUFB 3IQZA 3JCZA 3JZIA 2W4MA 4OYYA 2OCIA 5JXGA 5K8CA 2JJ2D 1GQOA 4P4TA 2AJBA 3QXSA 2JHGA 3EE6A 3GDWA 5DF1A 3HO6A 4OAQA 1MOQA 4F5ZA 5J4LA 1F0NA 3T7RA 3A9WA 1SUBA 4Z9FA 3C7TA 4UPVA 2PS3A 3JQFC 1BX1A 3Q7IA 3ZX5A 4LEIA 1YB7A 2FMHA 2H7VA 3DT9A 2B8JA 1U7PA 1BW9A 2FPIA 3S2FA 3EYWA 4DLKA 1Q77A 3EPLA 1H6DA 3FUUA 2PT7A 3TI7A 1JHPA 1P9OA 2FP4A 4MSUA 3ORSA 4I55B 1E2JA 3I6IA 3KQSA 4FCWA 2AVDA 4Q9AA 4MQUA 1DBRA 5KAMA 4E5YA 4DPKA 1UANA 4GQBA 2Z56A 1BTOA 3MIZA 3PJRA 2G83A 3IV9A 1M34E 1Z37A 4P4SA 3TSCA 4EKDA 3GLUA 2ZRIA 3A4IA 5M5BA 1IHPA 1F0YA 3GARA 2FSHA 3DSRA 3EFHA 4G1FA 4QGSA 1KZ7B 3GDGA 1QANA 2BE7A 1QZ3A 2GPNA 2QLMA 3OU6A 3Q98A 2UUOA 3ZCVA 2CSUA 2H8GA 1TVCA 1DQRA 3AIKA 3NJ4A 1W0KA 4IHJF 4ZGGA 2SECE 4JSYA 1Y1TA 4KPGA 4NCNA 1TYZA 1I5EA 1LDNA 3VR5A 4TT8A 1JBEA 2EJBA 2G80A 3ZCXA 3N58A 3Q2IA 2YHBA 4FEYA 4MV9A 5DTQA 3ZU3A 2NSDA 3FX2A 5IH3A 3EC2A 2HLDA 2DQKA 3MWLA 2YTZA 3DVLA 4Z7OB 3KJXA 4E2ZA 4D80A 1C81A 1QFZA 5B53A 1ZBQA 4DRZA 2AFHA 3A7EA 1VPEA 5AVXA 3U44B 5ALDA 2BGUA 5KOHA 1DGQA 2BFDA 2OG1A 3KXKA 3H4TA 3I34X 3BF7A 4B3JA 4P2BA 1ISPA 1LH0A 3HL0A 3R5XA 4Y2HA 2NSLA 4XRGA 2H18A 2XUAA 4G0ZA 5JSFA 4GMKA 4DIUA 1NI4A 3A6LA 1JT9A 1WJGA 3FZYA 5DCWA 1EESA 3FRJA 3HEAA 2A4KA 4KQWA 1NRXA 2PH1A 3JU3A 3THOA 3I76A 5AVSA 4A2PA 5JANA 1DWOA 1OV4A 2A1UB 1DTSA 2O1SA 3GNQA 3BZBA 1D09A 2Z8YM 3C1TA 1IQRA 1NBWB 1ZM2A 2JJ1D 4D8UA 2NO5A 1E1CB 3L7IA 4V38A 4QREA 3V4ZA 2WVJA 1E1MA 1K7CA 4YPOA 2UU9B 5F23A 2D1YA 4NBTA 1YBVA 3K0CC 1RP1A 2FUNB 2BMJA 3EGOA 1MG0A 1S9HA 1E1RA 5IMSA 2Y9PB 3HDQA 3RTCA 3BGOS 4R7GA 2HBQA 4IWYA 4BB6A 3NKFA 4BLQA 2O8FA 4J7AA 2W22A 1TZKA 1M7HA 2SKCA 4BN4A 4C1BA 4EY4A 5FB3A 1TZCA 5CA0F 2RAUA 2H0QA 3BL6A 2I1LA 3QELA 3GEEA 4IDEA 4V0KA 2QUKA 4RDCA 2PKRA 3CEPB 2ANCA 5J2TB 5ENVA 1CJTC 5F35A 3Q8WA 5ALNA 4AN1A 3EDOA 1VIAA 4C05A 4DM4A 3G7NA 5HZGA 3SJCA 4F2HA 1FIUA 2GESA 3OKFA 4FHZA 4D74A 4OQNA 5DNVA 2VSFA 3O0TA 1ZI9A 1MB2A 3DLTA 1BX0A 1QQAA 2HMTA 4JLNA 1LFDB 3GPCA 3PWZA 5ENZA 1MBZA 3H5WA 4J7XA 5HX7A 5EKTA 4W82A 2WUFA 2XCUA 1VG0B 2ASVA 3I9FA 3QVSA 5BVGB 1B00A 3OIFA 1EFDN 3W3ZB 3OOHA 2MHCA 2VNKA 2R6FA 1K86A 4ALLA 2A1TR 3DHYA 4YASA 1FDVA 4FQ5A 1RWNA 1KMHA 3RABA 4MRVA 1JEQB 5FPYA 3T0IA 4ZCLA 3W4KA 3VZCA 2REBA 1BWPA 1FU8A 2GH1A 4TV9B 4DSTA 2VQSA 1NL3A 3L4JA 1ZK3A 3GRVA 3R0XA 1A7AA 4Q18A 4OK6A 1Y3CE 3EC7A 4WAUA 1ZESA 3SEZA 3ROMA 4OQQA 2VI5A 1ZM7A 2E55A 4M1WA 2OCKA 1PYDA 1O8BA 1R0YA 5CA0B 2WYIA 4LNUA 5CDSA 2VZ8A 2XRMA 1UC5B 3IDOA 3ZBQA 1H66A 4PBRA 1LTQA 4XKJA 1VKOA 4WZBA 2ZWMA 1ICEA 1WUIS 4EJSA 3EVNA 1TD1A 3L6RA 2DUUA 4BKRA 5AI0A 3LCUA 3ZIAA 2X0IA 3NB0A 1JJFA 4IFIA 5E0KB 1EDDA 3BICA 4M1QA 1VGQA 1J49A 3HZZA 3Q6IA 1P74A 3UG7A 4JYZA 4TQAA 1SCDA 2I6GA 5B2EA 4KQEA 1UMBB 1XG5A 4RTJA 1QTQA 2CXUA 3BXZA 2IDJA 5DRTA 3F5MA 3IQWA 5B36A 2PBZA 1DI0A 1P9RA 3PTLA 1XL0A 2B1RA 1DO0A 1X8LA 2C84A 3GAMA 4MVJP 3DYVA 2IHBA 3M4XA 4YMWA 4MWDA 2A30A 2IA5A 1U1GA 4B73A 3LIPA 5EQJB 4ZCIA 4JBNA 4OUDB 4BXOB 2KHZA 3DMGA 1KTIA 1MJ5A 2GWRA 4B2LA 1HNXB 2VPWA 1EG7A 3IXLA 4OLHA 4DIBA 7MDHA 4CTMA 2RSLA 4O2AB 3TB4A 2VQ6A 3AJRA 4QNRA 3NDBB 3H19A 4KLRA 4WN9A 4UQOA 3HGTA 2PFKA 1BXRB 4K9PA 1M34A 3DJFA 2BHRA 5BMVA 3BRQA 2HDOA 3RYIA 2YV2A 1TQ6A 3KEMA 4QDXA 1E20A 4NCHA 4EM6A 1LFAA 4MV5A 5JH7F 4R3UC 4CM6A 3IR7A 3PXUA 4LRYA 3DBIA 1WETA 3SFTA 3K6JA 1KQ3A 4HLQB 4N65A 5ALPA 3VR0A 4YRZA 2ZIGA 4P8RA 1T5HX 3TLAA 2BFOA 2JGRA 3PJEA 3M1AA 1CT9A 4L3VA 3VDQA 2V7UA 4O8ZA 3UH1A 5KTSA 3OCYA 3SDZA 3DOUA 3ZS9A 1GPMA 1SZDA 2F7SA 3IP7A 2BM0A 3M6AA 1C9MA 5DWDA 4EMUA 2F59A 2ZYGA 3DB2A 3BQNB 1KI2A 2AOTA 2OV1A 1ZRMA 2FNAA 2OFWA 4G65A 3M81A 4B8ZA 4AJLA 2R25B 2BHNA 1QFJA 4B43A 1EP3B 4QXAA 2O7SA 4DC0A 1EU1A 2N1MA 2ODBA 4ZMSA 3IJEB 1OY1A 4QD3A 4II2A 2D1RA 4NCXA 1TRKA 2DR0A 4UATA 4LHWA 5DHQA 1FQWA 5JS6A 2ZYRA 3I9V1 1KAGA 3BMCA 2P4UA 4PM4A 1J8MF 4R0NA 1ZNZA 3RRXA 2HPZA 4MI1A 3WTCA 1T5BA 5L7TA 1CJBA 1HE5A 3O92A 1YS9A 4PQRA 5CCEA 3ELDA 3EEIA 4ILKA 3VHLB 3THYB 4NBUA 1BA2A 3P9KA 5EMMA 1LC0A 2R97A 3M9WA 4UZSA 3WNZA 4EG1A 1D9ZA 1FK8A 4HWKA 2FR8C 1LS6A 4DUGD 3KQMA 3D7RA 4MW9A 2G4LA 3I58A 4BJ5A 3JARA 3KV1A 4QPPA 2IY8A 3K4QA 1DB3A 4Q3BA 5DE3A 1L3CA 3EEFA 3CLVA 2EXXA 1X3LA 1CUIA 3DTTA 3FMFA 4G37A 5CEJA 1CVIA 4DMUB 4NV0A 3I5YA 3TFWA 3MRSA 2D0DA 4RA6B 4PYIA 1QOZA 2QN3A 4MB6A 1SOMA 1DAHA 2VG8A 2EX0A 2PUJA 4A6XA 4RE6A 2WW8A 3HCNA 2Y1GA 1SCBA 2WWTA 3E9MA 3IJ5A 4KKVA 2P7IA 1OREA 2YMMA 4YACA 3ER8A 4DLLA 2Q9UA 1E7QA 2VPYA 4MVJM 5F33A 2H9AA 2QZ4A 1JHMA 1NLZA 4JI7B 1KE2A 2JK1A 1WDKA 2QRPA 1Z0SA 2LVBA 2G28A 1PRYA 5IHPA 4D4KA 4DV2B 2JFPA 3OE7D 1UOQA 4OSEA 4ZIRB 1N7GA 2YMPA 2I65A 1FYDA 1T15A 1PF7E 1TZJA 2HA4A 2O7RA 1OXSC 5EXXA 4BVLA 3I42A 2QOEA 5KREA 3PIRA 3TE6A 4W5OA 1NURA 2Y77A 2OM2A 1P2GA 4BUZA 4OMUA 4RGYA 3II6X 2QQFA 5AM4A 1GN9A 5AOBA 1YGPA 1GNPA 2HJGA 5JVDA 4B84A 2G9VA 5SY9A 3TIXB 4OB7A 4EDHA 2FMKA 5CGZA 1Z18A 4GPD1 3ZU5A 4ONEA 2JFNA 3DOJA 1JPUA 3TN7A 4EUKA 1YFLA 1CDDA 1KZ1A 4OQYA 2JA1A 3BMNB 3AEYA 2M1XA 3ER6A 3FRHA 4O25A 4BRWA 2GBPA 4HVCA 1GKLA 3H9QA 9MHTA 3JQDA 1TA4A 1CS4C 3VR6A 3CA8A 3S5JA 3NPAA 1AA9A 4QFMA 2G09A 2XCQA 2GD1O 1T0IA 2AN3A 2PYDA 1WMDA 2X6TA 2QL7A 2AOXA 3EXHC 1Z2NX 1LU9A 4ZZ0A 2PMWB 4QHTA 4RFSB 7YASA 2QUHA 1XEFA 4JKIA 5AVVA 1XZJA 2GKSA 1KL7A 1UK7A 2ZVDA 3QUBA 5KJ6A 4ICIA 2FWJA 2JI6A 2Q1TA 3DOOA 1YRAA 3ZWPA 1PQUA 4NTZA 3SX2A 1MF7A 1YRYE 2WUDA 1KJ8A 2YN2A 3M1YA 4AJ1A 5B12A 1WXDA 4TS1A 3BYZA 1JG3A 2DJIA 4FC7A 3L2OB 5IM4F 3CLKA 4X1KB 4KR6A 5ALLA 3AFHA 3FPFA 3LBFA 4RF3A 1ULTA 1MB9A 5TXGA 3K6SA 2WSSA 1T2DA 2D0PB 3MD9A 3ICWA 4HH1A 1P0CA 1SQ0A 1X7WA 4S1WA 5IFKA 5JTUA 1ORDA 5B64A 2XD4A 2VLIA 3DAPA 3GW8A 3IEUA 4MV6A 3IKMB 4L6IA 3DKVA 4RYLA 3TXXA 1Y34E 1RAAA 2WT9A 1NNEA 2JIRA 3DZFA 2JLAA 4GLBA 4ODIA 2A3NA 2JFOA 1A88A 2XYGA 3D5TA 1QDEA 3QNWA 3CLTC 4GUAA 4HS9A 2G36A 4LZJA 2GK3A 1PLJA 1USIA 2XUDA 4JP5A 4KXYA 5FA8A 1R0WA 4G8BA 1ECGA 3FDJA 4HUJA 4EHAA 3D0KA 1MB4A 1QB7A 4D9IA 1V5GA 1NMZA 2OHGA 3S2EA 2ZIEA 3KB8A 3LZCA 4B0OA 3I28A 3HA2A 2QYOA 4IG9A 4YFVA 4BFYA 3PUIA 4CODB 2ID9A 6ADHA 4WFKA 4PYNA 5IX8A 2X5OA 4WT7A 1CEEA 4IIJF 3BIXA 5IH7A 1NI5A 1PT9A 4MV3A 2NT3A 4OP3A 3VGJA 3F73A 4G4IA 4L3WA 4BFSA 2DXIA 2A78A 3WMEA 3NAGA 3OEWA 2CVFA 2YXDA 3O2QB 4H0NA 2ETXA 4MPJA 3KYDB 1LWNA 1H23A 1QQ7A 1YA8A 1MHTA 1KSHA 2PMFA 2E4WA 3GLHB 3B3FA 3M89A 4J07A 3R8CA 4QXQA 6GPBA 2OD2A 1SCQA 4YJHA 1DRVA 5K3BA 5DHTA 2HAEA 1U2ZA 4C21A 1E9BA 3JQGA 4TRRA 1X0VA 4MUFA 3WR5A 1SUWA 1X14A 2FPOA 2V4ZA 3JY6A 4UTVA 4WGFA 5H3HA 5ES4B 4K9NA 1SKYE 1G3MA 3IDAA 1XVTA 1KJYA 3F6CA 2YZ2A 3F49S 3I9MA 3IUBA 3JYQA 3MYRA 4MCJA 1T0JB 3V5NA 1W6UA 3WNCA 1PT8A 4ZOAA 3WLAA 3KDPA 2QXYA 5AT1A 3BWCA 3O4HA 4NYJQ 4O4IF 3PFIA 1NBOA 2EDAA 2YFYA 3INRA 1RACA 2XIQA 4J1TC 5CVVA 1XF1A 3W3AD 1P0MA 1L8AA 1J20A 5DYIA 2CFRA 3Q3GE 4OA5A 5F4BA 1ADFA 2EP7A 4RETA 3GFOA 3OOYA 1KKMA 4EG8A 5FEMA 1ACMA 1WB4A 2HK9A 3JQ9C 2P9CA 5BR4A 3EJWA 1I2CA 4IIGA 4XUGB 2YY6A 2JB9A 2JKZA 2UZ4A 1L7QA 3SMVA 5MGNA 4EUEA 4ENTA 3WKCA 2X4IA 1MO3A 1UBGA 1DU4A 3RU2A 2I76A 1LC3A 4IIJB 1U3WA 1CUAA 1LK5A 5GPBA 3VDMA 4CMJA 1IUPA 3EGWA 3BXPA 3W1WA 2QN6A 5AUNB 4JC8A 5F1PA 1R4NB 5H02A 1DHTA 1TM1E 3ZCRA 1OXBB 4J0IA 4JCCA 4PRKA 5E6SB 5K8LA 1TO1E 4I08A 3RF7A 1CERA 4HYEA 3GFQA 4FDAA 4MTCA 2R44A 1Z5GA 3MCWA 4IIDA 3W2IA 4CM8B 4HSEA 4L16A 5ER9A 1GZVA 1UIRA 3ICVA 4DFDA 1N5KA 1DKRA 1FTWA 1GTG1 5LUBA 4ZJYA 4IHAA 4WNYA 5IULC 4FBLA 4IUCS 4MR7B 1ULSA 1HE3A 1O94A 1R3UA 4LC9A 3P1JA 1QIJA 4ERXA 1IE3A 5K0SA 3R5SA 1P9WA 5HUQA 5HA5A 3UA4A 1TVMA 1VOTA 2BCJQ 3H8SA 4L4UA 4RZUA 3R9KA 1YA6A 2IYZA 1QIMA 1JNXX 4BV3A 1DG9A 1M1YB 4IIYA 2QQ0A 4QO8A 1ZNXA 3BXFA 3DKKA 4IJUA 4BFVA 4CF3A 3DZKA 4Q1DA 3T8YA 2KB0A 1YHNA 3EPPA 3G13A 2OZKA 4R68A 4GRDA 1JJAA 1Z7WA 3AVVA 5KQRA 4DV6B 2WBLC 4EIWA 2LKDA 3CT4A 4PFSA 4S1TA 4QHYA 3L6DA 4TTPA 5GM2A 3AVTA 2Z3ZA 3BA6A 1RYDA 4JEIA 3TPCA 1YQEA 1WIWA 5IZCC 1D4OA 5EP4A 4WLEA 1E2NA 2DR3A 1VE6A 1V39A 5IDWA 2WIBA 1NM5C 2FGJA 1YHYA 4FS8A 4L74A 3ZWKA 1P19A 1GG2A 1IQUA 2JW5A 1OU0A 3GGPA 4G4JA 1RCTE 1UK8A 3BFPA 2NOAA 3VBEA 4JCOA 3E0XA 2H2DA 3PR3A 3CVOA 1M0WA 3EN0A 3R3XA 4Y2QA 5ALVA 5COBA 4M9CA 1QLJA 4RV5A 3LGXA 5KDDA 4CMKA 4JV5B 1SD2A 3CBGA 3GRAA 4GBED 1SXJE 2AHRA 4I6EA 2ZROA 5JAIA 1PUXA 1U2GC 4UXHA 2I4TA 1A04A 3PVCA 5ANRB 2VNHA 3A26A 3ELWA 1PJCA 4JLPA 4O3FA 3L7KA 3HCEA 5GY7A 3IERA 3TD2A 3TRJA 4BBJA 2P6OA 2ODWA 2OHIA 4WLNA 3R3SA 5CYPA 3P2EA 5G0TA 5LIRA 2PS0A 1HBJA 1Z06A 4FUTA 3FSRA 4UPDA 1E9VA 4RPKA 3SSMA 1W59A 1COZA 2JIZA 4O5OA 4DPLA 3KXPA 5FL7D 4GM1A 5KINB 3T5AA 2G1UA 4CM4B 2EOAA 5K3AA 4WOJA 1ZH8A 1M7GA 4C6TB 4ZMRA 5C4IA 1AQNA 2ATEA 3KKPA 2GZSA 4WGGA 3RB8A 2Q2NA 3M4JA 4RIFA 2J33A 2JI8A 2HU2A 4OH1A 2ISCA 5C81A 4O2LA 3WGGA 1XNGA 3UJDA 3CX8A 3FKJA 3UXMA 1M8GA 4MYDA 4JI6B 5K0TA 4GC5A 2X76A 4C0XA 1S1CA 4G2TA 2GEJA 2Z1NA 3ZWVA 3H3JA 4A23A 2ZJ4A 3H84A 3ZHVA 2IYFA 3B36A 4DLWA 2PH3A 2W43A 2VH1A 4QSHA 2WHPA 2HH9A 4Z3DA 1LZLA 1C9KA 2IY9A 1ISSA 1IJBA 4KR0A 2ZTVA 3E1SA 1KDOA 4JDPA 3ZNOA 4OX9B 1EP9A 5DNUA 1F3OA 1RI4A 3UMYA 2PX5A 2K2QB 2QUBA 4W99A 4PCAA 1QRRA 3CGGA 2R48A 3D6MA 4OV6B 1AX9A 3WB0A 4BV8A 2QDXA 4QO7A 4ZHQB 3HR7A 4Q4LA 1TT5A 2CJYA 4GXQA 2DKOA 1KI7A 2GYYA 4BX8A 2Y0CA 1KYXA 2DOKA 2P0EA 1GPAA 4OI2A 5JPCA 1L8QA 2GN6A 1H6BA 2NXWA 3V3KA 2Q3EA 2W2PA 2OCAA 5AKZA 1GDTA 2B5WA 4IW3B 4AXXA 2Q3CA 4MQEA 2JGLA 1TQ8A 1DL5A 4BNKA 1E6UA 1SCUB 4MW0A 4OQLA 1KF0A 1KVSA 1DKNA 2OCBA 4RJLA 1W7AA 3ZJVA 3OM1A 4BKOA 5LNK6 1XLVA 3BD9A 5FA5A 2IV3A 4FN4A 2L0XA 1W88B 1Z73A 2V0NA 2F8SA 2UYHA 3BKWA 3KP1A 1DUVG 1W5AA 5TF4A 1AF7A 4ZI3A 5HKKA 3R3WA 5DB4A 2Z2ZA 2X0KA 2OO5C 1EAYA 2XX3A 4OMCA 3UWOA 2PK3A 4ZEVA 5A4MS 1SUSA 3FJOA 2OCPA 2QLJA 3BFVA 5DT2A 3RYCB 3GUHA 4LXUA 3D59A 3NHBA 4M8LA 3E9NA 3Q3EA 2ZRFA 2Y1XA 3CEAA 1RW4A 2Q49A 3ANLA 3KDAA 3MJDA 4H3HB 4I5DA 4B1FA 3TLKA 4D25A 1ZS9A 1C2TA 4JLMA 4G5FA 5L8VA 4HDNA 3Q9NA 4NBVA 4RGQA 3NH6A 4V3CA 1JB1A 5AKJA 3U2QA 1FJ2A 5HM8A 5A4FS 4Q3DA 2VYCA 2HHAA 2Q1XA 3NT4A 3ODPA 4ZXFA 1Y1PA 1Y9EA 4WL0A 4LXGA 2FDRA 3O8RA 2YBDA 1VA4A 2JHAA 1JIJA 1EZ1A 3DWFA 1YNOA 3B52X 3PL5A 3TTSA 3HN6A 4TV8F 4ZAYA 3TQIA 4GGPA 3KM0A 4MUHA 5IUJC 5JY6A 4Q9DA 1DKUA 5A3SA 2DHDA 2RGYA 2CXNA 4JLAA 4JIMA 4WE3A 1YE5A 1JLSA 4J29A 4Z6KA 5LZ5A 1L6IA 4FDTA 4IS2A 4LWPA 5CU7A 1HYQA 1TGYA 4M0LA 2DBYA 3OPYI 1E7YA 3I6ZA 1F2TB 3TNDA 1XWWA 5BWCA 5KX5A 1WCV1 2FFRA 4KLNA 4AJEA 3SZRA 4GOKA 2GASA 2BFEB 2Z09A 3FYUC 3RUIA 4BMNA 5HJ5A 3EZYA 3LCJA 2X4DA 4LE2A 5IEJA 4EENA 3WMRA 3ONVA 3NRCA 1OQAA 3ICOA 4PQEA 4KIUA 1H8HA 2EW8A 3CU5A 4MH0R 3VOBA 4Q3LA 1GADO 1NIJA 2AOWA 1DXYA 1H42A 2RHBA 3JYPA 4BKUA 5IF3A 3KQUA 2GILA 4HGYA 5CFZA 3I4LA 4INOA 1PQ4A 4D46A 5EJ8A 1Z0UA 5IJ9A 1WQ4A 5CFPA 2FKNA 3UK0A 1FTSA 1DO8A 1JAIA 2ECFA 2NSYA 2R00A 3EVEA 2CZQA 4X0EA 4ZPXA 4AJKA 4BB0A 1ILWA 2ADMA 1M6WA 1MQAA 1OGIA 4G5RA 1EEHA 1K7YA 4YRNA 2C9MA 2W6ZA 5CLIA 1VSQA 3E58A 4NNPA 3KB1A 1U2EA 1X1SA 2GERA 3ABZA 3N07A 4Q05A 4QQ8A 4WXYB 1TK3A 3UCFA 3ZY4A 4YUYA 4DUYB 1FNDA 5GV7A 1H8ED 5DHSA 5CFOA 3WBKA 1QU2A 3I92A 4UUOA 1TAGA 2BEWB 3JWIA 2Y93A 3QW4B 1QH0A 2NWQA 3GFVA 2QQGA 5J40A 4YJ2B 4LG1A 1SXJA 3MTJA 4UNPA 4XI9A 4FZVA 2ZUBA 4FYYA 4M7PA 2CJXA 4MP6A 5JD4A 2FUCA 3E9RA 2YV5A 1YS2X 1Y5NA 2D2EA 2ZS7A 3BXGA 3K31A 3MT7A 4KQFA 4DR6B 4WW0A 1SUEA 1MVOA 3DAYA 4KYUA 4OA8A 4YP6A 4CM7A 1YR7A 1G7TA 4DTIA 2OILA 2QTRA 1ZZGA 4MLZA 2GNPA 3L4BC 4GT1A 2C58A 2B35A 3I3OA 4HDMA 3M49A 5IPFA 1MPXA 4QTUB 1R64A 2ODAA 3U1BA 3VYSB 4F91B 4XJTA 4YXFA 3DHVA 2GK6A 3I0ZA 4TLAA 4AICA 3IQGX 5DHPA 1ORVA 3I23A 3OPXA 2OFFA 1D0VA 4IG4A 5IJXA 4AK9A 3GAZA 4XX1A 5AK3A 3SEAA 3HP1A 4H2DA 3WK6A 3ZHXA 4D82A 521PA 4E5DA 4Y2YA 1AK2A 2C98A 1ID8A 1XAIA 4YCMA 2FHSA 4XQCA 4FGSA 2ZBPA 4JUFA 4X20A 4HRYA 4C0WA 1S2NA 1L7EA 1U28C 2L2QA 1GPH1 2IKSA 3LMKA 5AVOA 2IZ6A 1H1DA 2OZLB 3BJEA 3OX3A 2R6R1 3ZS8A 4JI8B 4WZ6A 4XDHA 4ZVRA 1CVRA 1XXLA 3H0EA 1HQDA 4ZRNA 4B7AA 4E08A 1VLVA 2H65A 5CH3A 2OBNA 3RTAA 1N5OX 1QVWA 1Y4UA 2DCMA 1BC5A 1YJCA 3NHKA 3K35A 3OO0A 3HEMA 2VUTA 4UEKA 1FLNA 3N2GA 1FRZA 1ZL0A 3BRWD 3CZCA 2AW3A 3LTEA 1QFYA 3P9CA 4HB0A 3GJTA 1VE9A 3URKA 3W34A 4CMEC 3HCOA 1BDMA 2HZ7A 2POCA 2XTMA 3H9EO 1R9GA 4ECAA 3LBHA 4J91A 3CLUD 2BGLA 3PE3A 4XM0A 4DA7A 5U9CA 3NKVA 3D31A 4TRJA 5DIZA 2JLVA 3PC4A 3GN1A 4KRYA 1SVOA 3F6PA 3K6RA 3KJHA 3N8GA 2EWMA 1RIFA 2QVLA 2OV8A 2F1RA 5G02A 1I24A 2BDUA 2O8CA 2ZR8A 1A8PA 4I4CA 1OCEA 1ZCZA 4K7JA 4KBGA 1SVUA 1TIBA 3S29A 4E15A 1T5DX 1P3DA 1LSOA 3FWNA 3DW3X 3NNNA 4H4DA 3UQZA 4H7IA 3EFEA 3RREA 4QT0A 5GOTA 2Q3DA 3K5IA 4IQFA 4X54A 1E18A 4MVJI 4I4TB 4RXMA 1R0LA 2HTEA 2WTNA 3O1IC 1CJSA 4RWEA 3RRFA 3OP4A 5G1PA 4BNLA 2EJTA 3SQOA 2JFQA 2OHJA 1FNBA 1D0SA 1DIHA 1U0LA 2CD7A 1QU3A 1K5DA 5CA1A 4ADSG 3IOMA 1N5DA 1RC1A 1Y7TA 3AWDA 4HTFA 4M98A 1U8XX 1XTRA 1DCKA 1SBQA 3I8OA 4QWWA 1Y81A 4XD2A 5T6BA 5JQGF 3N05A 2J67A 3SP1A 3E9DA 4OQ4A 1GA1A 1Z6AA 1BRTA 3QQ5A 3O8DA 4TL8A 1Y4AE 1YDMA 4TS3A 3PKZA 3TZBA 4WKPA 3V8NA 4LFAB 3LT1A 2R8EA 3HTXA 4RY9A 3PNBA 1RTKA 1B93A 1LSSA 1NIPA 1WVIA 3OT4A 5TQVA 1X80B 3I0MA 4HH3C 1OLSA 2PX3A 4I1SA 4JK3A 4F4DA 1Z5PA 1E6LA 3EGCA 4C78A 1E0DA 3FNHA 4WBNB 1RYFA 2P8SA 4BNDA 5EIBC 2PUWA 2YNMA 3EDCA 4JELA 4EJ0A 2YS6A 1VP3A 4GX5A 5CXXA 1R00A 2CLDX 4QAJA 2NTEA 4EYKA 4ZCRA 4GOLD 5TQ2A 2ETVA 4BL5A 4IZOA 2PT5A 1WF3A 4I19A 4HWGA 3GEDA 5GONF 1W36B 1Y0BA 2HO4A 3WZMA 1NUPA 3QLTA 4OSOA 1ZMXA 5KOYA 1FUKA 4PIVA 3ZW7A 3NTOA 3AFOA 4XIIA 3KSBC 1SC6A 3SICE 2O59A 4X6LA 1PI3A 1WCXA 3AEXA 1WKBA 3KPVA 5CK5A 5K4HA 3ZGYA 1XMJA 1JA1A 2NZYA 4MJXA 4KN8A 4GWGA 1JEJA 4PGGA 4BJ3A 1PR1A 5CLHA 4C5CA 5AW7A 4W1QA 5CAEB 2ZUTA 3T9EA 3ZEIA 2C9DA 5C4GB 3O9MA 1CBUA 3JQAB 4AZTA 1KP2A 5JJIA 1HE8B 1Z8NA 1OKKA 1CY4A 4KWTA 4C03A 1WUYA 2V55B 3SK0A 4PHTA 1VHQA 1Z4KA 2DCUA 1C1XB 2RBGA 2VS1A 4U9HS 3VU9A 3T9FA 2HQSA 1VJDA 5ALWA 5AM3A 2WJ4A 5HXAA 3LHIA 5E1DA 5JE8A 1NI3A 3JW8A 5ITVA 3SKXA 1EK0A 1NVAA 2ZRMA 1QYDA 2AMLA 2XWJI 4MPPA 5BQ5A 1VL5A 1BH2A 3AHJA 1I7PA 1SZCA 1JHYA 1NJ1A 1T1EA 1XCPA 3MAJA 3MSCA 4YI3A 5LQRA 4AN4A 3IAUA 5CTJA 4CQLB 2R6GA 4OX9Y 5JJLA 2B4RO 2ODPA 3ANTA 1WBJB 3LC7O 4R83A 3TGWA 5CFRA 5E4TA 4HATA 4CKEA 1AHPA 5DOVA 3NBYC 4HBGA 2VT2A 2JC3A 1WPRA 5GONB 3M2TA 3WLEA 4KVAA 1SHZA 1TKRA 2Q3MA 3TLXA 4BWVA 1K8QA 1M54A 2E3JA 2ZBGA 4JXZA 4YRIA 4XYBA 4D2IA 2IKQA 4E1AA 5JZOA 1RWPA 2HIGA 4I4LA 3OEHA 4XR9A 5AJTA 3RVBA 2PUAA 4OL0A 3C8HA 2BKEA 2BH2A 4DGQA 3GPDG 3NAMA 3GXBA 1XEXA 3U39A 4CKWA 5EIEA 5KB3A 1PFGA 3DBVO 2BDTA 3LQ1A 4XWGA 5HKOA 5ER6A 2FXIA 4AO6A 2D5AA 2P2YA 4KIJA 3GO4A 3JVEA 4E12A 4WZAE 4M1EA 4X71A 5JNSA 4KSYA 2GXAA 2AD1A 2UKDA 1WLSA 2LP4Y 3A2KA 3IDSA 1N8SA 3Q8KA 1HFEL 2BZGA 2RCYA 3DVAB 1I94B 2Z58A 2XADA 1K9VF 1MU0A 1NUTA 4ITVA 2ZXEA 2J1LA 1L5HA 1TCVA 1OTHA 1X1BA 4G09A 4YDRA 3C48A 4NYIQ 4B34A 4B8WA 2V97A 3GEIA 3GLGB 3TXAA 3CG4A 3O95A 4KGDA 2NMVA 3IQEA 1QDUA 1W0JA 2HDNB 4XDYA 2ONKA 5FI1B 1VPVA 2GEVA 2SCUA 3M3PA 1C4WA 2VJMB 3ISJA 4X8HA 4BIMA 4NRDA 4UAUA 3KQKA 1XPUA 2DU8A 2MSKA 1STOA 4QU9A 3W5IA 2C54A 3HBFA 3AR6A 1PG5A 1EUCB 5FD8A 3BRCA 4LAFA 2ZPUA 1YGYA 4PC1A 3WYEA 3OHPA 1IG3A 4PBTA 5CB6A 5BSMA 3BF8A 4J0DA 4E4YA 3B3GA 2FE1A 3QOWA 3H65A 4L0CA 5IABA 1GU1A 2OXTA 4NBKA 2FWNA 3EC1A 3EZNA 5LXTF 3RU9A 2VTBB 1W5FA 4EW3A 2B30A 3B20A 4RXTA 2WJZB 2BY4A 1U9ZA 2MSNA 2P9EA 3GLKA 3IP3A 4LHSA 4QE3A 1X1EA 4U2DA 5G4LA 5BT9A 3RU7A 1U0OC 4Q3KA 2P4HX 4QDKA 3N76A 4LQDA 1VBNA 4ZJZA 5DNCA 3LDAA 3FJYA 1QOPB 4ZV9A 3ABQB 3RM3A 2V7QA 1B4DA 1XMPA 4LXTA 4W9NC 1R0KA 2G0TA 4L72A 2XWSA 1YB4A 4W8HA 3ZCQA 4YMUA 3R44A 2IDZA 2HB6A 4ZAZA 2R62A 3TLEA 1GZ6A 2B82A 3UMCA 3GI1A 4YCNA 3RC7A 3SN6A 1RNLA 3UWDA 3I0NA 4V0MA 1E69A 1H5NA 2O4UX 2GO1A 4BGEA 1UBRS 2FEOA 4ZZ2A 2XE7A 3EZLA 3PYXA 2IY7A 4YK7A 3VZDA 4ACAA 3CLTD 3GD7A 1ZK1A 3SBEA 3DWIA 4WIAA 1GZSA 1II0A 3C8DA 3DEFA 4L50A 1G0NA 1AH2A 2AC2A 1RKVA 3UAVA 1ZIXA 2V6BA 3REQA 1EFUA 4HVLA 4GBGA 3A1NA 3F71A 3GVXA 1UAGA 3ADKA 3HFJA 5IC4A 1CZLA 4TMXA 3ULKA 4LDQA 3ES9A 4ROSA 3ZD7A 5H68A 1PJRA 1DKQA 3PK0A 2AR7A 3GEHA 1Z33A 1NUUA 1T8SA 4AKSA 1T9HA 5L45A 1IDOA 4EF4A 1SA0B 3B7PA 4IMRA 2D7JA 4A0SA 1L7VC 1V5FA 5ICMA 1SUPA 3A9RA 2O3QA 5DMHA 3VZBA 2BFWA 3LWNA 5FOQA 2JJQA 5HJEA 3R3ZA 1CW2B 4MX8A 3DCJA 3IAEA 1YDFA 2AN5A 3FDZA 2ZRAA 5LXTB 3CY6A 4P4GA 1FX0B 3OMLA 3UCEA 1JBQA 3EIOA 2EX4A 2GGSA 2WI8A 5AW6A 4XWAA 1WZ2A 1M1NA 3HN2A 5J1SB 1Q1AA 3PLAE 2H4YA 3NHMA 1EG2A 1G5FA 1JUDA 1XZEA 2RH8A 3IDFA 4H17A 1CRLA 3BMOA 1DKMA 2QVGA 3KSDO 1WUKS 3LDFA 3ORYA 2QD2A 2QTMA 2RHDA 3FSGA 4FMDF 4PSKA 3UT5A 1PWXA 3G0BA 3SM3A 5JNRA 1PTJA 2H2AA 3JQAD 1USWA 1V7ZA