1N73A

Fibrin d-dimer, lamprey complexed with the peptide ligand: gly-his-arg-pro-amide
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
91
structure length
91
Chain Sequence
EVLRELERRIIHLQRRINMQLQQLTLLQHNIKTQVSQILRVEVDIDVALRACKGSCARYLEYRLDKEKNLQLEKAASYIANLKFERFEEVV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title The Crystal structure of fragment double-D from cross-linked lamprey fibrin reveals isopeptide linkages across an unexpected D-D interface
pubmed doi rcsb
molecule tags Blood clotting
molecule keywords Fibrin alpha-1 chain
total genus 30
structure length 91
sequence length 91
chains with identical sequence D
ec nomenclature
pdb deposition date 2002-11-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.50 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 1n73A00
1M1JA 2HPCA 1FZBA 3HUSC 1LT9A 1FZCA 2OYIA 1LTJB 2Z4EA 2FFDA 1JY2N 2FFDC 1RF1B 3BVHA 1FZGA 1RF1C 1N73C 1JY2P 1LT9C 1FZAA 1LWUC 1M1JC 1JY3O 1W2EA 1RE4C 1LWUB 2A45H 3H32A 2OYHA 2OYHC 3GHGB 2HODA 1LTJC 2A45I 1RF1A 2HODB 3GHGA 1RE4A 1RF0C 1T3UA 3HUSA 1LWUA 3H32B 1JY3P 2H43A 2OYHB 2OYIC 1M1JB 2HPCB 1RE3A 1N73B 1LTJA 2FFDB 1JY3N 2A45G 3GHGC 2HLOA 1RF0A 1FZCC 1JY2O 1FZFA 2OYIB 1FZCB 2Q9IA 1LT9B 1FZEA 1N86A 2XNXA 1RE3C 3E1IA 1N73A 3HUSB
chains in the Genus database with same CATH superfamily
1KYOH 3KHUA 2QM7A 2GUVA 5APSA 1ZW0A 4H44C 1LTJB 2QJPC 4HKZH 4JPZB 1NU1J 1GZLA 3AE8C 4LGDE 4XA4A 5H2FE 4H0LB 1NAYA 3NTNA 2Z5IA 5AW2B 1GW3A 1BE3D 2KI7B 5KLVE 3Q1MA 1SS1A 1N73C 1EZVG 5AVQB 3Q5SA 3A3YB 5APUA 1LTAC 1EDIA 1ZOYC 1UIIA 3WUUA 2WT7B 3BATA 3CPWO 1VL2A 1EXJA 5KJ7D 1L4AD 1VPCA 1OX3A 1SQXD 3EQ2A 4D6TD 1MV8A 1NTZK 1S1CX 3SFEC 2K9YA 2P2UA 2JWDA 3E1RA 3H1JE 3CWBG 5GTHE 3VN0A 1NU1G 2P7JA 1BSNA 3H1IE 4PD4H 5APQA 1FS0E 5AW3B 3V2PA 3H1JJ 3CCQP 1WMKA 1NOHA 2FBWC 2M3BA 1KMIZ 3L73D 1XTCC 3MIWA 3VP9A 1M1KQ 2XDJA 3L36A 3A0HE 3AEEC 1LT9A 2KK7A 2OYIA 2FFDA 1ZR4A 2PAJA 3GLMA 2M5AA 1LTTC 1OVVA 3WMM0 2XKMA 4GOEA 1KB9I 2FYUJ 3RK2C 2WT7A 1N7LA 3AECC 4IFFA 2FYUE 5CBNA 3HD7A 4YPCA 3H1LD 1SQBG 3JCUH 1OZHA 1SFCB 2FYUD 2IFNA 2XNDH 3GHGA 4WBAA 2WITA 1NJIQ 4BRYA 4I2LC 1KORA 2HPCB 3UIAA 2PFXA 3OW2O 1JY3N 2O01N 5APVA 3PP5A 3AE4C 4GOFA 2KUBA 1N7SC 3N7NA 1AVOA 1LT9B 1SQBJ 3FX0A 1N8RQ 2LXBA 3H1KD 1GTWA 1L4AA 3B71A 2ZYAA 2RH0A 1VQMP 1FOSE 4L73A 3ITKA 3CC2P 2ZVOB 1PP9G 4I6MC 5AW9B 1PP9D 4XE5B 1N2DC 4JBZA 3ZDMA 3CL3D 2GA1A 2IBZE 3MTUE 2YXRB 1OMIA 2P58A 3H1KG 4BRYB 1EDKA 1W2EA 3C9IA 4NPDA 2V4HA 1NH4A 2KZJA 2OQQA 2W6AA 2WPRA 5KTBA 3W68A 4IFMA 2I1KA 3NFQA 1KYOD 3TSIA 1BE3J 3FXEA 3II6A 5KLIB 4KT0J 2BCCD 2E5TA 2YNYA 2M5AB 3CWBJ 2AEFA 1BE3E 1VQ4P 1S3JA 5CJ0A 1UIXA 1VF5D 2R3SA 1AA0A 4LLHA 5KLIC 3U1CA 1Q81Q 1KILC 4H44D 2D2CB 1DIPA 3V2NA 2B87B 3MHVA 1SQVD 3CX5E 5CMZA 4ZMDA 1BSHA 1HUCA 1HGVA 4JYBA 4U7JA 1KC8Q 2JDIH 5CHXA 5KKZB 1Q82Q 1YQ3C 1BCCD 1A02J 1Y47A 4PD4E 1BCCG 1S5LH 3TK1A 5KLVJ 3CD6P 4EIJA 1SQPK 1Z56A 3MP7B 5KAIH 1YJ9P 2O1JA 4K3AA 2G3AA 2WPQA 3L73G 1NTKD 2RN0A 1KFNA 1S5LX 1HJ0A 3L71E 3WUVA 1KQLA 2WZ7A 3L74D 3H1HE 4ASVA 2KS1A 4OGQD 4KJMA 1OXZA 3LW5H 3RL0C 2YKPA 2R5DA 5GTIH 4M3LA 1LNQA 1Q90D 1VQPP 3V4WA 3C8VA 1KQGB 2KLVA 1L0LE 2CPBA 4PD4I 1KV4A 2XV5A 3IF4A 2A45G 3L75D 2KLUA 1NHLA 4IFDK 1IFMA 2D2CC 3CCVP 5BU5A 1RQUA 3M06A 3OJAB 4AQRD 2C9NY 2W27A 5KJ7A 2PGDA 2QG4A 1CSBA 3VMXA 1VQ5P 2IBZD 1LP1A 1NTKG 3USSA 2B88A 1EZVD 2ZJSE 4BXLA 1ZP0C 3V4QA 1SQQJ 1G2CA 1L0NG 2HFED 4PV1D 3PRJA 2OARA 4PJ0E 1DH3A 3OAKA 1SQQE 1X79B 1CZQA 3FWLA 1FOSF 5E79H 2A06E 3NXSA 1J2JB 1G1JA 1SVFA 5KJ7C 2OYHC 1SQVJ 1HVVA 1JMBA 1RQVA 1KQSO 3FWNA 1IFIA 1N7SB 1GU4A 2QA4P 1E5WA 1NAFA 3H1HG 1BGYE 1FDIA 1URQC 3AEFC 3K5BA 3RGUA 3TGUG 2OYHB 1OVUA 1SQXJ 2WSCH 3L74E 5AW4B 2Q3EA 3KQGA 3VTPC 1SQPE 4I7ZC 4ZKUA 2KIKA 3H1LG 2GUSA 1JY2O 3R2PA 3NMDA 2R32A 3R4YA 2Q7CA 3D6ZA 1QLED 1GU5A 1IO4A 1P84E 1NTMG 1PZQA 3VMYA 3PTZA 1HWTC 2JR8A 1X22A 1FU1A 1Q2NA 4WY4B 3D70A 1GL2D 1PIXA 2O01H 3HRNA 2B9BA 3SWYA 1RF1B 3VOPA 3LW5J 3LIEA 2QRXA 1MZ9A 3AE3C 1JY3O 1N7SA 1T6AA 1NVOA 2AXTE 4RO0A 5E79E 3GHGB 3CLQA 5AVRB 5H2FH 1LTJC 2QJPB 3PH0A 3AE7C 4UB6H 3Q5RA 2YIUC 1KB9E 4Y28J 4GKGA 2QJYC 1NWQA 1IC2A 1KYOE 1Q86Q 1SQQD 3RBZA 1IK9A 2CK3H 3O6QB 4H0LD 2KSEA 3G6EP 2WSEJ 3G4SP 3H1KE 3A5TA 1GL2C 1SQPG 1EC5A 1ZN5A 2IDBA 2IYPA 4TLFA 1VF5C 3TGUD 2Q6QA 3L74G 4JQ0D 3W67A 3H1KJ 1WRGA 3IAOA 3A0HH 4UB8H 4W7YA 4EDFA 3KXDA 1PP9E 2WSEH 5C39A 3L75J 3RL0g 4NPFX 1RHZB 3PLNA 2NPSD 3TGUJ 3U59A 1M1JA 2H7HA 3HUSC 5B66H 1PP9J 1GK4A 2YO3A 3L75E 2K88A 4DZOA 2JP3A 1SQXK 2E75B 3AEDC 5CCHC 1NTZD 1S9KD 1SQVG 5AW1B 4RKUJ 5APWA 1LWUC 4MN4C 2O01J 1RE4C 1P84D 1SQVK 3H1HJ 4C46A 1H88A 2N9BA 5TJHA 2OYHA 3JSVC 2IBZI 2XU6A 4XFJA 2ZXEB 1DEEG 1NTKE 2QM8A 2DW3A 2Y0DA 3CMAP 1NU1D 3BCCJ 1SQPD 1RY3A 3M0DC 2HG5D 1SQQK 2J59M 3L37A 4PV1B 2VRSA 2A06G 2Q3IA 2WMMA 1GDTA 1VQLP 3BRVB 2CPSA 2V7QH 1RF0A 3GF3A 5CCHD 1SQQG 2N1TC 2N9YB 3B5NC 2Y9YA 1FAVA 2W90A 2N1TD 3C1LA 4OWFA 1L0NE 4YTPC 1N86A 1YIJP 2E76D 2FKWB 1S2EA 3RK3E 1MFZA 2ZT9C 3S1KA 2W6BA 2L5GB 2M8RA 3E7KA 3L73E 3Q3DA 1H89A 4OGQB 4H0LC 1FZGA 1L4AC 1NU1E 1SQVE 2LXCB 3CX5D 3L73J 3VP8A 2B89A 5BU8B 1L0LG 2JO1A 3H1JD 1LTBC 5APXA 1VQKP 1H0TA 2O1KA 3L75G 1SFCA 1EQ7A 2A45I 2KZIA 2KB7P 3PJSK 5CCGA 1DD3A 3V5BA 3TNUA 1KQFB 1YBKA 2P10A 1JUNA 1DEBA 1SQPJ 2E74D 4CPGA 5KLVK 5B66E 2E5YA 1EZVE 1T8ZA 4L74A 5K5GB 1D7MA 1LTJA 1XTGB 3AE1C 3O8ZA 2YKQA 4WWIA 5KLVG 2WSSH 1Q7YQ 3MGNA 1AJYA 1FZFA 3H1HD 1QVFO 1LP1B 2D2CD 1FZEA 1JO5A 3E1IA 2FYNB 3MZWB 2OTLP 5KAFH 1YYCA 2R5BA 1NTZG 2Q1KA 3CXHD 4IL6H 4N78D 1R5SA 2HYNA 3QWOC 5CBOA 1FZCA 4U3FE 2H8PD 5B5EE 5DJTB 3I55P 5DJUB 2FXMA 2QJKC 3G9RA 2E74C 4U3FJ 1K8AQ 1PGOA 2IBZG 4YXWH 2GM4A 1M1JC 1URQD 3CMEP 1ZLLA 4JF7A 1NTME 1RF1A 1SLQA 1GL2A 1WT6A 1JCDA 2HODB 1T3JA 3HE4A 5AVXB 4C7NB 3CCUP 1M8OB 2K3RA 3N4XA 1JY3P 1KYOI 1HF9A 2M3EA 2WSFJ 1J1EB 1T2KD 3CC4P 3AE5C 1LGHB 4UB8E 3IN6A 3H1LE 2FFDB 1P84I 3P7KA 4K35A 1ZXGA 1IJDB 1R5LA 2ITAA 5AVZB 3HTKA 2Q9IA 2NRGA 1SQBK 4RJTA 3M0AA 3CCRP 1BGYG 2R44A 3O6QA 4DT0A 1QVGO 1HJBA 5AW7B 2SPZA 2QEXP 4H44B 3EWKA 2N1TA 5APTA 4LC1A 2W6JH 4HYTB 1GL2B 3EFGA 2C0XA 1JCCA 1SFCD 3L71J 5CCGD 2I8DA 1PV3A 1FZAA 1KN7A 3HE4B 1CI6A 4C7NA 1YTZI 2M0BA 3CXHE 2WPVB 1IFNA 2KS1B 1J1DB 3H1ID 2FYUK 1ZV8A 2ZT9D 3V2RA 4WY4A 5AVTB 5KLVD 3Q5PA 1HGZA 1YJWP 1YITP 2H43A 1H0TB 2FYUG 3AEGC 3RK2D 3AEAC 2YKOA 1RE3A 1U57A 4DJGA 3H1IG 4RESB 3T97A 1ZR2A 3MUDA 2WQYC 2ZT9B 3H1JG 2WWWA 1KB9D 3F5HA 2H88C 3WU2E 2YO2A 4C7RA 1KZUB 2JEEA 3B5NA 3KPEA 1URQB 2OTJP 3HE5B 2WSFH 1HTLC 3T97B 2O3JA 2HPCA 4R4LA 1VQ9P 2OTKE 1EZVI 3IFMA 3L71D 1OVRA 3FXDA 4ZNCA 4YXDC 3L71G 1NTZJ 3P8MC 1JTHB 3KZIH 1BCCJ 1JM0A 3ABVC 4AYCA 1FJPA 3V6IA 1JY2P 1T2KC 3VMAA 1S72P 1BCCE 3TDKA 4UB6E 2ZVNB 1K73Q 3M9BA 1BGYJ 1NKNA 1SP4A 1SFCC 3G3ZA 4U3FD 5CCGC 3CXHH 4B86A 5TISH 3IR9A 4WY4D 3SWFA 2NPSC 1FBMA 2KYVA 2YMYA 1NU1K 2A06D 2FYNC 2KNCA 4NPEA 4EOTA 1LTIC 1U7MA 1QL1A 4GIFA 3M9HA 1YTZT 2E75C 1M56D 2ZAEB 1HH0A 3GHGC 2HLOA 3GF7A 2NPSB 1M7LA 1DX7A 1L0LJ 1BE3G 1YQ4C 4GODA 2YIUB 4O9BA 5KKZC 5AW8B 1E79H 3H1IJ 1KFMA 2IX7C 2BEZF 2AEMA 1JNMA 1AQTA 1OW8A 1X8YA 3BASA 3L72E 1AV1A 3HTKB 1KILB 1FZBA 2NPSA 1MFTA 1VQ8P 1NO4A 2YMKA 3L72J 3VMZA 3CCLP 1NTMK 2W83C 1KB9H 1A02F 2ZYDA 3BVHA 2P1JA 1DD4A 2E76B 2ZFCA 2IYOA 5AVVB 2Y9ZA 2E42A 2AXTH 3H32A 1VQOP 1PGJA 1USEA 1LTGC 1NTKK 3A0BE 3A2AA 3CI9A 3KZIE 4GT1A 3TNUB 3RK3C 4BWNA 1VDFA 1VQ6P 3L70D 1JEKA 1LWUA 3H32B 3MD0A 5AW6B 5AVUB 2E74B 4HB1A 2UWJE 2QIWA 1N73B 3GW6A 1G2CB 2IFMA 3HD7C 2FXPA 1IFDA 3WU2H 4ZKPA 1K04A 2POHA 2AEJA 2OYOA 5AVWB 1USDA 1X0TA 4H13B 1KILE 2XNXA 1RE3C 3VYIA 2WTYA 3CC7P 1CW5A 1SQBE 1OFCX 4L75A 4EYYQ 5BVZA 1EXIA 3B5ND 2C0WA 1X9VA 4H13C 2FFDC 1IFJA 5CCHA 4PD4D 2BCCJ 2WPSA 3AE9C 4HH2A 3D71A 1RF1C 2G8YA 1AVYA 2PRRA 1NYHA 2IZ0A 2RMZA 3PHLA 2BCCE 1PL5A 1HBWA 5EFWB 1S9KE 1FDMA 1JTHA 2LR2A 1U7JA 3GG2A 1Y8AA 3RL0B 1OIPA 1AFOA 2IPPA 1PPJG 1ZRTD 4PJ0H 3CCSP 3WUTA 1FC2C 1L4AB 3L4FA 3AE6C 1P84H 4W7ZA 2OGUA 3M91A 3L35A 1QL2A 1L0NK 3CWBE 1GK6A 3BCCG 3CCMP 1KILA 1PPJD 4IL6E 1OW6A 1QX8A 2WSCJ 4D6TE 1FZCB 4Y99C 2B87A 5M1BA 1QGKB 2Q5UA 3L72G 1JB0J 2KOGA 2V7QJ 1VQNP 2E75D 4JYCA 3TYYA 4W80A 2JJLA 1L0ND 3A7OA 1M90Q 1PFIA 2K9JB 1TU3F 1MKMA 1QEXA 2JWAA 3I5CA 1LT9C 4WY4C 3CX5I 2FYZA 2KP8A 1LWUB 1YJNP 1FE6A 2QVAA 3S9OA 4HJGH 1PGPA 1KD1Q 3A0BH 1VQ7P 3Q2YA 3MUDC 3LIDA 1RF0C 2XZRA 3HUSA 1S5LE 2NZ2A 4IOIH 1S4XA 3BCCD 5AVYB 2MKVA 4D6TG 1M1JB 2OYIC 4GDOA 1JOCA 4I7ZB 1ZRTE 4EI2A 3BCCE 2JKVA 4H13D 3TF5A 3L70G 1URQA 3AEBC 1FZCC 1SQBD 2KSJA 2OYIB 2N1TB 3QH9A 2Y0EA 1LJ2A 2IZ1A 1BDCA 2Z5HA 4WB4A 1J1EC 1N73A 2KXPB 1J1DC 1L0NJ 1VF5B 2LKMA 3U1AA 5GTIE 2PP6A 1NTMD 3HD7D 3RK3B 1PGQA 4A7PA 1JY2N 1MUUA 4N78E 2QE7H 3M0DA 2Z4EA 1M57D 2E43A 2QSIA 1IK7A 3P8CD 1YI2P 2RKLA 3KDPB 2Y0CA 3F89A 4N6JA 4TT3H 2C9LY 3B4SA 2A45H 4AUWA 2AXCA 3CXHI 1BGYD 3V2QA 4KHXA 3JCUE 5KAIE 4PV1C 2HODA 3CCJP 1GD2E 3D6YA 3KYQA 1R8EA 2QJYB 3JC22 1PPJE 2P67A 1T3UA 3CWBD 1GW4A 1W5CE 2K9JA 2R3CA 3AE2C 3RK2B 5CJ4A 1JMMA 3HE5A 2E76C 2BCCG 2K37A 1L2PA 1OW7A 1GMJA 1SQXG 1N7SD 1SQXE 2I1JA 1G1IA 1FDOA 2WVRA 2YXQB 2FXOA 3L74J 4OVNF 5AVSB 1EDLA 1LTSC 3GMAA 2J5UA 1L0LD 2K1AA 3BRTB 4DOJA 5KAFE 4Z1MH 1ZMEC 4Y99B 4WVZA 4QMAA 3HUSB 4IL6X 1W2BO 2J58A 1Y9BA 2KNCB 2ZXXA 4OH8B 3SWKA 3FGAD 3HD7B 3RK3D 5GTHH 3P32A 1NKZB 3G71P 3L72D 1KTMA 4R4MA 2QJKB 1CI6B 2ZYGA 3M9QA 3B8EB 5TISE 3SFDC 2BASA 1BDDA 1NGMB 3SSUA 1K05A 4L76A 1AQ5A 1NTKJ 1K9MQ 1H8AA 2FY8A 4OGQC 3RL0D 4DCKA 3RBXA 5AW5B 3H25A 1RE4A 2MJZA 1IFPA 1NTMJ 3P8CE 4ASWA 1EDJA 3L70J 3OA7A 1RH5B 5B5EH 1FJKA 1OWAA 2W8ZA 2HR3A 3CX5H 4D6TJ 3L70E 1KILD 3H6PA 3CCEP 5APYA 1YHQP 3EFFK 2BEQD 3B5NB 3S4RA 2L91A 4I1LA 3H1LJ 5AW0B 1IZNB 4N3YB 2H89C 4U3FG 1L0LK 1LT1A 3I56P 1NTZE 3TGUE 5L8RJ
chains in the Genus database with same CATH topology
2QM7A 2GUVA 5APSA 1LTJB 1GZLA 4LGDE 4XA4A 3NTNA 2Z5IA 5AW2B 1GW3A 1N73C 5AVQB 3A3YB 5APUA 1LTAC 2WT7B 3BATA 5KJ7D 1L4AD 1VPCA 3EQ2A 1MV8A 1NTZK 2P2UA 3VN0A 2P7JA 5APQA 5AW3B 3V2PA 1NOHA 2M3BA 3MIWA 3VP9A 1XTCC 2XDJA 3L36A 1LT9A 2OYIA 2FFDA 1ZR4A 2PAJA 1LTTC 3WMM0 2XKMA 3RK2C 2WT7A 1N7LA 4IFFA 3HD7A 1SFCB 2IFNA 3GHGA 4WBAA 2WITA 4I2LC 2HPCB 3UIAA 1JY3N 5APVA 3N7NA 1N7SC 1LT9B 1GTWA 1L4AA 1FOSE 4I6MC 5AW9B 4XE5B 1N2DC 3CL3D 3MTUE 1W2EA 3C9IA 1NH4A 2WPRA 2W6AA 5KTBA 4IFMA 2I1KA 3NFQA 3TSIA 3II6A 2YNYA 5CJ0A 4LLHA 3U1CA 1KILC 3V2NA 5CMZA 1HUCA 1HGVA 4JYBA 5CHXA 1A02J 3TK1A 4EIJA 1SQPK 1Z56A 2O1JA 2WPQA 1KFNA 1KQLA 2WZ7A 3RL0C 1OXZA 3LW5H 2YKPA 2R5DA 4M3LA 3V4WA 2KLVA 2CPBA 2XV5A 2A45G 1NHLA 4IFDK 1IFMA 5BU5A 3M06A 4AQRD 3OJAB 2C9NY 2W27A 5KJ7A 1CSBA 3VMXA 3V4QA 1G2CA 2HFED 2OARA 1DH3A 3OAKA 1X79B 1CZQA 1FOSF 3NXSA 1J2JB 1G1JA 1SVFA 5KJ7C 2OYHC 1HVVA 1IFIA 1N7SB 1E5WA 1NAFA 2C9LY 1URQC 2OYHB 5AW4B 2WSCH 3KQGA 3VTPC 4ZKUA 2GUSA 1JY2O 3R2PA 3NMDA 2R32A 2Q7CA 1GU5A 1IO4A 3VMYA 1HWTC 1FU1A 4WY4B 1GL2D 2O01H 3HRNA 3SWYA 1RF1B 3VOPA 3LIEA 1MZ9A 1JY3O 1N7SA 5AVRB 3GHGB 3CLQA 1LTJC 4GKGA 1NWQA 1IC2A 1IK9A 3A5TA 1GL2C 1ZN5A 1WRGA 4W7YA 2WSEH 2NPSD 3U59A 1M1JA 2H7HA 3HUSC 1GK4A 2YO3A 4DZOA 1SQXK 5CCHC 1S9KD 5AW1B 5APWA 1LWUC 1RE4C 1H88A 1SQVK 4C46A 2OYHA 2N9BA 2XU6A 2ZXEB 2QM8A 1RY3A 3M0DC 2HG5D 1SQQK 2J59M 3L37A 2VRSA 2Q3IA 1GDTA 3BRVB 2CPSA 5CCHD 1RF0A 2N1TC 3B5NC 1FAVA 2N1TD 1N86A 2FKWB 1MFZA 2W6BA 2L5GB 2M8RA 1H89A 1FZGA 1L4AC 1GU4A 3VP8A 5BU8B 1LTBC 5APXA 2O1KA 1SFCA 1EQ7A 2A45I 5CCGA 2KB7P 3V5BA 3TNUA 1DEBA 5KLVK 1T8ZA 1LTJA 3O8ZA 1XTGB 2YKQA 3MGNA 1FZFA 1FZEA 1JO5A 3E1IA 1YYCA 2R5BA 4N78D 2HYNA 1FZCA 2H8PD 2FXMA 2GM4A 1M1JC 1URQD 1ZLLA 4JF7A 1RF1A 1SLQA 1GL2A 1WT6A 1JCDA 2HODB 1T3JA 3HE4A 5AVXB 4C7NB 3N4XA 1JY3P 1J1EB 1T2KD 1LGHB 2FFDB 3P7KA 1IJDB 5AVZB 3HTKA 2Q9IA 1SQBK 3M0AA 1HJBA 5AW7B 2N1TA 5APTA 4LC1A 4HYTB 1GL2B 3EFGA 2C0XA 1JCCA 1SFCD 5CCGD 1FZAA 3HE4B 1CI6A 4C7NA 1YTZI 1IFNA 1J1DB 2FYUK 1ZV8A 3V2RA 4WY4A 5AVTB 2H43A 1HGZA 3RK2D 2YKOA 1RE3A 4RESB 3T97A 1ZR2A 3MUDA 2WWWA 4C7RA 2YO2A 1KZUB 2JEEA 3B5NA 3KPEA 1URQB 3HE5B 2WSFH 1HTLC 2HPCA 3IFMA 3P8MC 1JTHB 4AYCA 1FJPA 1T2KC 1JY2P 3M9BA 1NKNA 1SP4A 3G3ZA 1SFCC 5CCGC 4B86A 3IR9A 4WY4D 3SWFA 2NPSC 1FBMA 2KYVA 2YMYA 1NU1K 4EOTA 1LTIC 1QL1A 4GIFA 3M9HA 1YTZT 3PP5A 3GHGC 1HH0A 2HLOA 2NPSB 1M7LA 1DX7A 4O9BA 5AW8B 1KFMA 2IX7C 1JNMA 3BASA 1X8YA 3HTKB 1KILB 1FZBA 2NPSA 1NO4A 3VMZA 1NTMK 1A02F 3BVHA 2P1JA 2ZFCA 5AVVB 2E42A 3H32A 1LTGC 1NTKK 3A2AA 3CI9A 4GT1A 3TNUB 3RK3C 1VDFA 1LWUA 3H32B 3MD0A 5AW6B 5AVUB 1N73B 3HD7C 1G2CB 2IFMA 1IFDA 4ZKPA 2POHA 5AVWB 3VYIA 2XNXA 1RE3C 2WTYA 1CW5A 5BVZA 3B5ND 2C0WA 1X9VA 2FFDC 1IFJA 5CCHA 4HH2A 2WPSA 1RF1C 1HBWA 1S9KE 1FDMA 1JTHA 3RL0B 1AFOA 1JUNA 2IPPA 1L4AB 3L4FA 4W7ZA 3M91A 3L35A 1QL2A 1L0NK 1GK6A 1KILA 1FZCB 2Q5UA 2KOGA 4JYCA 3TYYA 4W80A 2JJLA 3A7OA 1PFIA 3I5CA 1LT9C 4WY4C 2FYZA 2KP8A 1LWUB 3LIDA 1RF0C 2XZRA 3HUSA 5AVYB 2OYIC 1M1JB 1JOCA 1URQA 1FZCC 2KSJA 2OYIB 2N1TB 2Z5HA 4WB4A 1J1EC 1N73A 1J1DC 2LKMA 3U1AA 2PP6A 3HD7D 3RK3B 2Z4EA 1JY2N 1MUUA 4N78E 3M0DA 2E43A 3P8CD 3KDPB 4N6JA 2A45H 4AUWA 3V2QA 4KHXA 2HODA 1GD2E 3KYQA 2P67A 1T3UA 1GW4A 2R3CA 5CJ4A 3RK2B 1JMMA 3HE5A 4Y99C 2I1JA 1N7SD 1G1IA 5AVSB 1LTSC 3BRTB 4DOJA 4Y99B 3HUSB 2J58A 4OH8B 3HD7B 3RK3D 3P32A 1NKZB 1CI6B 3M9QA 3B8EB 2BASA 1AQ5A 1H8AA 3RL0D 5AW5B 1RE4A 2MJZA 3P8CE 3OA7A 1FJKA 1OWAA 1KILD 3H6PA 5APYA 3B5NB 4I1LA 5AW0B 4N3YB 1L0LK
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1M1J A;  2HPC A;  1FZB A;  3HUS C;  1LT9 A;  1FZC A;  2OYI A;  1LTJ B;  2Z4E A;  2FFD A;  1JY2 N;  2FFD C;  1RF1 B;  3BVH A;  1FZG A;  1RF1 C;  1N73 C;  1JY2 P;  1LT9 C;  1FZA A;  1LWU C;  1M1J C;  1JY3 O;  1W2E A;  1RE4 C;  1LWU B;  2A45 H;  3H32 A;  2OYH A;  2OYH C;  3GHG B;  2HOD A;  1LTJ C;  2A45 I;  1RF1 A;  2HOD B;  3GHG A;  1RE4 A;  1RF0 C;  1T3U A;  3HUS A;  1LWU A;  3H32 B;  1JY3 P;  2H43 A;  2OYH B;  2OYI C;  1M1J B;  2HPC B;  1RE3 A;  1N73 B;  1LTJ A;  2FFD B;  1JY3 N;  2A45 G;  3GHG C;  2HLO A;  1RF0 A;  1FZC C;  1JY2 O;  1FZF A;  2OYI B;  1FZC B;  2Q9I A;  1LT9 B;  1FZE A;  1N86 A;  2XNX A;  1RE3 C;  3E1I A;  1N73 A;  3HUS B; 
#chains in the Genus database with same CATH topology
 1KYO H;  3KHU A;  2QM7 A;  2GUV A;  5APS A;  1ZW0 A;  4H44 C;  1LTJ B;  2QJP C;  4HKZ H;  4JPZ B;  1NU1 J;  1GZL A;  3AE8 C;  4LGD E;  4XA4 A;  5H2F E;  4H0L B;  1NAY A;  3NTN A;  2Z5I A;  5AW2 B;  1GW3 A;  1BE3 D;  2KI7 B;  5KLV E;  3Q1M A;  1SS1 A;  1N73 C;  1EZV G;  5AVQ B;  3Q5S A;  3A3Y B;  5APU A;  1LTA C;  1EDI A;  1ZOY C;  1UII A;  3WUU A;  2WT7 B;  3BAT A;  3CPW O;  1VL2 A;  1EXJ A;  5KJ7 D;  1L4A D;  1VPC A;  1OX3 A;  1SQX D;  3EQ2 A;  4D6T D;  1MV8 A;  1NTZ K;  1S1C X;  3SFE C;  2K9Y A;  2P2U A;  2JWD A;  3E1R A;  3H1J E;  3CWB G;  5GTH E;  3VN0 A;  1NU1 G;  2P7J A;  1BSN A;  3H1I E;  4PD4 H;  5APQ A;  1FS0 E;  5AW3 B;  3V2P A;  3H1J J;  3CCQ P;  1WMK A;  1NOH A;  2FBW C;  2M3B A;  1KMI Z;  3L73 D;  1XTC C;  3MIW A;  3VP9 A;  1M1K Q;  2XDJ A;  3L36 A;  3A0H E;  3AEE C;  1LT9 A;  2KK7 A;  2OYI A;  2FFD A;  1ZR4 A;  2PAJ A;  3GLM A;  2M5A A;  1LTT C;  1OVV A;  3WMM 0;  2XKM A;  4GOE A;  1KB9 I;  2FYU J;  3RK2 C;  2WT7 A;  1N7L A;  3AEC C;  4IFF A;  2FYU E;  5CBN A;  3HD7 A;  4YPC A;  3H1L D;  1SQB G;  3JCU H;  1OZH A;  1SFC B;  2FYU D;  2IFN A;  2XND H;  3GHG A;  4WBA A;  2WIT A;  1NJI Q;  4BRY A;  4I2L C;  1KOR A;  2HPC B;  3UIA A;  2PFX A;  3OW2 O;  1JY3 N;  2O01 N;  5APV A;  3PP5 A;  3AE4 C;  4GOF A;  2KUB A;  1N7S C;  3N7N A;  1AVO A;  1LT9 B;  1SQB J;  3FX0 A;  1N8R Q;  2LXB A;  3H1K D;  1GTW A;  1L4A A;  3B71 A;  2ZYA A;  2RH0 A;  1VQM P;  1FOS E;  4L73 A;  3ITK A;  3CC2 P;  2ZVO B;  1PP9 G;  4I6M C;  5AW9 B;  1PP9 D;  4XE5 B;  1N2D C;  4JBZ A;  3ZDM A;  3CL3 D;  2GA1 A;  2IBZ E;  3MTU E;  2YXR B;  1OMI A;  2P58 A;  3H1K G;  4BRY B;  1EDK A;  1W2E A;  3C9I A;  4NPD A;  2V4H A;  1NH4 A;  2KZJ A;  2OQQ A;  2W6A A;  2WPR A;  5KTB A;  3W68 A;  4IFM A;  2I1K A;  3NFQ A;  1KYO D;  3TSI A;  1BE3 J;  3FXE A;  3II6 A;  5KLI B;  4KT0 J;  2BCC D;  2E5T A;  2YNY A;  2M5A B;  3CWB J;  2AEF A;  1BE3 E;  1VQ4 P;  1S3J A;  5CJ0 A;  1UIX A;  1VF5 D;  2R3S A;  1AA0 A;  4LLH A;  5KLI C;  3U1C A;  1Q81 Q;  1KIL C;  4H44 D;  2D2C B;  1DIP A;  3V2N A;  2B87 B;  3MHV A;  1SQV D;  3CX5 E;  5CMZ A;  4ZMD A;  1BSH A;  1HUC A;  1HGV A;  4JYB A;  4U7J A;  1KC8 Q;  2JDI H;  5CHX A;  5KKZ B;  1Q82 Q;  1YQ3 C;  1BCC D;  1A02 J;  1Y47 A;  4PD4 E;  1BCC G;  1S5L H;  3TK1 A;  5KLV J;  3CD6 P;  4EIJ A;  1SQP K;  1Z56 A;  3MP7 B;  5KAI H;  1YJ9 P;  2O1J A;  4K3A A;  2G3A A;  2WPQ A;  3L73 G;  1NTK D;  2RN0 A;  1KFN A;  1S5L X;  1HJ0 A;  3L71 E;  3WUV A;  1KQL A;  2WZ7 A;  3L74 D;  3H1H E;  4ASV A;  2KS1 A;  4OGQ D;  4KJM A;  1OXZ A;  3LW5 H;  3RL0 C;  2YKP A;  2R5D A;  5GTI H;  4M3L A;  1LNQ A;  1Q90 D;  1VQP P;  3V4W A;  3C8V A;  1KQG B;  2KLV A;  1L0L E;  2CPB A;  4PD4 I;  1KV4 A;  2XV5 A;  3IF4 A;  2A45 G;  3L75 D;  2KLU A;  1NHL A;  4IFD K;  1IFM A;  2D2C C;  3CCV P;  5BU5 A;  1RQU A;  3M06 A;  3OJA B;  4AQR D;  2C9N Y;  2W27 A;  5KJ7 A;  2PGD A;  2QG4 A;  1CSB A;  3VMX A;  1VQ5 P;  2IBZ D;  1LP1 A;  1NTK G;  3USS A;  2B88 A;  1EZV D;  2ZJS E;  4BXL A;  1ZP0 C;  3V4Q A;  1SQQ J;  1G2C A;  1L0N G;  2HFE D;  4PV1 D;  3PRJ A;  2OAR A;  4PJ0 E;  1DH3 A;  3OAK A;  1SQQ E;  1X79 B;  1CZQ A;  3FWL A;  1FOS F;  5E79 H;  2A06 E;  3NXS A;  1J2J B;  1G1J A;  1SVF A;  5KJ7 C;  2OYH C;  1SQV J;  1HVV A;  1JMB A;  1RQV A;  1KQS O;  3FWN A;  1IFI A;  1N7S B;  1GU4 A;  2QA4 P;  1E5W A;  1NAF A;  3H1H G;  1BGY E;  1FDI A;  1URQ C;  3AEF C;  3K5B A;  3RGU A;  3TGU G;  2OYH B;  1OVU A;  1SQX J;  2WSC H;  3L74 E;  5AW4 B;  2Q3E A;  3KQG A;  3VTP C;  1SQP E;  4I7Z C;  4ZKU A;  2KIK A;  3H1L G;  2GUS A;  1JY2 O;  3R2P A;  3NMD A;  2R32 A;  3R4Y A;  2Q7C A;  3D6Z A;  1QLE D;  1GU5 A;  1IO4 A;  1P84 E;  1NTM G;  1PZQ A;  3VMY A;  3PTZ A;  1HWT C;  2JR8 A;  1X22 A;  1FU1 A;  1Q2N A;  4WY4 B;  3D70 A;  1GL2 D;  1PIX A;  2O01 H;  3HRN A;  2B9B A;  3SWY A;  1RF1 B;  3VOP A;  3LW5 J;  3LIE A;  2QRX A;  1MZ9 A;  3AE3 C;  1JY3 O;  1N7S A;  1T6A A;  1NVO A;  2AXT E;  4RO0 A;  5E79 E;  3GHG B;  3CLQ A;  5AVR B;  5H2F H;  1LTJ C;  2QJP B;  3PH0 A;  3AE7 C;  4UB6 H;  3Q5R A;  2YIU C;  1KB9 E;  4Y28 J;  4GKG A;  2QJY C;  1NWQ A;  1IC2 A;  1KYO E;  1Q86 Q;  1SQQ D;  3RBZ A;  1IK9 A;  2CK3 H;  3O6Q B;  4H0L D;  2KSE A;  3G6E P;  2WSE J;  3G4S P;  3H1K E;  3A5T A;  1GL2 C;  1SQP G;  1EC5 A;  1ZN5 A;  2IDB A;  2IYP A;  4TLF A;  1VF5 C;  3TGU D;  2Q6Q A;  3L74 G;  4JQ0 D;  3W67 A;  3H1K J;  1WRG A;  3IAO A;  3A0H H;  4UB8 H;  4W7Y A;  4EDF A;  3KXD A;  1PP9 E;  2WSE H;  5C39 A;  3L75 J;  3RL0 g;  4NPF X;  1RHZ B;  3PLN A;  2NPS D;  3TGU J;  3U59 A;  1M1J A;  2H7H A;  3HUS C;  5B66 H;  1PP9 J;  1GK4 A;  2YO3 A;  3L75 E;  2K88 A;  4DZO A;  2JP3 A;  1SQX K;  2E75 B;  3AED C;  5CCH C;  1NTZ D;  1S9K D;  1SQV G;  5AW1 B;  4RKU J;  5APW A;  1LWU C;  4MN4 C;  2O01 J;  1RE4 C;  1P84 D;  1SQV K;  3H1H J;  4C46 A;  1H88 A;  2N9B A;  5TJH A;  2OYH A;  3JSV C;  2IBZ I;  2XU6 A;  4XFJ A;  2ZXE B;  1DEE G;  1NTK E;  2QM8 A;  2DW3 A;  2Y0D A;  3CMA P;  1NU1 D;  3BCC J;  1SQP D;  1RY3 A;  3M0D C;  2HG5 D;  1SQQ K;  2J59 M;  3L37 A;  4PV1 B;  2VRS A;  2A06 G;  2Q3I A;  2WMM A;  1GDT A;  1VQL P;  3BRV B;  2CPS A;  2V7Q H;  1RF0 A;  3GF3 A;  5CCH D;  1SQQ G;  2N1T C;  2N9Y B;  3B5N C;  2Y9Y A;  1FAV A;  2W90 A;  2N1T D;  3C1L A;  4OWF A;  1L0N E;  4YTP C;  1N86 A;  1YIJ P;  2E76 D;  2FKW B;  1S2E A;  3RK3 E;  1MFZ A;  2ZT9 C;  3S1K A;  2W6B A;  2L5G B;  2M8R A;  3E7K A;  3L73 E;  3Q3D A;  1H89 A;  4OGQ B;  4H0L C;  1FZG A;  1L4A C;  1NU1 E;  1SQV E;  2LXC B;  3CX5 D;  3L73 J;  3VP8 A;  2B89 A;  5BU8 B;  1L0L G;  2JO1 A;  3H1J D;  1LTB C;  5APX A;  1VQK P;  1H0T A;  2O1K A;  3L75 G;  1SFC A;  1EQ7 A;  2A45 I;  2KZI A;  2KB7 P;  3PJS K;  5CCG A;  1DD3 A;  3V5B A;  3TNU A;  1KQF B;  1YBK A;  2P10 A;  1JUN A;  1DEB A;  1SQP J;  2E74 D;  4CPG A;  5KLV K;  5B66 E;  2E5Y A;  1EZV E;  1T8Z A;  4L74 A;  5K5G B;  1D7M A;  1LTJ A;  1XTG B;  3AE1 C;  3O8Z A;  2YKQ A;  4WWI A;  5KLV G;  2WSS H;  1Q7Y Q;  3MGN A;  1AJY A;  1FZF A;  3H1H D;  1QVF O;  1LP1 B;  2D2C D;  1FZE A;  1JO5 A;  3E1I A;  2FYN B;  3MZW B;  2OTL P;  5KAF H;  1YYC A;  2R5B A;  1NTZ G;  2Q1K A;  3CXH D;  4IL6 H;  4N78 D;  1R5S A;  2HYN A;  3QWO C;  5CBO A;  1FZC A;  4U3F E;  2H8P D;  5B5E E;  5DJT B;  3I55 P;  5DJU B;  2FXM A;  2QJK C;  3G9R A;  2E74 C;  4U3F J;  1K8A Q;  1PGO A;  2IBZ G;  4YXW H;  2GM4 A;  1M1J C;  1URQ D;  3CME P;  1ZLL A;  4JF7 A;  1NTM E;  1RF1 A;  1SLQ A;  1GL2 A;  1WT6 A;  1JCD A;  2HOD B;  1T3J A;  3HE4 A;  5AVX B;  4C7N B;  3CCU P;  1M8O B;  2K3R A;  3N4X A;  1JY3 P;  1KYO I;  1HF9 A;  2M3E A;  2WSF J;  1J1E B;  1T2K D;  3CC4 P;  3AE5 C;  1LGH B;  4UB8 E;  3IN6 A;  3H1L E;  2FFD B;  1P84 I;  3P7K A;  4K35 A;  1ZXG A;  1IJD B;  1R5L A;  2ITA A;  5AVZ B;  3HTK A;  2Q9I A;  2NRG A;  1SQB K;  4RJT A;  3M0A A;  3CCR P;  1BGY G;  2R44 A;  3O6Q A;  4DT0 A;  1QVG O;  1HJB A;  5AW7 B;  2SPZ A;  2QEX P;  4H44 B;  3EWK A;  2N1T A;  5APT A;  4LC1 A;  2W6J H;  4HYT B;  1GL2 B;  3EFG A;  2C0X A;  1JCC A;  1SFC D;  3L71 J;  5CCG D;  2I8D A;  1PV3 A;  1FZA A;  1KN7 A;  3HE4 B;  1CI6 A;  4C7N A;  1YTZ I;  2M0B A;  3CXH E;  2WPV B;  1IFN A;  2KS1 B;  1J1D B;  3H1I D;  2FYU K;  1ZV8 A;  2ZT9 D;  3V2R A;  4WY4 A;  5AVT B;  5KLV D;  3Q5P A;  1HGZ A;  1YJW P;  1YIT P;  2H43 A;  1H0T B;  2FYU G;  3AEG C;  3RK2 D;  3AEA C;  2YKO A;  1RE3 A;  1U57 A;  4DJG A;  3H1I G;  4RES B;  3T97 A;  1ZR2 A;  3MUD A;  2WQY C;  2ZT9 B;  3H1J G;  2WWW A;  1KB9 D;  3F5H A;  2H88 C;  3WU2 E;  2YO2 A;  4C7R A;  1KZU B;  2JEE A;  3B5N A;  3KPE A;  1URQ B;  2OTJ P;  3HE5 B;  2WSF H;  1HTL C;  3T97 B;  2O3J A;  2HPC A;  4R4L A;  1VQ9 P;  2OTK E;  1EZV I;  3IFM A;  3L71 D;  1OVR A;  3FXD A;  4ZNC A;  4YXD C;  3L71 G;  1NTZ J;  3P8M C;  1JTH B;  3KZI H;  1BCC J;  1JM0 A;  3ABV C;  4AYC A;  1FJP A;  3V6I A;  1JY2 P;  1T2K C;  3VMA A;  1S72 P;  1BCC E;  3TDK A;  4UB6 E;  2ZVN B;  1K73 Q;  3M9B A;  1BGY J;  1NKN A;  1SP4 A;  1SFC C;  3G3Z A;  4U3F D;  5CCG C;  3CXH H;  4B86 A;  5TIS H;  3IR9 A;  4WY4 D;  3SWF A;  2NPS C;  1FBM A;  2KYV A;  2YMY A;  1NU1 K;  2A06 D;  2FYN C;  2KNC A;  4NPE A;  4EOT A;  1LTI C;  1U7M A;  1QL1 A;  4GIF A;  3M9H A;  1YTZ T;  2E75 C;  1M56 D;  2ZAE B;  1HH0 A;  3GHG C;  2HLO A;  3GF7 A;  2NPS B;  1M7L A;  1DX7 A;  1L0L J;  1BE3 G;  1YQ4 C;  4GOD A;  2YIU B;  4O9B A;  5KKZ C;  5AW8 B;  1E79 H;  3H1I J;  1KFM A;  2IX7 C;  2BEZ F;  2AEM A;  1JNM A;  1AQT A;  1OW8 A;  1X8Y A;  3BAS A;  3L72 E;  1AV1 A;  3HTK B;  1KIL B;  1FZB A;  2NPS A;  1MFT A;  1VQ8 P;  1NO4 A;  2YMK A;  3L72 J;  3VMZ A;  3CCL P;  1NTM K;  2W83 C;  1KB9 H;  1A02 F;  2ZYD A;  3BVH A;  2P1J A;  1DD4 A;  2E76 B;  2ZFC A;  2IYO A;  5AVV B;  2Y9Z A;  2E42 A;  2AXT H;  3H32 A;  1VQO P;  1PGJ A;  1USE A;  1LTG C;  1NTK K;  3A0B E;  3A2A A;  3CI9 A;  3KZI E;  4GT1 A;  3TNU B;  3RK3 C;  4BWN A;  1VDF A;  1VQ6 P;  3L70 D;  1JEK A;  1LWU A;  3H32 B;  3MD0 A;  5AW6 B;  5AVU B;  2E74 B;  4HB1 A;  2UWJ E;  2QIW A;  1N73 B;  3GW6 A;  1G2C B;  2IFM A;  3HD7 C;  2FXP A;  1IFD A;  3WU2 H;  4ZKP A;  1K04 A;  2POH A;  2AEJ A;  2OYO A;  5AVW B;  1USD A;  1X0T A;  4H13 B;  1KIL E;  2XNX A;  1RE3 C;  3VYI A;  2WTY A;  3CC7 P;  1CW5 A;  1SQB E;  1OFC X;  4L75 A;  4EYY Q;  5BVZ A;  1EXI A;  3B5N D;  2C0W A;  1X9V A;  4H13 C;  2FFD C;  1IFJ A;  5CCH A;  4PD4 D;  2BCC J;  2WPS A;  3AE9 C;  4HH2 A;  3D71 A;  1RF1 C;  2G8Y A;  1AVY A;  2PRR A;  1NYH A;  2IZ0 A;  2RMZ A;  3PHL A;  2BCC E;  1PL5 A;  1HBW A;  5EFW B;  1S9K E;  1FDM A;  1JTH A;  2LR2 A;  1U7J A;  3GG2 A;  1Y8A A;  3RL0 B;  1OIP A;  1AFO A;  2IPP A;  1PPJ G;  1ZRT D;  4PJ0 H;  3CCS P;  3WUT A;  1FC2 C;  1L4A B;  3L4F A;  3AE6 C;  1P84 H;  4W7Z A;  2OGU A;  3M91 A;  3L35 A;  1QL2 A;  1L0N K;  3CWB E;  1GK6 A;  3BCC G;  3CCM P;  1KIL A;  1PPJ D;  4IL6 E;  1OW6 A;  1QX8 A;  2WSC J;  4D6T E;  1FZC B;  4Y99 C;  2B87 A;  5M1B A;  1QGK B;  2Q5U A;  3L72 G;  1JB0 J;  2KOG A;  2V7Q J;  1VQN P;  2E75 D;  4JYC A;  3TYY A;  4W80 A;  2JJL A;  1L0N D;  3A7O A;  1M90 Q;  1PFI A;  2K9J B;  1TU3 F;  1MKM A;  1QEX A;  2JWA A;  3I5C A;  1LT9 C;  4WY4 C;  3CX5 I;  2FYZ A;  2KP8 A;  1LWU B;  1YJN P;  1FE6 A;  2QVA A;  3S9O A;  4HJG H;  1PGP A;  1KD1 Q;  3A0B H;  1VQ7 P;  3Q2Y A;  3MUD C;  3LID A;  1RF0 C;  2XZR A;  3HUS A;  1S5L E;  2NZ2 A;  4IOI H;  1S4X A;  3BCC D;  5AVY B;  2MKV A;  4D6T G;  1M1J B;  2OYI C;  4GDO A;  1JOC A;  4I7Z B;  1ZRT E;  4EI2 A;  3BCC E;  2JKV A;  4H13 D;  3TF5 A;  3L70 G;  1URQ A;  3AEB C;  1FZC C;  1SQB D;  2KSJ A;  2OYI B;  2N1T B;  3QH9 A;  2Y0E A;  1LJ2 A;  2IZ1 A;  1BDC A;  2Z5H A;  4WB4 A;  1J1E C;  1N73 A;  2KXP B;  1J1D C;  1L0N J;  1VF5 B;  2LKM A;  3U1A A;  5GTI E;  2PP6 A;  1NTM D;  3HD7 D;  3RK3 B;  1PGQ A;  4A7P A;  1JY2 N;  1MUU A;  4N78 E;  2QE7 H;  3M0D A;  2Z4E A;  1M57 D;  2E43 A;  2QSI A;  1IK7 A;  3P8C D;  1YI2 P;  2RKL A;  3KDP B;  2Y0C A;  3F89 A;  4N6J A;  4TT3 H;  2C9L Y;  3B4S A;  2A45 H;  4AUW A;  2AXC A;  3CXH I;  1BGY D;  3V2Q A;  4KHX A;  3JCU E;  5KAI E;  4PV1 C;  2HOD A;  3CCJ P;  1GD2 E;  3D6Y A;  3KYQ A;  1R8E A;  2QJY B;  3JC2 2;  1PPJ E;  2P67 A;  1T3U A;  3CWB D;  1GW4 A;  1W5C E;  2K9J A;  2R3C A;  3AE2 C;  3RK2 B;  5CJ4 A;  1JMM A;  3HE5 A;  2E76 C;  2BCC G;  2K37 A;  1L2P A;  1OW7 A;  1GMJ A;  1SQX G;  1N7S D;  1SQX E;  2I1J A;  1G1I A;  1FDO A;  2WVR A;  2YXQ B;  2FXO A;  3L74 J;  4OVN F;  5AVS B;  1EDL A;  1LTS C;  3GMA A;  2J5U A;  1L0L D;  2K1A A;  3BRT B;  4DOJ A;  5KAF E;  4Z1M H;  1ZME C;  4Y99 B;  4WVZ A;  4QMA A;  3HUS B;  4IL6 X;  1W2B O;  2J58 A;  1Y9B A;  2KNC B;  2ZXX A;  4OH8 B;  3SWK A;  3FGA D;  3HD7 B;  3RK3 D;  5GTH H;  3P32 A;  1NKZ B;  3G71 P;  3L72 D;  1KTM A;  4R4M A;  2QJK B;  1CI6 B;  2ZYG A;  3M9Q A;  3B8E B;  5TIS E;  3SFD C;  2BAS A;  1BDD A;  1NGM B;  3SSU A;  1K05 A;  4L76 A;  1AQ5 A;  1NTK J;  1K9M Q;  1H8A A;  2FY8 A;  4OGQ C;  3RL0 D;  4DCK A;  3RBX A;  5AW5 B;  3H25 A;  1RE4 A;  2MJZ A;  1IFP A;  1NTM J;  3P8C E;  4ASW A;  1EDJ A;  3L70 J;  3OA7 A;  1RH5 B;  5B5E H;  1FJK A;  1OWA A;  2W8Z A;  2HR3 A;  3CX5 H;  4D6T J;  3L70 E;  1KIL D;  3H6P A;  3CCE P;  5APY A;  1YHQ P;  3EFF K;  2BEQ D;  3B5N B;  3S4R A;  2L91 A;  4I1L A;  3H1L J;  5AW0 B;  1IZN B;  4N3Y B;  2H89 C;  4U3F G;  1L0L K;  1LT1 A;  3I56 P;  1NTZ E;  3TGU E;  5L8R J; 
#chains in the Genus database with same CATH homology
 2QM7 A;  2GUV A;  5APS A;  1LTJ B;  1GZL A;  4LGD E;  4XA4 A;  3NTN A;  2Z5I A;  5AW2 B;  1GW3 A;  1N73 C;  5AVQ B;  3A3Y B;  5APU A;  1LTA C;  2WT7 B;  3BAT A;  5KJ7 D;  1L4A D;  1VPC A;  3EQ2 A;  1MV8 A;  1NTZ K;  2P2U A;  3VN0 A;  2P7J A;  5APQ A;  5AW3 B;  3V2P A;  1NOH A;  2M3B A;  3MIW A;  3VP9 A;  1XTC C;  2XDJ A;  3L36 A;  1LT9 A;  2OYI A;  2FFD A;  1ZR4 A;  2PAJ A;  1LTT C;  3WMM 0;  2XKM A;  3RK2 C;  2WT7 A;  1N7L A;  4IFF A;  3HD7 A;  1SFC B;  2IFN A;  3GHG A;  4WBA A;  2WIT A;  4I2L C;  2HPC B;  3UIA A;  1JY3 N;  5APV A;  3N7N A;  1N7S C;  1LT9 B;  1GTW A;  1L4A A;  1FOS E;  4I6M C;  5AW9 B;  4XE5 B;  1N2D C;  3CL3 D;  3MTU E;  1W2E A;  3C9I A;  1NH4 A;  2WPR A;  2W6A A;  5KTB A;  4IFM A;  2I1K A;  3NFQ A;  3TSI A;  3II6 A;  2YNY A;  5CJ0 A;  4LLH A;  3U1C A;  1KIL C;  3V2N A;  5CMZ A;  1HUC A;  1HGV A;  4JYB A;  5CHX A;  1A02 J;  3TK1 A;  4EIJ A;  1SQP K;  1Z56 A;  2O1J A;  2WPQ A;  1KFN A;  1KQL A;  2WZ7 A;  3RL0 C;  1OXZ A;  3LW5 H;  2YKP A;  2R5D A;  4M3L A;  3V4W A;  2KLV A;  2CPB A;  2XV5 A;  2A45 G;  1NHL A;  4IFD K;  1IFM A;  5BU5 A;  3M06 A;  4AQR D;  3OJA B;  2C9N Y;  2W27 A;  5KJ7 A;  1CSB A;  3VMX A;  3V4Q A;  1G2C A;  2HFE D;  2OAR A;  1DH3 A;  3OAK A;  1X79 B;  1CZQ A;  1FOS F;  3NXS A;  1J2J B;  1G1J A;  1SVF A;  5KJ7 C;  2OYH C;  1HVV A;  1IFI A;  1N7S B;  1E5W A;  1NAF A;  2C9L Y;  1URQ C;  2OYH B;  5AW4 B;  2WSC H;  3KQG A;  3VTP C;  4ZKU A;  2GUS A;  1JY2 O;  3R2P A;  3NMD A;  2R32 A;  2Q7C A;  1GU5 A;  1IO4 A;  3VMY A;  1HWT C;  1FU1 A;  4WY4 B;  1GL2 D;  2O01 H;  3HRN A;  3SWY A;  1RF1 B;  3VOP A;  3LIE A;  1MZ9 A;  1JY3 O;  1N7S A;  5AVR B;  3GHG B;  3CLQ A;  1LTJ C;  4GKG A;  1NWQ A;  1IC2 A;  1IK9 A;  3A5T A;  1GL2 C;  1ZN5 A;  1WRG A;  4W7Y A;  2WSE H;  2NPS D;  3U59 A;  1M1J A;  2H7H A;  3HUS C;  1GK4 A;  2YO3 A;  4DZO A;  1SQX K;  5CCH C;  1S9K D;  5AW1 B;  5APW A;  1LWU C;  1RE4 C;  1H88 A;  1SQV K;  4C46 A;  2OYH A;  2N9B A;  2XU6 A;  2ZXE B;  2QM8 A;  1RY3 A;  3M0D C;  2HG5 D;  1SQQ K;  2J59 M;  3L37 A;  2VRS A;  2Q3I A;  1GDT A;  3BRV B;  2CPS A;  5CCH D;  1RF0 A;  2N1T C;  3B5N C;  1FAV A;  2N1T D;  1N86 A;  2FKW B;  1MFZ A;  2W6B A;  2L5G B;  2M8R A;  1H89 A;  1FZG A;  1L4A C;  1GU4 A;  3VP8 A;  5BU8 B;  1LTB C;  5APX A;  2O1K A;  1SFC A;  1EQ7 A;  2A45 I;  5CCG A;  2KB7 P;  3V5B A;  3TNU A;  1DEB A;  5KLV K;  1T8Z A;  1LTJ A;  3O8Z A;  1XTG B;  2YKQ A;  3MGN A;  1FZF A;  1FZE A;  1JO5 A;  3E1I A;  1YYC A;  2R5B A;  4N78 D;  2HYN A;  1FZC A;  2H8P D;  2FXM A;  2GM4 A;  1M1J C;  1URQ D;  1ZLL A;  4JF7 A;  1RF1 A;  1SLQ A;  1GL2 A;  1WT6 A;  1JCD A;  2HOD B;  1T3J A;  3HE4 A;  5AVX B;  4C7N B;  3N4X A;  1JY3 P;  1J1E B;  1T2K D;  1LGH B;  2FFD B;  3P7K A;  1IJD B;  5AVZ B;  3HTK A;  2Q9I A;  1SQB K;  3M0A A;  1HJB A;  5AW7 B;  2N1T A;  5APT A;  4LC1 A;  4HYT B;  1GL2 B;  3EFG A;  2C0X A;  1JCC A;  1SFC D;  5CCG D;  1FZA A;  3HE4 B;  1CI6 A;  4C7N A;  1YTZ I;  1IFN A;  1J1D B;  2FYU K;  1ZV8 A;  3V2R A;  4WY4 A;  5AVT B;  2H43 A;  1HGZ A;  3RK2 D;  2YKO A;  1RE3 A;  4RES B;  3T97 A;  1ZR2 A;  3MUD A;  2WWW A;  4C7R A;  2YO2 A;  1KZU B;  2JEE A;  3B5N A;  3KPE A;  1URQ B;  3HE5 B;  2WSF H;  1HTL C;  2HPC A;  3IFM A;  3P8M C;  1JTH B;  4AYC A;  1FJP A;  1T2K C;  1JY2 P;  3M9B A;  1NKN A;  1SP4 A;  3G3Z A;  1SFC C;  5CCG C;  4B86 A;  3IR9 A;  4WY4 D;  3SWF A;  2NPS C;  1FBM A;  2KYV A;  2YMY A;  1NU1 K;  4EOT A;  1LTI C;  1QL1 A;  4GIF A;  3M9H A;  1YTZ T;  3PP5 A;  3GHG C;  1HH0 A;  2HLO A;  2NPS B;  1M7L A;  1DX7 A;  4O9B A;  5AW8 B;  1KFM A;  2IX7 C;  1JNM A;  3BAS A;  1X8Y A;  3HTK B;  1KIL B;  1FZB A;  2NPS A;  1NO4 A;  3VMZ A;  1NTM K;  1A02 F;  3BVH A;  2P1J A;  2ZFC A;  5AVV B;  2E42 A;  3H32 A;  1LTG C;  1NTK K;  3A2A A;  3CI9 A;  4GT1 A;  3TNU B;  3RK3 C;  1VDF A;  1LWU A;  3H32 B;  3MD0 A;  5AW6 B;  5AVU B;  1N73 B;  3HD7 C;  1G2C B;  2IFM A;  1IFD A;  4ZKP A;  2POH A;  5AVW B;  3VYI A;  2XNX A;  1RE3 C;  2WTY A;  1CW5 A;  5BVZ A;  3B5N D;  2C0W A;  1X9V A;  2FFD C;  1IFJ A;  5CCH A;  4HH2 A;  2WPS A;  1RF1 C;  1HBW A;  1S9K E;  1FDM A;  1JTH A;  3RL0 B;  1AFO A;  1JUN A;  2IPP A;  1L4A B;  3L4F A;  4W7Z A;  3M91 A;  3L35 A;  1QL2 A;  1L0N K;  1GK6 A;  1KIL A;  1FZC B;  2Q5U A;  2KOG A;  4JYC A;  3TYY A;  4W80 A;  2JJL A;  3A7O A;  1PFI A;  3I5C A;  1LT9 C;  4WY4 C;  2FYZ A;  2KP8 A;  1LWU B;  3LID A;  1RF0 C;  2XZR A;  3HUS A;  5AVY B;  2OYI C;  1M1J B;  1JOC A;  1URQ A;  1FZC C;  2KSJ A;  2OYI B;  2N1T B;  2Z5H A;  4WB4 A;  1J1E C;  1N73 A;  1J1D C;  2LKM A;  3U1A A;  2PP6 A;  3HD7 D;  3RK3 B;  2Z4E A;  1JY2 N;  1MUU A;  4N78 E;  3M0D A;  2E43 A;  3P8C D;  3KDP B;  4N6J A;  2A45 H;  4AUW A;  3V2Q A;  4KHX A;  2HOD A;  1GD2 E;  3KYQ A;  2P67 A;  1T3U A;  1GW4 A;  2R3C A;  5CJ4 A;  3RK2 B;  1JMM A;  3HE5 A;  4Y99 C;  2I1J A;  1N7S D;  1G1I A;  5AVS B;  1LTS C;  3BRT B;  4DOJ A;  4Y99 B;  3HUS B;  2J58 A;  4OH8 B;  3HD7 B;  3RK3 D;  3P32 A;  1NKZ B;  1CI6 B;  3M9Q A;  3B8E B;  2BAS A;  1AQ5 A;  1H8A A;  3RL0 D;  5AW5 B;  1RE4 A;  2MJZ A;  3P8C E;  3OA7 A;  1FJK A;  1OWA A;  1KIL D;  3H6P A;  5APY A;  3B5N B;  4I1L A;  5AW0 B;  4N3Y B;  1L0L K; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...