1N73A

Fibrin d-dimer, lamprey complexed with the peptide ligand: gly-his-arg-pro-amide
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
91
structure length
91
Chain Sequence
EVLRELERRIIHLQRRINMQLQQLTLLQHNIKTQVSQILRVEVDIDVALRACKGSCARYLEYRLDKEKNLQLEKAASYIANLKFERFEEVV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title The Crystal structure of fragment double-D from cross-linked lamprey fibrin reveals isopeptide linkages across an unexpected D-D interface
pubmed doi rcsb
molecule keywords Fibrin alpha-1 chain
molecule tags Blood clotting
total genus 30
structure length 91
sequence length 91
chains with identical sequence D
ec nomenclature
pdb deposition date 2002-11-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.50 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 1n73A00
2Z4EA 1LT9C 2HLOA 1N73A 2OYHA 3HUSB 2OYIA 1LTJB 1FZCA 2A45G 1JY3P 1JY3O 3H32B 1RF1C 1W2EA 1M1JC 2FFDC 1RE3C 1JY3N 1LT9A 3GHGB 2HODB 1JY2O 1JY2P 3HUSC 1FZGA 2HPCB 1LWUB 2A45H 2XNXA 2OYIB 1FZEA 1RF1A 1LTJC 1RE3A 1N73B 2H43A 1M1JA 2OYHB 2FFDA 1RF0C 1FZCB 1JY2N 1RE4C 1FZFA 2A45I 3HUSA 1LT9B 3GHGC 1LTJA 1LWUC 1RF0A 1FZBA 1FZAA 3H32A 1T3UA 2OYHC 2OYIC 1N86A 1RE4A 2Q9IA 1N73C 2FFDB 3GHGA 2HODA 1RF1B 3E1IA 1M1JB 1FZCC 3BVHA 2HPCA 1LWUA
chains in the Genus database with same CATH superfamily
1SQQE 1IFMA 2GUVA 1SQBG 2M3BA 1FDIA 2M8RA 3A3YB 1LT1A 3FWLA 4UB8E 2PAJA 1QLED 2P2UA 4H44B 1EZVI 3H1JJ 1PGPA 1NTZK 2LXBA 1PP9D 2KS1A 1MFTA 4PV1B 4N6JA 2HG5D 2N1TB 1RE3C 3AE3C 3RBZA 3L37A 3M0DA 3BATA 1S72P 1XTCC 1N73C 1SQXD 3NTNA 3HTKB 5APYA 1NKZB 2QVAA 2E43A 3CD6P 1EZVG 2HPCB 4YPCA 3H1KE 1L4AB 3L75J 3L71E 4GIFA 3M9QA 3GHGC 5GTHE 1Y8AA 1FJPA 1NVOA 2YIUC 2IBZI 2BEZF 1J1DC 1DIPA 1TU3F 2WPQA 3H1JG 3A0HH 4IL6X 5CJ4A 4O9BA 3RL0C 4C7NB 3IFMA 1M8OB 3Q1MA 1M57D 3OAKA 3G6EP 1T6AA 3A0BH 2W6JH 2B87B 1U7JA 3AE2C 1FZCC 4OGQC 5BVZA 1OW7A 1LTJB 4BXLA 5KKZB 3U1CA 3WUTA 1SFCA 4CPGA 1NTZJ 1KC8Q 2XKMA 3M0AA 1E79H 3L72D 3FX0A 3L75G 1MUUA 3H1HJ 1W2BO 1NO4A 3L74J 2W27A 4RKUJ 4H44C 3CPWO 1G2CB 1IK9A 3BRTB 2B88A 4PV1C 1M1KQ 2IBZE 1SQQD 2N1TC 5BU8B 2QJPB 1T3JA 5KTBA 3CCQP 1AVYA 2HR3A 3LW5J 3AEDC 2FYUE 1FBMA 1JY3N 1N7SA 4HJGH 2NPSC 3L36A 2Q6QA 3L35A 2QA4P 2Y9YA 2E76D 5DJUB 2H8PD 1L4AC 3MP7B 3A0HE 5AVTB 2OYIA 1SQVK 3MGNA 3H1HG 2HODB 1BGYJ 2WSCH 2YMKA 3A0BE 1Z56A 3UIAA 3RK2D 2Z5IA 2POHA 3VMYA 3MUDA 1ZRTD 1Y47A 2FBWC 3FXEA 1GL2D 3OJAB 3L71D 3L73G 3M06A 3C8VA 3NFQA 3N7NA 1BCCE 1GU4A 1LWUB 1LTJC 2FKWB 3GF7A 1KTMA 1BDCA 2KYVA 1EZVD 3R2PA 3L70J 1QL1A 4PJ0H 2JEEA 3H1IJ 1LP1B 1S5LX 1MKMA 2QSIA 1RE3A 2JKVA 1GU5A 1BGYG 2E75D 3MZWB 3CX5H 1URQB 3BASA 1K73Q 1N73A 3RK3D 4DT0A 3TK1A 2GM4A 3V2PA 5CBNA 1M56D 3SWKA 2E42A 1SQVJ 1KQFB 1Q81Q 1NTKK 4TLFA 3GHGA 1L0NK 1LJ2A 3CX5I 3IR9A 4HKZH 3GLMA 1L0LK 3L70G 1U57A 2XNDH 2ZFCA 3B5NA 3L75D 1W5CE 3H1IG 3CLQA 4DJGA 1LTGC 3U1AA 2A06G 1AA0A 5AVVB 2RKLA 1YJNP 3AE4C 3HUSB 1FZCA 3VP9A 1KFNA 5C39A 3FXDA 3CC2P 1Q90D 2WSEH 2IDBA 2G8YA 3B4SA 4WY4B 3D71A 2QE7H 3IN6A 4PJ0E 1QVGO 1EC5A 2YXQB 1JUNA 1SQVG 2HLOA 5APQA 2Q3EA 5B5EH 3G71P 4RJTA 1G1IA 2OQQA 3PHLA 3CX5E 1OVUA 2N1TA 3F89A 1BCCD 2WMMA 2OYOA 1NTMK 2KI7B 2ZJSE 3G9RA 1NTKJ 5AW1B 1HWTC 3II6A 1A02F 1L0NJ 2QJYC 3L73D 2W6BA 5KLVK 2W90A 1L0LJ 1YBKA 2HPCA 1DD4A 4EOTA 1L4AA 3K5BA 1AQTA 1KILB 3CMAP 3PP5A 2M0BA 2ZAEB 2JJLA 1YQ3C 3CCJP 2E74D 4C7NA 4B86A 5DJTB 3KPEA 4ZKPA 4GODA 1NWQA 2B87A 2K37A 4IOIH 1PP9E 3SWYA 3G3ZA 1LTJA 5AW9B 1NTKG 1L0NG 3EFGA 5B5EE 2YMYA 4WY4C 1KQSO 1L0LG 1N2DC 3CCEP 1M1JC 3BCCJ 3S9OA 1BSNA 5APWA 2FYNB 1SQXE 3CI9A 2O01J 1HBWA 1ZP0C 1H89A 1NTMJ 1NH4A 3VP8A 3C1LA 1VQ7P 1Q82Q 1VL2A 1G2CA 1ZR4A 1ZLLA 1VQKP 1JNMA 1VPCA 4LC1A 3H1ID 2PGDA 3KDPB 2A45G 1LGHB 5KLVJ 1FOSE 3M9HA 1DD3A 2J58A 4GOEA 2OYHC 2BASA 1VF5C 3Q3DA 2K9JB 3TYYA 2JR8A 2WSFJ 1IC2A 1PPJE 3HE4B 4D6TE 1IK7A 1CI6B 1JTHB 1JOCA 2KXPB 2FY8A 3BCCG 3CMEP 2GA1A 2ZXXA 2HODA 1HJ0A 1NTMG 2P10A 1SFCD 1OW6A 3RL0B 3V2QA 2ZYGA 1FDOA 2R44A 4BWNA 2R3SA 3L72E 5AVZB 1FZGA 3N4XA 5KLVG 4I6MC 1NJIQ 3TGUE 2FYUK 1LWUA 3H1KJ 3KQGA 4IL6H 4K3AA 1LT9A 4C7RA 1NHLA 1KORA 2YKQA 1A02J 2H43A 3AE7C 3L4FA 2FYNC 3W68A 1P84I 5KAFH 1HJBA 2FFDB 1LP1A 3TNUB 1S3JA 4C46A 3JSVC 1N7SD 1LNQA 1SQBE 1RF1C 1PGOA 2IPPA 3P8CE 2J59M 4ASWA 1URQA 3HD7D 5H2FH 3PJSK 2OTJP 2BEQD 2BCCJ 4DCKA 3O8ZA 4EDFA 2NPSB 2FXOA 2P1JA 1ZRTE 2H7HA 4UB6H 3LIEA 3WMM0 1IFPA 3V4WA 2VRSA 4GKGA 4XA4A 1ZMEC 1GK6A 1ZV8A 4Z1MH 1X9VA 1M7LA 1EZVE 1ZXGA 2FYUJ 5AVWB 3HUSA 2QIWA 1PPJD 2KSJA 4D6TD 1MFZA 3CC4P 1YYCA 4IL6E 3H1LJ 2QJKB 1FS0E 2XDJA 3H1JE 1KQGB 2BCCG 4WY4A 5K5GB 4KJMA 3AEFC 4H13B 2C9LY 5AVXB 5KAFE 5AW8B 1R5LA 3RK3E 2QM7A 4L75A 3SSUA 2OTKE 5AW5B 4U3FJ 2ZT9B 3BCCD 1NU1K 2KLUA 1W2EA 2FFDC 2K1AA 4AUWA 1EDLA 3TGUD 2P7JA 5H2FE 5AW2B 3R4YA 3RK2C 5AVRB 1LTSC 2W83C 2FXPA 3L75E 2Q7CA 1SQPK 3B5ND 3EQ2A 2ZYAA 1S5LH 3MD0A 1BE3J 4UB6E 4AYCA 3A7OA 4JQ0D 2QRXA 1T2KD 1SQBD 2KUBA 1S2EA 1NTZG 2KB7P 3P8CD 4OGQD 4RESB 3HD7A 1KILA 1FC2C 1YJ9P 2R32A 3RGUA 1VQOP 3HE5B 1VQ8P 2KNCA 1FU1A 3L74G 2D2CD 3NMDA 4L74A 2WT7B 5APXA 1D7MA 1UIXA 1DEBA 1NTZE 2E75C 1OVRA 4WWIA 4H44D 1NGMB 3IAOA 3H32B 2QJKC 4PV1D 3H1HE 1QVFO 4JF7A 2N1TD 1H88A 2IFMA 5AW4B 1NU1J 1S9KE 1DX7A 5BU5A 1BE3G 4H13C 1P84D 1VQ9P 1H8AA 2KZIA 1FOSF 4YXDC 3L73E 3O6QB 2H88C 2ZT9C 4WVZA 3M91A 2V7QJ 1SQPJ 3CWBJ 3H1JD 2QM8A 1VQLP 1L4AD 4TT3H 2LR2A 1Q7YQ 1S5LE 1OX3A 2QJYB 2Y0CA 3CCUP 4H0LB 3GF3A 2IZ0A 1N7LA 2K9JA 4HH2A 1BGYE 3HE4A 1CI6A 1N86A 3S4RA 4N3YB 2ZXEB 1JTHA 1NU1G 3WU2H 3V6IA 2KIKA 2WPVB 5L8RJ 2O3JA 2R5BA 1JEKA 4LLHA 2KSEA 5CCHC 3CC7P 4QMAA 4RO0A 4ASVA 3AEGC 1E5WA 2WITA 1SQPG 3CWBG 5APSA 3TDKA 5AW7B 1QX8A 3L70E 3T97A 1OW8A 3H1IE 2RH0A 1RE4C 1K9MQ 3SFEC 3Q5PA 1N8RQ 2A06E 4N78E 1M1JB 4L73A 4JPZB 1USDA 1PGQA 1NTZD 3V2NA 5CJ0A 3TNUA 2LXCB 1SFCB 2KP8A 1FZBA 1VQ4P 4OVNF 3H1HD 1IFNA 3L74D 1IO4A 1SS1A 1LTBC 5CHXA 1EXJA 1GDTA 1SQVE 3VN0A 4LGDE 1QL2A 1S9KD 1IFJA 3I5CA 3RL0g 5AVUB 2OYHB 3AECC 4YXWH 1KMIZ 1VF5B 2ITAA 2NPSA 3HTKA 4H0LC 3WU2E 4KHXA 1Q2NA 1PGJA 1SQXJ 1X79B 1SQQK 1HF9A 3M0DC 2A45H 5AW3B 2E5YA 2M3EA 5CCGC 2Y9ZA 1JCDA 3FGAD 3ZDMA 1J2JB 2CPSA 2WSSH 4A7PA 1CW5A 1T8ZA 1BGYD 1FAVA 3S1KA 2OYIB 2MKVA 2A45I 4R4MA 1GZLA 1T3UA 2AXCA 1URQD 1KILE 4ZNCA 1QGKB 1FZEA 3B8EB 1FZFA 5EFWB 3AE1C 3D70A 4PD4H 1NTKE 1YTZI 3L72J 3L70D 1PIXA 1RF1B 1L0NE 3E1IA 1SFCC 1JY3O 1JY3P 1ZW0A 1YTZT 1L0LE 2WQYC 3V5BA 4NPDA 1ZR2A 5KJ7C 2A06D 1SQPD 4N78D 2P58A 3CWBD 4ZMDA 1GW3A 2R5DA 3PRJA 1SQQJ 2WSFH 4M3LA 2PRRA 1L2PA 3FWNA 4PD4I 1VQPP 2RMZA 1FE6A 1SP4A 1UIIA 1S1CX 3P32A 3H6PA 1NYHA 1SQVD 5CCHA 3HE5A 4WY4D 5APTA 2KZJA 1N7SC 1PZQA 4ZKUA 2WT7A 2L91A 1NAYA 1H0TB 3KHUA 3WUVA 1JY2O 1JY2P 2SPZA 1P84H 1J1EB 1JM0A 3BCCE 1GW4A 2PP6A 1G1JA 1OXZA 3H32A 2OYIC 1RE4A 4XE5B 1SQQG 1NTME 2Z4EA 2YKPA 1OVVA 3IF4A 2IZ1A 2YO2A 3I56P 5M1BA 3L71J 3CCVP 2N9YB 1QEXA 4PD4E 2E76B 3EWKA 5KLVE 1FZAA 3O6QA 1DEEG 1KN7A 2D2CB 2B89A 4JBZA 1K05A 2YNYA 3C9IA 3Q5RA 3RK2B 1DH3A 1R5SA 2Q5UA 1RQVA 1Q86Q 2IYPA 1KILD 1YI2P 1GL2B 1IFDA 2Z5HA 3VTPC 3VOPA 3HRNA 1S4XA 3CCLP 3CCSP 3PTZA 3ABVC 1NTKD 3AE5C 1Y9BA 4L76A 1L0ND 3H1KG 5AW6B 1AV1A 1K04A 3L71G 1JB0J 1EDJA 1L0LD 2NRGA 1USEA 2OTLP 5CCGA 2RN0A 3MTUE 1P84E 3H25A 1YHQP 2JP3A 2E75B 3JC22 1OWAA 2OGUA 1IFIA 4I7ZB 3RK3B 2Q9IA 3I55P 3AE6C 1J1EC 1VQMP 1VQ5P 1FJKA 3B5NC 1IZNB 4W7YA 4W80A 1KB9H 4EYYQ 3WUUA 1M1JA 5GTIH 1T2KC 4AQRD 2WWWA 1VDFA 4XFJA 1EDIA 2L5GB 1LTTC 3TF5A 2E76C 4GT1A 2XNXA 2YKOA 1LTIC 3W67A 4JYCA 2BCCE 1MZ9A 2C0XA 3KZIH 2IBZG 1NAFA 2D2CC 3P7KA 2M5AB 1NTMD 3CXHH 3LW5H 1KB9I 3LIDA 5KJ7A 1K8AQ 1EXIA 2I1KA 2FYUG 4WB4A 1BCCJ 4PD4D 2OYHA 1GL2C 3U59A 1OIPA 5KLVD 3Q2YA 4I2LC 3RL0D 3H1LG 3CXHI 3L73J 1YJWP 2R3CA 1WRGA 1LTAC 3A5TA 1BDDA 3E1RA 1KFMA 3RBXA 1OFCX 3H1LE 3AE9C 4U3FG 3SFDC 5TISH 1OMIA 1GD2E 2ZYDA 3KYQA 1AVOA 2GUSA 2FXMA 4BRYB 2H89C 2YO3A 2JWDA 1KB9E 4HYTB 4I7ZC 3RK3C 1HH0A 3AE8C 1BCCG 4U3FE 5GTIE 2QEXP 3L74E 2XZRA 1HVVA 5APVA 4GDOA 4HB1A 4R4LA 1BSHA 2W8ZA 2WSCJ 1GTWA 1KV4A 3H1KD 2Q3IA 3KZIE 4IFFA 2V7QH 3CXHE 2NPSD 3TSIA 5KKZC 3BRVB 1RF1A 3P8MC 1RF0C 2UWJE 2E74B 1JY2N 1LT9B 3CCMP 1KYOH 1OZHA 1BE3E 2B9BA 5E79H 1IJDB 4IFDK 1R8EA 1NKNA 4K35A 3VMZA 1KD1Q 2Y0DA 2P67A 2AEFA 1CZQA 3AEBC 2KS1B 1RQUA 2QG4A 4NPEA 2BCCD 3F5HA 1KYOI 2J5UA 1FDMA 2QJPC 1KQLA 1EQ7A 5TISE 5AVYB 1CSBA 1SQXK 3D6YA 1SLQA 5KLIB 3VMXA 4H13D 1H0TA 2IBZD 3CL3D 1NU1E 3D6ZA 2AEJA 3MHVA 2ZT9D 1YIJP 3VYIA 2FYUD 4Y99B 5CMZA 4Y28J 3H1LD 4W7ZA 2KLVA 2HFED 1SQPE 3CWBE 2WTYA 3NXSA 5TJHA 3GW6A 2OARA 3OA7A 2FFDA 1KYOE 2CK3H 4U7JA 1X22A 5E79E 1KB9D 3GMAA 2JWAA 1JCCA 1LWUC 2K3RA 2WSEJ 4U3FD 1AFOA 2E74C 1LT9C 1PP9J 1EDKA 4OWFA 2O01N 1GL2A 5CCHD 3JCUH 4GOFA 4OH8B 2WVRA 2G3AA 3PLNA 1PFIA 5APUA 1RY3A 2JDIH 3CXHD 1ZOYC 1PL5A 2MJZA 1JMMA 1XTGB 3M9BA 4KT0J 5KAIH 1GK4A 1URQC 5CBOA 1U7MA 1BE3D 4EIJA 2KOGA 1SVFA 2W6AA 1N7SB 2XU6A 2IFNA 5KLIC 2WPSA 1VQ6P 2HYNA 4MN4C 1PV3A 3E7KA 1KZUB 1SQBK 1JMBA 1YQ4C 3HD7B 3AEEC 1PP9G 2WPRA 2DW3A 2KNCB 3ITKA 2C0WA 2O1KA 2C9NY 4D6TJ 4Y99C 1M90Q 2IX7C 1JO5A 4YTPC 5B66H 4IFMA 2O01H 4DZOA 3SWFA 3EFFK 3OW2O 1SQXG 2WZ7A 3HUSC 2KK7A 1HTLC 3CCRP 3V2RA 3GG2A 1HUCA 2CPBA 1NU1D 4I1LA 3QH9A 2O1JA 2Y0EA 4H0LD 3VMAA 1RF0A 1RHZB 2K88A 5AW0B 4JYBA 2YXRB 2NZ2A 2M5AA 3MIWA 2I8DA 3JCUE 1GMJA 2AXTH 1WT6A 3TGUJ 2ZVOB 1X0TA 5CCGD 2JO1A 2AEMA 2Q1KA 2I1JA 1X8YA 4EI2A 4UB8H 5KAIE 3A2AA 3Q5SA 2ZVNB 1KYOD 3AEAC 3V4QA 4NPFX 5AVQB 1PPJG 4D6TG 2N9BA 2FYZA 1N73B 1HGZA 3PH0A 4DOJA 1WMKA 2E5TA 1SQBJ 1VQNP 1HGVA 3G4SP 3CX5D 2LKMA 1MV8A 3L72G 4WBAA 2K9YA 3GHGB 1AJYA 2YIUB 4BRYA 1AQ5A 3HD7C 1J1DB 1KILC 3TGUG 1RH5B 5B66E 3B5NB 5GTHH 3USSA 3QWOC 3BVHA 2PFXA 3KXDA 2V4HA 5KJ7D 2XV5A 1YITP 1ZN5A 1NOHA 5AVSB 1FZCB 3MUDC 4OGQB 3T97B 3B71A 2IYOA 1VF5D 2AXTE
chains in the Genus database with same CATH topology
2OYHA 1GL2C 3U59A 1IFMA 2GUVA 3KPEA 4ZKPA 2M3BA 4I2LC 2R5BA 1NWQA 3RL0D 4LLHA 2M8RA 5CCHC 3A3YB 3SWYA 2PAJA 2P2UA 3G3ZA 1LTJA 5AW9B 1E5WA 2R3CA 2WITA 1NTZK 1WRGA 3EFGA 1LTAC 5APSA 2YMYA 4WY4C 3A5TA 4N6JA 1KFMA 1N2DC 5AW7B 2HG5D 2N1TB 1M1JC 1RE3C 5APWA 3T97A 3CI9A 1HBWA 1H89A 1NH4A 1RE4C 3L37A 1GD2E 3VP8A 3M0DA 3KYQA 2GUSA 2FXMA 3BATA 1G2CA 1XTCC 1N73C 1ZR4A 4N78E 1ZLLA 1M1JB 3NTNA 1JNMA 1VPCA 4LC1A 2YO3A 3HTKB 3KDPB 5APYA 2A45G 4HYTB 3RK3C 1NKZB 2E43A 1HH0A 1LGHB 3V2NA 5CJ0A 2HPCB 2XZRA 1HVVA 3TNUA 1FOSE 5APVA 3M9HA 1L4AB 1SFCB 4GIFA 3M9QA 2J58A 3GHGC 2KP8A 1FJPA 1FZBA 1GTWA 2BASA 2OYHC 1IFNA 1IO4A 5CHXA 1LTBC 2Q3IA 1J1DC 3TYYA 1GDTA 3VN0A 4IFFA 2WPQA 4LGDE 1QL2A 1IC2A 1S9KD 3HE4B 1CI6B 5CJ4A 4O9BA 3RL0C 4C7NB 1IFJA 3I5CA 3IFMA 2NPSD 1JTHB 1JOCA 3TSIA 5AVUB 3BRVB 1RF1A 2OYHB 3P8MC 3OAKA 1RF0C 1JY2N 1LT9B 2NPSA 3HTKA 4KHXA 2HODA 1FZCC 1SFCD 1IJDB 4IFDK 1X79B 3RL0B 3V2QA 5BVZA 1SQQK 1LTJB 1NKNA 3U1CA 3VMZA 1SFCA 5AVZB 2P67A 1CZQA 1FZGA 3M0DC 2A45H 5AW3B 2XKMA 3N4XA 3M0AA 5CCGC 1JCDA 4I6MC 1MUUA 2FYUK 1J2JB 1NO4A 1LWUA 2W27A 3KQGA 2CPSA 1FDMA 1CW5A 1T8ZA 1G2CB 1IK9A 1FAVA 1KQLA 1LT9A 1EQ7A 3BRTB 4C7RA 1NHLA 5AVYB 1CSBA 1SQXK 2OYIB 2YKQA 1A02J 2H43A 2N1TC 1SLQA 2A45I 3L4FA 3VMXA 5BU8B 1HJBA 1GZLA 1T3UA 1T3JA 5KTBA 3TNUB 2FFDB 4C46A 3CL3D 1N7SD 1FBMA 1URQD 1RF1C 2IPPA 1JY3N 1N7SA 3P8CE 2J59M 2NPSC 3VYIA 3L36A 1URQA 1FZEA 3B8EB 4Y99B 5CMZA 3L35A 3HD7D 1FZFA 1YTZI 4W7ZA 1RF1B 2H8PD 1L4AC 2KLVA 3E1IA 3O8ZA 2HFED 1SFCC 1JY3P 1JY3O 5AVTB 2WTYA 2NPSB 2OYIA 1SQVK 1YTZT 3MGNA 3V5BA 2P1JA 3NXSA 2HODB 1ZR2A 2WSCH 5KJ7C 4N78D 2H7HA 2OARA 3OA7A 1Z56A 2FFDA 1GW3A 2R5DA 3UIAA 3RK2D 2Z5IA 2WSFH 4M3LA 1JCCA 1LWUC 2POHA 3LIEA 3V4WA 3VMYA 3WMM0 3MUDA 2VRSA 1AFOA 4GKGA 1GL2D 4XA4A 1LT9C 3OJAB 3M06A 1SP4A 1GK6A 1ZV8A 3NFQA 1GL2A 5CCHD 1X9VA 3N7NA 3P32A 1M7LA 3H6PA 1GU4A 1LWUB 4OH8B 1LTJC 2FKWB 1PFIA 5CCHA 5APUA 5AVWB 1RY3A 3HUSA 2KSJA 1MFZA 2KYVA 3HE5A 3R2PA 2MJZA 1YYCA 4WY4D 1JMMA 1XTGB 1QL1A 3M9BA 5APTA 1N7SC 2JEEA 1GK4A 1URQC 2XDJA 4WY4A 4ZKUA 2WT7A 1JY2O 1JY2P 4EIJA 2C9LY 1RE3A 5AVXB 2KOGA 5AW8B 1SVFA 1GU5A 1J1EB 2W6AA 2QM7A 1GW4A 2PP6A 1N7SB 3H32A 1G1JA 1OXZA 2OYIC 1RE4A 1URQB 3BASA 2XU6A 2IFNA 4XE5B 5AW5B 2Z4EA 2YKPA 1N73A 2WPSA 1NU1K 3RK3D 2YO2A 2HYNA 1KZUB 1SQBK 1W2EA 3TK1A 2FFDC 4AUWA 3HD7B 3V2PA 2GM4A 2P7JA 2WPRA 5AW2B 3RK2C 5AVRB 1LTSC 2E42A 2C0WA 1FZAA 2O1KA 2C9NY 1NTKK 4Y99C 3GHGA 2IX7C 1JO5A 1L0NK 2Q7CA 1SQPK 4IFMA 3B5ND 3EQ2A 3IR9A 2O01H 2YNYA 3C9IA 4DZOA 3SWFA 1L0LK 3RK2B 1DH3A 2ZFCA 2Q5UA 2WZ7A 3HUSC 3B5NA 3MD0A 4AYCA 1HTLC 3A7OA 3V2RA 1HUCA 2CPBA 3CLQA 4I1LA 1T2KD 2O1JA 1KILD 1GL2B 1IFDA 1RF0A 2Z5HA 3VTPC 1LTGC 3U1AA 2KB7P 3P8CD 4RESB 5AVVB 3HD7A 1KILA 3VOPA 5AW0B 4JYBA 3HRNA 3MIWA 2R32A 3HUSB 1FZCA 3VP9A 1KFNA 1WT6A 3HE5B 1FU1A 3NMDA 2WSEH 5AW6B 4WY4B 5CCGD 2WT7B 5APXA 2I1JA 1DEBA 1X8YA 5CCGA 3A2AA 1JUNA 2HLOA 5APQA 3V4QA 5AVQB 3MTUE 2N9BA 3H32B 2FYZA 1G1IA 4JF7A 1N73B 1HGZA 2N1TD 1H88A 2IFMA 4DOJA 1OWAA 5AW4B 1IFIA 1S9KE 1DX7A 5BU5A 2N1TA 3RK3B 2Q9IA 1H8AA 1HGVA 1J1EC 1NTMK 1FOSF 1FJKA 2LKMA 1MV8A 3B5NC 4WBAA 3GHGB 4W7YA 4W80A 5AW1B 1HWTC 3II6A 1A02F 3M91A 1M1JA 1AQ5A 1T2KC 4AQRD 2WWWA 3HD7C 1J1DB 1KILC 2W6BA 1VDFA 5KLVK 2QM8A 3B5NB 1L4AD 2L5GB 1LTTC 4GT1A 3BVHA 2HPCA 4EOTA 2XNXA 2YKOA 1LTIC 1L4AA 4JYCA 1MZ9A 2C0XA 5KJ7D 1KILB 1NAFA 3P7KA 2XV5A 3PP5A 1ZN5A 1NOHA 5AVSB 1N7LA 1FZCB 3LW5H 3LIDA 5KJ7A 2JJLA 4HH2A 3HE4A 2I1KA 1CI6A 1N86A 4N3YB 4C7NA 2ZXEB 4B86A 4WB4A 1JTHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2Z4E A;  1LT9 C;  2HLO A;  1N73 A;  2OYH A;  3HUS B;  2OYI A;  1LTJ B;  1FZC A;  2A45 G;  1JY3 P;  1JY3 O;  3H32 B;  1RF1 C;  1W2E A;  1M1J C;  2FFD C;  1RE3 C;  1JY3 N;  1LT9 A;  3GHG B;  2HOD B;  1JY2 O;  1JY2 P;  3HUS C;  1FZG A;  2HPC B;  1LWU B;  2A45 H;  2XNX A;  2OYI B;  1FZE A;  1RF1 A;  1LTJ C;  1RE3 A;  1N73 B;  2H43 A;  1M1J A;  2OYH B;  2FFD A;  1RF0 C;  1FZC B;  1JY2 N;  1RE4 C;  1FZF A;  2A45 I;  3HUS A;  1LT9 B;  3GHG C;  1LTJ A;  1LWU C;  1RF0 A;  1FZB A;  1FZA A;  3H32 A;  1T3U A;  2OYH C;  2OYI C;  1N86 A;  1RE4 A;  2Q9I A;  1N73 C;  2FFD B;  3GHG A;  2HOD A;  1RF1 B;  3E1I A;  1M1J B;  1FZC C;  3BVH A;  2HPC A;  1LWU A; 
#chains in the Genus database with same CATH topology
 1SQQ E;  1IFM A;  2GUV A;  1SQB G;  2M3B A;  1FDI A;  2M8R A;  3A3Y B;  1LT1 A;  3FWL A;  4UB8 E;  2PAJ A;  1QLE D;  2P2U A;  4H44 B;  1EZV I;  3H1J J;  1PGP A;  1NTZ K;  2LXB A;  1PP9 D;  2KS1 A;  1MFT A;  4PV1 B;  4N6J A;  2HG5 D;  2N1T B;  1RE3 C;  3AE3 C;  3RBZ A;  3L37 A;  3M0D A;  3BAT A;  1S72 P;  1XTC C;  1N73 C;  1SQX D;  3NTN A;  3HTK B;  5APY A;  1NKZ B;  2QVA A;  2E43 A;  3CD6 P;  1EZV G;  2HPC B;  4YPC A;  3H1K E;  1L4A B;  3L75 J;  3L71 E;  4GIF A;  3M9Q A;  3GHG C;  5GTH E;  1Y8A A;  1FJP A;  1NVO A;  2YIU C;  2IBZ I;  2BEZ F;  1J1D C;  1DIP A;  1TU3 F;  2WPQ A;  3H1J G;  3A0H H;  4IL6 X;  5CJ4 A;  4O9B A;  3RL0 C;  4C7N B;  3IFM A;  1M8O B;  3Q1M A;  1M57 D;  3OAK A;  3G6E P;  1T6A A;  3A0B H;  2W6J H;  2B87 B;  1U7J A;  3AE2 C;  1FZC C;  4OGQ C;  5BVZ A;  1OW7 A;  1LTJ B;  4BXL A;  5KKZ B;  3U1C A;  3WUT A;  1SFC A;  4CPG A;  1NTZ J;  1KC8 Q;  2XKM A;  3M0A A;  1E79 H;  3L72 D;  3FX0 A;  3L75 G;  1MUU A;  3H1H J;  1W2B O;  1NO4 A;  3L74 J;  2W27 A;  4RKU J;  4H44 C;  3CPW O;  1G2C B;  1IK9 A;  3BRT B;  2B88 A;  4PV1 C;  1M1K Q;  2IBZ E;  1SQQ D;  2N1T C;  5BU8 B;  2QJP B;  1T3J A;  5KTB A;  3CCQ P;  1AVY A;  2HR3 A;  3LW5 J;  3AED C;  2FYU E;  1FBM A;  1JY3 N;  1N7S A;  4HJG H;  2NPS C;  3L36 A;  2Q6Q A;  3L35 A;  2QA4 P;  2Y9Y A;  2E76 D;  5DJU B;  2H8P D;  1L4A C;  3MP7 B;  3A0H E;  5AVT B;  2OYI A;  1SQV K;  3MGN A;  3H1H G;  2HOD B;  1BGY J;  2WSC H;  2YMK A;  3A0B E;  1Z56 A;  3UIA A;  3RK2 D;  2Z5I A;  2POH A;  3VMY A;  3MUD A;  1ZRT D;  1Y47 A;  2FBW C;  3FXE A;  1GL2 D;  3OJA B;  3L71 D;  3L73 G;  3M06 A;  3C8V A;  3NFQ A;  3N7N A;  1BCC E;  1GU4 A;  1LWU B;  1LTJ C;  2FKW B;  3GF7 A;  1KTM A;  1BDC A;  2KYV A;  1EZV D;  3R2P A;  3L70 J;  1QL1 A;  4PJ0 H;  2JEE A;  3H1I J;  1LP1 B;  1S5L X;  1MKM A;  2QSI A;  1RE3 A;  2JKV A;  1GU5 A;  1BGY G;  2E75 D;  3MZW B;  3CX5 H;  1URQ B;  3BAS A;  1K73 Q;  1N73 A;  3RK3 D;  4DT0 A;  3TK1 A;  2GM4 A;  3V2P A;  5CBN A;  1M56 D;  3SWK A;  2E42 A;  1SQV J;  1KQF B;  1Q81 Q;  1NTK K;  4TLF A;  3GHG A;  1L0N K;  1LJ2 A;  3CX5 I;  3IR9 A;  4HKZ H;  3GLM A;  1L0L K;  3L70 G;  1U57 A;  2XND H;  2ZFC A;  3B5N A;  3L75 D;  1W5C E;  3H1I G;  3CLQ A;  4DJG A;  1LTG C;  3U1A A;  2A06 G;  1AA0 A;  5AVV B;  2RKL A;  1YJN P;  3AE4 C;  3HUS B;  1FZC A;  3VP9 A;  1KFN A;  5C39 A;  3FXD A;  3CC2 P;  1Q90 D;  2WSE H;  2IDB A;  2G8Y A;  3B4S A;  4WY4 B;  3D71 A;  2QE7 H;  3IN6 A;  4PJ0 E;  1QVG O;  1EC5 A;  2YXQ B;  1JUN A;  1SQV G;  2HLO A;  5APQ A;  2Q3E A;  5B5E H;  3G71 P;  4RJT A;  1G1I A;  2OQQ A;  3PHL A;  3CX5 E;  1OVU A;  2N1T A;  3F89 A;  1BCC D;  2WMM A;  2OYO A;  1NTM K;  2KI7 B;  2ZJS E;  3G9R A;  1NTK J;  5AW1 B;  1HWT C;  3II6 A;  1A02 F;  1L0N J;  2QJY C;  3L73 D;  2W6B A;  5KLV K;  2W90 A;  1L0L J;  1YBK A;  2HPC A;  1DD4 A;  4EOT A;  1L4A A;  3K5B A;  1AQT A;  1KIL B;  3CMA P;  3PP5 A;  2M0B A;  2ZAE B;  2JJL A;  1YQ3 C;  3CCJ P;  2E74 D;  4C7N A;  4B86 A;  5DJT B;  3KPE A;  4ZKP A;  4GOD A;  1NWQ A;  2B87 A;  2K37 A;  4IOI H;  1PP9 E;  3SWY A;  3G3Z A;  1LTJ A;  5AW9 B;  1NTK G;  1L0N G;  3EFG A;  5B5E E;  2YMY A;  4WY4 C;  1KQS O;  1L0L G;  1N2D C;  3CCE P;  1M1J C;  3BCC J;  3S9O A;  1BSN A;  5APW A;  2FYN B;  1SQX E;  3CI9 A;  2O01 J;  1HBW A;  1ZP0 C;  1H89 A;  1NTM J;  1NH4 A;  3VP8 A;  3C1L A;  1VQ7 P;  1Q82 Q;  1VL2 A;  1G2C A;  1ZR4 A;  1ZLL A;  1VQK P;  1JNM A;  1VPC A;  4LC1 A;  3H1I D;  2PGD A;  3KDP B;  2A45 G;  1LGH B;  5KLV J;  1FOS E;  3M9H A;  1DD3 A;  2J58 A;  4GOE A;  2OYH C;  2BAS A;  1VF5 C;  3Q3D A;  2K9J B;  3TYY A;  2JR8 A;  2WSF J;  1IC2 A;  1PPJ E;  3HE4 B;  4D6T E;  1IK7 A;  1CI6 B;  1JTH B;  1JOC A;  2KXP B;  2FY8 A;  3BCC G;  3CME P;  2GA1 A;  2ZXX A;  2HOD A;  1HJ0 A;  1NTM G;  2P10 A;  1SFC D;  1OW6 A;  3RL0 B;  3V2Q A;  2ZYG A;  1FDO A;  2R44 A;  4BWN A;  2R3S A;  3L72 E;  5AVZ B;  1FZG A;  3N4X A;  5KLV G;  4I6M C;  1NJI Q;  3TGU E;  2FYU K;  1LWU A;  3H1K J;  3KQG A;  4IL6 H;  4K3A A;  1LT9 A;  4C7R A;  1NHL A;  1KOR A;  2YKQ A;  1A02 J;  2H43 A;  3AE7 C;  3L4F A;  2FYN C;  3W68 A;  1P84 I;  5KAF H;  1HJB A;  2FFD B;  1LP1 A;  3TNU B;  1S3J A;  4C46 A;  3JSV C;  1N7S D;  1LNQ A;  1SQB E;  1RF1 C;  1PGO A;  2IPP A;  3P8C E;  2J59 M;  4ASW A;  1URQ A;  3HD7 D;  5H2F H;  3PJS K;  2OTJ P;  2BEQ D;  2BCC J;  4DCK A;  3O8Z A;  4EDF A;  2NPS B;  2FXO A;  2P1J A;  1ZRT E;  2H7H A;  4UB6 H;  3LIE A;  3WMM 0;  1IFP A;  3V4W A;  2VRS A;  4GKG A;  4XA4 A;  1ZME C;  1GK6 A;  1ZV8 A;  4Z1M H;  1X9V A;  1M7L A;  1EZV E;  1ZXG A;  2FYU J;  5AVW B;  3HUS A;  2QIW A;  1PPJ D;  2KSJ A;  4D6T D;  1MFZ A;  3CC4 P;  1YYC A;  4IL6 E;  3H1L J;  2QJK B;  1FS0 E;  2XDJ A;  3H1J E;  1KQG B;  2BCC G;  4WY4 A;  5K5G B;  4KJM A;  3AEF C;  4H13 B;  2C9L Y;  5AVX B;  5KAF E;  5AW8 B;  1R5L A;  3RK3 E;  2QM7 A;  4L75 A;  3SSU A;  2OTK E;  5AW5 B;  4U3F J;  2ZT9 B;  3BCC D;  1NU1 K;  2KLU A;  1W2E A;  2FFD C;  2K1A A;  4AUW A;  1EDL A;  3TGU D;  2P7J A;  5H2F E;  5AW2 B;  3R4Y A;  3RK2 C;  5AVR B;  1LTS C;  2W83 C;  2FXP A;  3L75 E;  2Q7C A;  1SQP K;  3B5N D;  3EQ2 A;  2ZYA A;  1S5L H;  3MD0 A;  1BE3 J;  4UB6 E;  4AYC A;  3A7O A;  4JQ0 D;  2QRX A;  1T2K D;  1SQB D;  2KUB A;  1S2E A;  1NTZ G;  2KB7 P;  3P8C D;  4OGQ D;  4RES B;  3HD7 A;  1KIL A;  1FC2 C;  1YJ9 P;  2R32 A;  3RGU A;  1VQO P;  3HE5 B;  1VQ8 P;  2KNC A;  1FU1 A;  3L74 G;  2D2C D;  3NMD A;  4L74 A;  2WT7 B;  5APX A;  1D7M A;  1UIX A;  1DEB A;  1NTZ E;  2E75 C;  1OVR A;  4WWI A;  4H44 D;  1NGM B;  3IAO A;  3H32 B;  2QJK C;  4PV1 D;  3H1H E;  1QVF O;  4JF7 A;  2N1T D;  1H88 A;  2IFM A;  5AW4 B;  1NU1 J;  1S9K E;  1DX7 A;  5BU5 A;  1BE3 G;  4H13 C;  1P84 D;  1VQ9 P;  1H8A A;  2KZI A;  1FOS F;  4YXD C;  3L73 E;  3O6Q B;  2H88 C;  2ZT9 C;  4WVZ A;  3M91 A;  2V7Q J;  1SQP J;  3CWB J;  3H1J D;  2QM8 A;  1VQL P;  1L4A D;  4TT3 H;  2LR2 A;  1Q7Y Q;  1S5L E;  1OX3 A;  2QJY B;  2Y0C A;  3CCU P;  4H0L B;  3GF3 A;  2IZ0 A;  1N7L A;  2K9J A;  4HH2 A;  1BGY E;  3HE4 A;  1CI6 A;  1N86 A;  3S4R A;  4N3Y B;  2ZXE B;  1JTH A;  1NU1 G;  3WU2 H;  3V6I A;  2KIK A;  2WPV B;  5L8R J;  2O3J A;  2R5B A;  1JEK A;  4LLH A;  2KSE A;  5CCH C;  3CC7 P;  4QMA A;  4RO0 A;  4ASV A;  3AEG C;  1E5W A;  2WIT A;  1SQP G;  3CWB G;  5APS A;  3TDK A;  5AW7 B;  1QX8 A;  3L70 E;  3T97 A;  1OW8 A;  3H1I E;  2RH0 A;  1RE4 C;  1K9M Q;  3SFE C;  3Q5P A;  1N8R Q;  2A06 E;  4N78 E;  1M1J B;  4L73 A;  4JPZ B;  1USD A;  1PGQ A;  1NTZ D;  3V2N A;  5CJ0 A;  3TNU A;  2LXC B;  1SFC B;  2KP8 A;  1FZB A;  1VQ4 P;  4OVN F;  3H1H D;  1IFN A;  3L74 D;  1IO4 A;  1SS1 A;  1LTB C;  5CHX A;  1EXJ A;  1GDT A;  1SQV E;  3VN0 A;  4LGD E;  1QL2 A;  1S9K D;  1IFJ A;  3I5C A;  3RL0 g;  5AVU B;  2OYH B;  3AEC C;  4YXW H;  1KMI Z;  1VF5 B;  2ITA A;  2NPS A;  3HTK A;  4H0L C;  3WU2 E;  4KHX A;  1Q2N A;  1PGJ A;  1SQX J;  1X79 B;  1SQQ K;  1HF9 A;  3M0D C;  2A45 H;  5AW3 B;  2E5Y A;  2M3E A;  5CCG C;  2Y9Z A;  1JCD A;  3FGA D;  3ZDM A;  1J2J B;  2CPS A;  2WSS H;  4A7P A;  1CW5 A;  1T8Z A;  1BGY D;  1FAV A;  3S1K A;  2OYI B;  2MKV A;  2A45 I;  4R4M A;  1GZL A;  1T3U A;  2AXC A;  1URQ D;  1KIL E;  4ZNC A;  1QGK B;  1FZE A;  3B8E B;  1FZF A;  5EFW B;  3AE1 C;  3D70 A;  4PD4 H;  1NTK E;  1YTZ I;  3L72 J;  3L70 D;  1PIX A;  1RF1 B;  1L0N E;  3E1I A;  1SFC C;  1JY3 O;  1JY3 P;  1ZW0 A;  1YTZ T;  1L0L E;  2WQY C;  3V5B A;  4NPD A;  1ZR2 A;  5KJ7 C;  2A06 D;  1SQP D;  4N78 D;  2P58 A;  3CWB D;  4ZMD A;  1GW3 A;  2R5D A;  3PRJ A;  1SQQ J;  2WSF H;  4M3L A;  2PRR A;  1L2P A;  3FWN A;  4PD4 I;  1VQP P;  2RMZ A;  1FE6 A;  1SP4 A;  1UII A;  1S1C X;  3P32 A;  3H6P A;  1NYH A;  1SQV D;  5CCH A;  3HE5 A;  4WY4 D;  5APT A;  2KZJ A;  1N7S C;  1PZQ A;  4ZKU A;  2WT7 A;  2L91 A;  1NAY A;  1H0T B;  3KHU A;  3WUV A;  1JY2 O;  1JY2 P;  2SPZ A;  1P84 H;  1J1E B;  1JM0 A;  3BCC E;  1GW4 A;  2PP6 A;  1G1J A;  1OXZ A;  3H32 A;  2OYI C;  1RE4 A;  4XE5 B;  1SQQ G;  1NTM E;  2Z4E A;  2YKP A;  1OVV A;  3IF4 A;  2IZ1 A;  2YO2 A;  3I56 P;  5M1B A;  3L71 J;  3CCV P;  2N9Y B;  1QEX A;  4PD4 E;  2E76 B;  3EWK A;  5KLV E;  1FZA A;  3O6Q A;  1DEE G;  1KN7 A;  2D2C B;  2B89 A;  4JBZ A;  1K05 A;  2YNY A;  3C9I A;  3Q5R A;  3RK2 B;  1DH3 A;  1R5S A;  2Q5U A;  1RQV A;  1Q86 Q;  2IYP A;  1KIL D;  1YI2 P;  1GL2 B;  1IFD A;  2Z5H A;  3VTP C;  3VOP A;  3HRN A;  1S4X A;  3CCL P;  3CCS P;  3PTZ A;  3ABV C;  1NTK D;  3AE5 C;  1Y9B A;  4L76 A;  1L0N D;  3H1K G;  5AW6 B;  1AV1 A;  1K04 A;  3L71 G;  1JB0 J;  1EDJ A;  1L0L D;  2NRG A;  1USE A;  2OTL P;  5CCG A;  2RN0 A;  3MTU E;  1P84 E;  3H25 A;  1YHQ P;  2JP3 A;  2E75 B;  3JC2 2;  1OWA A;  2OGU A;  1IFI A;  4I7Z B;  3RK3 B;  2Q9I A;  3I55 P;  3AE6 C;  1J1E C;  1VQM P;  1VQ5 P;  1FJK A;  3B5N C;  1IZN B;  4W7Y A;  4W80 A;  1KB9 H;  4EYY Q;  3WUU A;  1M1J A;  5GTI H;  1T2K C;  4AQR D;  2WWW A;  1VDF A;  4XFJ A;  1EDI A;  2L5G B;  1LTT C;  3TF5 A;  2E76 C;  4GT1 A;  2XNX A;  2YKO A;  1LTI C;  3W67 A;  4JYC A;  2BCC E;  1MZ9 A;  2C0X A;  3KZI H;  2IBZ G;  1NAF A;  2D2C C;  3P7K A;  2M5A B;  1NTM D;  3CXH H;  3LW5 H;  1KB9 I;  3LID A;  5KJ7 A;  1K8A Q;  1EXI A;  2I1K A;  2FYU G;  4WB4 A;  1BCC J;  4PD4 D;  2OYH A;  1GL2 C;  3U59 A;  1OIP A;  5KLV D;  3Q2Y A;  4I2L C;  3RL0 D;  3H1L G;  3CXH I;  3L73 J;  1YJW P;  2R3C A;  1WRG A;  1LTA C;  3A5T A;  1BDD A;  3E1R A;  1KFM A;  3RBX A;  1OFC X;  3H1L E;  3AE9 C;  4U3F G;  3SFD C;  5TIS H;  1OMI A;  1GD2 E;  2ZYD A;  3KYQ A;  1AVO A;  2GUS A;  2FXM A;  4BRY B;  2H89 C;  2YO3 A;  2JWD A;  1KB9 E;  4HYT B;  4I7Z C;  3RK3 C;  1HH0 A;  3AE8 C;  1BCC G;  4U3F E;  5GTI E;  2QEX P;  3L74 E;  2XZR A;  1HVV A;  5APV A;  4GDO A;  4HB1 A;  4R4L A;  1BSH A;  2W8Z A;  2WSC J;  1GTW A;  1KV4 A;  3H1K D;  2Q3I A;  3KZI E;  4IFF A;  2V7Q H;  3CXH E;  2NPS D;  3TSI A;  5KKZ C;  3BRV B;  1RF1 A;  3P8M C;  1RF0 C;  2UWJ E;  2E74 B;  1JY2 N;  1LT9 B;  3CCM P;  1KYO H;  1OZH A;  1BE3 E;  2B9B A;  5E79 H;  1IJD B;  4IFD K;  1R8E A;  1NKN A;  4K35 A;  3VMZ A;  1KD1 Q;  2Y0D A;  2P67 A;  2AEF A;  1CZQ A;  3AEB C;  2KS1 B;  1RQU A;  2QG4 A;  4NPE A;  2BCC D;  3F5H A;  1KYO I;  2J5U A;  1FDM A;  2QJP C;  1KQL A;  1EQ7 A;  5TIS E;  5AVY B;  1CSB A;  1SQX K;  3D6Y A;  1SLQ A;  5KLI B;  3VMX A;  4H13 D;  1H0T A;  2IBZ D;  3CL3 D;  1NU1 E;  3D6Z A;  2AEJ A;  3MHV A;  2ZT9 D;  1YIJ P;  3VYI A;  2FYU D;  4Y99 B;  5CMZ A;  4Y28 J;  3H1L D;  4W7Z A;  2KLV A;  2HFE D;  1SQP E;  3CWB E;  2WTY A;  3NXS A;  5TJH A;  3GW6 A;  2OAR A;  3OA7 A;  2FFD A;  1KYO E;  2CK3 H;  4U7J A;  1X22 A;  5E79 E;  1KB9 D;  3GMA A;  2JWA A;  1JCC A;  1LWU C;  2K3R A;  2WSE J;  4U3F D;  1AFO A;  2E74 C;  1LT9 C;  1PP9 J;  1EDK A;  4OWF A;  2O01 N;  1GL2 A;  5CCH D;  3JCU H;  4GOF A;  4OH8 B;  2WVR A;  2G3A A;  3PLN A;  1PFI A;  5APU A;  1RY3 A;  2JDI H;  3CXH D;  1ZOY C;  1PL5 A;  2MJZ A;  1JMM A;  1XTG B;  3M9B A;  4KT0 J;  5KAI H;  1GK4 A;  1URQ C;  5CBO A;  1U7M A;  1BE3 D;  4EIJ A;  2KOG A;  1SVF A;  2W6A A;  1N7S B;  2XU6 A;  2IFN A;  5KLI C;  2WPS A;  1VQ6 P;  2HYN A;  4MN4 C;  1PV3 A;  3E7K A;  1KZU B;  1SQB K;  1JMB A;  1YQ4 C;  3HD7 B;  3AEE C;  1PP9 G;  2WPR A;  2DW3 A;  2KNC B;  3ITK A;  2C0W A;  2O1K A;  2C9N Y;  4D6T J;  4Y99 C;  1M90 Q;  2IX7 C;  1JO5 A;  4YTP C;  5B66 H;  4IFM A;  2O01 H;  4DZO A;  3SWF A;  3EFF K;  3OW2 O;  1SQX G;  2WZ7 A;  3HUS C;  2KK7 A;  1HTL C;  3CCR P;  3V2R A;  3GG2 A;  1HUC A;  2CPB A;  1NU1 D;  4I1L A;  3QH9 A;  2O1J A;  2Y0E A;  4H0L D;  3VMA A;  1RF0 A;  1RHZ B;  2K88 A;  5AW0 B;  4JYB A;  2YXR B;  2NZ2 A;  2M5A A;  3MIW A;  2I8D A;  3JCU E;  1GMJ A;  2AXT H;  1WT6 A;  3TGU J;  2ZVO B;  1X0T A;  5CCG D;  2JO1 A;  2AEM A;  2Q1K A;  2I1J A;  1X8Y A;  4EI2 A;  4UB8 H;  5KAI E;  3A2A A;  3Q5S A;  2ZVN B;  1KYO D;  3AEA C;  3V4Q A;  4NPF X;  5AVQ B;  1PPJ G;  4D6T G;  2N9B A;  2FYZ A;  1N73 B;  1HGZ A;  3PH0 A;  4DOJ A;  1WMK A;  2E5T A;  1SQB J;  1VQN P;  1HGV A;  3G4S P;  3CX5 D;  2LKM A;  1MV8 A;  3L72 G;  4WBA A;  2K9Y A;  3GHG B;  1AJY A;  2YIU B;  4BRY A;  1AQ5 A;  3HD7 C;  1J1D B;  1KIL C;  3TGU G;  1RH5 B;  5B66 E;  3B5N B;  5GTH H;  3USS A;  3QWO C;  3BVH A;  2PFX A;  3KXD A;  2V4H A;  5KJ7 D;  2XV5 A;  1YIT P;  1ZN5 A;  1NOH A;  5AVS B;  1FZC B;  3MUD C;  4OGQ B;  3T97 B;  3B71 A;  2IYO A;  1VF5 D;  2AXT E; 
#chains in the Genus database with same CATH homology
 2OYH A;  1GL2 C;  3U59 A;  1IFM A;  2GUV A;  3KPE A;  4ZKP A;  2M3B A;  4I2L C;  2R5B A;  1NWQ A;  3RL0 D;  4LLH A;  2M8R A;  5CCH C;  3A3Y B;  3SWY A;  2PAJ A;  2P2U A;  3G3Z A;  1LTJ A;  5AW9 B;  1E5W A;  2R3C A;  2WIT A;  1NTZ K;  1WRG A;  3EFG A;  1LTA C;  5APS A;  2YMY A;  4WY4 C;  3A5T A;  4N6J A;  1KFM A;  1N2D C;  5AW7 B;  2HG5 D;  2N1T B;  1M1J C;  1RE3 C;  5APW A;  3T97 A;  3CI9 A;  1HBW A;  1H89 A;  1NH4 A;  1RE4 C;  3L37 A;  1GD2 E;  3VP8 A;  3M0D A;  3KYQ A;  2GUS A;  2FXM A;  3BAT A;  1G2C A;  1XTC C;  1N73 C;  1ZR4 A;  4N78 E;  1ZLL A;  1M1J B;  3NTN A;  1JNM A;  1VPC A;  4LC1 A;  2YO3 A;  3HTK B;  3KDP B;  5APY A;  2A45 G;  4HYT B;  3RK3 C;  1NKZ B;  2E43 A;  1HH0 A;  1LGH B;  3V2N A;  5CJ0 A;  2HPC B;  2XZR A;  1HVV A;  3TNU A;  1FOS E;  5APV A;  3M9H A;  1L4A B;  1SFC B;  4GIF A;  3M9Q A;  2J58 A;  3GHG C;  2KP8 A;  1FJP A;  1FZB A;  1GTW A;  2BAS A;  2OYH C;  1IFN A;  1IO4 A;  5CHX A;  1LTB C;  2Q3I A;  1J1D C;  3TYY A;  1GDT A;  3VN0 A;  4IFF A;  2WPQ A;  4LGD E;  1QL2 A;  1IC2 A;  1S9K D;  3HE4 B;  1CI6 B;  5CJ4 A;  4O9B A;  3RL0 C;  4C7N B;  1IFJ A;  3I5C A;  3IFM A;  2NPS D;  1JTH B;  1JOC A;  3TSI A;  5AVU B;  3BRV B;  1RF1 A;  2OYH B;  3P8M C;  3OAK A;  1RF0 C;  1JY2 N;  1LT9 B;  2NPS A;  3HTK A;  4KHX A;  2HOD A;  1FZC C;  1SFC D;  1IJD B;  4IFD K;  1X79 B;  3RL0 B;  3V2Q A;  5BVZ A;  1SQQ K;  1LTJ B;  1NKN A;  3U1C A;  3VMZ A;  1SFC A;  5AVZ B;  2P67 A;  1CZQ A;  1FZG A;  3M0D C;  2A45 H;  5AW3 B;  2XKM A;  3N4X A;  3M0A A;  5CCG C;  1JCD A;  4I6M C;  1MUU A;  2FYU K;  1J2J B;  1NO4 A;  1LWU A;  2W27 A;  3KQG A;  2CPS A;  1FDM A;  1CW5 A;  1T8Z A;  1G2C B;  1IK9 A;  1FAV A;  1KQL A;  1LT9 A;  1EQ7 A;  3BRT B;  4C7R A;  1NHL A;  5AVY B;  1CSB A;  1SQX K;  2OYI B;  2YKQ A;  1A02 J;  2H43 A;  2N1T C;  1SLQ A;  2A45 I;  3L4F A;  3VMX A;  5BU8 B;  1HJB A;  1GZL A;  1T3U A;  1T3J A;  5KTB A;  3TNU B;  2FFD B;  4C46 A;  3CL3 D;  1N7S D;  1FBM A;  1URQ D;  1RF1 C;  2IPP A;  1JY3 N;  1N7S A;  3P8C E;  2J59 M;  2NPS C;  3VYI A;  3L36 A;  1URQ A;  1FZE A;  3B8E B;  4Y99 B;  5CMZ A;  3L35 A;  3HD7 D;  1FZF A;  1YTZ I;  4W7Z A;  1RF1 B;  2H8P D;  1L4A C;  2KLV A;  3E1I A;  3O8Z A;  2HFE D;  1SFC C;  1JY3 P;  1JY3 O;  5AVT B;  2WTY A;  2NPS B;  2OYI A;  1SQV K;  1YTZ T;  3MGN A;  3V5B A;  2P1J A;  3NXS A;  2HOD B;  1ZR2 A;  2WSC H;  5KJ7 C;  4N78 D;  2H7H A;  2OAR A;  3OA7 A;  1Z56 A;  2FFD A;  1GW3 A;  2R5D A;  3UIA A;  3RK2 D;  2Z5I A;  2WSF H;  4M3L A;  1JCC A;  1LWU C;  2POH A;  3LIE A;  3V4W A;  3VMY A;  3WMM 0;  3MUD A;  2VRS A;  1AFO A;  4GKG A;  1GL2 D;  4XA4 A;  1LT9 C;  3OJA B;  3M06 A;  1SP4 A;  1GK6 A;  1ZV8 A;  3NFQ A;  1GL2 A;  5CCH D;  1X9V A;  3N7N A;  3P32 A;  1M7L A;  3H6P A;  1GU4 A;  1LWU B;  4OH8 B;  1LTJ C;  2FKW B;  1PFI A;  5CCH A;  5APU A;  5AVW B;  1RY3 A;  3HUS A;  2KSJ A;  1MFZ A;  2KYV A;  3HE5 A;  3R2P A;  2MJZ A;  1YYC A;  4WY4 D;  1JMM A;  1XTG B;  1QL1 A;  3M9B A;  5APT A;  1N7S C;  2JEE A;  1GK4 A;  1URQ C;  2XDJ A;  4WY4 A;  4ZKU A;  2WT7 A;  1JY2 O;  1JY2 P;  4EIJ A;  2C9L Y;  1RE3 A;  5AVX B;  2KOG A;  5AW8 B;  1SVF A;  1GU5 A;  1J1E B;  2W6A A;  2QM7 A;  1GW4 A;  2PP6 A;  1N7S B;  3H32 A;  1G1J A;  1OXZ A;  2OYI C;  1RE4 A;  1URQ B;  3BAS A;  2XU6 A;  2IFN A;  4XE5 B;  5AW5 B;  2Z4E A;  2YKP A;  1N73 A;  2WPS A;  1NU1 K;  3RK3 D;  2YO2 A;  2HYN A;  1KZU B;  1SQB K;  1W2E A;  3TK1 A;  2FFD C;  4AUW A;  3HD7 B;  3V2P A;  2GM4 A;  2P7J A;  2WPR A;  5AW2 B;  3RK2 C;  5AVR B;  1LTS C;  2E42 A;  2C0W A;  1FZA A;  2O1K A;  2C9N Y;  1NTK K;  4Y99 C;  3GHG A;  2IX7 C;  1JO5 A;  1L0N K;  2Q7C A;  1SQP K;  4IFM A;  3B5N D;  3EQ2 A;  3IR9 A;  2O01 H;  2YNY A;  3C9I A;  4DZO A;  3SWF A;  1L0L K;  3RK2 B;  1DH3 A;  2ZFC A;  2Q5U A;  2WZ7 A;  3HUS C;  3B5N A;  3MD0 A;  4AYC A;  1HTL C;  3A7O A;  3V2R A;  1HUC A;  2CPB A;  3CLQ A;  4I1L A;  1T2K D;  2O1J A;  1KIL D;  1GL2 B;  1IFD A;  1RF0 A;  2Z5H A;  3VTP C;  1LTG C;  3U1A A;  2KB7 P;  3P8C D;  4RES B;  5AVV B;  3HD7 A;  1KIL A;  3VOP A;  5AW0 B;  4JYB A;  3HRN A;  3MIW A;  2R32 A;  3HUS B;  1FZC A;  3VP9 A;  1KFN A;  1WT6 A;  3HE5 B;  1FU1 A;  3NMD A;  2WSE H;  5AW6 B;  4WY4 B;  5CCG D;  2WT7 B;  5APX A;  2I1J A;  1DEB A;  1X8Y A;  5CCG A;  3A2A A;  1JUN A;  2HLO A;  5APQ A;  3V4Q A;  5AVQ B;  3MTU E;  2N9B A;  3H32 B;  2FYZ A;  1G1I A;  4JF7 A;  1N73 B;  1HGZ A;  2N1T D;  1H88 A;  2IFM A;  4DOJ A;  1OWA A;  5AW4 B;  1IFI A;  1S9K E;  1DX7 A;  5BU5 A;  2N1T A;  3RK3 B;  2Q9I A;  1H8A A;  1HGV A;  1J1E C;  1NTM K;  1FOS F;  1FJK A;  2LKM A;  1MV8 A;  3B5N C;  4WBA A;  3GHG B;  4W7Y A;  4W80 A;  5AW1 B;  1HWT C;  3II6 A;  1A02 F;  3M91 A;  1M1J A;  1AQ5 A;  1T2K C;  4AQR D;  2WWW A;  3HD7 C;  1J1D B;  1KIL C;  2W6B A;  1VDF A;  5KLV K;  2QM8 A;  3B5N B;  1L4A D;  2L5G B;  1LTT C;  4GT1 A;  3BVH A;  2HPC A;  4EOT A;  2XNX A;  2YKO A;  1LTI C;  1L4A A;  4JYC A;  1MZ9 A;  2C0X A;  5KJ7 D;  1KIL B;  1NAF A;  3P7K A;  2XV5 A;  3PP5 A;  1ZN5 A;  1NOH A;  5AVS B;  1N7L A;  1FZC B;  3LW5 H;  3LID A;  5KJ7 A;  2JJL A;  4HH2 A;  3HE4 A;  2I1K A;  1CI6 A;  1N86 A;  4N3Y B;  4C7N A;  2ZXE B;  4B86 A;  4WB4 A;  1JTH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...