1N6RA

Crystal structure of human rab5a a30l mutant complex with gppnhp
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
167
structure length
167
Chain Sequence
b'GNKICQFKLVLLGESLVGKSSLVLRFVKGQFHEFQESTIGAAFLTQTVCLDDTTVKFEIWDTAGQERYHSLAPMYYRGAQAAIVVYDITNEESFARAKNWVKELQRQASPNIVIALSGNKADLANKRAVDFQEAQSYADDNSLLFMETSAKTSMNVNEIFMAIAKKL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ras-related protein Rab-5A
molecule tags Protein transport
source organism Homo sapiens
publication title High Resolution Crystal Structures of Human Rab5a and Five Mutants with Substitutions in the Catalytically Important Phosphate-Binding Loop
pubmed doi rcsb
total genus 55
structure length 167
sequence length 167
ec nomenclature
pdb deposition date 2002-11-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1n6rA00
1MOZA 5L3RA 3R7WA 2XSZA 2F1RA 1TNDA 1X8KA 3HWSA 3X1WA 3U7GA 3OEHA 3T1TA 4Q19A 3W6OA 4MYTA 3VNUA 2NO9A 2GKSA 4KITB 1TUEA 1EWRA 4IFEA 3B13B 2CLSA 4RKEA 2UZIR 4B6FA 1E2IA 5KDLA 1WBDA 1FFHA 1UADA 3PUXA 1HY3A 2PX0A 4MYCA 3WBJA 3U60B 2FNAA 1VCOA 2QRNA 5DI3A 1TMKA 2QMOA 4BLTA 1P2UA 3PVSA 3GLGB 3AP1A 2IXEA 3JVUA 3TBKA 4BPBA 3KDSE 5G41A 1XXHB 3NDBB 2CL6X 1G3MA 2WJHA 3KXIA 1EX6A 1GZSA 2YV5A 4Q5IA 5KSZA 1ZJ6A 4DT1B 2XTMA 2IWHA 4EJSC 2XNSA 3PEWA 2PMDA 2P6UA 1IHUA 4DLXA 1E0SA 2OZEA 1HQCA 5SZKB 1ZUIA 4EPTA 4RFVA 1XU4A 2FFBA 4PAQA 1KI8A 1EGAA 3KUCA 4Q7LA 4Q48A 2CEAA 1IN7A 4RZXA 2FEOA 4R71A 1WB9A 2VHJA 5DH9A 1XZPA 2XJ4A 4BZQA 2IS6A 3HR7A 1LF0A 2EU8A 4V0MA 2VP6A 4IEIA 4DLSA 3ADCA 3TR0A 3I1FA 1J8MF 4JLBA 5AJYA 1E1RD 4NCIA 3WHLA 2BWJA 3ADBA 4DB2A 1CJTC 2JEOA 1N25A 3MD0A 1KI7A 4M1MA 4OHYA 3FKSD 4P31A 1KSFX 3WMGA 2ZM5A 1P5ZB 2A9KA 2DFNA 2ZE8A 1KMQA 2Z6VA 1DS6A 1II0A 2VYFA 4UKDA 1Q22A 1Z6TA 1E69A 3FMFA 1DAMA 5LB4A 1C9KA 2OXRA 3I73A 3IQXA 5GJVC 3UWKA 1ZC3A 4C0LA 4PQYA 2XB4A 3BFXA 3QKUA 5F9FA 5F2EA 1E2JA 2OCAA 1ZC4A 2X2EA 1Q12A 1E98A 2H5EA 4F91B 1FX0B 1G6HA 2QP9X 5J5CA 3K0EA 1VKJA 3GP8A 1BMFA 4C0AC 3LY5A 2BM0A 2ZUBA 4M53A 4JT4A 5HE9A 1RRCA 4MRPA 2ATVA 3RC3A 1ESMA 4H1UA 1EFHA 2ONJA 5FUXA 3CH4B 1QVRA 3CIOA 3FWYA 3C8UA 2IUUA 4KO8A 2QROA 1JBKA 1HT2E 3UMRA 3PENA 1GNRA 3FOZA 1D6JA 1ZD1A 3UWOA 5KPJA 3B60A 5JI3E 4MUAA 3BBPA 3LW7A 2XGJA 5DO9A 1ZP6A 4PQFA 1NN3A 4DWJA 1FNNA 4JYBA 3ZYCA 3KJGA 5TDHA 3VAAA 2I1QA 5CJ2A 1CULC 1E2FA 4DDUA 1XRJA 1IAQA 2F1HA 6Q21A 1S1CA 5FI0B 3C15C 5AK0A 1DVRA 2C9OA 4DXAA 4HDQB 4OL0A 4N0DA 3ZGXA 4HDOB 1UKYA 4MH0R 3AVXA 2VLIA 2CJWA 2HT1A 1N3BA 1Z2AA 3NBZC 4B3FX 4B76A 2YWHA 3A4MA 4XJXA 1E6CA 1MR3F 1G8HA 1JPJA 1UBFA 2GJKA 2P67A 2R65A 4B71A 1YRBA 3RS4A 1HE1C 1QG4A 1Q1BA 3BORA 4KAXA 4OI1A 3CRQA 5JCPA 1GRNA 4GI7A 4L8GA 2XEXA 1G7TA 5F9HA 3MUFA 1M7GA 4WW0A 1CJKC 3QI2A 4RD2A 4Q1BA 4ITRC 4XSGA 3U5ZB 3CR8A 5FUVA 3LQRA 5E95A 3RRYA 1QHSA 4CEIA 1XP8A 3TVTA 1U8AA 1Q44A 4BWYA 5L3QB 3K0SA 3KKNA 4B3CA 2GVDC 2XAUA 2ZYTX 5FFMA 4DCNA 1IY1A 3NHBA 2OT3B 4LI0A 1F2UA 1KI1A 2O8FA 1KY3A 2FA9A 2CK3A 1KO1A 1GVNB 1UDXA 1Z0JA 1CRQA 5FUWA 1KAOA 3T12A 2ZRNA 1U81A 3AGPA 3RRZA 4C0QC 2WICA 3JZMA 3RSOA 4GMXA 3EIEA 4D26A 4PSAA 2ZE6A 5CYOA 2PMKA 1B0UA 4TTPA 3K70B 1NBMA 3VTKA 3WYGA 1OIXA 3R20A 4BFXA 1VG0B 2N42A 2QN6A 1U9IC 2GJSA 2GJ8A 4FMBB 1TQ2A 1LF5A 1FTNA 3U2QA 1YZNA 2ZJZA 1XEFA 4AKGA 2A78A 2CMKA 3OEEA 4Q1AA 4Q03A 1EESA 4OK3A 1TTTA 5FPSA 2EVWX 4XTCS 4BUJA 2F9LA 2YC4C 2ZR9A 1M2OB 3BC1A 3GJXC 3HPQA 2GCPA 3NC1C 4B34A 4DLWA 3TW8B 2YWFA 3WNDA 1IN4A 3HPRA 1G7RA 2G77B 5DE3A 2ZJ5A 5DI9A 1OYYA 5EP3A 3ZVRA 2W2XA 3SC3A 3AP2A 3BRWD 1R0YA 3NIBA 1FZQA 1ZNYA 3U6BA 3AV0B 1W2GA 2OBLA 1JB1A 4RD4A 1SXJD 5FL3A 1OFUX 3DM5A 2IYRA 4LJ6A 4TT3D 1P9RA 4V0NA 4CGZA 2CHQA 1G41A 4CDGA 3RRNA 2FGJA 4I1VA 1OLOA 4WBSA 2ZSDA 1M7BA 2GEVA 2AXPA 5SZHB 3QEOA 1D9XA 1OFHA 4ZCMA 2DPXA 1RVDA 2EFHB 2ZJYA 4TZ0A 1KKLA 4Z8YA 4O3MA 5HCIA 2IXFA 1SZPA 1OT3A 1UBGA 5DIFA 4R7ZA 2P5TB 4IOLA 1ZMXA 1N6IA 4I1OA 5FBRB 1MRNA 1RRGA 2V9PA 3FHOA 2J0VA 1CR1A 2CCGA 1GWNA 3JZAA 3MMPA 3WMEA 4DUGA 4G5SA 4NYMQ 2J41A 4GDFA 4TYWA 4XD7D 1NKSA 3KKMA 1Q1QA 2REXB 2RGEA 3VU9A 1FX0A 1XTIA 4A1FA 2IEYA 2O8DB 3FHTA 3NXSA 2XITA 1EK0A 1KI4A 2MSEB 3H1TA 2OCBA 3NKVA 4A6PA 2CLDX 1DG3A 2F6RA 4C2UA 2IHBA 1E9SA 4II7A 2ZS9A 5K8LA 1JI0A 2X8AA 4OYHA 4OJQA 4J0QA 1KI2A 2ZJ2A 3LO5A 3K0CC 4KLZA 3U7FB 4IXNA 4UNPA 2JJ8A 3SJCA 4CT5A 1FQJA 1G17A 4MRVA 3NC0C 4W9MC 2JAQA 3W34A 4BE7B 2JDID 3CBQA 4JLKA 4EQ6B 4HLUA 5EQTA 4D4JA 2F3RA 2ZI7A 2ORIA 5CYPA 1Z0IA 2MSDB 1XCMA 4FD2A 4EDHA 2OHFA 2GNOA 1ONBA 1PLLA 3O8CA 3I62A 4OKSA 1T3HA 2V55B 2QMHA 4US1R 3UKDA 1E0AA 1LNZA 4LV8B 4NCKA 2W6JA 2FF7A 2ZJBA 5FPYA 4M9XA 2VH5R 3MRSA 1VHLA 2IW3A 2BCJQ 1MRSA 1WMSA 2O0HA 3DMNA 1TF2A 1CP2A 2V54A 4Q01A 4WOPA 4A8JA 4DSTA 3ZS8A 4Q00A 1CEEA 3KQNA 1J8YF 1XXHE 2G6BA 3G82C 3GQBA 2VP5A 1UF9A 1N5JA 3UPUA 2DB3A 1FMJA 4ESVA 1SKQA 2J87A 2C03A 1JNYA 4GOJA 4IW3B 2FN4A 3SOPA 4KHZA 1HTWA 4WAUA 4JLDA 3T1QA 3CLVA 1IBRA 4S35A 2QT0A 1GILA 2R62A 1H65A 3FMPB 2ZRKA 5HZKA 2ZU0C 4FW9A 2P5SA 3CNOA 1KMHA 1YQTA 3L8ZA 4C3ZA 1U99A 4D81A 3U4QB 3GJ6A 2Q9AA 2NPFA 4KBFA 4G5GA 3GJ3A 4ASUA 2GCOB 2WSSA 2Z0MA 2XOKA 4KJZA 1N5LA 5HR5A 2R6GA 5C1BA 3TW4A 2ZUCA 3DVLA 2EQBA 2PCLA 1AA9A 2ZRFA 2VP4A 3QE0A 3F0TA 3QEJA 4GZMA 2Z83A 4GOKA 2CK3D 3NTUA 4L9WA 1LFDB 1AS3A 1DAIA 3RRMA 3GMTA 1JAHA 2WWFA 4PHTA 3VU9B 1P61B 1XB2A 4QGHA 1NRJB 3BXZA 4LJYA 5KYKA 3BFVA 2VHQA 4HAWA 1KZ7B 2B7BA 4RFSB 3TVDA 2WTUA 1BYIA 3C14C 2VRWA 1R8SA 4IEEA 2ZR0A 1ZM9A 3RS2A 4GBMA 4QNRA 2A3RA 3GD7A 3J81k 3AVTA 4DDWA 5J4KA 3B9QA 1ZW6A 4I99A 1TEVA 5DHAA 1LV7A 3RABA 2XXAA 2B92A 4IJMA 1N2CE 1XFAA 4A6XA 5L3QA 3QF7A 1NF3A 3UG7A 1RFLA 3VFDA 5TY0A 4X8OA 5TB5A 3W9YA 4UXJA 5BYKA 4IOKA 1OJLA 2BMEA 1OB5A 1UAAA 2A5JA 1XMSA 4A92A 5JMTA 1FUUA 4Q47A 5EE5B 1CTQA 4JKYA 4C2TA 1KDPA 1KO5A 1E9FA 4LK2A 2P65A 4FWTA 3SQWA 3TNFA 4P0TA 1KHTA 2I4IA 4LYFA 5AJXA 4Q1CA 2R6CA 3B78A 4Q66C 1JQJC 2IS2A 2OFOA 1ESNA 8OHMA 1M34E 3Q7PA 1NIPA 3U7HB 5GVSA 1KI6B 4JYCA 1HYQA 5CM9C 5L3SA 2ERYA 3ZQ6A 4MYUA 3QENA 3NVAA 2YINC 2IYTA 2ZI4A 2FSFA 2WJVA 2FU5C 1XD9A 3C5CA 3RLFA 1O87A 2BBSA 2C77A 5KUTA 3B9PA 3CRVA 4NL4H 4W5WA 3V4RA 4GOXA 2QTVB 3IIJA 5JS8A 2GXQA 4R9UC 4JJKA 1YR8A 1DAFA 2LKCA 2PJRA 2ZRAA 3CH5A 3T34A 2FZ4A 3K9GA 2H7VA 3BFKA 3TUJC 3W90A 1KIMA 3K09A 4M1SA 5D3MA 4Z1MA 3I5YA 1F6BA 3W8NA 4URUR 2ZQ5A 1XX6A 2WIAA 5A0FA 4N1AA 3FTQA 3QXHA 3V9PA 3QJYA 5FOVA 4NCJA 5JHGB 1GL6A 2W6JD 3IEVA 3K0FB 621PA 1U94A 3SQXA 1XNJA 3KB1A 4MGKR 1M8PA 3VR3A 4DKXA 3ADKA 3CM0A 5ELXA 5AUPB 4A8JC 3GLIE 2GZAA 1J90A 3QKRB 3QKRA 4JVMA 4M9SA 2W00A 4IDNA 1W1WA 4US0R 3W6PA 5GJBA 1T8TA 4TSFD 2G0NA 2HCBA 3DM9B 3SFZA 5JJKA 5K8TA 4CEHB 4F4JA 1H8ED 4LDJA 2SHKA 3FKSA 4C30A 2IX3A 2OILA 2QPTA 2R9VA 1NMYA 4PZLA 4DJTA 2WVJA 2FSIA 5JLJA 1KTVA 5HZHA 4LSGA 1E1QD 2ASEA 5KU1A 3UIEA 4AKEA 2ZE7A 3K9LA 3D7MA 4NKRA 4YONB 3WNCA 3U61B 2ZIAA 4ACBA 1NG1A 3LXXA 1AGRA 1KZGB 1MO6A 5KO2A 1ELOA 2X77A 2HJGA 2GF0A 4NONA 2JLWA 3M4YA 2RGBA 5IRCD 2GVZC 2HF9A 2IEZA 4HZUA 4Q7MB 3CF2A 1UPTA 4R2HA 1NY6A 2ZYVX 1TPZA 1ANKA 2EFGA 2GDJA 4G1UC 3UMSA 2ZI5A 1HUQA 2JA1A 4IRUB 4AURA 3LA6A 2I1VB 4L5BA 1I2DA 1CR0A 2O8BB 1U0LA 3CNNA 3KTAB 4TTQA 4U7DA 1K8RA 4GNKA 2DWPA 3FYHA 4NYJQ 4PHFA 1N0WA 1W4AA 3SS8A 3GJ0A 1L4UA 3NH6A 2FX3A 2J3EA 2CCJA 3AQ4A 1DADA 4PR0A 5AWFC 4GZLA 4O2LA 4GMDA 4DT1A 4DEXA 2OAP1 3DZ8A 4KLNA 4EPRA 4BFZA 1R0WA 1XJ0A 3RAPR 3X1DA 3DMDA 3OAAD 2C95A 1EFUA 1XXHA 1SVOA 1SHKA 4OHVA 4QBHA 3MAAC 4UXHA 1NI3A 5CDFA 1IJEA 1Z6GA 3K0AA 5D3QA 3X1YA 1XMJA 4TQAA 3DZDA 4Q21A 1P75A 3QXCA 4NPHA 3TAHA 3DOFA 2FEMA 3AB3A 3SE0A 5JRZA 1NG9A 3B82A 3BS4A 2B21A 2ANCA 3KJIA 4GP6A 2H92A 2QBYB 3B1ZA 3LV8A 3VR2A 4PQRA 3L82B 3TR5A 2TMKA 2CXXA 1KKMA 4RFSA 1DEKA 3RVBA 4F4CA 5EE3A 1XCGB 4Y0VA 1XTQA 3R7WB 1KYIA 2GAAA 3T35A 3CR7A 2O0JA 4G0NA 5FTKA 3ZLJA 2DWOA 1GNQA 2GXSA 2WKQA 4JLPA 4MRSA 3VNVA 1L4YA 2QAJA 4ZDWA 2V7QA 4ZI2A 1NLZA 2G0TA 2IYWA 4MDEA 5L8VA 3KKOA 1P73A 3ETLA 5FOSA 1A4RA 2QMEA 4DBLC 1NSFA 3A4NA 2WWGA 3B85A 2A30A 4PFSA 2V1UA 4TYPA 2C96A 2AFIE 2VHCA 3T06B 5KHOC 2PCJA 4HUQB 1OYWA 4IOMA 5EXTA 5FUYA 3A37A 1O3YA 1Z28A 2D2EA 3FPAA 5DSZA 5C46F 3QY0A 3VKGA 1OSNA 3ZH9B 3PUWA 1R0ZA 3NBYC 4OQFA 1YZLA 2NO0A 2AX4A 4PC3A 1M7HA 1DAHA 5FL7D 1YZTA 1KY2A 3CX6A 4MKHA 3BH0A 1IQPA 1DO2A 4GT1A 5E4FA 1NVVQ 1N6PA 3KTAA 5EP4A 4A8JB 2WPDD 4LYAA 2H8KA 3VMFA 4E22A 3EZFA 2JLVA 5FOXA 4L9SA 3DO6A 2AHOA 2ZU6A 5FTNA 4EUNA 2Z4RA 4BFVA 5FTJA 4OK6A 4RZ3A 4D6PA 3GLIA 1NN5A 4DC9A 1BKDR 4LJAA 2BC9A 2UZ3A 1R6BX 3SZRA 2ZITA 1NN0A 1Z22A 3LLMA 4M4SA 4M2LA 1FP6A 3G5UA 4G5RA 3SFVA 2J0SA 2GAOA 4A0FA 1ZVQA 3GFOA 2A5GA 3NH9A 4HZIA 2GXAA 1KDRA 3W6NA 4ACAA 3R9XA 1Z47A 2QPAA 1Z6AA 4PAMA 4TMXA 3OFND 1AJEA 2CLCX 1DPFA 4IXMA 3AKYA 2HEIA 2D62A 2AD1A 3VR5A 1DO0A 1T3LA 4NMMA 2LCFA 5EUQB 1A2BA 2GBLC 1N6LA 2XZPA 3OEED 4WA7A 3CPEA 1EFRA 4A2WA 2V1XA 3REGA 3VKHA 4EPVA 1E0JA 3U44A 1GKUB 2PBRA 5H8WA 2IYVA 4KV9A 3RC8A 1CIPA 4E09A 3VHXA 4KU4A 4KSCA 1E9DA 5FPTA 2CNWA 4IDOA 4RY2A 4WZBE 3K70D 4PHHA 2OO7A 1J70A 2WOOA 4P4TA 1N6NA 3EXAA 4ERNA 5B30A 2RGGA 4MRNA 4YXWD 4IOJA 2PLFA 1FOEB 2QAGA 2QT1A 1T8UA 1HA3A 4NP6A 4AD8A 3QVVA 2O8CB 1T5IA 3I8XA 3PUZA 3QKTA 4GSYA 4EPWA 1RYFA 3BERA 3OIVA 3AVPA 3M6AA 2F55A 4PPGA 2HYDA 1R5OA 4EFNA 1Z0FA 1YR7A 3EZ7A 4KFTA 3IO5A 3B1VA 4HUTA 2VP0A 3DDCA 2HDNB 4DB4A 1F2TA 4PC1A 3VR6A 1NP6A 3EX7C 4TLCA 3PJRA 4JSYA 3MFYA 2BCGY 1RRPA 4WZAE 4D4KA 2HCJB 3RANA 1GTVA 3CRRA 5FTLA 3QPUA 3MGCA 3EPKA 2PH1A 2Y8EA 4BEJA 4Z54A 4HB4A 4ZCIA 2B7CA 4PO9A 5J4YA 3WY9A 1E9AA 2RGAA 1U2RA 2QEQA 1E2LA 4D80A 2QTFA 3OIUA 3QOFA 1IXRC 4A82A 1E1RA 5E3HA 3MWJA 1XDBA 5FBWB 4F7WA 3TUZC 3GLFB 2AKYA 2QRZA 2VSXA 2QP3A 3SHWA 3AUXA 1N6RA 3NBFA 4YMWA 3OIWA 3I4LA 3JVVA 1AQUA 1U98A 3PIRA 4V0KA 3GLHA 4EFLA 1NKTA 2AKAB 3PUYA 4GFDA 4PPFA 2JJ1A 2W0MA 1NVVR 3KKQA 4LHXA 3CZQA 5FI1B 1W36B 1TL7C 2EYUA 3BJIC 1UEJA 2HLDD 4DLZA 3QKSB 1PLKA 4V0LA 4DDTA 4CEHA 2J7PD 2WM9B 4LYHA 4RCYA 5D3MB 4URVR 1M1YE 2ZRCA 5EZ6B 3H86A 3U3OA 1TU4A 5CB6A 3VHLB 4YMUA 1RRFA 3VKWA 3REFA 3GJ5A 5SZIA 3SJAA 4D4MA 4S2EA 4D4LA 3PUVA 2GXUA 1AK2A 1SULA 2HXSA 3QF4B 2WMOB 5EXPA 3D31A 1SVKA 521PA 1F2UB 1UBCA 4WVFA 4HYYA 3P20A 1JEDA 3THYA 4KI0A 4LPKA 5FBVB 4Q4JA 4HATA 5TARA 1G8GA 2A2ZA 3THXA 1SQ5A 1JQLB 2H57A 4MITA 3BH6A 1KO8A 1N0UA 1MABA 3CPJB 2WV9A 1GAJA 3Q7QA 1W4CA 4LV5B 1F2TB 5K8UA 1AKEA 3W5IA 2ZROA 1JECA 3S1AB 4BZPA 5J4LA 3TSZA 5P21A 1Q3HA 2J0UA 2QM7A 1DOAA 4TMTA 1LTQA 3B7GA 3U4QA 2NO7A 1DG1G 4MQBA 4PHGA 4DLTA 3PITA 1JXOA 4JS0A 2E87A 2J1LA 1C4OA 3RS3A 1CF4A 2XNDA 3WMFA 2P6RA 3AVUA 2VF7A 1Y3AA 1W36D 1E4YA 2A7QA 2FGKA 1MABB 4H1VA 3HYRA 4AC9A 1XMVA 1BS1A 2GBLA 2P0EA 3K09C 1KJYA 2H16A 3PXGA 3A58B 5BXQC 1XF9A 1I4TD 3THYB 4Z51A 121PA 1GL7A 1XCPA 4ZDIA 4XWOA 2K5UA 3QG5A 3VR1A 3SU8A 4DUGD 1AN0A 4DCSA 1D2NA 2HV8A 2J7PA 4G3XA 1KOFA 4OQNA 4MDFA 2DHRA 1OPXA 5F98A 4ZDKA 1VIAA 3TAUA 4K8OA 4A2QA 2G83A 2FZLA 1BIFA 4QHYA 3FFAA 3PCRB 5G3ZA 1ZBDA 2F43B 2IF2A 1G6OA 1M74A 1ZRHA 3SYLA 3CNLA 1IXSB 4HLCA 2CL7X 2IWRA 5KPDA 2OBNA 4Q7KA 1Q1ZA 3HP1A 1SVLA 1G16A 1A1VA 2O5VA 1NIJA 2BHRA 5DI3B 2J0QA 1WRBA 2VO1A 1BYUA 4MKFA 4NZYA 1G21E 3T5DA 2CBZA 3UG6A 5KOYA 2REBA 1ZD8A 4H9GA 2BV3A 5DNYB 1EFCA 1WBBA 2FE4A 4M1TA 1RZ3A 3B1XA 3RSLA 4BLQA 1E2QA 3I61A 2JLYA 3U3RA 1MO3A 4Q9IA 5C18A 1UJ2A 2QENA 1AGPA 1YZGA 2IUTA 3RWMB 2BOVA 3D8BA 1S2MA 3TSWA 2IYZA 1QF9A 4JLOA 1KI3A 4QC2A 4URXR 2V3CC 4M0LA 3ZQJA 4G5OA 4Y0AA 3TLXA 3EIQA 4ZIRA 3CZPA 1G7CA 1GRRA 2R6DA 4B48A 1Q0UA 2W6IA 1OIVA 4KBGA 4OQLA 1SGWA 1G64A 2AFHE 2RGXA 4LHWA 4BLSA 4IVRA 4ZI3A 1W49A 2PT5A 2Q6TA 4WXPA 2JJ1D 4YXWA 2MMCA 4KVAA 1RW4A 3P4XA 2IBMA 1H8HA 1VHTA 1IJFA 4Z8XA 5IK2D 4YQFA 3DEFA 2CNWD 4OHWA 3W3AA 4UNRA 2RHDA 2ZRDA 2WWIA 3W5JA 1AZSC 4PZYA 4MKIA 2QGNA 3TUIC 4AG6A 4BASA 4CT4B 4XVUA 1AQYA 1P9NA 2OFWA 4HAXA 4KODA 5TXGA 1R8QA 2CE7A 4NCNA 3SYKA 3U6KA 4FWIB 3SR0A 2FFAA 3KFXA 5FPKA 2RHMA 5G53C 1ZM4A 3GPLA 2NG1A 2ZUDA 1SVMA 4CYMA 1YE8A 3AEZA 5LPNA 2VPPA 4FCVA 4QJ5A 1UKEA 2ZI6A 1T0HB 4DHEA 3F8TA 1XJQA 1QZXA 4L15A 4F4IA 1G9XA 2GCNA 2AWNA 5JBQA 2HXYA 3KQHA 5AUQA 4P33A 3A8TA 4LHVA 1IN5A 2KBFA 4DLRA 4B35A 1XMIA 1KO4A 4LCBA 1E96A 2YJTD 2MMGA 2AN9A 3LX5A 1OV4A 1Q1EA 4PTLA 1R5BA 3MSXA 2X19A 1TEXA 5KSOA 3QBTA 1E9RA 4C0SA 4JVSB 2AD5A 1A7JA 1JAIA 4FI3C 1I2MA 5DN6A 4OQXA 4TN1A 3SJZA 4LWZA 2Q3HA 3TK1A 3PQCA 3AM1A 1KK2A 3LX8A 1TF7A 4JIMA 3IPYA 4I4LA 2PLRA 4AY2A 1W5TA 5DISB 3SI7A 2DFKB 3H84A 4B33A 3TGPA 2F43A 1XD8A 2IHYA 4HLQB 4QBIA 4X8MA 1II9A 1EFRD 4W7SA 2OE2A 2WJYA 1DELA 5LB2A 1YVDA 2QAGC 4MUBA 2Q9CA 721PA 4QHSA 5FR2A 1G4AE 2AR7A 2GHIA 2QE7D 3HR8A 2LKDA 3GEIA 3BAFA 5FTMA 3AUYA 3AF3A 4RVCA 5DYGA 1Q21A 4LX0A 1MT0A 3F3YA 1N6OA 2KE5A 4M22A 2XJ9A 1X3SA 1T6NA 3GCGA 4OK5A 3L0OA 1KNXA 1RPZA 3T1OA 1Z83A 2F7SA 5FOUA 5JEDA 5J40A 4M9QA 5M04A 3X2SA 1N6HA 1P3JA 3MWLA 1KI9A 3KUDA 3FGNA 3PEUA 1H8HD 4RZUA 3R8CA 1II8A 3SYNA 1X86B 2FWRA 1L2TA 1I4DD 1P62B 3K53A 2ZRBA 4HB3A 4AG5A 4ARZB 1VG9B 4EFMA 2V6IA 4HB0A 4B44A 2RH5A 4GPTA 2BDTA 1G8PA 2BEKA 1NL3A 3LD9A 4NYMR 1S9HA 1WF3A 4A36A 1QHGA 3AGQA 3ASZA 3CO5A 4QGGA 3SBDA 1GUAA 2DWQA 4Q4JB 4FMCF 1EX7A 4EPXA 3EWAA 4NBSA 1D8TA 1NVUQ 3E70C 3LWNA 1U8YA 4DVGA 2GETA 3EAQA 2NPIA 2RB4A 3P26A 4XOIA 4ZCLA 3CPHA 3GJ4A 5IHPA 1S96A 4UQOA 1E2KA 3FE2A 2OXCA 2OLKA 5J4VA 5FPHA 2ERXA 2YVUA 3ZIAD 2C5LA 1SXJB 3L8YA 4P4SA 4DCTA 1YR6A 1G291 1AZTA 4Q9JA 3N5CA 1W44A 1XWIA 2OCYC 2WMNB 3EZ2A 3BGWA 5HCNA 4C0JA 4AKIA 3B1WA 4XD7A 3QKSA 3NDPA 2D06A 4V0OA 3TJZA 3VQTA 2D7DA 2D7CA 5SZJA 1LY1A 2ECKA 5AUNB 3VX3A 4TLEA 2ZJ8A 4QG7A 1G19A 3KZ1E 4P4UA 4KFSA 2ONKA 2Q21A 1QHNA 2JLXA 2YZ2A 3N2IA 4YMSA 2RGNC 2ZRPA 1US8A 5CJPA 2JLUA 3ZVNA 5B57C 4EJSB 1VYUA 1ZCAA 3TKLA 1RJ9B 3EZ9A 2C78A 1GNPA 1G3UA 4JKIA 1FUKA 2VSFA 1G5TA 5JRJA 4B2IA 1AS0A 4HLUC 4BFTA 2FPMA 1Z63A 1ODFA 3C4JA 1XBTA 1FP7A 1RJ9A 2E1RA 3LBHA 3RYTC 3L0PA 3K0CA 3LVRE 4HLDA 4TT3A 3WNBA 2WIBA 4JL6A 1US8B 4K81B 1ZU4A 2ATXA 4A4DA 1KJZA 1ZU5A 3O47A 3SBEA 3U3JA 1BH2A 2DFTA 3SN6A 2G3YA 3TMKA 3EARA 3I32A 4BECA 1R5NA 3ICQB 3BD9A 1DE0A 4OBEA 4QNMA 1S8FA 3T15A 2AK3A 4N3NA 1AS2A 5KDOA 4LJ9A 4F38A 3T1VA 5EE0A 2HT6A 3E2IA 1P4SA 3RS0A 4NDZA 4HAZA 4C0BA 1YR9A 4JSTA 2IYSA 1QHXA 4XH9B 3BK7A 4NYIQ 4Q1DA 5CK4A 2VP2A 3KQKA 2XX3A 2NMVA 4I1UA 2P2LA 4ON9A 3HU3A 3I8SA 1XEXB 4Q1FA 4DSOA 3P32A 5CLLA 5A4JA 5JI2E 5G3YA 2FOLA 2OLJA 4HEJA 1OB2A 1ZAKA 2CVFA 2F1JA 2ZAOA 4XTRA 5TVKA 1YRAA 2L0XA 3QIAA 3IHLA 1CJVC 2R6FA 5CB8A 4MRRA 2WOJA 1VCIA 1PZNA 2J46A 2VQSA 2JGNA 3K0FA 3OAAA 3LLUA 2ZRMA 4K46A 4M1WA 5CK5A 3RHFA 2BKUA 2NO1A 2ORWA 1NBMD 3AVYA 3SHFA 1Y63A 2J7KA 4JBWA 1G18A 2IXGA 4C4PA 3QQ5A 2BIFA 5B58C 5CDFE 3W8RA 1FPMA 3OEHD 2G9NA 3THWA 1G3QA 2XSZD 5LD2B 4CVNA 1TQDA 1XTKA 4UNSA 1OF1A 4FINA 4POAA 4IKEA 2QE7A 421PA 5CITA 4P32A 821PA 4LJ5A 2ZEJA 1FQKA 1H8EA 2Q3MA 4US2R 3GLHB 3IDQA 4TQ9A 1IM2A 1VG8A 3DHWC 5TMPA 2FSGA 3B5JA 2PX3A 4UJ5A 1R7RA 1T5LA 4TSFA 3MG9A 2YYZA 4DCVA 1Q57A 4RCZA 1G3RA 1OH8A 1UFQA 1NMXA 3CRW1 2YOFA 1WXQA 2ODNA 3I72A 3L0SA 5TV2A 1VIYA 3LNCA 2IS4A 3QXXA 1E4VA 1CR4A 4AYXA 5BN3A 1Z5ZA 2WJJA 4DZZA 1FTSA 1II8B 1J99A 1YZKA 3KFVA 3QXJA 1SKYE 4PC7A 3ND8A 1U0HC 4HI0E 3MWYW 3U3KA 1GITA 4EJSA 1OH5A 3KKPA 4Q18A 1LS1A 1X1SA 4YDSA 2WAXA 3BB4A 1Z3IX 1DAKA 4O2RA 4OI4A 5JZVA 2PT7A 2VHUA 5JFGA 4WIAA 5E7MA 2D3WA 4D0NA 2R44A 1OXTA 2VA8A 3I3SR 1NNEA 1TQ6A 4RJLA 4YMVA 2DFLA 3SJBA 1K5GA 2ZSBA 2WWHA 4LHYA 1PUIA 4E03A 1PLJA 4QL3A 2PEYA 1XPUA 1KAGA 2QSZA 4LJ7A 2XXAB 3B6EA 1X1RA 1QBKC 2BKEA 2Z5FA 1XEWX 3ONWA 2WWYA 1G20E 1X8JA 2ZRJA 2VSOA 1QHIA 1NBME 1YU9A 2V6JA 2IL1A 4O25A 4B3BA 5B64A 1P6XA 2ZRHA 4QJ4A 3ASYA 4IDPA 2IK8A 2QGZA 2GTPA 2F3TA 3CONA 4LPSA 3W3ZB 1YZQA 2OFXA 2IC5A 4UJ3A 2OESA 3EPLA 2V4ZA 4Q1EA 3AP3A 3O8BA 4LJ8A 2ZVPX 3CKLA 4XVQA 2MSCB 3DKVA 1F60A 2FV8A 1E79D 2GJAA 5H68A 1YJ5A 2BVNA 3TIFA 3EA5A 4V03A 4NH0A 3RDPA 2QU8A 4TL6A 4D25A 3M0EA 1S3GA 2QNRA 3FMOB 3UMFA 4AWXA 3EW9A 4AKHA 1CR2A 5JSZB 2C8VA 3GLHE 2IYQA 2JLZA 5EUMA 1Z29A 2ZVQX 2FDCA 3B1YA 4YDHB 2CHVA 4PPNA 1F5NA 2ODWA 3LFUA 4FMDB 3AF0A 3KB2A 3BH7A 4TMKA 3C16C 2PJZA 4PO8A 1GDDA 4D2IA 5B2ZA 3Q85A 1SVWA 4DLVA 1SXJE 2VEDA 3D6TB 3IHWA 4MGIR 1VECA 2BMFA 1K5DA 1B23P 2GEDA 4ZDJA 1GSIA 2O0KA 2CVHA 2GK7A 4B43A 2A5YB 2QUZA 1E9BA 2EWWA 1W0KA 2CHGA 2F1IA 1D9ZA 2QA5A 2BBOA 2J45A 3O8DA 3OE7D 3UK6A 5A5GA 2XZOA 4I1SA 2OV2A 3OF5A 3LW8A 1OFTA 1SHZA 1KDTA 3DL0A 1Z6YA 3F5FA 3LH5A 4Q4AA 1MO5A 4IVQA 2NOAA 1HE8B 4KVGA 2XOKD 1KSJA 4MGYR 4NYJR 2QSYA 1CJUC 2W2VA 3EWSA 1AM4D 3K70C 4BLPA 4BEBA 1N6KA 3ZD7A 1W47A 2GWHA 5IK2A 2RAPA 1UBEA 2X2FA 2C98A 2PEZA 5HE8A 4ZKEA 2JIZA 1G5PA 1OXUA 2FSHA 4HUQA 1TADA 5LDDC 3TH5A 3GJ8A 1IOZA 5CLQA 2HJVA 1DARA 3FB4A 4C9BA 1W36C 3AH8A 4EIWA 5LD2C 3OIYA 1KO7A 2G1KA 3B8HA 3WHKA 4OHXA 3IBYA 2OBMA 1P2VA 1OXSC 1V43A 3DPUA 2XTNA 2BJVA 1FW6A 4XVRA 3LAWA 3GLFE 1XD2B 4DSNA 5JECA 4PO1A 2WKRA 5BW8A 1OH6A 4BGDA 2ZSAA 1BO6A 4TWZA 3I92A 4QGAA 3A1VA 1XJCA 1AIPA 4ZV4A 1FL9A 4KFUA 2FFQA 1JR3D 1LVGA 2ZR7A 1CS4C 4PXAA 2ZETA 1KNQA 2CDNA 3AF1A 2KB0A 1E0KA 1G8YA 2OG2A 2Q3FA 2OM2A 1E99A 2ZREA 3ND9A 2J9RA 2W2TA 1W0JA 1G1MA 5IDVA 4QKQA 4W5HA 2WWXA 2G1JA 1D5CA 3EG5A 4A15A 1RIFA 3WYFA 1CU1A 2WWWA 4A9AA 3A1UA 3KXKA 4M21A 4EAQA 5EXXA 1ZNXA 2WHXA 2UVQA 5G40A 1COWD 4GP7A 2RMKA 4KXFB 4LUCA 4B2LA 1WQ1R 4OHZA 1VTKA 4CEIB 2AL7A 2DYKA 2CL0X 1KSHA 1QG2A 4CEJB 5JCZA 1XEWY 3AKCA 2GZHA 5JWHA 5JHHB 5J4HA 2WZQA 4D82A 5K8IA 2F9MA 4LYJA 4B6EA 2EYQA 3ZZ0A 3KJHA 2VL7A 2IYLD 1W4RA 4BFWA 2QMUA 4BLOA 5FR1A 5EXSA 5FOTA 1A5TA 3EIHA 4TMVA 4BFYA 5BQ5A 4FCWA 2CJWB 4TLAA 1P60A 2KBEA 4PSVA 4Q9LA 4Q4HB 4TL8A 4R98A 4LBWA 1P72A 4C0HA 1Z0KA 4URYR 1G8FA 3BIFA 4LV6A 3IIMA 4KYUA 3T5GA 1EG7A 3P27A 4JL8A 1ZUHA 5CM8B 4JVLA 2O8EA 3P4YA 2XNDD 3IILA 4PC2A 4XWKA 2OEPA 3N2EA 4QRHA 2HYIC 2ZANA 4OI0A 3Q72A 1SKYB 2GESA 1TF5A 5AJVB 2PZEA 2FPLA 4M1OA 2D4HA 1NSTA 2H17A 1XZQA 4LY6A 1XTRA 2GK6A 2WBLC 1L8QA 3HU2A 3S1AA 4DEYA 4XWAA 4DIDA 1E2PA 1S9DA 1VCNA 3C5HA 5JS7A 1IY2A 4U00A 1P2SA 2B8WA 5DGXA 3BOSA 2X1VA 2Z4SA 1ZD9A 4TYQA 2O8CA 1GG2A 1SXJA 2G88A 4P4SB 2YOGA 1W7AA 4RKFA 3FDIA 1OKKD 1W0KD 3OE7A 4JLMA 4D0LB 4OI2A 4YC7A 3DOEA 5KTYA 1SVIA 5IT5A 3NWJA 2FPKA 3CW2A 4QM7A 2NZJA 4OJKA 2ORVA 3EA0A 4RD6A 4ZO4A 1TQ4A 3SDZA 2EW1A 2A5FA 3GJ7A 1KSGA 1UKZA 3AVQA 4M1YA 1MV5A 2NO6A 1LW7A 2N46A 2ZRGA 1ZM7A 5CIQA 5EP2A 2JASA 1LS6A 1ZYUA 5EE1A 4M9ZA 4B3GA 1NMZA 5JJLA 3LDAA 1W0JD 1KK3A 2V8OA 5KSPA 4ARZA 4MGZR 4PZZA 4IDHA 5BN4A 4RD0A 4E5UA 1E79A 3GFPA 5CIWA 1FMLA 4DLYA 2JLRA 1KGDA 4Q9KA 2CE2X 2KSQA 2BMDA 2VTKA 2DCUA 1DBSA 2J0UB 4MKGA 4L16A 4O0MA 2IA5A 4NHOA 4AYWA 4QM6A 4PAOA 2O8EB 1P9WA 2C9CA 4TZ6A 3Q3JB 2Q0HA 3OHMA 5JJIA 2BEJA 2QZ4A 3V00A 3QNUA 1OXXK 3IKJA 1VMAA 3HJNA 5KSYA 4QJ3A 1CXZA 1E3MA 2QI9C 1MKYA 3IQWA 2JIZD 1WCV1 2EWVA 4L4UA 3R9IA 1OW3B 1EWQA 3ZZTA 2FMXA 3QF4A 4KCGA 4EKDA 2YOHA 1A82A 3A6PC 2ZE5A 1ZM3A 2YHSA 3QVUA 4FCTA 1NLFA 2NZ8A 1Z0AA 4IVPA 4F93B 1EXMA 4X8LA 3ZJYA 1BMFD 2B6HA 4ZKDA 4M8NE 4CW7A 1Q20A 4MA4A 1AKYA 4LZZA 1TUIA 3E1SA 1P7CA 3A36A 3OFNA 1U0JA 3ZVMA 1NJGA 4IFBA 4CIDA 4JLNA 3IO3A 2BM1A 3IGFA 3K8YA 3PG5A 4R2IA 2ZYWX 3GLFA 1JR6A 3GLGE 3WP1B 1OFIA 2RCNA 3PEVA 1GFIA 1WDTA 3B2EA 3KQUA 3IEUA 2ZI3A 1NVWQ 4IDQA 3DKPA 3ZVLA 3AVVA 3Q8XB 4DDVA 4F92B 4TTRA 1X6VA 3OZXA 1JR3E 1Z07A 4B3DA 3A1TA 5KNDA 5BN5A 4NCHA 3BE4A 3H4MA 1VCMA 3D3QA 5DHFA 5EE9A 3UATA 4JBYA 3WXMA 4LBVA 4KSBA 1YKSA 4G5QA 2H18A 4JJZA 2YKGA 3N70A 1F48A 1GRQA 3GLIB 4RD3A 1DAGA 4AK9A 3ZD6A 2W6ID 1IONA 4BLRA 2QORA 3CRMA 3AF2A 3MJRA 5AJWA 3E5HA 2EFCB 3U3MA 3X1ZA 2WPDA 1S0UA 3GFTA 1NY5A 4I81A 2D2FA 2PZGA 4HAYA 5DYIA 1KK0A 2BMJA 3ECCA 1Z6XA 4LJ4A 3AVWA 4URWR 5LBIA 1E32A 1YHNA 1SXJC 2R8RA 1QDEA 3AF4A 4ZIRB 1T0JB 2QG6A 2IYXA 5E7IA 5FL7A 2NQ2C 2OUKA 3K9NA 1NN1A 4NTZA 4QXAA 3ZZUA 4RSGA 1JJVA 1NJFA 5ANRB 2GILA 3KQLA 4TLDA 1WP9A 1OHHD 2KJQA 3WRXC 1KJWA 2GZDA 2V7QD 1R2QA 2GEUA 3L0IB 4DCUA 3KJEA 4TL9A 3LBIA 3IPXA 4M1KA 1VPLA 1W46A 4B75A 2AXNA 4NU0A 5FBLB 1HQYE 1T4GA 1KDOA 4QFMA 3CWZA 2ZYUX 5GADl 4D0GA 1GM5A 1XTSA 1J2JA 4BZXA 1CKEA 3VR4A 5JWRA 1QHYA 3TE6A 1QHHB 3AKDA 3UANA 4B74A 5GVRA 4EQ6A 2YNMA 1PV4A 3NG1A 5E7JA 5GJCA 2DY1A 2WAYA 4A0GA 2IS1A 3L2OB 4DLUA 4BFUA 1L7VC 3PV0A 3KL4A 2EFDB 3WP0A 5C4MA 1ZUNB 1GKIA 3FKQA 3GEEA 1TAGA 1U8ZA 1VDZA 3Q9LA 1CBUA 3MLEA 1OKKA 1F3OA 2RGNA 2YC2C 4HSEA 5HTKA 2OSBA 3V4FA 1E2HA 4ABYA 2JATA 2P3SA 1KK1A 2QTHA 1R4AA 2QBYA 2IT1A 3WRYC 2OCPA 3ICEA 221PA 2ZI9A 3QUSA 4HAVA 1TX4B 4G01B 3I5XA 3R8FA 3EPHA 1XPRA 3LXRA 4X8HA 4N0EA 1V5WA 1WE2A 1X8LA 1D2MA 3EC1A 3Q5EA 4HAUA 1EFTA 5BYJA 4B47A 2Q9BA 4QBGB 3OESA 1FNMA 3KX2A 5KDDA 3FVQA 4JBXA 3RNLA 5FH9A 1E9CA 1CJMA 1COWA 4HZUB 2WJGA 5IF9A 3RWOA 3RS5A 2GJ9A 4DIEA 2HUPA 3M1IA 3NEYA 2XZLA 3R9WA 1JXMA 1T91A 2YWGA 2E9SA 2NTYC 3FMIA 1OXVA 4JLAA 4WXRA 4C7OB 1K6MA 3EC2A 3IUYA 1C1YA 3NEJA 1GIAA 4XSHA 4CF7A 4RZ2A 3IIKA 4PC6A 2O52A 3THXB 4Z1MD 1E2NA 1IY0A 3K9HA 3KXLA 3K1JA 4QBFA 4Q4LA 2IYUA 1GKYA 1T3SA 4Q7JB 1OHHA 3TQCA 2QL6A 1ZNZA 1VYVA 1HV8A 2KWIA 2W0SA 1J7KA 2JJ2D 4LRWA 2GA8A 3LQQA 4Q02A 3CUEF 1GP2A 1Z0DA 1E1QA 2R6AA 4CZ2A 2HLDA 1HT1E 1YZUA 1Z08A 3C7KA 4NE2A 1E2MA 5HKKD 3EASA 4OQMA 3RS7A 2KI5A 4JLJA 3HYTA 3CWQA 1JJ7A 3EZ6A 3HU1A 3GEHA 2ZSFA 1TU3A 1RYHA 3K0AB 3THWB 2ZSEA 3PFIA 2DR3A 4TMWA 4MYHA 4YMTA 3QBVA 5BWMA 1JR3A 1QVAA 2A5DA 4U02A 3MWKA 2RGCA 3LVQE 2CCKA 3C41J 4FN5A 2WKPA 3X1XA 3PR1A 2C99A 2ZS8A 4B2PA 4GL2A 4LBZA 1S4QA 2ZTSA 4TLBA 1P2TA 3A4LA 2RGDA 3QSYA 4TYYA 4NYIR 1W4BA 1ZIPA 3H0KA 4AYTA 2C9YA 4FXPA 1JPNA 4KYIB 2ODEA 2VHTA 1SVSA 2JLSA 1IN8A 3ZIAA 1PUJA 4A0RA 2O8FB 5AR1A 5H70A 3QPWA 1E2DA 1D2EA 2O8BA 2W58A 3BB1A 1ZM2A 1XEXA 2FH5B 1XTJA 3L43A 2IF0A 2WSMA 2ZRLA 4FIDA 1W2HA 5L3SB 5L3VA 1Z2CA 4ESHA 3AVOA 4XIGS 1QRAA 2NIPA 3QG1A 1OH7A 2QM8A 2QQEA 3BB3A 2PZFA 4B73A 1Z06A 1JEEA 1NLYA 1XD2A 2B8TA 3NBXX 4LGMA 3TQFA 3WBKA 5C2JB 3CB4A 3QXSA 1GOTA 1RC8A 1RE0A 1HURA 3CX8A 4LBYA 1M6NA 5F3WB 4JVNA 2J5XA 4TMZA 4LOAA 3T61A 1A2KC 1Q3TA 2QQ0A 4E07A 1UDWA 3P1JA 2Z43A 4QHTA 4DSUA 2BJWA 3CF0A 1GL9B 3Q5DA 5DLQC 5DN6D 4V02A 4GRAA 4HB2A 4CEJA 4LHZA 4DRZA 1E94E 2P6NA 1N5IA 2W83A 4LC0A 1R10A 1NVXQ 1VG1A 1Z8FA 2VIIA 1HEIA 2XB2A 2ZRIA 4ILEA 2PL3A 2VP9A 4ASUD 3VX4A 2ZPTX 4EPYA 4P3YA 1E2EA 1N5KA 3HDTA 2REOA 2ZXUA 1T9HA 4CRWB 1IN6A 4AI6A 3ADDA 2AK2A 3LRPA 3O8RA 1S1MA 2ANBA 2JLQA 2BBTA 5HKKA 2VF8A 3WYAA 4TQUS 4FMDF 1ZCBA 3A1WA 4RD1A 2IYYA 4JT2A 2R2AA 2DBYA 2GF9A 3TRFA 1IXZA 1ZINA 2AWOA 4PANA 4PPQA 4UNQA 2QY9A 4QOSA 1I4LD 2FG5A 3FHCB 1HH4A 1DTSA 2WJIA 2ZS7A 3GLGA 1PVOA 3NHAA 1N0VC 4BQSA 2ODBA 5JEEA 2FFHA 5KNBA 1QHHA 1MH1A 1WA5A 2GCOA 2HF8A 2WSSD 2EFEB 5AUOB 3AKEA 5EP1A 4BFSA 1PJRA 1W48A 5JSZA 4JL5A 4TL7A 4LC1A 1E9EA 1S3SA 1UKVY 3CX7A 4PSKA 4B32A 2ZAMA 2XTZA 2ZJOA 5HPYB 5J47A 1VYTA 2N1BA 1JALA 4JLVA 4BRUA 1E2GA 1RKBA 4YLGA 1G3IA 5EJEA 1KI6A 1MO4A 2OAQ1 4B3XA 2QP4A 1ZIOA 3SEAA 5JWOA 4KFRA 1ZNWA 2O8DA 1G4UR 4ZPXA 3TSOA 4A0HA 1BOFA 4TYNA 3LBNA 4FMCB 2ZJAA 4Q4HA 2GRJA 1CLUA 4JMPA 4C7OA 3FFBA 2BBWA 3UXMA 2I3BA 5FBQB 2VBCA 3SNHA 4UNNA 3PEYA 4BRWA 1DAEA 1KMHB 1LB1B 3THOA 2JCSA 3CF6R 2NGRA 3ZDQA 1CRPA 4WZ6A 5UKDA 4JZKA 2YWEA 4C0KA 4QGFA 5GJWC 3IBGA 3U7EB 2IUSA 4URZR 2JJ2A 5FOWA 3H2YA 4HDCA 2QAGB 3MJHA 1W5SA 4UXIA 1OIWA 1XPOA 1G5RA 2H1LA 5EZ5A 3A1SA 5C4GB 3EPJA 4A2PA 4Q9HA 1U9IA 1UM8A 1ETUA 4Q4AB 2FJUA 2C04A 2D74A 3QPVA 5AJZA 1UEIA 1OE0A 1U90A 1G7SA 2J59A 2LWIA 3G0HA 1R0XA 4V0ME 2JDIA 4PX9A 4W5JA 3ZS9A 4U5XA 3BWDD 5KNCA 2C2HA 3U44B 4AIIA 5H1YA 3MCAA 2QPOA 4IHQA 2UKDA 2RKOA
chains in the Genus database with same CATH superfamily
4O4HA 5KJCA 5TLSA 1KORA 4MW6A 4ZVUA 2I6XA 2F1RA 3CZ4A 2BMAA 3GUHA 2R8ZA 4MQEA 2HGZA 3U7GA 3X1WA 2PUHA 4G1EB 3FLEA 3T1TA 4NBWA 3V32A 2ZIZA 3W6OA 3VNUA 1KBZA 4F5EA 3I9FA 4O4LB 2BF7A 2GKSA 2RHOA 3JPYA 1EWRA 3DFZA 2ZJ3A 3B13B 3JQ6A 3WLKX 2ZATA 5KJFA 1A50B 1T2NA 2XUOA 2Q3JA 5AKGA 3CLHA 3EXEB 4QYWA 3PUXA 4MYCA 1HY3A 3WLAA 1SURA 1G60A 3NEAA 5C34B 2P1ZA 4YY3B 3NHRA 2R79A 4JJ8A 2FNAA 1VCOA 1TMKA 1WPGA 2IE0A 2QMOA 4I1IA 3VC7A 3VR6A 3GRVA 3GLGB 2BHTA 3RVQA 3JQFA 1HE2A 1SKBA 1SIOA 1BQ3A 2A35A 3DZBA 1CNFA 3IHTA 1XXHB 1ODTC 3ANTA 3E35A 3RARA 1Y5RA 3RHZA 4K9OA 3K9WA 1WVGA 3V42A 4B6RA 4PGHA 4Y2QA 3S6JA 2YV5A 5IH3A 1L5GB 1ZJ6A 1S4MA 2UZ0A 4NU6A 5D2CA 3ROZA 5I7UA 1E89A 4BGUA 2O14A 3QWFA 2PL5A 3PEWA 3AT1A 3P0FA 2B5VA 3DOHA 1BXRB 1FJXA 4M46A 3TL3A 2PFGA 1DKPA 1OVGA 1XTVA 1SCJA 4DLXA 3F3KA 4KPUA 5SZKB 3CFYA 3WB2A 4JB8A 1MIOB 1Y7TA 3I23A 2D13A 1ISFA 3S28A 1AXGA 1EGAA 2O5RA 4LCJA 2EJBA 4FDLA 1NYTA 4L2IB 2RKWA 1HNZB 1L4GA 4B47A 2RSLA 4RZXA 2GTIA 1QO9A 1T3TA 3NCTA 3M89A 3DDNA 5DH9A 1OCEA 3MT8A 2PFSA 3FETA 4MWBA 5LNK1 4K6MA 4DLSA 3LUPA 5A4KA 3PDCA 3TR0A 1P4HA 2Q2VA 3G2IA 3E18A 3WMRA 4NCIA 4LKRA 3H3JA 1CLEA 5L4LA 4MVYA 4RH3A 5TGZA 3MD0A 3ML1A 1BOOA 1KI7A 2B37A 2PD4A 3MWGA 3QYFA 3E7DA 4FKMA 4KRYA 1GTRA 2ZB2A 1IZZA 4P31A 1C7RA 3D8UA 3DS8A 2E5FA 2DFNA 2IIBA 4PYIA 1KMQA 3RUIA 1KRHA 3SIPA 2VYFA 3JAMA 4BO7A 4OHMA 3DKKA 1Q22A 5G0SA 4CU5A 3EISA 1KJ8A 3TNYA 2C9ZA 1U28A 2WKSA 3L4BA 3KQQA 3IQXA 1WXFA 3UWKA 4J6EA 4WUTA 4PQYA 4M6WA 2P4QA 3BFXA 1N9KA 3QKUA 4Y2GA 5F9FA 2V7GA 4BXOA 2W2MA 3R76A 2NM0A 4M87A 2AZ4A 1ZC4A 1H2RS 2H5EA 1QWOA 4R2LA 2QP9X 2HH9A 3HCAA 5J5CA 3IHKA 3WRXA 4B4KA 4GQIA 3GP8A 2AA3A 3G2MA 2PAFA 3RBZA 1MEEA 1JG6A 2JLCA 4M53A 2Z9BA 4P83A 3JRXA 4TKUB 5HE9A 4EBBA 5JXHA 3L02A 1UKCA 1X7YB 1D6NA 2QU7A 3PDHA 4M0EA 3RC3A 3V2GA 1CUZA 5EXEA 5HF6A 2D5IA 2AQKA 3CH4B 1O6FA 4QVGA 3CIOA 3AMVA 2QTMA 1I3MA 3HUDA 3HKEA 2M1ZA 2ZW9A 1JBKA 5KIAA 3QI7A 4FOPA 3O4VA 3UMRA 5ECDA 1HYGA 1X7YA 1D6JA 3L0YA 4AJLA 3K8ZA 1ZD1A 2FUKA 5GM1A 2ZSJA 3AUSA 4MUAA 3BBPA 5ERGB 2PANA 2J32A 4U6QA 5HRCA 2I22A 3NP7A 1Z5NA 1RWVA 2H2GA 4PQFA 3DTVD 1PGOA 4ZAYA 1W6UA 3KJGA 2O3QA 5TDHA 1OREA 2YWBA 1CF9A 3AUTA 3DZKA 3WL5A 4LOHA 2I9KA 2QJTA 2I2CA 4XX1A 4HXFB 4UEQA 1XR3A 4GC9A 4CU2A 5KNBH 5AK0A 3IE0A 3VSDA 1TJNA 3R41A 2OKCA 3N8GA 2V5VA 4CR8A 3ZGXA 4AXBA 1UKYA 1X3LA 2GPSA 2XQKA 2COKA 4CQNA 2Y0EA 4MUGA 3W7BA 4B3FX 4OLBA 2YWHA 3A4MA 3DE4X 4WN3A 3T7CA 3ZW9A 1VKHA 3VJLA 1MR3F 4MPPA 3KC2A 1ZD2P 4DLKA 2JARA 2ZSUA 3DJFA 4LJKA 4B71A 2OCIA 1HE1C 5LWHA 3BORA 2AT1A 5FPPA 3DTTA 4EGSA 1O9GA 3CRQA 4YRFA 4AZ0A 2W2LA 2X7JA 4ENQA 1NLUA 5F9HA 4L8GA 1G7TA 1I2ZA 2Q27A 2VUTA 2Z8XA 4WW0A 3T1YB 1YC2A 1OAAA 3QI2A 5WRFA 4RD2A 4HT3B 4Q1BA 1QIJA 4Q24A 3CR8A 4RZHA 3LQRA 3F7NA 5HUHA 2FK8A 3EUFA 1QHSA 2JANA 3F90A 1B26A 4HGQA 3SYMA 2GBPA 2WVGA 2XAUA 4C4ZA 4OXIA 2FLWA 3D4IA 3EQZA 1P1RA 3NHBA 4LA4A 1JEJA 1LUAA 4LOKA 4LI0A 1F2UA 3CLUC 3NANA 2O8FA 1EM8A 1AMNA 1KY3A 1R6DA 2VH2A 3OPYA 2FA9A 2CK3A 1Z2DA 1CQWA 2BTQB 4YT8A 5F1KA 3FI0A 1CRQA 1O5IA 1PGQA 2VJLA 3V8MA 5FUWA 1XRNA 3VGJA 4EB0A 2H6EA 1CZKA 3OETA 1AOXA 1U81A 3AFGA 3AGPA 3AR3A 4WLNA 1K7EB 4Z9BA 3RSOA 3EIEA 4OXRA 4D26A 4PSAA 1JYFA 2ZE6A 3JQDA 4Q3DA 1EGQA 1P8JA 2SKEA 1SXHA 2R2GA 2YIJA 3D2LA 3EEFA 3OHPA 5I9NA 3N76A 2FPSA 3EEQA 3DSRA 1RM3A 2PH7A 3ORQA 4PLZA 1G2QA 3NBQA 4FZ3A 4F06A 6CHYA 2FRDC 4BFXA 4AMBA 1T8RA 1P0IA 1TZKA 1R8YA 4KIJA 2VNAA 1FTNA 1YZNA 2ZJZA 1QHEA 4ILKA 4AKGA 4MWEA 4YO8A 2VKTA 4Q03A 4LNAA 4OK3A 3VHQA 4M0PA 2C3PA 5IVHA 2XCUA 5FPSA 3PQ7A 3RRBA 3WLSA 4NZZA 2X15A 3S3TA 5BR8B 1AN9A 2JC3A 3LTEA 1EGHA 3I01A 4MRAA 3V7YA 1WULS 2F9LA 4M8SA 2JFYA 3C1UA 4BVHA 5E9WA 5JDIC 1NI4A 1T15A 3GJXC 1RI5A 3G2KA 3FPGA 5B6JA 3WNDA 1TKRA 1IN4A 1G7RA 2G77B 1DQPA 4CLHA 5DE3A 1OYYA 3O3MB 1U2SA 4JJAA 4R31A 4HEA1 4K1LA 3SC3A 2VSNA 3TKYA 1HPLA 3PIDA 2PL1A 3UT6A 2RHHA 1Z18A 2C7GA 3HNRA 3TXYA 4B1FA 4E31A 2CXRA 2H06A 1WHSB 3AV0B 3D1VA 1THMA 1M1ZA 4YGYA 5FL3A 3KDPA 1UBOS 2HQ1A 2X2PA 4DQUA 2RD2A 4LJ6A 3VC1A 1P9RA 4V0NA 4W6QA 1YB7A 3BX1A 3T5PA 3O8NA 4B6QA 2CHQA 5LQAA 1FJ2A 1G41A 1WNTA 2PHZA 3CUKA 3WZMA 1O0CA 3USES 1KU6A 4BKPA 2ZSDA 5AI8A 3WGJA 1M7BA 3QGMA 1L5HB 2DQ4A 3LQ4A 4Q3KA 5K6AC 2QRVB 1CUVA 1UJ6A 1T4CA 1P0MA 4HDKA 3NOVA 3X43A 3HU5A 1SEPA 2KYRA 1NBIA 2NZWA 5CLJA 1SZPA 2X4DA 5JNVA 3P9XA 2DQYA 3N2YA 1EQ2A 1N6IA 2GR9A 4CM8B 1XI2A 4QOHA 1YJCA 5B3LA 5CH8A 1J4AA 2V9PA 3FHOA 3INGA 2J0VA 2OD2A 2XMPA 2J09A 1GWNA 1XF1A 3WMEA 4DUGA 2BMWA 3T3EA 4EJ0A 3HRIA 3BIOA 1THZA 4ZODA 2WHRA 4GDFA 2G70A 1NKSA 4OHCA 1Q1QA 1THGA 2PSFA 2REXB 1M2JA 2WYHA 3WL3A 3N9IA 2CB9A 2G28A 4U2GA 3TI7A 2IEYA 4MQLA 4YT2A 2P9EA 4LJSA 3WMWA 5IEJA 2ZR8A 3IURA 2GERA 1DXQA 3NXSA 2D1SA 1DV2A 2MSEB 4A6PA 2HSZA 1DG3A 3BXXA 2O07A 4PE5B 4WOKA 3L0CA 1URPA 1ZOLA 2A4KA 4OYHA 5LYJB 4QT4A 1E3DA 1JHXA 4UHJA 4RMIA 5CUQA 5H82A 4U9HS 5GZ1A 1P4AA 1HDIA 4YJ2A 3AM4A 1NJ5A 1H1TA 3NXKA 3O03A 1RYZA 4UNPA 5HKOA 3CBGA 3F46A 1F4LA 2R4UA 3EG9A 4BNDB 3PNVA 1G17A 1I1OA 1LK0A 2PIDA 4GSLA 3TXAA 4V2IA 2G9QA 4S3MA 5DFAA 1T6ZA 1WOMA 2JDID 3CBQA 3OOJA 3PA8A 2QVBA 2AG6A 3V1KA 4JQCA 5I9IA 5EQTA 2AI3A 3C3YA 1KPGA 2F3RA 3DHEA 3O2NA 4GDMA 5KQMA 2XUGA 2FWNA 3OQIB 1TA4A 5CURA 1LDGA 1WMFA 3EFOA 1Q7CA 3K5WA 4EDHA 5I8PA 2FR0A 1N5MA 2EJCA 3VTAA 4DCJA 2B2CA 2X41A 5IUNC 3UBMA 2V55B 3CVUA 3UPTA 2GQ0A 3UKDA 2GCEA 3R7NA 1E0AA 2EERA 4NCKA 4NCXA 2ZJBA 1O1YA 4RQBA 3FCCA 3KHKA 4M9XA 2VH5R 1KP2A 1JWBB 1U0FA 3QW2A 4RA6A 1FFDA 2IW3A 5DRYA 3COYA 5JZ9A 4AKHA 3COJA 4UCQA 3OE4A 1K27A 3KBBA 3TWOA 2YRFA 2YXDA 5JS6A 4Q00A 2V0GA 2XUHA 1CEEA 3KQNA 1J8YF 2RHTA 4KPUB 3VSBA 2G6BA 4PXSA 4HX9A 2G9VA 4NFHA 1WKBA 3K6RA 1N5JA 2FPOA 3BQ9A 1P3Y1 1PFUA 3GPCA 4MV5A 4FYWA 4OGFA 2DB3A 3P94A 4EF5A 4ESVA 2X3FA 1SKQA 2J87A 5M2QA 3PBKA 1I7LA 4FR5A 5B4UA 4MUNA 3PQ5A 1DHRA 4H4DA 3OM9A 5ADUS 1IPEA 2XUZA 3M5PA 3OF2A 3M2TA 3SOPA 1HTWA 1KEPA 2PXCA 2R7AA 2FPPA 4S35A 4RJKA 4W63A 3HEMA 2V3WA 3NNSA 4E13A 1OLUA 3FMPB 2IBSA 2J4CA 4R5MA 5HZKA 3JTMA 1JDNA 2CSUA 3CNOA 3Q2KA 1KQNA 3SEZA 1YQTA 3HL4A 1UJ5A 1DJMA 1B93A 1TK2A 3H4IA 2C2OA 1JA1A 1N8TA 3CKMA 4MRMB 3Q9NA 4LRSB 1SHUX 2Q5JA 1NQWA 1KPIA 1I0IA 2UVDA 1ULZA 2WQZA 4M7RA 2GCOB 3M3DA 5JFTA 2PGIA 5HR5A 4L5JA 3KTFA 3LZ6A 2P41A 3EHEA 2VCHA 4PRYA 5CLIA 2ZRFA 3AZOA 4I36A 4A16A 2AMVA 3PGKA 4AJKA 1KEKA 1EVLA 2IHTA 1UIMA 3WC4A 1GPH1 2R1ZA 4GOKA 2QUKA 3T0IA 3GH3A 3JX9A 4FD3A 4L9WA 5CLFA 1DAIA 1ZJJA 4AO8A 2CLMB 4HQLA 4QRDA 3QVLA 3H7IA 3PQ8A 4OUDB 2WWFA 3KAJA 4J3NA 4FFVA 4ZJZA 3BXZA 3OZ7A 3DQZA 3IOBA 4HAWA 2PKRA 4DUYB 4U8HA 1BYIA 4O29A 1L7PA 2I2WA 4L1KA 3B3FA 1N9GA 4IEEA 1UBHS 1FFEA 3GP5A 3LY9A 4PIPA 3RS2A 4GBMA 2H1RA 1VSUA 1L8LA 1PIWA 3R3XA 4GX5A 4X20B 3UH1A 1A97A 3I2GA 5J4KA 3O95A 5DHAA 4X6LA 3IV7A 1NW3A 2B92A 2YS7A 4IJMA 1XFAA 2G72A 4A6XA 2GFIA 2GB4A 4DJJA 5KQRA 1YI0A 1KH2A 1RFLA 4WJZA 5EHXA 4KQXA 5E6RB 3U49A 5BQ3A 4ARCA 4X8OA 4EA7A 4NENB 5JNLA 1W5FA 2WP0A 4QTZA 4RPLA 5EZQA 3U80A 2BMEA 5EINA 1RQRA 3NT5A 1E1LA 3OFKA 1NONA 4Q47A 1MXFA 4W9RA 3QOYA 4C2TA 3HN2A 1YS6A 2EX1A 1M0TA 4R5HA 3SQWA 3LS2A 1MA3A 1KYWA 2DCMA 4Y9TA 3OU2A 2JLBA 3TNFA 1JA0A 3D0OA 3DAGA 4G26A 5CYGA 3FKJA 5BR1A 2AHRA 4D0SA 5JNRA 2I4IA 4KXYA 3ZDYB 2SCUB 3RCBA 3B78A 1J2RA 2XLCA 3P19A 4P92A 4TS4A 2IS2A 2VDNB 3RT1A 3DXXA 4BAUA 2R6ZA 5D84A 1CDOA 2E7ZA 3P9NA 3TS1A 1QIKA 1E3WB 3MXOA 2WM8A 3CSUA 4D3DA 4RTQA 1HYQA 3STTA 1QE0A 1U3VA 3EGXA 2ERYA 1BAPA 4XRRA 3TAXA 4KL8S 2IYTA 3V8RA 3TTVA 3KWFA 3RLFA 4DWOA 4ZZ0A 2V7BA 3B9PA 2BFMA 3MK31 4OMCA 2AG5A 2CKMA 2NU6A 3IIJA 3JU3A 3TRJA 1YR8A 2NTNA 4O2BB 1DAFA 4JMLA 6REQA 5K3OA 2ZRAA 1J6UA 4BFSA 2FZ4A 2VWQA 2H7VA 1H42A 1DKNA 1WPRA 3LWBA 1SZCA 1H6BA 3K09A 4UEWA 5D3MA 1EK6A 1WY5A 3W3AD 3W8NA 4AXXA 3M7IA 5A3JA 2ZQ5A 2NX2A 2ZAYA 5A0FA 3WDMA 2Q5OA 2IYFA 2R84A 3QJYA 4QPCA 4NCJA 5U4QA 1GL6A 2W6JD 1F9AA 3GNLA 2O6HA 1U7OA 1E59A 1XNJA 3KB1A 4WGGA 3ZTYA 4C7JA 5AUPB 1HNWB 2EC5A 3W8DA 1DEHA 2VUIB 4RS3A 2P4SA 5DHPA 5DSXA 4BYGA 5ADVA 3QKRA 1VLHA 3HDGA 4S04A 4PZCA 3UJ6A 2VTEA 3ND7A 5A5VA 3EHDA 1JLHA 4REOA 4L3OA 2G0NA 4XFKA 3ROXA 3AHFA 5CXQA 3SFZA 4EO7A 2ECOA 2XWSA 5JJKA 5HG0A 3H6GA 4OQYA 1Z38A 3UJPA 3FKSA 4FE3A 4PWYA 4C30A 1UMCA 2QPTA 3SXJA 4FBGA 4PZLA 2Q3DA 5BRJA 4MKZA 2G4LA 2TMGA 1HETA 2I65A 2LBPA 3QVWA 4QWWA 5E6SB 4CQMA 2FMTA 1YOVB 2ASEA 4RLQA 3UIEA 2CMDA 4XPZA 4BBPA 4DZTA 5JNTA 5K0EA 3D7MA 3ZY2A 4AUMA 3AU8A 4CF4A 2VAVA 2ZXEA 3ELWA 4QELA 4F3RA 1KZGB 3NKLA 3IEIA 2AKEA 1K7CA 1UT5A 5IWAB 2HJGA 3V2HA 1TD1A 3HJCA 2GF0A 3GMIA 3KQSA 3PQEA 2RHCA 4RHXA 2RGBA 2GVZC 2E4WA 5CDGA 1AV6A 1K8ZB 1AHIA 3LFTA 4HZUA 3RR2A 4CIWA 2J3LA 3GC6A 2NUTA 5CW2A 1ESZA 1TPZA 4WI1A 5ESRA 3M6FA 3Q41A 4YRKA 4ODIA 4I14A 3VYTB 2VT7A 3VI3B 3PXBA 4KIFA 5AVKA 3WICA 4U7HA 3KLPX 1F8XA 4XGQA 2K6GA 3LA6A 3B1FA 1CR0A 1KQ3A 2O8BB 3CNNA 3FSJX 4NR0A 4XR9A 3FYCA 2DWPA 3FYHA 2XDAA 3G0OA 3PS9A 4NYJQ 2JVJA 4LECA 4LTMA 4PHFA 3VNSA 2PUTA 4HQKA 4MUXA 3STHA 1RRVA 3BDIA 1E2UA 2CCJA 1BX0A 1DWOA 3TOCA 1YQWA 2YJNA 4J0JA 2YW9A 1E5XA 1ZRNA 3CRNA 4AZWA 2JKZA 4PBTA 3D8SA 3MCTA 4PG8A 1CDEA 3RAPR 4WASA 1GQYA 3OAAD 4YRSA 1XXHA 2B0JA 2DX7A 1O94C 2Q8PA 3HBAA 2FXIA 4KXNA 1NI3A 5CDFA 1IJEA 1TJ5A 3UAYA 4BMYA 3K0AA 5D3QA 3S2GA 2HPAA 1Z4JA 2UZ1B 1GAXA 1TZBA 3DZDA 4TKUA 3F4BA 3LVFO 1QZZA 1VOTA 2FEMA 3LF2A 3AB3A 3S5JA 4DIKA 2W48A 5PNTA 3NP9A 1XCBA 1GSHA 3BS4A 3DAPA 2V96A 1UFRA 4GP6A 4J2HA 1J5EB 4F5YA 3FLBA 3L1JA 2H92A 2VBGA 1YDFA 3P52A 3B1ZA 2Z6QA 5LQNA 1W6RA 1FS6A 2AI1A 1R1DA 4YCAA 3MT9A 1CZNA 3ZCUA 1UZLA 3ZD8A 1D2GA 3RVBA 1GN9A 3U5TA 2DH6A 2HJSA 1Z7YA 3C6MA 3NUZA 1QX3A 4WSOA 4CLRB 5IJ0B 1PT7A 1SCIA 4PYNA 4Y0VA 1XTQA 3E58A 2JIDA 1H0RA 2R48A 3LUBA 7ADHA 1XZCA 1A7UA 2HMWA 1PJZA 3KQWA 5F5LA 5FTKA 1L7BA 5J9FA 2OXEA 4MRSA 4QDOA 3RSZA 3UJNA 2CDBA 1L4YA 4WDRA 1SBCA 2XUKA 4GWLA 2CWWA 4N54A 4R9NA 5H3HA 3DL7A 2G0TA 1XROA 4BHTA 5LKRA 4DJFC 3JARB 3II6X 3PC6A 4BO2A 1MD9A 4FEGA 4PV7A 1N78A 3G3EA 2O0LA 2HX1A 1DINA 4M60A 2EGHA 3T41A 4L8YA 1UXGA 4CM4A 5DMXA 5TQ0B 3SPXA 4A03A 5A7FA 1SRRA 2B4RO 4PFSA 3GBPA 2V1UA 2DLNA 1SG9A 4HNTA 2AFIE 4RJ2A 4L3VA 1Z12A 2EXXA 1CNEA 1H2AS 4WLVA 1XA4A 3ROGA 4Z7JA 1FTWA 1NOJA 3IJRA 3E7FA 4DV3B 1OYWA 2LCIA 3BA1A 4JQOA 1M67A 4LRQA 4EHLA 1HRDA 5FUYA 4GX1A 3A37A 3DXZA 3I0MA 5B37A 3O3NB 5CVTA 3O84A 1H4SA 3QY0A 2CUTA 3COVA 3ZH9B 3EXFA 3CGGA 2NV2B 4O4IA 1R0ZA 4OQFA 4PC3A 4X92A 5CXSA 2FQWA 5B1DA 2X0RA 1YZTA 1QNFA 1TQHA 4W5RA 3CLRC 5E4FA 1NVVQ 3GMSA 1N6PA 3CLTC 4KAJA 5HZGA 4JC5A 4YX9A 3H05A 2JBAA 4LGVA 5JSKA 1E6EA 1GEGA 1RHKA 3CINA 3TXXA 1RBMA 2WZBA 2XMZA 3EZFA 4Q3NA 3QW4B 5HQJA 4DVJA 2JLVA 1GEEA 1N2SA 1OWNA 2AHOA 2ZU6A 3GEBA 5AVYA 1DT3A 2A92A 2WF7A 5FTJA 3NVMB 1YD7A 3P2JA 4IWYA 5HIIA 3GLIA 1NN5A 3OCWA 4TWAA 4JR1A 1BKDR 3RYHA 1SIUA 2GPAA 4F2WA 1Z22A 1EA5A 3VH3A 3I53A 4HNUA 1FU4A 3DMTA 2FJ0A 3LLMA 1CQPA 5DU2A 5F1YA 1ES9A 3VZCA 3SFVA 2GAOA 4A0FA 3QKWA 5AW2A 1N8SA 2MR6A 1QH8A 1G21A 1O9BA 1NC1A 1GTSA 1WSDA 3IESA 3OFVA 4TTAA 5FPQA 2CLCX 2BFBB 3GPBA 4NNJA 2HEIA 4AJPA 5SV2A 3EDYA 1NRXA 2AD1A 1BN7A 1XK7A 4WBXC 1T3LA 4BVKA 1ZICA 1U0OC 2X23A 3HA2A 4YAIA 2H7XA 1TM4E 1IIRA 2YWCA 1XHFA 2VDQB 3LKBA 3RSGA 1EFRA 4RMNA 2FWMX 3KEOA 1QVZA 1AK1A 3REGA 2GEFA 4KUGA 5EMJA 4LMRA 3PX3A 5F76A 4YR7A 2YJGA 3I64A 3QPBA 1YQDA 2VR1A 4R1UA 4BU1A 3EMKA 4BZWA 4DL9A 4UTRA 4KV9A 3D1LA 4B6SA 4FKZA 4RKWA 4IEFB 3G0GA 2C3YA 1E9DA 4KSCA 3ZY5A 2IHZA 4BP8A 3DUWA 3RWBA 1NUHA 2WA1A 3ZE0B 3O21A 4HGRA 2W4IA 1J70A 1UZUA 4PGMA 1N6NA 3EXAA 2Y6UA 5DHUA 5THQA 3L3BA 4RJTA 4IOJA 1W2WB 5JR3A 2B1IA 4QT0A 3A11A 3INTA 1SR8A 3B6KA 2QNBA 1YB5A 3R7DA 1CYEA 2F3QA 3MWFA 5KWSA 4FHGA 5EKSA 3C3PA 3PFHA 4JBGA 2BHLA 1S6YA 4ZWNA 2EF1A 3I9V6 3GU3A 3G2QA 3WI7A 3OIVA 3FB1A 2F55A 2I7DA 4PPGA 2WSYB 3VPSA 4E46A 1AF4A 3H1AA 4JOQA 1Z0FA 2W2KB 4F93B 5JS1A 1YR7A 2LR0A 4OAQA 4G0YA 4O5OA 4KFTA 3L6DA 4M86A 4ERXA 4R40A 1Y9AA 4TX1A 3PWKA 1YCGA 3M4XA 3TGWA 4BDSA 1CRZA 4R1PA 1VIMA 1WXGA 2A86A 5T8KC 1KVUA 4Y2VA 4YCJA 4ZHQA 4DB4A 2I7TA 1N77A 2JCXA 4G0MA 3RGGA 2I4NA 5BW4A 2OZLA 3MS7A 1CRWG 3FF4A 5DJ5A 3GIDA 1FNCA 1GTVA 5FTLA 2CJPA 5LLTA 1I14A 3MGCA 5TIIA 3W1VA 4ZCIA 4J4BA 2BFFA 4E11A 4C6TB 2IJGX 1U2RA 2YZMA 4DN6A 4E2ZA 4EY3A 2C7QA 1JMKC 2J0EA 5AVJA 1PL6A 1PJCA 1NQ5A 3QLVA 4BWFB 4L6CA 1XDBA 3LT5A 5GGXA 4UMEA 5A04A 2YXNA 1FFWA 1P77A 1XDDA 4FVTA 4WACA 5IDWA 2VSXA 1XU7A 3GVPA 4HADA 4BB5A 1L1EA 2D1RA 4YMWA 3OIWA 3W79A 3WV4A 3LIIA 1UP6A 3LSTA 3GLHA 1NKTA 2JFHA 3PUYA 4PPFA 2PKQO 3BK1A 5HZMA 5KQPA 2W0MA 3A1CA 1HNXB 2C2MA 1ONPA 4DMHA 4BMXA 2ZAIA 5FI1B 1EE1A 2EYUA 2FSVA 2WHQA 3QKSB 5AO9A 4V0LA 1K88A 2C82A 2Y0DA 2FP4B 3BQNB 3ZW7A 2J7PD 4KFCA 4O6VA 5A4AA 4QEDA 3TNLA 1RD4A 2C29D 2E6UX 5D3MB 2I7VA 4B5LA 3ROMA 5C8YB 2R1TA 3R6DA 3K20A 3UHPA 4AROA 1E3QA 1WETA 4EHBA 1QF7A 4YMUA 3ASVA 3GJ5A 3NTRA 5ILGA 2VTBA 4OX9Y 2H2FA 4KQJA 5ALMA 2H4WA 1MJGM 4S2EA 4D4MA 4JU9A 4D4LA 3PUVA 4WFJA 1KVRA 5E1OA 1Z62A 2PE5A 3O7MA 3GGDA 3E5RA 3L0BA 4ETWA 1DUVG 1F2UB 4DNQA 3ABQB 5ERXA 4HYYA 3P20A 1JEDA 4I5DA 4RPGA 4Y6SA 1PFGA 1O4WA 1GCUA 4Q4JA 2VDVE 1XMOB 4JXXA 3GJYA 2A2ZA 1HG0A 1SQ5A 3TIVA 3DBVO 4ETIA 5KYWA 1KO8A 1AMUA 2PLAA 5FHRA 1W4CA 2IKQA 4FGKA 3M1YA 3LHKA 1AKEA 2OAGA 1L4MA 2ZROA 1JECA 3S1AB 4WL0A 3ZHZA 4J0GA 3TSZA 5P21A 5M3BA 5J4LA 4L5AA 5JU6A 2W6ZA 1BVUA 1DOAA 4X7PA 2C2XA 2A9JA 1LVUA 4C87A 2IHUA 1O95D 2C4UA 3JQ7A 2J1LA 3EYWA 3ZWMA 1Q7GA 1C4OA 1T1SA 4F4FA 1CF4A 4RA9A 3T5MA 1P91A 4ISBA 2BR3A 3LYHA 4RDCA 3SMQA 4L85A 1E4YA 3H18A 5T4HA 1XMVA 4RQAA 3H0CA 3K09C 1KJYA 2H16A 2NW6A 4NENA 1CY6A 5BXQC 2EBHX 3ER8A 3I58A 3VYSB 5C81A 4JJGA 3GZTB 3MD9A 4N0QA 2ORED 1GL7A 1TYAE 1KZ6A 3QX7A 3PPIA 1LPNA 1Q14A 3DGEC 1FLAA 4BJ5A 1M8GA 4PCVA 4ZOLB 3UAVA 1HFKA 4LEIA 1H6DA 2ABWA 5I5EA 2HV8A 2GWRA 3K1TA 1YR1A 3NB0A 4HXEB 2QLFA 5F98A 1N2HA 3TAUA 3V97A 4AF6A 1C0EA 2EP8A 4MHTA 4L9RA 3KVVA 1XRQA 9MHTA 1VJRA 3RD5A 3PCRB 5G3ZA 4V2UA 4B7AA 3JQCA 5JAIA 1ZNQO 3MMSA 1WB5A 4WJKB 2NUAA 3JQGA 3I6QA 3RFVA 4DZRA 1NM5C 4UBKA 5DK6A 2PX2A 1SUEA 4DG5A 3QEBZ 4RANA 2BEVA 3ABRB 3SC2A 1D6SA 1Q1ZA 3BVPA 1G16A 3HUUA 2BHRA 3PGLA 1QH8B 2Q5FA 3L1VA 5DI3B 2XKKA 1J33A 1N9GB 1RAEA 3AFOA 3FWNA 3AY7A 4UULA 3FCOA 4XIJA 3W05A 1G21E 3SSMA 2XUDA 3LPMA 3UG6A 2OCGA 3PRKE 2REBA 4OYYA 4DE5A 1ZD8A 4NBKA 4AUKA 4J94A 5AVOA 3SBOA 1EFCA 4DADA 2AUMA 4GU5A 4M1TA 1WBBA 2WU1A 3B1XA 2OM6A 2A7XA 2V6BA 3B2QA 2XDQB 5TS3A 1A8SA 5C18A 1YIOA 2OUIA 4ETMA 5AKXA 4D9BA 4YMIA 2NACA 2BOVA 4PYQA 3O2SB 3NIWA 4RXUA 3WADA 3EC7A 3LQFA 2GPWA 4JLOA 1F9EA 4Q16A 4DLBA 2XMCA 4BLVA 2JRLA 3I34X 4Y0AA 3EF1A 3CZPA 3K2QA 3R7FA 4QZVA 5K3EA 4HYEA 1KMNA 4I9GA 4NY1A 3IPAA 4H7HA 2EZ8A 2BSXA 4OQLA 1OIVA 3QMPA 4F46A 4RIIA 1BE0A 2C61A 1SHLA 2RGXA 2HMAA 3DD1A 4LHWA 4QTXA 4WZBB 4LF8B 5J5VA 2ARKA 1T29A 2Q6TA 3KZKA 2JJ1D 4BNVA 4YXWA 1EDZA 1KIAA 5ENDA 3O82A 1G5IA 1Y1LA 3IBTA 2DF8A 4EHIA 3RV4A 5KNCD 5KS2A 2IBMA 3UN1A 1C7QA 4BQEA 3D7KA 2CNWD 2QRMA 3GRFA 1Z75A 3OLCX 2OYCA 3FTNA 2RHDA 3ZWDA 3L46A 1AZSC 1JF8A 1MVLA 2Q2OA 4XVUA 4EY8A 1ID8A 1SCUB 4G97A 3RKSA 2Z9DA 5TXGA 2C88A 2FEXA 4OMUA 3U6KA 1R8QA 2CE7A 3CT4A 3IA2A 3BE8A 2XMRA 4B6OA 4D4KA 5K8VA 4WNYA 2EAUA 3HZZA 2PKQP 2JG3A 1ZM4A 1U2TA 3GPLA 5BSHA 1RRKA 1GA4A 1ZMOA 1VE6A 1YZVA 1A7AA 1TCUA 3OT1B 5AKKA 4RHFA 3ICCA 4R8LA 4XZ3A 3E1GA 4ZEWA 3WFZA 4OSPA 5LU8A 3CX3A 4S05A 3O1LA 3ZGVA 1UKEA 2ZI6A 3QWAA 1XJQA 3OLZA 5JMOA 2GCNA 3W2EA 2RHJA 4RACA 4AX8A 1E4OA 2ZTHA 4KG7A 2C0CA 3MBOA 4PLHA 1FNSA 5CT4A 4DQDA 3E22B 5AUQA 4QRIA 3TL2A 1L5RA 2XDQA 3BICA 3IQFA 3ZR4B 1GZ7A 3BXGA 4LHVA 2RI0A 3VOBA 3WIBA 3JALB 4WBNF 4B35A 1KO4A 1GYQA 1E96A 1UC9A 2EGGA 3FGPA 4ZOBA 1UPXA 3LX5A 4H6PA 4GWGA 1Q1EA 4PTLA 4RETA 1R5BA 4QQ8A 1YJXA 2O48X 1M2KA 1ORRA 1TEXA 1CR6A 3QBTA 4RK7A 4DFDA 5A6SA 1OC4A 2P9ZA 1JAIA 3TZKA 4FB5A 1ADBA 3K6JA 3FNGA 2ZWIA 1WZUA 2XGOA 1BJKA 4O4LA 1VPDA 1XA0A 3RUFA 3TK1A 3WRYA 5AT1A 1B0ZA 1KK2A 1PGPA 3T3OA 3H2JA 4JIMA 2ZYRA 3S29A 5EIBC 3L9WA 2K7FA 4AY2A 2VXYA 3DAOA 2DFKB 4FX5A 4UPVA 1U3WA 1XD8A 1E8NA 1RC0A 3BA6A 4QBIA 4C2BA 4QBTA 3D4PA 1II9A 4W7SA 3L6CA 1MQ8B 3U13A 3V1UA 2COUA 2XKJE 2Q9CA 1C3JA 3K35A 1U7TA 3PWTA 4FGSA 3A06A 1W94A 1T9DA 2P3OA 1VKOA 4F8YA 4JP1A 5KYXB 3FXAA 1C3OB 2ZXFA 1OBHA 2NXWA 4MVCA 3ZZMA 5C3MA 3R5XA 4NV3A 1D07A 2C42A 3E53A 3H99A 4J6FA 4RVCA 5AHWA 1TTPB 1R0KA 3DBRA 1PW5A 4MKRA 1NW9B 1DQNA 4RHUA 2IH2A 2QY6A 1F12A 4K6FA 4P82A 4YCBA 3KU4A 2UUCB 4G1BA 5DCWA 5F73A 3KKZA 4V0QA 5EMLA 2XGMA 2I1LA 2WHPA 4L7VA 2PAAA 3I76A 2O2JA 2XYHA 4FT2A 3FPBA 3CMMA 1U1GA 4GIBA 3OX4A 2HO5A 5CDHA 1X1TA 4G56A 3SXPA 1GKLA 4DCGA 3VGPA 1F0PA 4NHEA 1OTHA 4MTCA 4D4IA 3X2SA 4BNZA 2Y4NA 1P3JA 3L1UA 1P2FA 3MQ4A 4JODA 3KUDA 4MP6A 3PEUA 1XQWA 1Z68A 4RZUA 1QG6A 2NUPB 3TM4A 4KO1S 3R8CA 4YPOA 1SXGA 1FY2A 1II8A 1P81A 5T41A 3SYNA 3D6MA 5LUBA 2A1TR 2JCGA 4ARZB 3HGTA 4TKLA 1P62B 3K53A 3TN7A 4L3WA 1N5OX 1B7GO 1EZ1A 2RK4A 1VL1A 1OJ7A 3N6XA 4MQ6A 4MHOA 4OA8A 4CTOA 2P68A 1RHJA 4A36A 1Y80A 3GOHA 3F67A 4U39A 1Y8QB 2Y1CA 3ORHA 3UO8B 4INAA 4QGGA 1A69A 2P4EA 1HF3A 3ENKA 5DHRA 5JQGA 1JAZA 4L02A 1F8UA 4Q4JB 2P9TA 5BNZA 5JALA 5I4KA 1T26A 3QTLA 3ED1A 4MSUA 4EPXA 1V4VA 5DKFA 2MOKA 5EXDA 5FIUA 1Y4ZA 4JCCA 5D00A 1WZIA 4K3UA 4MGHA 3TZ6A 1YKGA 3E0QA 3DGFC 4OHRA 1U8YA 1UDRA 3IIIA 2GETA 4J9VA 3CPHA 3GJ4A 3ECAA 1S96A 1YGYA 4G0XA 4KPEC 1UMBB 2KM1A 1VJDA 1ZR4A 1SU8A 2V8BA 3CMCO 4FHFA 4HQRA 5FPHA 2QZPA 3P2OA 4P4SA 1AUXA 2GBCA 3TDNA 4DCTA 1AZTA 2ZBGA 4IUBS 1FVFA 2WMNB 4AKIA 2OCYC 4NV0A 4XWGA 5CIYA 2NU6B 1U1IA 4G5YA 4U2BA 4XD7A 1L7AA 2JF0A 3KVRA 4MUEA 2V98A 2XAAA 4H1HA 3H2SA 5SZJA 3TJZA 3LPDA 4Z4QA 2D7DA 3V48A 4TLEA 4GP9A 2FAXA 1G19A 3KZ1E 2WSLA 4P53A 4QG7A 4DA9A 2RK6A 4TRNA 2ONCA 3P9KA 2YR0A 5DM4A 4AZ0B 2CL5A 4F84A 2RI6A 2V9CA 3KQVA 3N2IA 2OWEA 4K6OA 3EODA 4CKBA 1US8A 4TV8B 1HE5A 5CJPA 3U62A 4EJFA 2JLUA 4KNWA 3ZVNA 3LF1A 1VYUA 2QYTA 3EZ9A 4LXYA 4JR2A 3DWIA 5C8DA 5C9ZA 3M3HA 1FUKA 1GGHA 2IELA 1WHTA 3PHLA 2FPXA 4II3A 4B2IA 4YRIA 2FPMA 2NT3A 4R01A 4LQLA 1ODFA 2PT9A 1DC6A 3C4JA 3DC2A 1Z63A 3QLVC 1XBTA 1QM5A 1N5RA 1W0CA 2QTGA 3K0CA 4H7KA 4HLDA 2CVQA 1ZS9A 2WIBA 3ZWVA 5JZOA