1N73A

Fibrin d-dimer, lamprey complexed with the peptide ligand: gly-his-arg-pro-amide
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
91
structure length
91
Chain Sequence
b'EVLRELERRIIHLQRRINMQLQQLTLLQHNIKTQVSQILRVEVDIDVALRACKGSCARYLEYRLDKEKNLQLEKAASYIANLKFERFEEVV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Fibrin alpha-1 chain
publication title The Crystal structure of fragment double-D from cross-linked lamprey fibrin reveals isopeptide linkages across an unexpected D-D interface
pubmed doi rcsb
molecule tags Blood clotting
total genus 30
structure length 91
sequence length 91
chains with identical sequence D
ec nomenclature
pdb deposition date 2002-11-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.50 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 1n73A00
2HLOA 1RF0C 2HODA 1RF1A 2OYIC 2XNXA 1JY2P 1M1JB 1N73A 2HPCA 1W2EA 1JY2O 2A45I 1LT9C 3HUSA 2H43A 1LWUA 1T3UA 3BVHA 3GHGC 2FFDC 1RE3A 1FZBA 1FZEA 3H32B 1FZFA 2Q9IA 2OYIB 1LTJC 1FZCC 2OYHC 1JY3N 1M1JA 1LT9B 1RF1C 2A45H 1RE4A 3GHGB 1FZAA 1RF0A 1JY2N 3H32A 3HUSC 2FFDB 3E1IA 1LWUC 2OYIA 2OYHA 1N73C 1FZCB 1LTJB 2HODB 2OYHB 1LT9A 1RE3C 2A45G 1RF1B 3GHGA 1M1JC 1JY3P 2HPCB 3HUSB 1FZGA 1N73B 2FFDA 1JY3O 1N86A 1RE4C 1LWUB 1LTJA 1FZCA 2Z4EA
chains in the Genus database with same CATH superfamily
1SS1A 2KUBA 1JY2P 1K05A 2ZT9D 3CCVP 1ZN5A 3H1KG 4KJMA 5H2FH 3A0HE 3SSUA 3RK2C 3Q1MA 2OARA 2WPVB 3A7OA 5E79E 3CC4P 3O6QA 1ZRTE 3S1KA 3CMEP 1KB9E 4OH8B 1GL2C 3AECC 3IR9A 4RKUJ 1PGPA 1LTBC 3V2RA 2A06E 2WSSH 2WSCJ 3QWOC 1NTMD 5KAFH 5APWA 1IFJA 1RE4A 1EXJA 4YXDC 2FYNC 1T6AA 3UIAA 1NTZK 3L72D 3GLMA 2QA4P 2IBZD 3AE1C 4L76A 1M57D 2Z5HA 1FZCB 3AE5C 2R44A 1BGYG 5KJ7A 3P32A 4C7NB 4EIJA 1GW3A 1QVGO 1SQXK 1L0LG 2KSEA 1BE3J 1DX7A 1YBKA 2NPSC 4PV1D 5CMZA 3R2PA 2BASA 3D71A 3AEBC 1SQBD 1SQXJ 1RY3A 3CWBG 1M8OB 3L74G 3V2PA 2KYVA 1KMIZ 2AEFA 5BU8B 3FX0A 1J1EB 1S4XA 3H32B 3CX5I 4BWNA 1MZ9A 3II6A 3WUTA 2FFDB 1IJDB 1OXZA 5B5EH 1EZVI 3KQGA 1FZCA 1RF0C 2FYUG 1DD3A 2Z5IA 4C7NA 1LTIC 4M3LA 2W90A 1YIJP 1S9KE 1ZRTD 3FWLA 1L0NG 1KB9D 5AVYB 4GODA 1N7SA 2H43A 1SQPK 1LWUA 1GL2B 1VPCA 3I55P 2QM7A 1JEKA 3PLNA 2QSIA 1NTKE 4B86A 1USEA 1RF1B 1SQPJ 3RBXA 3N4XA 1OIPA 2N9BA 2E43A 3LW5J 2ZT9C 1NHLA 3SWKA 3T97B 3LIEA 4TT3H 3RK3D 1OVRA 3L75G 3AEDC 3ZDMA 4PD4I 3H1IE 2D2CD 1L4AB 1M1KQ 2C9NY 3V4QA 1GL2A 1FAVA 1H89A 1HGVA 2O3JA 2NPSB 2Y9YA 2ZFCA 3H1HE 1HGZA 3CCSP 3PTZA 2N1TB 2WQYC 1EDIA 3HUSC 2Y0DA 2GUSA 3L73E 3MUDC 3AE8C 3CXHE 1BCCG 1W5CE 5CBNA 3H1KE 1RQVA 1G2CA 1HJBA 3PHLA 1FDMA 1YTZI 2JO1A 4IL6H 3SFEC 1HWTC 4XA4A 3CX5E 4DCKA 4JBZA 1S9KD 1S5LH 2MKVA 3L4FA 4PV1C 4UB6E 3WUVA 1A02F 3MD0A 1QEXA 1Q7YQ 1EZVE 2CPBA 1YI2P 2NPSA 1BGYJ 1OW7A 5CJ4A 1M90Q 2YNYA 1PL5A 3CCEP 3A2AA 1L0LJ 3P8MC 1NTKD 2P2UA 4L75A 1KILE 3VMZA 5AW4B 1KFNA 1W2EA 2L5GB 4ASWA 2W83C 2Y0EA 2P7JA 3VN0A 2AEMA 2YXRB 2FKWB 2QEXP 1D7MA 1RF0A 1IC2A 3KHUA 2YMYA 4BXLA 2KXPB 2ZT9B 3SFDC 4JYCA 3H1ID 5BVZA 1EXIA 2QVAA 1FJKA 3GG2A 5KAIH 5KAIE 1JTHB 2WSFJ 1KTMA 1HF9A 3L74E 1VQ5P 2KS1A 3CL3D 2DW3A 5AVSB 3CMAP 2L91A 1M56D 5GTHH 1P84H 4Z1MH 2IZ0A 1AA0A 2IYOA 2H7HA 2B88A 4PD4E 1NAFA 2ZAEB 3M91A 2PP6A 3OA7A 2WPRA 3HE4A 2FYUE 3VMAA 3HUSB 1HBWA 1N8RQ 1S3JA 3RK3C 5KKZC 4JYBA 2Z4EA 2YO3A 3H1KD 3TYYA 2JJLA 4DT0A 1KV4A 3TNUB 3EQ2A 1BDDA 1JOCA 2Q6QA 1CI6B 1U7JA 1FU1A 2D2CC 1K9MQ 1NTZG 1L0NE 3CX5D 3TGUJ 3O8ZA 2HPCB 1AFOA 2WPSA 1OWAA 1YTZT 4LLHA 2KLVA 4GKGA 1Q86Q 4PV1B 1EZVD 1VQ9P 3N7NA 1Y8AA 2OGUA 3EWKA 3FGAD 4BRYB 1PGJA 5AVZB 3TDKA 3U1CA 1SQXG 2AXCA 3L71J 1NO4A 1SQVE 3B5ND 1KILD 4O9BA 1AQ5A 2JKVA 4HJGH 1ZOYC 3HUSA 2IDBA 3RL0B 3MUDA 3W67A 3CCRP 3TNUA 1FZAA 1SQQE 3L75E 4GT1A 1KQFB 1IFMA 1OVVA 2BCCG 1YJNP 5AVVB 4Y99B 4WY4B 1CSBA 2IBZE 4RESB 3OJAB 4IFMA 2LXCB 5AVTB 3L74D 1JMMA 1ZP0C 3BCCE 1URQD 2R5DA 5M1BA 3H25A 2FXMA 1Z56A 1VDFA 4PD4D 2YIUC 1SQPG 3E7KA 3M0DC 2FYUD 1SQBE 3V4WA 1S72P 4D6TJ 3Q5SA 4WVZA 2AXTH 4KT0J 1NU1K 4C7RA 2KZJA 3JC22 1L0ND 1VF5D 2D2CB 3D6YA 5TISH 3CC7P 1NU1J 1PP9E 1SLQA 3IF4A 2XKMA 4U7JA 3KDPB 1VQOP 4U3FJ 3ITKA 3H1LE 1JCDA 3A0HH 2YXQB 1LP1A 3C9IA 1Y9BA 5E79H 1AJYA 2HODB 5K5GB 1HH0A 4JQ0D 1JY3P 1SQVD 1IFIA 1KB9H 3NXSA 5AW6B 2FY8A 3KPEA 2Q5UA 2IX7C 1X79B 3KZIE 3KZIH 2E75D 2OTJP 1VQKP 3GW6A 3Q2YA 5DJTB 4LC1A 2QRXA 5CCGA 1SQQD 3L75D 3P8CD 1WMKA 3USSA 3AEFC 2ZYDA 3U59A 2A45H 2K3RA 3CPWO 3RK3E 3HD7D 2LXBA 1RE3C 1NTZJ 3WMM0 2HODA 1OW6A 3BCCD 2ZXEB 2RH0A 3FXDA 2O1JA 4R4LA 1AVOA 1HUCA 1K04A 1FDOA 3B5NC 1WT6A 3OW2O 1KILC 1E5WA 4KHXA 1BCCD 3G71P 4Y28J 4GIFA 2M5AB 1N7SB 2LR2A 1LWUB 2ZJSE 4H13D 1KQSO 1YQ3C 2OQQA 4EYYQ 4EDFA 2E5TA 1LTGC 1MFZA 1BE3E 3Q3DA 3H1JG 3L35A 3C8VA 1PP9D 4IL6X 1OZHA 2BCCJ 1FZFA 3PJSK 3AEGC 1NWQA 3H1LD 1G1JA 4N6JA 1URQC 3V2QA 1S5LX 1NTKK 3RK2B 1LT1A 2H8PD 1NGMB 2XNXA 2M5AA 2E74D 3M0DA 2W8ZA 1RHZB 1PPJG 5APQA 2KK7A 1HVVA 3V5BA 1JCCA 5CCHD 3BRTB 1BDCA 1NH4A 5B66E 1VF5C 2FYNB 2IZ1A 1R5LA 1QL1A 1SFCD 3TGUG 1SVFA 1G2CB 5CCGD 3AE3C 3I56P 2IFMA 4TLFA 2KNCA 2V7QH 1SP4A 1SQPE 1JUNA 4H44D 2E75C 2Q3EA 3B5NB 3L71G 1QGKB 1KILB 2KLUA 2GA1A 4AUWA 1P84I 2ZXXA 3MHVA 3H1HJ 2WITA 3CD6P 3SWFA 4RO0A 1N73A 1H8AA 2O01N 3L73J 3WU2E 1PIXA 2FBWC 3L72G 2OYHC 4ASVA 5KLVK 2YO2A 1BE3D 1KFMA 1XTGB 3CXHH 2M8RA 3HD7C 3NMDA 5L8RJ 2XDJA 4N3YB 1NVOA 1RE3A 2WT7A 3V2NA 5KLVJ 2JWAA 1VQNP 1EC5A 1KQGB 3CX5H 4YTPC 3B5NA 1KILA 4ZMDA 4UB6H 1Q82Q 1JMBA 1FOSF 5AVWB 1JY2O 5BU5A 4H13C 1S1CX 3E1RA 2KS1B 3FWNA 2J59M 4OWFA 2YKOA 4D6TG 1HJ0A 3PRJA 2ZVOB 1X8YA 3BRVB 2QG4A 3HE4B 3VMXA 3HE5A 1W2BO 3JCUE 1BGYE 1UIIA 1NU1G 3GHGA 1N86A 1L0LE 4U3FG 1URQA 2YKQA 5APUA 3H1JJ 5APTA 3ABVC 1SQPD 1GW4A 4MN4C 4YPCA 4R4MA 4K35A 2A06G 2E74C 3CWBE 3IN6A 1ZV8A 1GD2E 2V4HA 2R3CA 5CCHC 4I2LC 4NPEA 1EDLA 3C1LA 4PD4H 2O1KA 5AVQB 1LJ2A 5GTIE 3AE2C 4WWIA 1SFCC 2A45G 1KORA 1KYOI 3L70J 2Q7CA 2P10A 1FOSE 2K9YA 5CCGC 3F5HA 5AW3B 2KSJA 4W7YA 2WMMA 2Q9IA 1LTJC 1OX3A 2Y0CA 1T8ZA 1VQLP 2RN0A 1YQ4C 4H44C 3CCQP 1SQVK 1KC8Q 5TJHA 2WWWA 1Q81Q 2OYIC 3GF7A 1K8AQ 1VQ6P 1NTMK 2J58A 1JY3N 1SQQK 3AE6C 4H13B 5AVXB 2XU6A 3PH0A 2RMZA 3KXDA 1KZUB 2OYHA 2PGDA 1NTMJ 4CPGA 3QH9A 1ZMEC 1ZR4A 1OMIA 1NAYA 1JB0J 1S2EA 4L73A 3HD7A 1BGYD 1L4AD 3I5CA 2M0BA 3AEEC 3M9BA 1KQLA 3L72J 1PGOA 3Q5RA 5C39A 3M0AA 3P8CE 1FZGA 3TSIA 2E76D 1L0LD 3NFQA 1NYHA 1UIXA 2M3BA 4XE5B 1H0TB 2A45I 3MP7B 1RH5B 2P67A 1VQ4P 1U7MA 3BCCJ 1NJIQ 2KB7P 1AVYA 1SQBK 3CWBD 1EDJA 2CK3H 3VTPC 4EOTA 4A7PA 2N1TD 1NTKG 1T3UA 2FXPA 1LP1B 1SQBJ 2Q3IA 3S9OA 1J1DC 3A0BE 1BCCE 5DJUB 2H88C 1DD4A 1GK6A 4H0LD 4NPDA 3CCMP 4RJTA 1YJWP 2R5BA 2I1JA 3RK3B 3MTUE 5KKZB 1AQTA 1FE6A 1G1IA 1H0TA 4UB8E 4I1LA 1R5SA 1R8EA 1LT9A 3CC2P 4XFJA 1DEEG 1N2DC 3JSVC 3G3ZA 4H44B 5CJ0A 1KYOE 1IFNA 1XTCC 4N78E 5CHXA 1LTTC 2FFDC 3RGUA 4OVNF 1EQ7A 3H1HG 5AW8B 3F89A 5APVA 2SPZA 4WBAA 1TU3F 5CCHA 3D6ZA 3L73G 1MUUA 2WVRA 3VMYA 3TGUD 2JR8A 1SFCA 1NU1E 2K9JA 3IFMA 5H2FE 4HH2A 4C46A 2KP8A 1LNQA 3B4SA 1N73C 3SWYA 5KTBA 1VQ8P 4U3FE 2IFNA 4L74A 3M9QA 1LTJA 1BSNA 5KLVG 2AEJA 2QE7H 1IFPA 1GDTA 3L71D 4YXWH 1EZVG 5KAFE 3FXEA 1RF1C 3W68A 1FS0E 2N9YB 2OYIA 2WSCH 3OAKA 2K1AA 2O01J 4W80A 1T2KD 3G4SP 2C0WA 4IFFA 1MKMA 3EFFK 1IO4A 2WTYA 2O01H 2G8YA 1NKZB 5APYA 3RL0g 3MZWB 1J1DB 2LKMA 5AVRB 2YIUB 1NOHA 1L4AC 3CI9A 3HTKB 3BVHA 3B71A 1NTZE 2FXOA 2E76C 3TK1A 2QIWA 1PV3A 1VL2A 3CXHI 3BASA 3CLQA 1AV1A 1PFIA 3PP5A 5AW0B 3VYIA 2H89C 1KYOD 3VOPA 2N1TC 1DEBA 4N78D 3EFGA 3GHGC 1SQXE 2CPSA 3MGNA 1Q2NA 4LGDE 4D6TD 4I6MC 1GTWA 5KLIC 3A3YB 1J2JB 3RL0D 4AYCA 5B5EE 2KNCB 3MIWA 2YMKA 3H6PA 3A5TA 1M7LA 2HLOA 2BEQD 2J5UA 2KIKA 3P7KA 4H0LC 2XV5A 1NTKJ 1HTLC 5AVUB 1NU1D 1FJPA 1MV8A 3CCUP 4WY4D 1T3JA 3HTKA 3L70G 2IPPA 4OGQD 2ZYAA 2BCCE 4U3FD 1FC2C 1N73B 2QM8A 5B66H 4I7ZC 3K5BA 3KYQA 2A06D 3H32A 1FBMA 2P1JA 1LGHB 1CW5A 3H1IJ 2V7QJ 1N7LA 2FFDA 1DH3A 3U1AA 1H88A 1DIPA 2NRGA 1SQVG 2WT7B 2Q1KA 2NZ2A 3WUUA 1PZQA 3AE4C 1JM0A 5AW2B 1NTMG 2IYPA 1SQQG 3LW5H 1OVUA 2XZRA 1USDA 3WU2H 1NTZD 2OYOA 1Q90D 2E76B 2WPQA 3H1KJ 2IBZG 2B87B 1X0TA 5KJ7D 1RF1A 3CCLP 2WZ7A 3L36A 3BCCG 3HE5B 5AW7B 1SQXD 2QJYC 1T2KC 2POHA 3GHGB 1YJ9P 2C9LY 3VP8A 3IAOA 2RKLA 1URQB 4GOEA 3T97A 5KLIB 2YKPA 1IZNB 1JO5A 2JP3A 1SQBG 3GF3A 1OW8A 1Y47A 4IL6E 4H0LB 1L4AA 3B8EB 1ZR2A 2KOGA 1MFTA 2B89A 2BCCD 3BATA 5KLVE 2W6JH 2GM4A 1S5LE 4IFDK 1L0LK 1JY3O 1ZXGA 3HRNA 4HB1A 2KZIA 1NKNA 2B87A 4DJGA 1K73Q 1E79H 4JF7A 2ITAA 4ZKUA 3AE9C 1IFDA 1PP9G 4I7ZB 4HKZH 1VF5B 1WRGA 4IOIH 2BEZF 1OFCX 3JCUH 2PRRA 3H1LG 5AW5B 2N1TA 1M1JC 2HR3A 3V6IA 1ZLLA 2W6AA 4ZKPA 5AW9B 3RL0C 1QLED 2IBZI 4NPFX 1LT9C 2FYZA 1N7SD 3CWBJ 1BSHA 3L74J 3GMAA 1GU5A 4Y99C 2FYUK 2QJKC 2E75B 3M06A 4WY4C 3LIDA 2JDIH 3CCJP 4OGQC 4ZNCA 4PJ0H 4PJ0E 3RBZA 4JPZB 2FYUJ 2PFXA 3H1JE 1QL2A 1L0NK 2W6BA 1A02J 1ZW0A 2OYHB 5GTIH 2ZVNB 1X9VA 2PAJA 2R3SA 1YITP 4K3AA 5APXA 2WSFH 5APSA 5GTHE 1KN7A 5CBOA 1P84E 4EI2A 2MJZA 1L0NJ 4DOJA 3RK2D 3H1HD 1QX8A 1X22A 3HD7B 1VQ7P 3E1IA 2QJPC 3L73D 1GL2D 2QJYB 5AW1B 2VRSA 3CXHD 1QVFO 1RE4C 3Q5PA 2WSEJ 1GK4A 1PPJE 1L2PA 1KD1Q 2GUVA 1VQPP 3L70E 1IK7A 2WSEH 1SQVJ 4AQRD 1JY2N 1KB9I 5EFWB 2W27A 4HYTB 1JTHA 5KLVD 3TF5A 1BE3G 2KI7B 3TGUE 1SQQJ 3L75J 3R4YA 1FZBA 5KJ7C 1FZEA 4WB4A 2HG5D 2B9BA 4GOFA 1VQMP 2E42A 2P58A 3L37A 2K88A 1PGQA 1M1JB 1GMJA 3L71E 2E5YA 2NPSD 1U57A 1NTME 2JWDA 1LT9B 4GDOA 4W7ZA 2M3EA 2OTKE 2XNDH 1IK9A 1YHQP 1CI6A 3AE7C 3D70A 3G6EP 2E74B 3S4RA 1EDKA 2QJKB 3M9HA 2I1KA 1RQUA 2HPCA 3L72E 1BCCJ 1LTSC 2UWJE 4OGQB 3NTNA 1FZCC 1FDIA 2R32A 1GU4A 3AEAC 4BRYA 1CZQA 3A0BH 1GZLA 3H1JD 4QMAA 2JEEA 3VP9A 2HYNA 1SFCB 1LTAC 2K9JB 1P84D 2C0XA 3O6QB 1M1JA 3H1IG 4UB8H 3G9RA 2K37A 1N7SC 1YYCA 1LWUC 1PP9J 4DZOA 1LTJB 2ZYGA 2QJPB 2Y9ZA 1J1EC 3H1LJ 1KYOH 1PPJD 2AXTE 2I8DA 1JNMA 3L70D 2G3AA 4WY4A 2OYIB 4D6TE 2HFED 2OTLP 5TISE
chains in the Genus database with same CATH topology
2HLOA 2KLVA 4GKGA 1FOSF 1JY2P 5AVWB 1JY2O 3P7KA 3N7NA 1ZN5A 2XV5A 5BU5A 5AVZB 1HTLC 5AVUB 1FJPA 3U1CA 1MV8A 4WY4D 1T3JA 3RK2C 2OARA 3A7OA 3HTKA 2J59M 2IPPA 2YKOA 1NO4A 1N73B 2QM8A 3B5ND 1KILD 4O9BA 4OH8B 1GL2C 1X8YA 3IR9A 1AQ5A 3KYQA 3BRVB 3HUSA 1LTBC 3V2RA 3RL0B 3MUDA 3HE4B 5APWA 3VMXA 1IFJA 1RE4A 3HE5A 3TNUA 1FZAA 4GT1A 3H32A 1FBMA 2P1JA 1LGHB 1CW5A 3GHGA 1IFMA 1N7LA 2FFDA 1DH3A 1N86A 3U1AA 1H88A 5AVVB 4Y99B 3UIAA 1URQA 2YKQA 4WY4B 5APUA 2WT7B 1NTZK 5APTA 1GW4A 1CSBA 4RESB 3OJAB 5AW2B 4IFMA 5AVTB 2Z5HA 1FZCB 3LW5H 1JMMA 5KJ7A 1ZV8A 2XZRA 1GD2E 3P32A 4C7NB 4EIJA 3H6PA 1GW3A 2R3CA 1URQD 5CCHC 1SQXK 2R5DA 4I2LC 2FXMA 1Z56A 1VDFA 1DX7A 2O1KA 5AVQB 2NPSC 5CMZA 2WPQA 3R2PA 2BASA 1SFCC 3M0DC 2A45G 3V4WA 1RY3A 2Q7CA 1FOSE 5KJ7D 1RF1A 3V2PA 2KYVA 5CCGC 2WZ7A 3L36A 5AW3B 5BU8B 2KSJA 4W7YA 3HE5B 1J1EB 1NU1K 5AW7B 3H32B 2Q9IA 1LTJC 1MZ9A 1T2KC 2POHA 4C7RA 3II6A 3GHGB 1T8ZA 2FFDB 2C9LY 3VP8A 1IJDB 1SQVK 1OXZA 1URQB 3T97A 3KQGA 2YKPA 2WWWA 1FZCA 1JO5A 1RF0C 2OYIC 1SLQA 2XKMA 3KDPB 1NTMK 2J58A 2Z5IA 1JY3N 4C7NA 1LTIC 4M3LA 1SQQK 1JCDA 1L4AA 3B8EB 3C9IA 1ZR2A 5AVXB 2XU6A 2KOGA 2HODB 1HH0A 1S9KE 3BATA 2GM4A 4IFDK 1JY3P 1L0LK 1JY3O 1IFIA 3HRNA 1KZUB 2OYHA 3NXSA 5AVYB 5AW6B 1NKNA 3KPEA 2Q5UA 2IX7C 1X79B 1N7SA 4JF7A 1ZR4A 2H43A 1SQPK 4ZKUA 1LWUA 1IFDA 1GL2B 1WRGA 4LC1A 1VPCA 3HD7A 2QM7A 5CCGA 1L4AD 3I5CA 3M9BA 4B86A 5AW5B 1KQLA 1RF1B 2N1TA 1M1JC 3M0AA 3P8CE 3P8CD 1FZGA 3TSIA 1ZLLA 2W6AA 3N4XA 4ZKPA 5AW9B 3RL0C 3NFQA 2M3BA 4XE5B 2A45I 1LT9C 2FYZA 1N7SD 2N9BA 2P67A 2E43A 3U59A 1GU5A 2A45H 1NHLA 2KB7P 3LIEA 3RK3D 3HD7D 2FYUK 1RE3C 1SQBK 4Y99C 3M06A 3VTPC 4WY4C 4EOTA 3LIDA 2N1TD 3WMM0 2HODA 2ZXEB 2O1JA 1HUCA 3B5NC 1WT6A 1KILC 1T3UA 1L4AB 1E5WA 4KHXA 2Q3IA 1J1DC 2C9NY 3V4QA 1QL2A 1L0NK 2W6BA 1A02J 1GL2A 1FAVA 1H89A 1HGVA 2OYHB 4GIFA 1X9VA 2PAJA 2NPSB 1GK6A 1N7SB 5APXA 1LWUB 2WSFH 5APSA 2MJZA 2ZFCA 2R5BA 3RK2D 2I1JA 4DOJA 3RK3B 3MTUE 3HD7B 1HGZA 1G1IA 4I1LA 2N1TB 1LTGC 1MFZA 3HUSC 3E1IA 2GUSA 1GL2D 1LT9A 5AW1B 2VRSA 1N2DC 1RE4C 3L35A 3G3ZA 5CJ0A 1G2CA 1GK4A 1IFNA 1XTCC 4N78E 2GUVA 5CHXA 1HJBA 1LTTC 2FFDC 1FZFA 1FDMA 1YTZI 1NWQA 1G1JA 2WSEH 1EQ7A 4N6JA 5AW8B 1URQC 3V2QA 1HWTC 4AQRD 1JY2N 1NTKK 4XA4A 5APVA 4WBAA 2W27A 4HYTB 5CCHA 1JTHA 1S9KD 3RK2B 3L4FA 1MUUA 2H8PD 1A02F 2XNXA 3MD0A 3VMYA 2CPBA 2NPSA 1SFCA 3M0DA 1FZBA 5KJ7C 1FZEA 5CJ4A 5APQA 3IFMA 4HH2A 2YNYA 4WB4A 4C46A 2HG5D 2KP8A 3A2AA 1HVVA 1N73C 3SWYA 5KTBA 3V5BA 3P8MC 1JCCA 2IFNA 2P2UA 3VMZA 5CCHD 3M9QA 3BRTB 5AW4B 1KFNA 2E42A 1W2EA 2L5GB 1LTJA 1NH4A 3L37A 1M1JB 1GDTA 2NPSD 2P7JA 3VN0A 1QL1A 2FKWB 1SFCD 1LT9B 1RF1C 4W7ZA 1RF0A 1IC2A 2OYIA 1IK9A 2YMYA 1CI6A 1SVFA 1G2CB 2WSCH 5CCGD 3OAKA 4JYCA 3M9HA 2IFMA 2I1KA 4W80A 2HPCA 1T2KD 2C0WA 5BVZA 1LTSC 1SP4A 4IFFA 1JUNA 3NTNA 1IO4A 1FZCC 2R32A 2WTYA 3B5NB 1FJKA 2O01H 1GU4A 1KILB 1JTHB 1NKZB 1CZQA 5APYA 1GZLA 2JEEA 1J1DB 3VP9A 4AUWA 2LKMA 3CL3D 5AVRB 2WITA 5AVSB 1NOHA 2HYNA 1L4AC 1SFCB 1LTAC 3CI9A 3SWFA 1N73A 1H8AA 3HTKB 2C0XA 3BVHA 3TK1A 2H7HA 2OYHC 1NAFA 1M1JA 3M91A 1N7SC 1YYCA 3BASA 3CLQA 1LWUC 2PP6A 4DZOA 3OA7A 1PFIA 1LTJB 2WPRA 3PP5A 3HE4A 5KLVK 2YO2A 1KFMA 5AW0B 3VYIA 1XTGB 3HUSB 1HBWA 2M8RA 3RK3C 3HD7C 1J1EC 4JYBA 2Z4EA 3NMDA 2YO3A 3TYYA 2JJLA 2XDJA 3A5TA 3VOPA 4N3YB 2N1TC 1DEBA 3TNUB 4N78D 3EFGA 3GHGC 1JNMA 1RE3A 3EQ2A 2CPSA 2OYIB 1JOCA 4WY4A 2WT7A 3MGNA 3V2NA 1CI6B 1FU1A 4LGDE 2HFED 4I6MC 1GTWA 3A3YB 1J2JB 3RL0D 4AYCA 3B5NA 3O8ZA 1KILA 2HPCB 3MIWA 1AFOA 2WPSA 1OWAA 1YTZT 1M7LA 4LLHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2HLO A;  1RF0 C;  2HOD A;  1RF1 A;  2OYI C;  2XNX A;  1JY2 P;  1M1J B;  1N73 A;  2HPC A;  1W2E A;  1JY2 O;  2A45 I;  1LT9 C;  3HUS A;  2H43 A;  1LWU A;  1T3U A;  3BVH A;  3GHG C;  2FFD C;  1RE3 A;  1FZB A;  1FZE A;  3H32 B;  1FZF A;  2Q9I A;  2OYI B;  1LTJ C;  1FZC C;  2OYH C;  1JY3 N;  1M1J A;  1LT9 B;  1RF1 C;  2A45 H;  1RE4 A;  3GHG B;  1FZA A;  1RF0 A;  1JY2 N;  3H32 A;  3HUS C;  2FFD B;  3E1I A;  1LWU C;  2OYI A;  2OYH A;  1N73 C;  1FZC B;  1LTJ B;  2HOD B;  2OYH B;  1LT9 A;  1RE3 C;  2A45 G;  1RF1 B;  3GHG A;  1M1J C;  1JY3 P;  2HPC B;  3HUS B;  1FZG A;  1N73 B;  2FFD A;  1JY3 O;  1N86 A;  1RE4 C;  1LWU B;  1LTJ A;  1FZC A;  2Z4E A; 
#chains in the Genus database with same CATH topology
 1SS1 A;  2KUB A;  1JY2 P;  1K05 A;  2ZT9 D;  3CCV P;  1ZN5 A;  3H1K G;  4KJM A;  5H2F H;  3A0H E;  3SSU A;  3RK2 C;  3Q1M A;  2OAR A;  2WPV B;  3A7O A;  5E79 E;  3CC4 P;  3O6Q A;  1ZRT E;  3S1K A;  3CME P;  1KB9 E;  4OH8 B;  1GL2 C;  3AEC C;  3IR9 A;  4RKU J;  1PGP A;  1LTB C;  3V2R A;  2A06 E;  2WSS H;  2WSC J;  3QWO C;  1NTM D;  5KAF H;  5APW A;  1IFJ A;  1RE4 A;  1EXJ A;  4YXD C;  2FYN C;  1T6A A;  3UIA A;  1NTZ K;  3L72 D;  3GLM A;  2QA4 P;  2IBZ D;  3AE1 C;  4L76 A;  1M57 D;  2Z5H A;  1FZC B;  3AE5 C;  2R44 A;  1BGY G;  5KJ7 A;  3P32 A;  4C7N B;  4EIJ A;  1GW3 A;  1QVG O;  1SQX K;  1L0L G;  2KSE A;  1BE3 J;  1DX7 A;  1YBK A;  2NPS C;  4PV1 D;  5CMZ A;  3R2P A;  2BAS A;  3D71 A;  3AEB C;  1SQB D;  1SQX J;  1RY3 A;  3CWB G;  1M8O B;  3L74 G;  3V2P A;  2KYV A;  1KMI Z;  2AEF A;  5BU8 B;  3FX0 A;  1J1E B;  1S4X A;  3H32 B;  3CX5 I;  4BWN A;  1MZ9 A;  3II6 A;  3WUT A;  2FFD B;  1IJD B;  1OXZ A;  5B5E H;  1EZV I;  3KQG A;  1FZC A;  1RF0 C;  2FYU G;  1DD3 A;  2Z5I A;  4C7N A;  1LTI C;  4M3L A;  2W90 A;  1YIJ P;  1S9K E;  1ZRT D;  3FWL A;  1L0N G;  1KB9 D;  5AVY B;  4GOD A;  1N7S A;  2H43 A;  1SQP K;  1LWU A;  1GL2 B;  1VPC A;  3I55 P;  2QM7 A;  1JEK A;  3PLN A;  2QSI A;  1NTK E;  4B86 A;  1USE A;  1RF1 B;  1SQP J;  3RBX A;  3N4X A;  1OIP A;  2N9B A;  2E43 A;  3LW5 J;  2ZT9 C;  1NHL A;  3SWK A;  3T97 B;  3LIE A;  4TT3 H;  3RK3 D;  1OVR A;  3L75 G;  3AED C;  3ZDM A;  4PD4 I;  3H1I E;  2D2C D;  1L4A B;  1M1K Q;  2C9N Y;  3V4Q A;  1GL2 A;  1FAV A;  1H89 A;  1HGV A;  2O3J A;  2NPS B;  2Y9Y A;  2ZFC A;  3H1H E;  1HGZ A;  3CCS P;  3PTZ A;  2N1T B;  2WQY C;  1EDI A;  3HUS C;  2Y0D A;  2GUS A;  3L73 E;  3MUD C;  3AE8 C;  3CXH E;  1BCC G;  1W5C E;  5CBN A;  3H1K E;  1RQV A;  1G2C A;  1HJB A;  3PHL A;  1FDM A;  1YTZ I;  2JO1 A;  4IL6 H;  3SFE C;  1HWT C;  4XA4 A;  3CX5 E;  4DCK A;  4JBZ A;  1S9K D;  1S5L H;  2MKV A;  3L4F A;  4PV1 C;  4UB6 E;  3WUV A;  1A02 F;  3MD0 A;  1QEX A;  1Q7Y Q;  1EZV E;  2CPB A;  1YI2 P;  2NPS A;  1BGY J;  1OW7 A;  5CJ4 A;  1M90 Q;  2YNY A;  1PL5 A;  3CCE P;  3A2A A;  1L0L J;  3P8M C;  1NTK D;  2P2U A;  4L75 A;  1KIL E;  3VMZ A;  5AW4 B;  1KFN A;  1W2E A;  2L5G B;  4ASW A;  2W83 C;  2Y0E A;  2P7J A;  3VN0 A;  2AEM A;  2YXR B;  2FKW B;  2QEX P;  1D7M A;  1RF0 A;  1IC2 A;  3KHU A;  2YMY A;  4BXL A;  2KXP B;  2ZT9 B;  3SFD C;  4JYC A;  3H1I D;  5BVZ A;  1EXI A;  2QVA A;  1FJK A;  3GG2 A;  5KAI H;  5KAI E;  1JTH B;  2WSF J;  1KTM A;  1HF9 A;  3L74 E;  1VQ5 P;  2KS1 A;  3CL3 D;  2DW3 A;  5AVS B;  3CMA P;  2L91 A;  1M56 D;  5GTH H;  1P84 H;  4Z1M H;  2IZ0 A;  1AA0 A;  2IYO A;  2H7H A;  2B88 A;  4PD4 E;  1NAF A;  2ZAE B;  3M91 A;  2PP6 A;  3OA7 A;  2WPR A;  3HE4 A;  2FYU E;  3VMA A;  3HUS B;  1HBW A;  1N8R Q;  1S3J A;  3RK3 C;  5KKZ C;  4JYB A;  2Z4E A;  2YO3 A;  3H1K D;  3TYY A;  2JJL A;  4DT0 A;  1KV4 A;  3TNU B;  3EQ2 A;  1BDD A;  1JOC A;  2Q6Q A;  1CI6 B;  1U7J A;  1FU1 A;  2D2C C;  1K9M Q;  1NTZ G;  1L0N E;  3CX5 D;  3TGU J;  3O8Z A;  2HPC B;  1AFO A;  2WPS A;  1OWA A;  1YTZ T;  4LLH A;  2KLV A;  4GKG A;  1Q86 Q;  4PV1 B;  1EZV D;  1VQ9 P;  3N7N A;  1Y8A A;  2OGU A;  3EWK A;  3FGA D;  4BRY B;  1PGJ A;  5AVZ B;  3TDK A;  3U1C A;  1SQX G;  2AXC A;  3L71 J;  1NO4 A;  1SQV E;  3B5N D;  1KIL D;  4O9B A;  1AQ5 A;  2JKV A;  4HJG H;  1ZOY C;  3HUS A;  2IDB A;  3RL0 B;  3MUD A;  3W67 A;  3CCR P;  3TNU A;  1FZA A;  1SQQ E;  3L75 E;  4GT1 A;  1KQF B;  1IFM A;  1OVV A;  2BCC G;  1YJN P;  5AVV B;  4Y99 B;  4WY4 B;  1CSB A;  2IBZ E;  4RES B;  3OJA B;  4IFM A;  2LXC B;  5AVT B;  3L74 D;  1JMM A;  1ZP0 C;  3BCC E;  1URQ D;  2R5D A;  5M1B A;  3H25 A;  2FXM A;  1Z56 A;  1VDF A;  4PD4 D;  2YIU C;  1SQP G;  3E7K A;  3M0D C;  2FYU D;  1SQB E;  3V4W A;  1S72 P;  4D6T J;  3Q5S A;  4WVZ A;  2AXT H;  4KT0 J;  1NU1 K;  4C7R A;  2KZJ A;  3JC2 2;  1L0N D;  1VF5 D;  2D2C B;  3D6Y A;  5TIS H;  3CC7 P;  1NU1 J;  1PP9 E;  1SLQ A;  3IF4 A;  2XKM A;  4U7J A;  3KDP B;  1VQO P;  4U3F J;  3ITK A;  3H1L E;  1JCD A;  3A0H H;  2YXQ B;  1LP1 A;  3C9I A;  1Y9B A;  5E79 H;  1AJY A;  2HOD B;  5K5G B;  1HH0 A;  4JQ0 D;  1JY3 P;  1SQV D;  1IFI A;  1KB9 H;  3NXS A;  5AW6 B;  2FY8 A;  3KPE A;  2Q5U A;  2IX7 C;  1X79 B;  3KZI E;  3KZI H;  2E75 D;  2OTJ P;  1VQK P;  3GW6 A;  3Q2Y A;  5DJT B;  4LC1 A;  2QRX A;  5CCG A;  1SQQ D;  3L75 D;  3P8C D;  1WMK A;  3USS A;  3AEF C;  2ZYD A;  3U59 A;  2A45 H;  2K3R A;  3CPW O;  3RK3 E;  3HD7 D;  2LXB A;  1RE3 C;  1NTZ J;  3WMM 0;  2HOD A;  1OW6 A;  3BCC D;  2ZXE B;  2RH0 A;  3FXD A;  2O1J A;  4R4L A;  1AVO A;  1HUC A;  1K04 A;  1FDO A;  3B5N C;  1WT6 A;  3OW2 O;  1KIL C;  1E5W A;  4KHX A;  1BCC D;  3G71 P;  4Y28 J;  4GIF A;  2M5A B;  1N7S B;  2LR2 A;  1LWU B;  2ZJS E;  4H13 D;  1KQS O;  1YQ3 C;  2OQQ A;  4EYY Q;  4EDF A;  2E5T A;  1LTG C;  1MFZ A;  1BE3 E;  3Q3D A;  3H1J G;  3L35 A;  3C8V A;  1PP9 D;  4IL6 X;  1OZH A;  2BCC J;  1FZF A;  3PJS K;  3AEG C;  1NWQ A;  3H1L D;  1G1J A;  4N6J A;  1URQ C;  3V2Q A;  1S5L X;  1NTK K;  3RK2 B;  1LT1 A;  2H8P D;  1NGM B;  2XNX A;  2M5A A;  2E74 D;  3M0D A;  2W8Z A;  1RHZ B;  1PPJ G;  5APQ A;  2KK7 A;  1HVV A;  3V5B A;  1JCC A;  5CCH D;  3BRT B;  1BDC A;  1NH4 A;  5B66 E;  1VF5 C;  2FYN B;  2IZ1 A;  1R5L A;  1QL1 A;  1SFC D;  3TGU G;  1SVF A;  1G2C B;  5CCG D;  3AE3 C;  3I56 P;  2IFM A;  4TLF A;  2KNC A;  2V7Q H;  1SP4 A;  1SQP E;  1JUN A;  4H44 D;  2E75 C;  2Q3E A;  3B5N B;  3L71 G;  1QGK B;  1KIL B;  2KLU A;  2GA1 A;  4AUW A;  1P84 I;  2ZXX A;  3MHV A;  3H1H J;  2WIT A;  3CD6 P;  3SWF A;  4RO0 A;  1N73 A;  1H8A A;  2O01 N;  3L73 J;  3WU2 E;  1PIX A;  2FBW C;  3L72 G;  2OYH C;  4ASV A;  5KLV K;  2YO2 A;  1BE3 D;  1KFM A;  1XTG B;  3CXH H;  2M8R A;  3HD7 C;  3NMD A;  5L8R J;  2XDJ A;  4N3Y B;  1NVO A;  1RE3 A;  2WT7 A;  3V2N A;  5KLV J;  2JWA A;  1VQN P;  1EC5 A;  1KQG B;  3CX5 H;  4YTP C;  3B5N A;  1KIL A;  4ZMD A;  4UB6 H;  1Q82 Q;  1JMB A;  1FOS F;  5AVW B;  1JY2 O;  5BU5 A;  4H13 C;  1S1C X;  3E1R A;  2KS1 B;  3FWN A;  2J59 M;  4OWF A;  2YKO A;  4D6T G;  1HJ0 A;  3PRJ A;  2ZVO B;  1X8Y A;  3BRV B;  2QG4 A;  3HE4 B;  3VMX A;  3HE5 A;  1W2B O;  3JCU E;  1BGY E;  1UII A;  1NU1 G;  3GHG A;  1N86 A;  1L0L E;  4U3F G;  1URQ A;  2YKQ A;  5APU A;  3H1J J;  5APT A;  3ABV C;  1SQP D;  1GW4 A;  4MN4 C;  4YPC A;  4R4M A;  4K35 A;  2A06 G;  2E74 C;  3CWB E;  3IN6 A;  1ZV8 A;  1GD2 E;  2V4H A;  2R3C A;  5CCH C;  4I2L C;  4NPE A;  1EDL A;  3C1L A;  4PD4 H;  2O1K A;  5AVQ B;  1LJ2 A;  5GTI E;  3AE2 C;  4WWI A;  1SFC C;  2A45 G;  1KOR A;  1KYO I;  3L70 J;  2Q7C A;  2P10 A;  1FOS E;  2K9Y A;  5CCG C;  3F5H A;  5AW3 B;  2KSJ A;  4W7Y A;  2WMM A;  2Q9I A;  1LTJ C;  1OX3 A;  2Y0C A;  1T8Z A;  1VQL P;  2RN0 A;  1YQ4 C;  4H44 C;  3CCQ P;  1SQV K;  1KC8 Q;  5TJH A;  2WWW A;  1Q81 Q;  2OYI C;  3GF7 A;  1K8A Q;  1VQ6 P;  1NTM K;  2J58 A;  1JY3 N;  1SQQ K;  3AE6 C;  4H13 B;  5AVX B;  2XU6 A;  3PH0 A;  2RMZ A;  3KXD A;  1KZU B;  2OYH A;  2PGD A;  1NTM J;  4CPG A;  3QH9 A;  1ZME C;  1ZR4 A;  1OMI A;  1NAY A;  1JB0 J;  1S2E A;  4L73 A;  3HD7 A;  1BGY D;  1L4A D;  3I5C A;  2M0B A;  3AEE C;  3M9B A;  1KQL A;  3L72 J;  1PGO A;  3Q5R A;  5C39 A;  3M0A A;  3P8C E;  1FZG A;  3TSI A;  2E76 D;  1L0L D;  3NFQ A;  1NYH A;  1UIX A;  2M3B A;  4XE5 B;  1H0T B;  2A45 I;  3MP7 B;  1RH5 B;  2P67 A;  1VQ4 P;  1U7M A;  3BCC J;  1NJI Q;  2KB7 P;  1AVY A;  1SQB K;  3CWB D;  1EDJ A;  2CK3 H;  3VTP C;  4EOT A;  4A7P A;  2N1T D;  1NTK G;  1T3U A;  2FXP A;  1LP1 B;  1SQB J;  2Q3I A;  3S9O A;  1J1D C;  3A0B E;  1BCC E;  5DJU B;  2H88 C;  1DD4 A;  1GK6 A;  4H0L D;  4NPD A;  3CCM P;  4RJT A;  1YJW P;  2R5B A;  2I1J A;  3RK3 B;  3MTU E;  5KKZ B;  1AQT A;  1FE6 A;  1G1I A;  1H0T A;  4UB8 E;  4I1L A;  1R5S A;  1R8E A;  1LT9 A;  3CC2 P;  4XFJ A;  1DEE G;  1N2D C;  3JSV C;  3G3Z A;  4H44 B;  5CJ0 A;  1KYO E;  1IFN A;  1XTC C;  4N78 E;  5CHX A;  1LTT C;  2FFD C;  3RGU A;  4OVN F;  1EQ7 A;  3H1H G;  5AW8 B;  3F89 A;  5APV A;  2SPZ A;  4WBA A;  1TU3 F;  5CCH A;  3D6Z A;  3L73 G;  1MUU A;  2WVR A;  3VMY A;  3TGU D;  2JR8 A;  1SFC A;  1NU1 E;  2K9J A;  3IFM A;  5H2F E;  4HH2 A;  4C46 A;  2KP8 A;  1LNQ A;  3B4S A;  1N73 C;  3SWY A;  5KTB A;  1VQ8 P;  4U3F E;  2IFN A;  4L74 A;  3M9Q A;  1LTJ A;  1BSN A;  5KLV G;  2AEJ A;  2QE7 H;  1IFP A;  1GDT A;  3L71 D;  4YXW H;  1EZV G;  5KAF E;  3FXE A;  1RF1 C;  3W68 A;  1FS0 E;  2N9Y B;  2OYI A;  2WSC H;  3OAK A;  2K1A A;  2O01 J;  4W80 A;  1T2K D;  3G4S P;  2C0W A;  4IFF A;  1MKM A;  3EFF K;  1IO4 A;  2WTY A;  2O01 H;  2G8Y A;  1NKZ B;  5APY A;  3RL0 g;  3MZW B;  1J1D B;  2LKM A;  5AVR B;  2YIU B;  1NOH A;  1L4A C;  3CI9 A;  3HTK B;  3BVH A;  3B71 A;  1NTZ E;  2FXO A;  2E76 C;  3TK1 A;  2QIW A;  1PV3 A;  1VL2 A;  3CXH I;  3BAS A;  3CLQ A;  1AV1 A;  1PFI A;  3PP5 A;  5AW0 B;  3VYI A;  2H89 C;  1KYO D;  3VOP A;  2N1T C;  1DEB A;  4N78 D;  3EFG A;  3GHG C;  1SQX E;  2CPS A;  3MGN A;  1Q2N A;  4LGD E;  4D6T D;  4I6M C;  1GTW A;  5KLI C;  3A3Y B;  1J2J B;  3RL0 D;  4AYC A;  5B5E E;  2KNC B;  3MIW A;  2YMK A;  3H6P A;  3A5T A;  1M7L A;  2HLO A;  2BEQ D;  2J5U A;  2KIK A;  3P7K A;  4H0L C;  2XV5 A;  1NTK J;  1HTL C;  5AVU B;  1NU1 D;  1FJP A;  1MV8 A;  3CCU P;  4WY4 D;  1T3J A;  3HTK A;  3L70 G;  2IPP A;  4OGQ D;  2ZYA A;  2BCC E;  4U3F D;  1FC2 C;  1N73 B;  2QM8 A;  5B66 H;  4I7Z C;  3K5B A;  3KYQ A;  2A06 D;  3H32 A;  1FBM A;  2P1J A;  1LGH B;  1CW5 A;  3H1I J;  2V7Q J;  1N7L A;  2FFD A;  1DH3 A;  3U1A A;  1H88 A;  1DIP A;  2NRG A;  1SQV G;  2WT7 B;  2Q1K A;  2NZ2 A;  3WUU A;  1PZQ A;  3AE4 C;  1JM0 A;  5AW2 B;  1NTM G;  2IYP A;  1SQQ G;  3LW5 H;  1OVU A;  2XZR A;  1USD A;  3WU2 H;  1NTZ D;  2OYO A;  1Q90 D;  2E76 B;  2WPQ A;  3H1K J;  2IBZ G;  2B87 B;  1X0T A;  5KJ7 D;  1RF1 A;  3CCL P;  2WZ7 A;  3L36 A;  3BCC G;  3HE5 B;  5AW7 B;  1SQX D;  2QJY C;  1T2K C;  2POH A;  3GHG B;  1YJ9 P;  2C9L Y;  3VP8 A;  3IAO A;  2RKL A;  1URQ B;  4GOE A;  3T97 A;  5KLI B;  2YKP A;  1IZN B;  1JO5 A;  2JP3 A;  1SQB G;  3GF3 A;  1OW8 A;  1Y47 A;  4IL6 E;  4H0L B;  1L4A A;  3B8E B;  1ZR2 A;  2KOG A;  1MFT A;  2B89 A;  2BCC D;  3BAT A;  5KLV E;  2W6J H;  2GM4 A;  1S5L E;  4IFD K;  1L0L K;  1JY3 O;  1ZXG A;  3HRN A;  4HB1 A;  2KZI A;  1NKN A;  2B87 A;  4DJG A;  1K73 Q;  1E79 H;  4JF7 A;  2ITA A;  4ZKU A;  3AE9 C;  1IFD A;  1PP9 G;  4I7Z B;  4HKZ H;  1VF5 B;  1WRG A;  4IOI H;  2BEZ F;  1OFC X;  3JCU H;  2PRR A;  3H1L G;  5AW5 B;  2N1T A;  1M1J C;  2HR3 A;  3V6I A;  1ZLL A;  2W6A A;  4ZKP A;  5AW9 B;  3RL0 C;  1QLE D;  2IBZ I;  4NPF X;  1LT9 C;  2FYZ A;  1N7S D;  3CWB J;  1BSH A;  3L74 J;  3GMA A;  1GU5 A;  4Y99 C;  2FYU K;  2QJK C;  2E75 B;  3M06 A;  4WY4 C;  3LID A;  2JDI H;  3CCJ P;  4OGQ C;  4ZNC A;  4PJ0 H;  4PJ0 E;  3RBZ A;  4JPZ B;  2FYU J;  2PFX A;  3H1J E;  1QL2 A;  1L0N K;  2W6B A;  1A02 J;  1ZW0 A;  2OYH B;  5GTI H;  2ZVN B;  1X9V A;  2PAJ A;  2R3S A;  1YIT P;  4K3A A;  5APX A;  2WSF H;  5APS A;  5GTH E;  1KN7 A;  5CBO A;  1P84 E;  4EI2 A;  2MJZ A;  1L0N J;  4DOJ A;  3RK2 D;  3H1H D;  1QX8 A;  1X22 A;  3HD7 B;  1VQ7 P;  3E1I A;  2QJP C;  3L73 D;  1GL2 D;  2QJY B;  5AW1 B;  2VRS A;  3CXH D;  1QVF O;  1RE4 C;  3Q5P A;  2WSE J;  1GK4 A;  1PPJ E;  1L2P A;  1KD1 Q;  2GUV A;  1VQP P;  3L70 E;  1IK7 A;  2WSE H;  1SQV J;  4AQR D;  1JY2 N;  1KB9 I;  5EFW B;  2W27 A;  4HYT B;  1JTH A;  5KLV D;  3TF5 A;  1BE3 G;  2KI7 B;  3TGU E;  1SQQ J;  3L75 J;  3R4Y A;  1FZB A;  5KJ7 C;  1FZE A;  4WB4 A;  2HG5 D;  2B9B A;  4GOF A;  1VQM P;  2E42 A;  2P58 A;  3L37 A;  2K88 A;  1PGQ A;  1M1J B;  1GMJ A;  3L71 E;  2E5Y A;  2NPS D;  1U57 A;  1NTM E;  2JWD A;  1LT9 B;  4GDO A;  4W7Z A;  2M3E A;  2OTK E;  2XND H;  1IK9 A;  1YHQ P;  1CI6 A;  3AE7 C;  3D70 A;  3G6E P;  2E74 B;  3S4R A;  1EDK A;  2QJK B;  3M9H A;  2I1K A;  1RQU A;  2HPC A;  3L72 E;  1BCC J;  1LTS C;  2UWJ E;  4OGQ B;  3NTN A;  1FZC C;  1FDI A;  2R32 A;  1GU4 A;  3AEA C;  4BRY A;  1CZQ A;  3A0B H;  1GZL A;  3H1J D;  4QMA A;  2JEE A;  3VP9 A;  2HYN A;  1SFC B;  1LTA C;  2K9J B;  1P84 D;  2C0X A;  3O6Q B;  1M1J A;  3H1I G;  4UB8 H;  3G9R A;  2K37 A;  1N7S C;  1YYC A;  1LWU C;  1PP9 J;  4DZO A;  1LTJ B;  2ZYG A;  2QJP B;  2Y9Z A;  1J1E C;  3H1L J;  1KYO H;  1PPJ D;  2AXT E;  2I8D A;  1JNM A;  3L70 D;  2G3A A;  4WY4 A;  2OYI B;  4D6T E;  2HFE D;  2OTL P;  5TIS E; 
#chains in the Genus database with same CATH homology
 2HLO A;  2KLV A;  4GKG A;  1FOS F;  1JY2 P;  5AVW B;  1JY2 O;  3P7K A;  3N7N A;  1ZN5 A;  2XV5 A;  5BU5 A;  5AVZ B;  1HTL C;  5AVU B;  1FJP A;  3U1C A;  1MV8 A;  4WY4 D;  1T3J A;  3RK2 C;  2OAR A;  3A7O A;  3HTK A;  2J59 M;  2IPP A;  2YKO A;  1NO4 A;  1N73 B;  2QM8 A;  3B5N D;  1KIL D;  4O9B A;  4OH8 B;  1GL2 C;  1X8Y A;  3IR9 A;  1AQ5 A;  3KYQ A;  3BRV B;  3HUS A;  1LTB C;  3V2R A;  3RL0 B;  3MUD A;  3HE4 B;  5APW A;  3VMX A;  1IFJ A;  1RE4 A;  3HE5 A;  3TNU A;  1FZA A;  4GT1 A;  3H32 A;  1FBM A;  2P1J A;  1LGH B;  1CW5 A;  3GHG A;  1IFM A;  1N7L A;  2FFD A;  1DH3 A;  1N86 A;  3U1A A;  1H88 A;  5AVV B;  4Y99 B;  3UIA A;  1URQ A;  2YKQ A;  4WY4 B;  5APU A;  2WT7 B;  1NTZ K;  5APT A;  1GW4 A;  1CSB A;  4RES B;  3OJA B;  5AW2 B;  4IFM A;  5AVT B;  2Z5H A;  1FZC B;  3LW5 H;  1JMM A;  5KJ7 A;  1ZV8 A;  2XZR A;  1GD2 E;  3P32 A;  4C7N B;  4EIJ A;  3H6P A;  1GW3 A;  2R3C A;  1URQ D;  5CCH C;  1SQX K;  2R5D A;  4I2L C;  2FXM A;  1Z56 A;  1VDF A;  1DX7 A;  2O1K A;  5AVQ B;  2NPS C;  5CMZ A;  2WPQ A;  3R2P A;  2BAS A;  1SFC C;  3M0D C;  2A45 G;  3V4W A;  1RY3 A;  2Q7C A;  1FOS E;  5KJ7 D;  1RF1 A;  3V2P A;  2KYV A;  5CCG C;  2WZ7 A;  3L36 A;  5AW3 B;  5BU8 B;  2KSJ A;  4W7Y A;  3HE5 B;  1J1E B;  1NU1 K;  5AW7 B;  3H32 B;  2Q9I A;  1LTJ C;  1MZ9 A;  1T2K C;  2POH A;  4C7R A;  3II6 A;  3GHG B;  1T8Z A;  2FFD B;  2C9L Y;  3VP8 A;  1IJD B;  1SQV K;  1OXZ A;  1URQ B;  3T97 A;  3KQG A;  2YKP A;  2WWW A;  1FZC A;  1JO5 A;  1RF0 C;  2OYI C;  1SLQ A;  2XKM A;  3KDP B;  1NTM K;  2J58 A;  2Z5I A;  1JY3 N;  4C7N A;  1LTI C;  4M3L A;  1SQQ K;  1JCD A;  1L4A A;  3B8E B;  3C9I A;  1ZR2 A;  5AVX B;  2XU6 A;  2KOG A;  2HOD B;  1HH0 A;  1S9K E;  3BAT A;  2GM4 A;  4IFD K;  1JY3 P;  1L0L K;  1JY3 O;  1IFI A;  3HRN A;  1KZU B;  2OYH A;  3NXS A;  5AVY B;  5AW6 B;  1NKN A;  3KPE A;  2Q5U A;  2IX7 C;  1X79 B;  1N7S A;  4JF7 A;  1ZR4 A;  2H43 A;  1SQP K;  4ZKU A;  1LWU A;  1IFD A;  1GL2 B;  1WRG A;  4LC1 A;  1VPC A;  3HD7 A;  2QM7 A;  5CCG A;  1L4A D;  3I5C A;  3M9B A;  4B86 A;  5AW5 B;  1KQL A;  1RF1 B;  2N1T A;  1M1J C;  3M0A A;  3P8C E;  3P8C D;  1FZG A;  3TSI A;  1ZLL A;  2W6A A;  3N4X A;  4ZKP A;  5AW9 B;  3RL0 C;  3NFQ A;  2M3B A;  4XE5 B;  2A45 I;  1LT9 C;  2FYZ A;  1N7S D;  2N9B A;  2P67 A;  2E43 A;  3U59 A;  1GU5 A;  2A45 H;  1NHL A;  2KB7 P;  3LIE A;  3RK3 D;  3HD7 D;  2FYU K;  1RE3 C;  1SQB K;  4Y99 C;  3M06 A;  3VTP C;  4WY4 C;  4EOT A;  3LID A;  2N1T D;  3WMM 0;  2HOD A;  2ZXE B;  2O1J A;  1HUC A;  3B5N C;  1WT6 A;  1KIL C;  1T3U A;  1L4A B;  1E5W A;  4KHX A;  2Q3I A;  1J1D C;  2C9N Y;  3V4Q A;  1QL2 A;  1L0N K;  2W6B A;  1A02 J;  1GL2 A;  1FAV A;  1H89 A;  1HGV A;  2OYH B;  4GIF A;  1X9V A;  2PAJ A;  2NPS B;  1GK6 A;  1N7S B;  5APX A;  1LWU B;  2WSF H;  5APS A;  2MJZ A;  2ZFC A;  2R5B A;  3RK2 D;  2I1J A;  4DOJ A;  3RK3 B;  3MTU E;  3HD7 B;  1HGZ A;  1G1I A;  4I1L A;  2N1T B;  1LTG C;  1MFZ A;  3HUS C;  3E1I A;  2GUS A;  1GL2 D;  1LT9 A;  5AW1 B;  2VRS A;  1N2D C;  1RE4 C;  3L35 A;  3G3Z A;  5CJ0 A;  1G2C A;  1GK4 A;  1IFN A;  1XTC C;  4N78 E;  2GUV A;  5CHX A;  1HJB A;  1LTT C;  2FFD C;  1FZF A;  1FDM A;  1YTZ I;  1NWQ A;  1G1J A;  2WSE H;  1EQ7 A;  4N6J A;  5AW8 B;  1URQ C;  3V2Q A;  1HWT C;  4AQR D;  1JY2 N;  1NTK K;  4XA4 A;  5APV A;  4WBA A;  2W27 A;  4HYT B;  5CCH A;  1JTH A;  1S9K D;  3RK2 B;  3L4F A;  1MUU A;  2H8P D;  1A02 F;  2XNX A;  3MD0 A;  3VMY A;  2CPB A;  2NPS A;  1SFC A;  3M0D A;  1FZB A;  5KJ7 C;  1FZE A;  5CJ4 A;  5APQ A;  3IFM A;  4HH2 A;  2YNY A;  4WB4 A;  4C46 A;  2HG5 D;  2KP8 A;  3A2A A;  1HVV A;  1N73 C;  3SWY A;  5KTB A;  3V5B A;  3P8M C;  1JCC A;  2IFN A;  2P2U A;  3VMZ A;  5CCH D;  3M9Q A;  3BRT B;  5AW4 B;  1KFN A;  2E42 A;  1W2E A;  2L5G B;  1LTJ A;  1NH4 A;  3L37 A;  1M1J B;  1GDT A;  2NPS D;  2P7J A;  3VN0 A;  1QL1 A;  2FKW B;  1SFC D;  1LT9 B;  1RF1 C;  4W7Z A;  1RF0 A;  1IC2 A;  2OYI A;  1IK9 A;  2YMY A;  1CI6 A;  1SVF A;  1G2C B;  2WSC H;  5CCG D;  3OAK A;  4JYC A;  3M9H A;  2IFM A;  2I1K A;  4W80 A;  2HPC A;  1T2K D;  2C0W A;  5BVZ A;  1LTS C;  1SP4 A;  4IFF A;  1JUN A;  3NTN A;  1IO4 A;  1FZC C;  2R32 A;  2WTY A;  3B5N B;  1FJK A;  2O01 H;  1GU4 A;  1KIL B;  1JTH B;  1NKZ B;  1CZQ A;  5APY A;  1GZL A;  2JEE A;  1J1D B;  3VP9 A;  4AUW A;  2LKM A;  3CL3 D;  5AVR B;  2WIT A;  5AVS B;  1NOH A;  2HYN A;  1L4A C;  1SFC B;  1LTA C;  3CI9 A;  3SWF A;  1N73 A;  1H8A A;  3HTK B;  2C0X A;  3BVH A;  3TK1 A;  2H7H A;  2OYH C;  1NAF A;  1M1J A;  3M91 A;  1N7S C;  1YYC A;  3BAS A;  3CLQ A;  1LWU C;  2PP6 A;  4DZO A;  3OA7 A;  1PFI A;  1LTJ B;  2WPR A;  3PP5 A;  3HE4 A;  5KLV K;  2YO2 A;  1KFM A;  5AW0 B;  3VYI A;  1XTG B;  3HUS B;  1HBW A;  2M8R A;  3RK3 C;  3HD7 C;  1J1E C;  4JYB A;  2Z4E A;  3NMD A;  2YO3 A;  3TYY A;  2JJL A;  2XDJ A;  3A5T A;  3VOP A;  4N3Y B;  2N1T C;  1DEB A;  3TNU B;  4N78 D;  3EFG A;  3GHG C;  1JNM A;  1RE3 A;  3EQ2 A;  2CPS A;  2OYI B;  1JOC A;  4WY4 A;  2WT7 A;  3MGN A;  3V2N A;  1CI6 B;  1FU1 A;  4LGD E;  2HFE D;  4I6M C;  1GTW A;  3A3Y B;  1J2J B;  3RL0 D;  4AYC A;  3B5N A;  3O8Z A;  1KIL A;  2HPC B;  3MIW A;  1AFO A;  2WPS A;  1OWA A;  1YTZ T;  1M7L A;  4LLH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...