1N73A

Fibrin d-dimer, lamprey complexed with the peptide ligand: gly-his-arg-pro-amide
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
91
structure length
91
Chain Sequence
EVLRELERRIIHLQRRINMQLQQLTLLQHNIKTQVSQILRVEVDIDVALRACKGSCARYLEYRLDKEKNLQLEKAASYIANLKFERFEEVV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Fibrin alpha-1 chain
publication title The Crystal structure of fragment double-D from cross-linked lamprey fibrin reveals isopeptide linkages across an unexpected D-D interface
pubmed doi rcsb
molecule tags Blood clotting
total genus 30
structure length 91
sequence length 91
chains with identical sequence D
ec nomenclature
pdb deposition date 2002-11-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.50 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 1n73A00
1M1JB 1RE3A 1LWUC 3GHGB 2OYIB 1RF1A 2Q9IA 1JY3P 1LWUB 3H32B 3HUSA 2OYHC 1T3UA 2HODA 1FZFA 2OYHB 1JY3N 2Z4EA 1RE4C 1N73C 2HPCB 1FZEA 1JY2O 1LT9A 1FZCA 1LTJA 2FFDC 1N73B 1FZBA 2A45I 1M1JA 2FFDB 2HLOA 1RF0C 2OYIA 1RE3C 3GHGA 1FZAA 1RF1C 3BVHA 1JY3O 1LWUA 2XNXA 3H32A 3E1IA 2OYHA 1RF1B 3HUSC 1N86A 2HPCA 1W2EA 3HUSB 1FZGA 2A45G 1LT9C 2H43A 1LTJC 2HODB 1RE4A 1N73A 1JY2P 1FZCC 2FFDA 1LT9B 1M1JC 3GHGC 1FZCB 1LTJB 2OYIC 2A45H 1RF0A 1JY2N
chains in the Genus database with same CATH superfamily
3RBZA 3H1KE 4OGQD 3L73G 1P84H 1H8AA 1LT1A 1X9VA 3GF3A 2Q3EA 3L73J 2QEXP 1LP1B 2JR8A 3B4SA 3NXSA 1RF0A 1SFCA 3G3ZA 1NOHA 2O1KA 1M1JA 1S5LH 5AW3B 1T8ZA 2K9YA 3H1JG 5H2FH 1PGJA 3H1ID 3N7NA 1A02F 1SQXK 3H1JJ 2IX7C 1OX3A 1KB9I 3EFFK 3H1KG 3LIDA 4OVNF 3D6ZA 4GDOA 1JB0J 3H1KJ 2W6BA 1YYCA 1S4XA 3AEGC 1SQXD 2Y9ZA 3JCUH 1FDMA 2WMMA 3SWYA 3ABVC 5B66E 1FZAA 2KK7A 4I7ZC 2N9BA 4GOEA 1BGYE 1NKZB 1OVVA 2PP6A 5KLIC 1GW3A 1M1JB 2FY8A 1AQTA 3CWBD 2YNYA 1GU5A 2FYNC 1NGMB 5AW4B 2OYIA 3BRVB 2XDJA 2WT7A 2E74B 1KILC 1KFNA 2K9JA 1KB9D 1EDIA 1KYOE 3HUSA 1QL2A 1QX8A 2P1JA 1BE3E 3WU2E 2AXTH 3D6YA 1FE6A 3OJAB 4TLFA 1JOCA 3A0HE 1LTGC 4DT0A 1J1EC 2GUVA 3H1HE 1BGYG 1IFMA 2A06D 1X79B 2Y0DA 1KQLA 2JKVA 2JJLA 1KC8Q 1NU1K 2IFNA 3KQGA 5C39A 1BGYJ 3CCMP 2ZT9C 2IBZD 3M9QA 5KTBA 4B86A 1SVFA 3HTKA 2KI7B 5CJ0A 5KLVE 2OYIB 3TYYA 3WUUA 2HYNA 1NWQA 3KPEA 2WT7B 3MGNA 1FJPA 2LXCB 4BRYA 5M1BA 3AE7C 3IF4A 4U3FJ 1T3JA 2M3EA 1NU1D 3HD7A 3H32A 1BE3G 2ZJSE 5KAFE 3HUSB 3O8ZA 3VN0A 1VQOP 3GMAA 1NAFA 3E1RA 4WVZA 1RF0C 2G8YA 2O01J 1SFCC 2RKLA 1LWUA 3L75D 3IN6A 4L73A 1AVOA 2IFMA 1PV3A 5APQA 3KXDA 1L0LE 5KLVG 1OWAA 2AEMA 3HTKB 5K5GB 5CBOA 2V7QJ 1DIPA 3LW5J 3L4FA 5KLVJ 4BRYB 4H13B 3H1LG 2C0WA 3Q5RA 5B5EE 2KSEA 3QH9A 1HF9A 2CPBA 3HE5B 3H1LJ 3S4RA 4HYTB 4UB8E 1SQBK 3WUTA 4NPEA 1UIXA 1RE4A 2KZIA 5E79E 2A45H 1T3UA 3AEBC 4UB6E 5AW7B 1MV8A 4PJ0E 1YBKA 3AE6C 2E74D 5EFWB 2YXQB 1L0LG 1P84E 3L35A 1Q7YQ 4R4MA 1T2KC 1FDIA 3CX5I 1SQBD 2FXOA 2J5UA 2JP3A 4U7JA 2ZXEB 3MTUE 1L0LJ 1GDTA 3GG2A 3B5NB 1BCCD 3L74E 1NO4A 1URQC 1AV1A 2HPCA 4PV1C 4AQRD 3E7KA 3PH0A 1S5LE 2D2CB 1KILE 1K05A 3SSUA 2QJKB 2K88A 1EDLA 1Q82Q 2E75B 2XZRA 3TGUE 1JMBA 1JY3N 5KKZB 1LTJA 1WT6A 4HH2A 5CCHD 3MP7B 1HBWA 1ZRTE 4EYYQ 5TISH 2KP8A 4IL6X 4H44C 4OGQB 2L5GB 3CCJP 2J58A 3B71A 2C0XA 4W7ZA 3FWLA 2E76C 3JCUE 1S3JA 1J2JB 4H13C 3L74G 1JO5A 3H1JD 3HD7C 1SQQE 3O6QB 3L70E 1ZMEC 1U57A 3M9BA 1KQFB 3L74J 3TGUG 3RL0C 2M5AB 1KN7A 1NTKE 4C7NA 3H1KD 2QIWA 1ZOYC 2QJPC 1N73A 2B9BA 2OTLP 3AEEC 1LTJB 4MN4C 3TGUJ 1LWUC 1PGOA 1NTZE 2GM4A 1AQ5A 1GU4A 2HG5D 2P58A 2OYHA 1L0NE 2AXTE 3W68A 3AE1C 1NH4A 3OAKA 1OXZA 2WSFH 1Z56A 4OWFA 1YQ3C 4L74A 2KSJA 2QG4A 2N1TC 3CCQP 1SQQG 3L70G 2E5YA 5KJ7C 1HGZA 1PIXA 2P2UA 2XNXA 1PP9D 3G71P 1FZGA 2HFED 2K3RA 1SQQJ 3L70J 1CI6A 1M56D 5CJ4A 3CL3D 1WMKA 1NTKG 3CCUP 4JYCA 4WWIA 1N8RQ 1RE4C 1YITP 4C7NB 3Q5SA 1NTZG 3FXEA 4RKUJ 3S9OA 5AW8B 1YTZT 2YMYA 1NTZJ 4OGQC 3CPWO 2OYHB 2QM7A 1LP1A 3VMAA 1BGYD 1JY2O 2PGDA 3B5ND 4ZKPA 2KYVA 1BDDA 1VQ8P 4OH8B 2QVAA 4Y28J 2YIUB 2M0BA 2XNDH 3GLMA 4Y99C 1IFNA 2D2CD 5AVZB 4JYBA 2DW3A 2QJYB 3PJSK 3AE8C 4U3FD 1X0TA 2WTYA 5GTIH 2FXMA 1IO4A 1CI6B 2YKPA 2I1KA 1KYOD 2P10A 2FYZA 1FBMA 1LTJC 1KB9H 1HGVA 2HODA 3B8EB 4WY4D 2Y9YA 5KLVK 4GIFA 3SFDC 5BU5A 5AVTB 1K73Q 1GL2D 1LTTC 1JY2P 1FZCC 2B87B 1RE3A 2PAJA 3JSVC 3T97A 3JC22 2KS1A 2WSSH 2JEEA 1K8AQ 3CCEP 1NTME 5AVXB 2ZYGA 1IFIA 1FDOA 2QM8A 5KLVD 5TJHA 1VQMP 3S1KA 3A7OA 3R4YA 5CHXA 4GKGA 4RO0A 2WITA 5APUA 1VPCA 1N73C 3H1LD 3OA7A 3CI9A 3BATA 1N7SD 3AEFC 1QVFO 3P8MC 3CLQA 1FOSE 5GTHH 3SFEC 3VMYA 4PD4I 3BCCD 4BWNA 1NKNA 3RK3B 2HODB 1L0LK 1LT9B 1K04A 3GHGB 1HVVA 3P8CE 1IK7A 3C1LA 3C9IA 1FZEA 2G3AA 4ZMDA 1J1DB 3RK2B 5AVQB 1VDFA 4IL6H 1DEBA 1G1JA 3L36A 2A45G 3T97B 1NTMG 2KS1B 1MKMA 4EI2A 1L0LD 2IBZI 4I1LA 5CCGD 1YJ9P 2RMZA 5CCHA 1X22A 3TNUB 1HWTC 2J59M 5TISE 3V4WA 1RF1B 1NJIQ 1OVUA 3CC4P 1XTCC 1IFJA 3PP5A 3FWNA 1RQUA 4M3LA 1E79H 1PPJE 4PD4D 1BSNA 3M9HA 1L4AB 4TT3H 3USSA 4DCKA 2IYOA 1YHQP 2Q6QA 4ASVA 1Y47A 1Q86Q 3PLNA 1S9KE 2WQYC 2KXPB 1M1KQ 1RQVA 2OGUA 3TSIA 3CCLP 3ZDMA 1RY3A 4GT1A 4AYCA 1W5CE 1X8YA 3AECC 1H89A 1Y9BA 2LXBA 3GF7A 4N6JA 2ZXXA 3NTNA 1GTWA 4EIJA 1PPJG 1KILD 2QSIA 2YXRB 3TGUD 3HE5A 3GW6A 5AVSB 5CMZA 1BE3J 3H1IE 1LTIC 1JMMA 2O1JA 2XU6A 3Q1MA 4GODA 4IOIH 5APVA 1RE3C 3H1HG 4LLHA 1SQQK 3G4SP 1ZRTD 1M8OB 1R8EA 2MJZA 1SS1A 2Q3IA 1VQNP 2KUBA 4NPFX 2JWAA 4WB4A 1M1JC 2XKMA 3H1HJ 4C46A 1VQKP 1PZQA 1OMIA 1VQLP 1FAVA 3EQ2A 2NRGA 3Q3DA 1SQXE 3CX5H 2E74C 1Y8AA 1NTZK 1SQQD 2Z5IA 3L72D 3L70D 3V2RA 3RK3D 3B5NA 1LTSC 2YMKA 2XV5A 3ITKA 5AW2B 1LJ2A 2K37A 1IJDB 2WSFJ 2Y0CA 3CXHI 3RK2D 1BSHA 1USDA 3OW2O 3H1IG 3TDKA 5GTIE 1NTZD 1S72P 1GZLA 1K9MQ 3F89A 2KOGA 2WZ7A 4IFFA 2WSCH 1KB9E 3FGAD 2ZFCA 3CMAP 3K5BA 3HRNA 3TF5A 1RH5B 1SQXG 3A3YB 1DD4A 2OYIC 1R5SA 2K1AA 1KZUB 1T6AA 2KB7P 3HE4B 1GL2A 2I8DA 1SQVE 2AEFA 4CPGA 2R3SA 2FFDB 2YKOA 2OTKE 3O6QA 1L4AD 1PFIA 3HUSC 1JNMA 5AW6B 2GA1A 3W67A 5AVVB 1JCDA 2WPVB 1M7LA 4IFDK 3CXHD 1JEKA 2M5AA 4W80A 4N78D 5H2FE 2NPSB 1CW5A 1EDKA 1KORA 4HKZH 2O3JA 4KHXA 4D6TE 3L73D 1JM0A 1D7MA 1A02J 5BVZA 4NPDA 4W7YA 1NU1E 4H0LB 4QMAA 1W2BO 5GTHE 3PHLA 1EXJA 1VF5B 4O9BA 4ASWA 4WY4B 3NFQA 3BVHA 1SQVG 1DH3A 3RGUA 1GK4A 1GL2B 1T2KD 4IL6E 1VQ6P 1SQVJ 2H7HA 1LNQA 4DZOA 4LC1A 2E43A 1RHZB 5CCGA 1URQD 5APYA 4PV1D 4D6TG 3II6A 1U7MA 4D6TJ 2IZ1A 4JBZA 5APTA 4BXLA 1N7SB 3AEAC 2FYUE 3IFMA 1IFDA 2SPZA 2QA4P 3B5NC 3V6IA 3CC2P 1SP4A 1GW4A 1YI2P 2POHA 2E76D 1HTLC 2Z5HA 2D2CC 1FU1A 2R5BA 2QJKC 2E75C 3FXDA 1KYOI 3U1CA 1GMJA 5KKZC 3IAOA 2ITAA 1OZHA 1KFMA 2E42A 2FKWB 1NTKJ 2H8PD 4ZKUA 1USEA 3KDPB 1YJWP 3TK1A 3P8CD 3KZIH 2UWJE 3CMEP 2FYUG 3R2PA 2AEJA 4I6MC 2QE7H 1KILA 5AVYB 1L0NG 3CCVP 5APWA 2FYUJ 2Y0EA 2P7JA 2B87A 5APXA 2YO3A 1L0NJ 1JCCA 2WPRA 1GD2E 3MUDA 2M3BA 2NPSD 3BRTB 2N1TD 2CPSA 1U7JA 5KJ7D 4RJTA 1ZP0C 2ZYDA 2PRRA 3VMXA 4I7ZB 4H0LD 5DJUB 1PPJD 3CX5E 1ZLLA 1BE3D 2JWDA 5CBNA 5KLIB 2BCCE 5KAIH 1VF5D 2KNCB 4PD4H 1OW8A 1LT9A 1E5WA 4YPCA 5AW1B 3GHGA 2FYNB 4YXDC 1EC5A 1EZVE 2AXCA 1Q2NA 3H1HD 1KILB 4R4LA 1UIIA 2LKMA 2CK3H 1L2PA 1EXIA 1HH0A 3WUVA 4N3YB 4RESB 4JF7A 3UIAA 1LTBC 1YTZI 2OYOA 4IFMA 1J1EB 3TNUA 2W8ZA 3VP9A 2L91A 2WSEH 3V2QA 5CCGC 1RF1A 3H6PA 1AA0A 2H89C 2BCCG 1ZV8A 2ZT9B 2H43A 3FX0A 1IFPA 1JTHA 2BCCJ 4WBAA 1PP9E 5AW5B 1EZVG 1JY2N 1L4AA 1CSBA 2BASA 2OYHC 3NMDA 5AW9B 2KLUA 2FXPA 3PTZA 2PFXA 2YIUC 1FJKA 4DOJA 3I56P 1P84I 3CD6P 2QJYC 1M57D 2YO2A 2W83C 3L71E 1G1IA 3MHVA 1NTMJ 3KYQA 4YXWH 1R5LA 2WSCJ 3QWOC 1SFCB 1OIPA 1N86A 1S1CX 2E5TA 3I5CA 1H0TA 2Q1KA 3P7KA 2KZJA 3A0BH 1NHLA 3G6EP 1SQPE 1PP9G 3WMM0 3RL0g 1JTHB 4U3FE 3M91A 3P32A 1SQVK 1PP9J 2GUSA 2C9LY 1URQA 2ZVOB 2Z4EA 5AVRB 1ZW0A 3MUDC 1KV4A 1PL5A 2R32A 4Z1MH 1FS0E 2JO1A 2ZYAA 1P84D 4DJGA 3L71G 2M8RA 4XE5B 2QRXA 1HJBA 2P67A 1AJYA 1AVYA 1SQVD 3L71J 2KIKA 2LR2A 1QGKB 3L74D 3VOPA 3V2NA 1JUNA 1H0TB 3KHUA 4L75A 1YJNP 2NZ2A 1Q81Q 5AW0B 2Q5UA 1SQPG 3RK3C 1W2EA 4K35A 1LT9C 1FC2C 1VQ9P 1PGPA 1SLQA 1XTGB 3GHGC 3CXHH 3MD0A 4U3FG 1SQPJ 4D6TD 1OFCX 2K9JB 1J1DC 2C9NY 3RK2C 3CCRP 4JQ0D 2O01N 2B88A 1KD1Q 3H1LE 5AVWB 1QL1A 3U59A 1URQB 4YTPC 1NAYA 4A7PA 2WWWA 1G2CA 4PV1B 2JDIH 1DEEG 3BCCE 2FBWC 1VQ7P 1NTKK 3KZIE 2Q7CA 1LGHB 3M0DA 2RH0A 4HB1A 1RF1C 1MFTA 2ZT9D 1JY3O 2WPSA 5AVUB 3HE4A 3CC7P 2FFDA 4EDFA 1VQPP 2FYUK 1TU3F 3AE2C 3AEDC 3A2AA 1L0NK 3U1AA 4H44B 3D71A 1ZR2A 1FZBA 1NTKD 1LTAC 3CWBE 1L4AC 1MUUA 4ZNCA 2E76B 2NPSA 4C7RA 2N1TA 1QLED 1AFOA 5KJ7A 1OW7A 3H1IJ 2HR3A 3HD7B 2IDBA 3H32B 2FYUD 4XFJA 3LIEA 3BCCG 1L0ND 5DJTB 3C8VA 1G2CB 5KAIE 1SFCD 3EWKA 4PD4E 1EDJA 3RL0B 5CCHC 2KLVA 3BCCJ 1BDCA 2QJPB 4WY4A 3V4QA 1JY3P 1LWUB 2WPQA 1SQXJ 1IK9A 2OTJP 1VQ5P 2BEQD 2A06E 2YKQA 3PRJA 3Q5PA 3M0AA 3CWBG 2R5DA 3L37A 2IBZE 2ZAEB 1S5LX 2W6JH 2Q9IA 1FZFA 2WVRA 4HJGH 1PGQA 3CWBJ 4JPZB 2B89A 2N1TB 3RBXA 3SWFA 3CCSP 1EZVI 1MZ9A 5B66H 1N7SA 1N7LA 3M06A 5BU8B 3I55P 3VTPC 2A45I 3AE5C 2A06G 1IZNB 3L75E 1KMIZ 1VL2A 1KQSO 3G9RA 1DD3A 4EOTA 1FZCA 1KQGB 3A5TA 2IBZG 2BEZF 3CX5D 1CZQA 1FOSF 5L8RJ 1YIJP 2BCCD 1KYOH 3AE9C 3WU2H 1NTMK 4Y99B 1NYHA 3L72E 3RK3E 1N2DC 1GK6A 2WSEJ 1EZVD 3A0HH 2O01H 1KTMA 2HPCB 1NU1G 3A0BE 3BASA 3V2PA 2OARA 1NU1J 2H88C 3M0DC 4KT0J 4LGDE 1MFZA 1NTMD 1EQ7A 4XA4A 4H44D 1NVOA 2FFDC 2RN0A 3L75G 1HJ0A 2V7QH 3LW5H 1OW6A 5APSA 3L75J 4H13D 1FZCB 1M90Q 2IYPA 3HD7D 2NPSC 1SQBE 5KAFH 2N9YB 3IR9A 3L72G 2W90A 3AE4C 1S2EA 2VRSA 2KNCA 3V5BA 3RL0D 1IC2A 3H25A 4H0LC 3L72J 1BCCE 1VF5C 3VYIA 1VQ4P 1ZN5A 3CXHE 4WY4C 1N73B 3MIWA 2HLOA 3EFGA 4I2LC 2W6AA 1YQ4C 3D70A 4N78E 3MZWB 3AE3C 1GL2C 1SQPK 4K3AA 3L71D 2R44A 3Q2YA 1HUCA 2IZ0A 3L73E 1QVGO 4L76A 2I1JA 2MKVA 1ZXGA 1ZR4A 4GOFA 2V4HA 1SQBG 2W27A 5B5EH 3VP8A 2R3CA 1SQPD 3VMZA 2E75D 1SQBJ 3SWKA 4AUWA 4UB8H 1BCCG 1WRGA 1Q90D 1N7SC 3H1JE 3F5HA 5E79H 2ZVNB 3E1IA 2OQQA 1QEXA 4KJMA 1BCCJ 2IPPA 1DX7A 4UB6H 1H88A 1OVRA 3N4XA 4PJ0H 1S9KD
chains in the Genus database with same CATH topology
1LWUC 2KOGA 2WZ7A 1URQA 4IFFA 2WSCH 2GM4A 2Z4EA 5AVRB 2R32A 2ZFCA 1GU4A 1H8AA 1AQ5A 2HG5D 1X9VA 2OYHA 2M8RA 4XE5B 3HRNA 1HJBA 1NH4A 3OAKA 2P67A 3A3YB 3NXSA 1OXZA 2OYIC 1KZUB 1RF0A 2WSFH 1SFCA 1Z56A 2KB7P 3G3ZA 1NOHA 2O1KA 2KSJA 3HE4B 3VOPA 1GL2A 2N1TC 3V2NA 1JUNA 1M1JA 2FFDB 2YKOA 5KJ7C 1HGZA 1L4AD 1PFIA 2P2UA 2XNXA 5AW3B 3HUSC 1T8ZA 5AW0B 2Q5UA 3RK3C 1JNMA 5AW6B 1W2EA 1FZGA 1LT9C 2HFED 1SLQA 3N7NA 1JCDA 1XTGB 5AVVB 1A02F 3GHGC 1M7LA 1SQXK 1CI6A 3MD0A 4IFDK 5CJ4A 3CL3D 4W80A 4JYCA 4N78D 2NPSB 1RE4C 2IX7C 1CW5A 1J1DC 2C9NY 3RK2C 4C7NB 4KHXA 5AVWB 1QL1A 3LIDA 3U59A 1A02J 1URQB 5BVZA 5AW8B 2WWWA 1G2CA 4W7YA 1YTZT 2YMYA 2W6BA 1YYCA 1FDMA 4O9BA 1NTKK 2OYHB 3SWYA 2QM7A 2Q7CA 1JY2O 4ZKPA 1LGHB 3B5ND 3M0DA 4WY4B 3NFQA 1FZAA 2KYVA 1RF1C 3BVHA 1JY3O 2WPSA 4OH8B 5AVUB 2N9BA 3HE4A 1NKZB 1DH3A 1GK4A 4Y99C 1GL2B 1T2KD 2FFDA 2PP6A 1IFNA 5AVZB 1GW3A 4JYBA 2FYUK 1M1JB 2H7HA 2YNYA 1GU5A 3A2AA 1L0NK 3U1AA 4DZOA 1ZR2A 1FZBA 2WTYA 4LC1A 1LTAC 5AW4B 2OYIA 2E43A 1L4AC 2FXMA 3BRVB 1IO4A 1MUUA 2XDJA 1CI6B 5CCGA 2WT7A 1URQD 1KILC 2YKPA 5APYA 2I1KA 2NPSA 1KFNA 4C7RA 2N1TA 2FYZA 1AFOA 1FBMA 1LTJC 3II6A 1HGVA 5KJ7A 3HD7B 3H32B 3HUSA 2HODA 1QL2A 2P1JA 3B8EB 3LIEA 4WY4D 5APTA 1G2CB 1N7SB 5KLVK 3OJAB 4GIFA 1SFCD 1JOCA 5BU5A 1LTGC 3IFMA 5AVTB 1J1EC 1GL2D 3RL0B 1LTTC 5CCHC 2KLVA 1JY2P 1FZCC 2GUVA 4WY4A 3V4QA 1IFDA 1RE3A 2PAJA 1IFMA 1JY3P 1LWUB 1X79B 3T97A 1KQLA 2WPQA 2JEEA 2JJLA 3B5NC 1IK9A 1NU1K 1SP4A 1GW4A 2IFNA 3KQGA 5AVXB 2POHA 2YKQA 1IFIA 3M9QA 2QM8A 1HTLC 3A7OA 5KTBA 2Z5HA 3M0AA 4B86A 5CHXA 2R5DA 1FU1A 1SVFA 3HTKA 5CJ0A 2R5BA 3L37A 4GKGA 2OYIB 2Q9IA 2WITA 3TYYA 2HYNA 3U1CA 1NWQA 5APUA 3KPEA 1FZFA 1VPCA 2WT7B 3MGNA 1N73C 1FJPA 3OA7A 3CI9A 3BATA 1N7SD 2N1TB 3SWFA 1KFMA 3P8MC 1T3JA 3CLQA 3HD7A 2E42A 3H32A 3VMYA 2FKWB 1FOSE 2H8PD 4ZKUA 3KDPB 1MZ9A 3HUSB 1NKNA 3RK3B 2HODB 3P8CD 3TK1A 1L0LK 1LT9B 1N7SA 3O8ZA 1N7LA 3M06A 3VN0A 3R2PA 5BU8B 4I6MC 3GHGB 1KILA 5AVYB 1HVVA 3P8CE 5APWA 3VTPC 1NAFA 3C9IA 1FZEA 2A45I 1J1DB 3RK2B 2P7JA 1RF0C 5APXA 1SFCC 5AVQB 1VDFA 1LWUA 2YO3A 1DEBA 1G1JA 1JCCA 3L36A 2A45G 2WPRA 2IFMA 1GD2E 3MUDA 5APQA 2M3BA 4I1LA 5CCGD 2NPSD 3BRTB 2N1TD 5CCHA 4EOTA 1FZCA 3TNUB 3A5TA 2CPSA 1OWAA 1HWTC 2J59M 5KJ7D 3HTKB 1CZQA 1FOSF 3V4WA 3VMXA 1RF1B 1XTCC 1IFJA 3L4FA 3PP5A 1ZLLA 1NTMK 4Y99B 4M3LA 1N2DC 2C0WA 1GK6A 2O01H 2HPCB 1LT9A 1E5WA 2CPBA 5AW1B 3HE5B 3GHGA 3BASA 3V2PA 2OARA 3M9HA 1L4AB 4HYTB 1SQBK 1KILB 1RE4A 3M0DC 2LKMA 4LGDE 2A45H 1MFZA 1HH0A 1EQ7A 4XA4A 1T3UA 5AW7B 1MV8A 1S9KE 2FFDC 4N3YB 4RESB 4JF7A 3LW5H 3TSIA 3UIAA 1LTBC 1YTZI 1RY3A 4GT1A 4AYCA 5APSA 4IFMA 3L35A 1J1EB 3TNUA 1X8YA 1T2KC 3VP9A 1FZCB 2WSEH 3V2QA 1H89A 5CCGC 2ZXEB 3HD7D 1RF1A 3H6PA 2NPSC 3MTUE 4N6JA 1GDTA 3IR9A 3NTNA 1GTWA 3B5NB 4EIJA 1ZV8A 2VRSA 1NO4A 3V5BA 1KILD 1URQC 3RL0D 1IC2A 2HPCA 4AQRD 2H43A 1JTHA 3HE5A 4WBAA 5AW5B 1JY2N 3VYIA 1L4AA 5AVSB 5CMZA 1CSBA 2BASA 2OYHC 3NMDA 2XZRA 1LTIC 1JY3N 1ZN5A 1JMMA 2O1JA 5AW9B 1LTJA 4WY4C 2XU6A 1N73B 3MIWA 1WT6A 2HLOA 3EFGA 4I2LC 2W6AA 1RE3C 5APVA 4LLHA 1SQQK 4N78E 2MJZA 2Q3IA 1FJKA 4DOJA 1GL2C 1SQPK 4HH2A 5CCHD 4WB4A 1HBWA 1M1JC 2XKMA 4C46A 1HUCA 2YO2A 2KP8A 1FAVA 2I1JA 1G1IA 3EQ2A 2L5GB 2J58A 3KYQA 1ZR4A 2C0XA 4W7ZA 1SFCB 1N86A 3I5CA 2W27A 1NTZK 2Z5IA 3V2RA 3RK3D 3P7KA 3VP8A 2R3CA 1J2JB 3B5NA 1LTSC 1JO5A 3VMZA 3HD7C 2XV5A 5AW2B 4AUWA 3M9BA 1NHLA 1IJDB 1WRGA 1N7SC 3RK2D 3WMM0 1JTHB 3M91A 3E1IA 3P32A 3RL0C 1SQVK 2IPPA 4C7NA 1DX7A 1N73A 1H88A 2GUSA 1GZLA 3N4XA 1LTJB 1S9KD 2C9LY
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1M1J B;  1RE3 A;  1LWU C;  3GHG B;  2OYI B;  1RF1 A;  2Q9I A;  1JY3 P;  1LWU B;  3H32 B;  3HUS A;  2OYH C;  1T3U A;  2HOD A;  1FZF A;  2OYH B;  1JY3 N;  2Z4E A;  1RE4 C;  1N73 C;  2HPC B;  1FZE A;  1JY2 O;  1LT9 A;  1FZC A;  1LTJ A;  2FFD C;  1N73 B;  1FZB A;  2A45 I;  1M1J A;  2FFD B;  2HLO A;  1RF0 C;  2OYI A;  1RE3 C;  3GHG A;  1FZA A;  1RF1 C;  3BVH A;  1JY3 O;  1LWU A;  2XNX A;  3H32 A;  3E1I A;  2OYH A;  1RF1 B;  3HUS C;  1N86 A;  2HPC A;  1W2E A;  3HUS B;  1FZG A;  2A45 G;  1LT9 C;  2H43 A;  1LTJ C;  2HOD B;  1RE4 A;  1N73 A;  1JY2 P;  1FZC C;  2FFD A;  1LT9 B;  1M1J C;  3GHG C;  1FZC B;  1LTJ B;  2OYI C;  2A45 H;  1RF0 A;  1JY2 N; 
#chains in the Genus database with same CATH topology
 3RBZ A;  3H1K E;  4OGQ D;  3L73 G;  1P84 H;  1H8A A;  1LT1 A;  1X9V A;  3GF3 A;  2Q3E A;  3L73 J;  2QEX P;  1LP1 B;  2JR8 A;  3B4S A;  3NXS A;  1RF0 A;  1SFC A;  3G3Z A;  1NOH A;  2O1K A;  1M1J A;  1S5L H;  5AW3 B;  1T8Z A;  2K9Y A;  3H1J G;  5H2F H;  1PGJ A;  3H1I D;  3N7N A;  1A02 F;  1SQX K;  3H1J J;  2IX7 C;  1OX3 A;  1KB9 I;  3EFF K;  3H1K G;  3LID A;  4OVN F;  3D6Z A;  4GDO A;  1JB0 J;  3H1K J;  2W6B A;  1YYC A;  1S4X A;  3AEG C;  1SQX D;  2Y9Z A;  3JCU H;  1FDM A;  2WMM A;  3SWY A;  3ABV C;  5B66 E;  1FZA A;  2KK7 A;  4I7Z C;  2N9B A;  4GOE A;  1BGY E;  1NKZ B;  1OVV A;  2PP6 A;  5KLI C;  1GW3 A;  1M1J B;  2FY8 A;  1AQT A;  3CWB D;  2YNY A;  1GU5 A;  2FYN C;  1NGM B;  5AW4 B;  2OYI A;  3BRV B;  2XDJ A;  2WT7 A;  2E74 B;  1KIL C;  1KFN A;  2K9J A;  1KB9 D;  1EDI A;  1KYO E;  3HUS A;  1QL2 A;  1QX8 A;  2P1J A;  1BE3 E;  3WU2 E;  2AXT H;  3D6Y A;  1FE6 A;  3OJA B;  4TLF A;  1JOC A;  3A0H E;  1LTG C;  4DT0 A;  1J1E C;  2GUV A;  3H1H E;  1BGY G;  1IFM A;  2A06 D;  1X79 B;  2Y0D A;  1KQL A;  2JKV A;  2JJL A;  1KC8 Q;  1NU1 K;  2IFN A;  3KQG A;  5C39 A;  1BGY J;  3CCM P;  2ZT9 C;  2IBZ D;  3M9Q A;  5KTB A;  4B86 A;  1SVF A;  3HTK A;  2KI7 B;  5CJ0 A;  5KLV E;  2OYI B;  3TYY A;  3WUU A;  2HYN A;  1NWQ A;  3KPE A;  2WT7 B;  3MGN A;  1FJP A;  2LXC B;  4BRY A;  5M1B A;  3AE7 C;  3IF4 A;  4U3F J;  1T3J A;  2M3E A;  1NU1 D;  3HD7 A;  3H32 A;  1BE3 G;  2ZJS E;  5KAF E;  3HUS B;  3O8Z A;  3VN0 A;  1VQO P;  3GMA A;  1NAF A;  3E1R A;  4WVZ A;  1RF0 C;  2G8Y A;  2O01 J;  1SFC C;  2RKL A;  1LWU A;  3L75 D;  3IN6 A;  4L73 A;  1AVO A;  2IFM A;  1PV3 A;  5APQ A;  3KXD A;  1L0L E;  5KLV G;  1OWA A;  2AEM A;  3HTK B;  5K5G B;  5CBO A;  2V7Q J;  1DIP A;  3LW5 J;  3L4F A;  5KLV J;  4BRY B;  4H13 B;  3H1L G;  2C0W A;  3Q5R A;  5B5E E;  2KSE A;  3QH9 A;  1HF9 A;  2CPB A;  3HE5 B;  3H1L J;  3S4R A;  4HYT B;  4UB8 E;  1SQB K;  3WUT A;  4NPE A;  1UIX A;  1RE4 A;  2KZI A;  5E79 E;  2A45 H;  1T3U A;  3AEB C;  4UB6 E;  5AW7 B;  1MV8 A;  4PJ0 E;  1YBK A;  3AE6 C;  2E74 D;  5EFW B;  2YXQ B;  1L0L G;  1P84 E;  3L35 A;  1Q7Y Q;  4R4M A;  1T2K C;  1FDI A;  3CX5 I;  1SQB D;  2FXO A;  2J5U A;  2JP3 A;  4U7J A;  2ZXE B;  3MTU E;  1L0L J;  1GDT A;  3GG2 A;  3B5N B;  1BCC D;  3L74 E;  1NO4 A;  1URQ C;  1AV1 A;  2HPC A;  4PV1 C;  4AQR D;  3E7K A;  3PH0 A;  1S5L E;  2D2C B;  1KIL E;  1K05 A;  3SSU A;  2QJK B;  2K88 A;  1EDL A;  1Q82 Q;  2E75 B;  2XZR A;  3TGU E;  1JMB A;  1JY3 N;  5KKZ B;  1LTJ A;  1WT6 A;  4HH2 A;  5CCH D;  3MP7 B;  1HBW A;  1ZRT E;  4EYY Q;  5TIS H;  2KP8 A;  4IL6 X;  4H44 C;  4OGQ B;  2L5G B;  3CCJ P;  2J58 A;  3B71 A;  2C0X A;  4W7Z A;  3FWL A;  2E76 C;  3JCU E;  1S3J A;  1J2J B;  4H13 C;  3L74 G;  1JO5 A;  3H1J D;  3HD7 C;  1SQQ E;  3O6Q B;  3L70 E;  1ZME C;  1U57 A;  3M9B A;  1KQF B;  3L74 J;  3TGU G;  3RL0 C;  2M5A B;  1KN7 A;  1NTK E;  4C7N A;  3H1K D;  2QIW A;  1ZOY C;  2QJP C;  1N73 A;  2B9B A;  2OTL P;  3AEE C;  1LTJ B;  4MN4 C;  3TGU J;  1LWU C;  1PGO A;  1NTZ E;  2GM4 A;  1AQ5 A;  1GU4 A;  2HG5 D;  2P58 A;  2OYH A;  1L0N E;  2AXT E;  3W68 A;  3AE1 C;  1NH4 A;  3OAK A;  1OXZ A;  2WSF H;  1Z56 A;  4OWF A;  1YQ3 C;  4L74 A;  2KSJ A;  2QG4 A;  2N1T C;  3CCQ P;  1SQQ G;  3L70 G;  2E5Y A;  5KJ7 C;  1HGZ A;  1PIX A;  2P2U A;  2XNX A;  1PP9 D;  3G71 P;  1FZG A;  2HFE D;  2K3R A;  1SQQ J;  3L70 J;  1CI6 A;  1M56 D;  5CJ4 A;  3CL3 D;  1WMK A;  1NTK G;  3CCU P;  4JYC A;  4WWI A;  1N8R Q;  1RE4 C;  1YIT P;  4C7N B;  3Q5S A;  1NTZ G;  3FXE A;  4RKU J;  3S9O A;  5AW8 B;  1YTZ T;  2YMY A;  1NTZ J;  4OGQ C;  3CPW O;  2OYH B;  2QM7 A;  1LP1 A;  3VMA A;  1BGY D;  1JY2 O;  2PGD A;  3B5N D;  4ZKP A;  2KYV A;  1BDD A;  1VQ8 P;  4OH8 B;  2QVA A;  4Y28 J;  2YIU B;  2M0B A;  2XND H;  3GLM A;  4Y99 C;  1IFN A;  2D2C D;  5AVZ B;  4JYB A;  2DW3 A;  2QJY B;  3PJS K;  3AE8 C;  4U3F D;  1X0T A;  2WTY A;  5GTI H;  2FXM A;  1IO4 A;  1CI6 B;  2YKP A;  2I1K A;  1KYO D;  2P10 A;  2FYZ A;  1FBM A;  1LTJ C;  1KB9 H;  1HGV A;  2HOD A;  3B8E B;  4WY4 D;  2Y9Y A;  5KLV K;  4GIF A;  3SFD C;  5BU5 A;  5AVT B;  1K73 Q;  1GL2 D;  1LTT C;  1JY2 P;  1FZC C;  2B87 B;  1RE3 A;  2PAJ A;  3JSV C;  3T97 A;  3JC2 2;  2KS1 A;  2WSS H;  2JEE A;  1K8A Q;  3CCE P;  1NTM E;  5AVX B;  2ZYG A;  1IFI A;  1FDO A;  2QM8 A;  5KLV D;  5TJH A;  1VQM P;  3S1K A;  3A7O A;  3R4Y A;  5CHX A;  4GKG A;  4RO0 A;  2WIT A;  5APU A;  1VPC A;  1N73 C;  3H1L D;  3OA7 A;  3CI9 A;  3BAT A;  1N7S D;  3AEF C;  1QVF O;  3P8M C;  3CLQ A;  1FOS E;  5GTH H;  3SFE C;  3VMY A;  4PD4 I;  3BCC D;  4BWN A;  1NKN A;  3RK3 B;  2HOD B;  1L0L K;  1LT9 B;  1K04 A;  3GHG B;  1HVV A;  3P8C E;  1IK7 A;  3C1L A;  3C9I A;  1FZE A;  2G3A A;  4ZMD A;  1J1D B;  3RK2 B;  5AVQ B;  1VDF A;  4IL6 H;  1DEB A;  1G1J A;  3L36 A;  2A45 G;  3T97 B;  1NTM G;  2KS1 B;  1MKM A;  4EI2 A;  1L0L D;  2IBZ I;  4I1L A;  5CCG D;  1YJ9 P;  2RMZ A;  5CCH A;  1X22 A;  3TNU B;  1HWT C;  2J59 M;  5TIS E;  3V4W A;  1RF1 B;  1NJI Q;  1OVU A;  3CC4 P;  1XTC C;  1IFJ A;  3PP5 A;  3FWN A;  1RQU A;  4M3L A;  1E79 H;  1PPJ E;  4PD4 D;  1BSN A;  3M9H A;  1L4A B;  4TT3 H;  3USS A;  4DCK A;  2IYO A;  1YHQ P;  2Q6Q A;  4ASV A;  1Y47 A;  1Q86 Q;  3PLN A;  1S9K E;  2WQY C;  2KXP B;  1M1K Q;  1RQV A;  2OGU A;  3TSI A;  3CCL P;  3ZDM A;  1RY3 A;  4GT1 A;  4AYC A;  1W5C E;  1X8Y A;  3AEC C;  1H89 A;  1Y9B A;  2LXB A;  3GF7 A;  4N6J A;  2ZXX A;  3NTN A;  1GTW A;  4EIJ A;  1PPJ G;  1KIL D;  2QSI A;  2YXR B;  3TGU D;  3HE5 A;  3GW6 A;  5AVS B;  5CMZ A;  1BE3 J;  3H1I E;  1LTI C;  1JMM A;  2O1J A;  2XU6 A;  3Q1M A;  4GOD A;  4IOI H;  5APV A;  1RE3 C;  3H1H G;  4LLH A;  1SQQ K;  3G4S P;  1ZRT D;  1M8O B;  1R8E A;  2MJZ A;  1SS1 A;  2Q3I A;  1VQN P;  2KUB A;  4NPF X;  2JWA A;  4WB4 A;  1M1J C;  2XKM A;  3H1H J;  4C46 A;  1VQK P;  1PZQ A;  1OMI A;  1VQL P;  1FAV A;  3EQ2 A;  2NRG A;  3Q3D A;  1SQX E;  3CX5 H;  2E74 C;  1Y8A A;  1NTZ K;  1SQQ D;  2Z5I A;  3L72 D;  3L70 D;  3V2R A;  3RK3 D;  3B5N A;  1LTS C;  2YMK A;  2XV5 A;  3ITK A;  5AW2 B;  1LJ2 A;  2K37 A;  1IJD B;  2WSF J;  2Y0C A;  3CXH I;  3RK2 D;  1BSH A;  1USD A;  3OW2 O;  3H1I G;  3TDK A;  5GTI E;  1NTZ D;  1S72 P;  1GZL A;  1K9M Q;  3F89 A;  2KOG A;  2WZ7 A;  4IFF A;  2WSC H;  1KB9 E;  3FGA D;  2ZFC A;  3CMA P;  3K5B A;  3HRN A;  3TF5 A;  1RH5 B;  1SQX G;  3A3Y B;  1DD4 A;  2OYI C;  1R5S A;  2K1A A;  1KZU B;  1T6A A;  2KB7 P;  3HE4 B;  1GL2 A;  2I8D A;  1SQV E;  2AEF A;  4CPG A;  2R3S A;  2FFD B;  2YKO A;  2OTK E;  3O6Q A;  1L4A D;  1PFI A;  3HUS C;  1JNM A;  5AW6 B;  2GA1 A;  3W67 A;  5AVV B;  1JCD A;  2WPV B;  1M7L A;  4IFD K;  3CXH D;  1JEK A;  2M5A A;  4W80 A;  4N78 D;  5H2F E;  2NPS B;  1CW5 A;  1EDK A;  1KOR A;  4HKZ H;  2O3J A;  4KHX A;  4D6T E;  3L73 D;  1JM0 A;  1D7M A;  1A02 J;  5BVZ A;  4NPD A;  4W7Y A;  1NU1 E;  4H0L B;  4QMA A;  1W2B O;  5GTH E;  3PHL A;  1EXJ A;  1VF5 B;  4O9B A;  4ASW A;  4WY4 B;  3NFQ A;  3BVH A;  1SQV G;  1DH3 A;  3RGU A;  1GK4 A;  1GL2 B;  1T2K D;  4IL6 E;  1VQ6 P;  1SQV J;  2H7H A;  1LNQ A;  4DZO A;  4LC1 A;  2E43 A;  1RHZ B;  5CCG A;  1URQ D;  5APY A;  4PV1 D;  4D6T G;  3II6 A;  1U7M A;  4D6T J;  2IZ1 A;  4JBZ A;  5APT A;  4BXL A;  1N7S B;  3AEA C;  2FYU E;  3IFM A;  1IFD A;  2SPZ A;  2QA4 P;  3B5N C;  3V6I A;  3CC2 P;  1SP4 A;  1GW4 A;  1YI2 P;  2POH A;  2E76 D;  1HTL C;  2Z5H A;  2D2C C;  1FU1 A;  2R5B A;  2QJK C;  2E75 C;  3FXD A;  1KYO I;  3U1C A;  1GMJ A;  5KKZ C;  3IAO A;  2ITA A;  1OZH A;  1KFM A;  2E42 A;  2FKW B;  1NTK J;  2H8P D;  4ZKU A;  1USE A;  3KDP B;  1YJW P;  3TK1 A;  3P8C D;  3KZI H;  2UWJ E;  3CME P;  2FYU G;  3R2P A;  2AEJ A;  4I6M C;  2QE7 H;  1KIL A;  5AVY B;  1L0N G;  3CCV P;  5APW A;  2FYU J;  2Y0E A;  2P7J A;  2B87 A;  5APX A;  2YO3 A;  1L0N J;  1JCC A;  2WPR A;  1GD2 E;  3MUD A;  2M3B A;  2NPS D;  3BRT B;  2N1T D;  2CPS A;  1U7J A;  5KJ7 D;  4RJT A;  1ZP0 C;  2ZYD A;  2PRR A;  3VMX A;  4I7Z B;  4H0L D;  5DJU B;  1PPJ D;  3CX5 E;  1ZLL A;  1BE3 D;  2JWD A;  5CBN A;  5KLI B;  2BCC E;  5KAI H;  1VF5 D;  2KNC B;  4PD4 H;  1OW8 A;  1LT9 A;  1E5W A;  4YPC A;  5AW1 B;  3GHG A;  2FYN B;  4YXD C;  1EC5 A;  1EZV E;  2AXC A;  1Q2N A;  3H1H D;  1KIL B;  4R4L A;  1UII A;  2LKM A;  2CK3 H;  1L2P A;  1EXI A;  1HH0 A;  3WUV A;  4N3Y B;  4RES B;  4JF7 A;  3UIA A;  1LTB C;  1YTZ I;  2OYO A;  4IFM A;  1J1E B;  3TNU A;  2W8Z A;  3VP9 A;  2L91 A;  2WSE H;  3V2Q A;  5CCG C;  1RF1 A;  3H6P A;  1AA0 A;  2H89 C;  2BCC G;  1ZV8 A;  2ZT9 B;  2H43 A;  3FX0 A;  1IFP A;  1JTH A;  2BCC J;  4WBA A;  1PP9 E;  5AW5 B;  1EZV G;  1JY2 N;  1L4A A;  1CSB A;  2BAS A;  2OYH C;  3NMD A;  5AW9 B;  2KLU A;  2FXP A;  3PTZ A;  2PFX A;  2YIU C;  1FJK A;  4DOJ A;  3I56 P;  1P84 I;  3CD6 P;  2QJY C;  1M57 D;  2YO2 A;  2W83 C;  3L71 E;  1G1I A;  3MHV A;  1NTM J;  3KYQ A;  4YXW H;  1R5L A;  2WSC J;  3QWO C;  1SFC B;  1OIP A;  1N86 A;  1S1C X;  2E5T A;  3I5C A;  1H0T A;  2Q1K A;  3P7K A;  2KZJ A;  3A0B H;  1NHL A;  3G6E P;  1SQP E;  1PP9 G;  3WMM 0;  3RL0 g;  1JTH B;  4U3F E;  3M91 A;  3P32 A;  1SQV K;  1PP9 J;  2GUS A;  2C9L Y;  1URQ A;  2ZVO B;  2Z4E A;  5AVR B;  1ZW0 A;  3MUD C;  1KV4 A;  1PL5 A;  2R32 A;  4Z1M H;  1FS0 E;  2JO1 A;  2ZYA A;  1P84 D;  4DJG A;  3L71 G;  2M8R A;  4XE5 B;  2QRX A;  1HJB A;  2P67 A;  1AJY A;  1AVY A;  1SQV D;  3L71 J;  2KIK A;  2LR2 A;  1QGK B;  3L74 D;  3VOP A;  3V2N A;  1JUN A;  1H0T B;  3KHU A;  4L75 A;  1YJN P;  2NZ2 A;  1Q81 Q;  5AW0 B;  2Q5U A;  1SQP G;  3RK3 C;  1W2E A;  4K35 A;  1LT9 C;  1FC2 C;  1VQ9 P;  1PGP A;  1SLQ A;  1XTG B;  3GHG C;  3CXH H;  3MD0 A;  4U3F G;  1SQP J;  4D6T D;  1OFC X;  2K9J B;  1J1D C;  2C9N Y;  3RK2 C;  3CCR P;  4JQ0 D;  2O01 N;  2B88 A;  1KD1 Q;  3H1L E;  5AVW B;  1QL1 A;  3U59 A;  1URQ B;  4YTP C;  1NAY A;  4A7P A;  2WWW A;  1G2C A;  4PV1 B;  2JDI H;  1DEE G;  3BCC E;  2FBW C;  1VQ7 P;  1NTK K;  3KZI E;  2Q7C A;  1LGH B;  3M0D A;  2RH0 A;  4HB1 A;  1RF1 C;  1MFT A;  2ZT9 D;  1JY3 O;  2WPS A;  5AVU B;  3HE4 A;  3CC7 P;  2FFD A;  4EDF A;  1VQP P;  2FYU K;  1TU3 F;  3AE2 C;  3AED C;  3A2A A;  1L0N K;  3U1A A;  4H44 B;  3D71 A;  1ZR2 A;  1FZB A;  1NTK D;  1LTA C;  3CWB E;  1L4A C;  1MUU A;  4ZNC A;  2E76 B;  2NPS A;  4C7R A;  2N1T A;  1QLE D;  1AFO A;  5KJ7 A;  1OW7 A;  3H1I J;  2HR3 A;  3HD7 B;  2IDB A;  3H32 B;  2FYU D;  4XFJ A;  3LIE A;  3BCC G;  1L0N D;  5DJT B;  3C8V A;  1G2C B;  5KAI E;  1SFC D;  3EWK A;  4PD4 E;  1EDJ A;  3RL0 B;  5CCH C;  2KLV A;  3BCC J;  1BDC A;  2QJP B;  4WY4 A;  3V4Q A;  1JY3 P;  1LWU B;  2WPQ A;  1SQX J;  1IK9 A;  2OTJ P;  1VQ5 P;  2BEQ D;  2A06 E;  2YKQ A;  3PRJ A;  3Q5P A;  3M0A A;  3CWB G;  2R5D A;  3L37 A;  2IBZ E;  2ZAE B;  1S5L X;  2W6J H;  2Q9I A;  1FZF A;  2WVR A;  4HJG H;  1PGQ A;  3CWB J;  4JPZ B;  2B89 A;  2N1T B;  3RBX A;  3SWF A;  3CCS P;  1EZV I;  1MZ9 A;  5B66 H;  1N7S A;  1N7L A;  3M06 A;  5BU8 B;  3I55 P;  3VTP C;  2A45 I;  3AE5 C;  2A06 G;  1IZN B;  3L75 E;  1KMI Z;  1VL2 A;  1KQS O;  3G9R A;  1DD3 A;  4EOT A;  1FZC A;  1KQG B;  3A5T A;  2IBZ G;  2BEZ F;  3CX5 D;  1CZQ A;  1FOS F;  5L8R J;  1YIJ P;  2BCC D;  1KYO H;  3AE9 C;  3WU2 H;  1NTM K;  4Y99 B;  1NYH A;  3L72 E;  3RK3 E;  1N2D C;  1GK6 A;  2WSE J;  1EZV D;  3A0H H;  2O01 H;  1KTM A;  2HPC B;  1NU1 G;  3A0B E;  3BAS A;  3V2P A;  2OAR A;  1NU1 J;  2H88 C;  3M0D C;  4KT0 J;  4LGD E;  1MFZ A;  1NTM D;  1EQ7 A;  4XA4 A;  4H44 D;  1NVO A;  2FFD C;  2RN0 A;  3L75 G;  1HJ0 A;  2V7Q H;  3LW5 H;  1OW6 A;  5APS A;  3L75 J;  4H13 D;  1FZC B;  1M90 Q;  2IYP A;  3HD7 D;  2NPS C;  1SQB E;  5KAF H;  2N9Y B;  3IR9 A;  3L72 G;  2W90 A;  3AE4 C;  1S2E A;  2VRS A;  2KNC A;  3V5B A;  3RL0 D;  1IC2 A;  3H25 A;  4H0L C;  3L72 J;  1BCC E;  1VF5 C;  3VYI A;  1VQ4 P;  1ZN5 A;  3CXH E;  4WY4 C;  1N73 B;  3MIW A;  2HLO A;  3EFG A;  4I2L C;  2W6A A;  1YQ4 C;  3D70 A;  4N78 E;  3MZW B;  3AE3 C;  1GL2 C;  1SQP K;  4K3A A;  3L71 D;  2R44 A;  3Q2Y A;  1HUC A;  2IZ0 A;  3L73 E;  1QVG O;  4L76 A;  2I1J A;  2MKV A;  1ZXG A;  1ZR4 A;  4GOF A;  2V4H A;  1SQB G;  2W27 A;  5B5E H;  3VP8 A;  2R3C A;  1SQP D;  3VMZ A;  2E75 D;  1SQB J;  3SWK A;  4AUW A;  4UB8 H;  1BCC G;  1WRG A;  1Q90 D;  1N7S C;  3H1J E;  3F5H A;  5E79 H;  2ZVN B;  3E1I A;  2OQQ A;  1QEX A;  4KJM A;  1BCC J;  2IPP A;  1DX7 A;  4UB6 H;  1H88 A;  1OVR A;  3N4X A;  4PJ0 H;  1S9K D; 
#chains in the Genus database with same CATH homology
 1LWU C;  2KOG A;  2WZ7 A;  1URQ A;  4IFF A;  2WSC H;  2GM4 A;  2Z4E A;  5AVR B;  2R32 A;  2ZFC A;  1GU4 A;  1H8A A;  1AQ5 A;  2HG5 D;  1X9V A;  2OYH A;  2M8R A;  4XE5 B;  3HRN A;  1HJB A;  1NH4 A;  3OAK A;  2P67 A;  3A3Y B;  3NXS A;  1OXZ A;  2OYI C;  1KZU B;  1RF0 A;  2WSF H;  1SFC A;  1Z56 A;  2KB7 P;  3G3Z A;  1NOH A;  2O1K A;  2KSJ A;  3HE4 B;  3VOP A;  1GL2 A;  2N1T C;  3V2N A;  1JUN A;  1M1J A;  2FFD B;  2YKO A;  5KJ7 C;  1HGZ A;  1L4A D;  1PFI A;  2P2U A;  2XNX A;  5AW3 B;  3HUS C;  1T8Z A;  5AW0 B;  2Q5U A;  3RK3 C;  1JNM A;  5AW6 B;  1W2E A;  1FZG A;  1LT9 C;  2HFE D;  1SLQ A;  3N7N A;  1JCD A;  1XTG B;  5AVV B;  1A02 F;  3GHG C;  1M7L A;  1SQX K;  1CI6 A;  3MD0 A;  4IFD K;  5CJ4 A;  3CL3 D;  4W80 A;  4JYC A;  4N78 D;  2NPS B;  1RE4 C;  2IX7 C;  1CW5 A;  1J1D C;  2C9N Y;  3RK2 C;  4C7N B;  4KHX A;  5AVW B;  1QL1 A;  3LID A;  3U59 A;  1A02 J;  1URQ B;  5BVZ A;  5AW8 B;  2WWW A;  1G2C A;  4W7Y A;  1YTZ T;  2YMY A;  2W6B A;  1YYC A;  1FDM A;  4O9B A;  1NTK K;  2OYH B;  3SWY A;  2QM7 A;  2Q7C A;  1JY2 O;  4ZKP A;  1LGH B;  3B5N D;  3M0D A;  4WY4 B;  3NFQ A;  1FZA A;  2KYV A;  1RF1 C;  3BVH A;  1JY3 O;  2WPS A;  4OH8 B;  5AVU B;  2N9B A;  3HE4 A;  1NKZ B;  1DH3 A;  1GK4 A;  4Y99 C;  1GL2 B;  1T2K D;  2FFD A;  2PP6 A;  1IFN A;  5AVZ B;  1GW3 A;  4JYB A;  2FYU K;  1M1J B;  2H7H A;  2YNY A;  1GU5 A;  3A2A A;  1L0N K;  3U1A A;  4DZO A;  1ZR2 A;  1FZB A;  2WTY A;  4LC1 A;  1LTA C;  5AW4 B;  2OYI A;  2E43 A;  1L4A C;  2FXM A;  3BRV B;  1IO4 A;  1MUU A;  2XDJ A;  1CI6 B;  5CCG A;  2WT7 A;  1URQ D;  1KIL C;  2YKP A;  5APY A;  2I1K A;  2NPS A;  1KFN A;  4C7R A;  2N1T A;  2FYZ A;  1AFO A;  1FBM A;  1LTJ C;  3II6 A;  1HGV A;  5KJ7 A;  3HD7 B;  3H32 B;  3HUS A;  2HOD A;  1QL2 A;  2P1J A;  3B8E B;  3LIE A;  4WY4 D;  5APT A;  1G2C B;  1N7S B;  5KLV K;  3OJA B;  4GIF A;  1SFC D;  1JOC A;  5BU5 A;  1LTG C;  3IFM A;  5AVT B;  1J1E C;  1GL2 D;  3RL0 B;  1LTT C;  5CCH C;  2KLV A;  1JY2 P;  1FZC C;  2GUV A;  4WY4 A;  3V4Q A;  1IFD A;  1RE3 A;  2PAJ A;  1IFM A;  1JY3 P;  1LWU B;  1X79 B;  3T97 A;  1KQL A;  2WPQ A;  2JEE A;  2JJL A;  3B5N C;  1IK9 A;  1NU1 K;  1SP4 A;  1GW4 A;  2IFN A;  3KQG A;  5AVX B;  2POH A;  2YKQ A;  1IFI A;  3M9Q A;  2QM8 A;  1HTL C;  3A7O A;  5KTB A;  2Z5H A;  3M0A A;  4B86 A;  5CHX A;  2R5D A;  1FU1 A;  1SVF A;  3HTK A;  5CJ0 A;  2R5B A;  3L37 A;  4GKG A;  2OYI B;  2Q9I A;  2WIT A;  3TYY A;  2HYN A;  3U1C A;  1NWQ A;  5APU A;  3KPE A;  1FZF A;  1VPC A;  2WT7 B;  3MGN A;  1N73 C;  1FJP A;  3OA7 A;  3CI9 A;  3BAT A;  1N7S D;  2N1T B;  3SWF A;  1KFM A;  3P8M C;  1T3J A;  3CLQ A;  3HD7 A;  2E42 A;  3H32 A;  3VMY A;  2FKW B;  1FOS E;  2H8P D;  4ZKU A;  3KDP B;  1MZ9 A;  3HUS B;  1NKN A;  3RK3 B;  2HOD B;  3P8C D;  3TK1 A;  1L0L K;  1LT9 B;  1N7S A;  3O8Z A;  1N7L A;  3M06 A;  3VN0 A;  3R2P A;  5BU8 B;  4I6M C;  3GHG B;  1KIL A;  5AVY B;  1HVV A;  3P8C E;  5APW A;  3VTP C;  1NAF A;  3C9I A;  1FZE A;  2A45 I;  1J1D B;  3RK2 B;  2P7J A;  1RF0 C;  5APX A;  1SFC C;  5AVQ B;  1VDF A;  1LWU A;  2YO3 A;  1DEB A;  1G1J A;  1JCC A;  3L36 A;  2A45 G;  2WPR A;  2IFM A;  1GD2 E;  3MUD A;  5APQ A;  2M3B A;  4I1L A;  5CCG D;  2NPS D;  3BRT B;  2N1T D;  5CCH A;  4EOT A;  1FZC A;  3TNU B;  3A5T A;  2CPS A;  1OWA A;  1HWT C;  2J59 M;  5KJ7 D;  3HTK B;  1CZQ A;  1FOS F;  3V4W A;  3VMX A;  1RF1 B;  1XTC C;  1IFJ A;  3L4F A;  3PP5 A;  1ZLL A;  1NTM K;  4Y99 B;  4M3L A;  1N2D C;  2C0W A;  1GK6 A;  2O01 H;  2HPC B;  1LT9 A;  1E5W A;  2CPB A;  5AW1 B;  3HE5 B;  3GHG A;  3BAS A;  3V2P A;  2OAR A;  3M9H A;  1L4A B;  4HYT B;  1SQB K;  1KIL B;  1RE4 A;  3M0D C;  2LKM A;  4LGD E;  2A45 H;  1MFZ A;  1HH0 A;  1EQ7 A;  4XA4 A;  1T3U A;  5AW7 B;  1MV8 A;  1S9K E;  2FFD C;  4N3Y B;  4RES B;  4JF7 A;  3LW5 H;  3TSI A;  3UIA A;  1LTB C;  1YTZ I;  1RY3 A;  4GT1 A;  4AYC A;  5APS A;  4IFM A;  3L35 A;  1J1E B;  3TNU A;  1X8Y A;  1T2K C;  3VP9 A;  1FZC B;  2WSE H;  3V2Q A;  1H89 A;  5CCG C;  2ZXE B;  3HD7 D;  1RF1 A;  3H6P A;  2NPS C;  3MTU E;  4N6J A;  1GDT A;  3IR9 A;  3NTN A;  1GTW A;  3B5N B;  4EIJ A;  1ZV8 A;  2VRS A;  1NO4 A;  3V5B A;  1KIL D;  1URQ C;  3RL0 D;  1IC2 A;  2HPC A;  4AQR D;  2H43 A;  1JTH A;  3HE5 A;  4WBA A;  5AW5 B;  1JY2 N;  3VYI A;  1L4A A;  5AVS B;  5CMZ A;  1CSB A;  2BAS A;  2OYH C;  3NMD A;  2XZR A;  1LTI C;  1JY3 N;  1ZN5 A;  1JMM A;  2O1J A;  5AW9 B;  1LTJ A;  4WY4 C;  2XU6 A;  1N73 B;  3MIW A;  1WT6 A;  2HLO A;  3EFG A;  4I2L C;  2W6A A;  1RE3 C;  5APV A;  4LLH A;  1SQQ K;  4N78 E;  2MJZ A;  2Q3I A;  1FJK A;  4DOJ A;  1GL2 C;  1SQP K;  4HH2 A;  5CCH D;  4WB4 A;  1HBW A;  1M1J C;  2XKM A;  4C46 A;  1HUC A;  2YO2 A;  2KP8 A;  1FAV A;  2I1J A;  1G1I A;  3EQ2 A;  2L5G B;  2J58 A;  3KYQ A;  1ZR4 A;  2C0X A;  4W7Z A;  1SFC B;  1N86 A;  3I5C A;  2W27 A;  1NTZ K;  2Z5I A;  3V2R A;  3RK3 D;  3P7K A;  3VP8 A;  2R3C A;  1J2J B;  3B5N A;  1LTS C;  1JO5 A;  3VMZ A;  3HD7 C;  2XV5 A;  5AW2 B;  4AUW A;  3M9B A;  1NHL A;  1IJD B;  1WRG A;  1N7S C;  3RK2 D;  3WMM 0;  1JTH B;  3M91 A;  3E1I A;  3P32 A;  3RL0 C;  1SQV K;  2IPP A;  4C7N A;  1DX7 A;  1N73 A;  1H88 A;  2GUS A;  1GZL A;  3N4X A;  1LTJ B;  1S9K D;  2C9L Y; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...