1N7DA

Extracellular domain of the ldl receptor
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
650
structure length
639
Chain Sequence
SVTCKSGDFSCGGNRCIPQFWRCDGQVDCNGSDEQGCPPKTCSQDEFRCHDGRQFVCDSDRDCLDGSDEASCPVLTCGPASFQCNSSTCIPQLWACDNDPDCEDGSDEWPQRCRGLYVFQGDSSPCSAFEFHCLSGECIHSSWRCDGGPDCKDKSDEENCAVATCRPDEFQCSDGNCIHGSRQCDREYDCKDMSDEVGCVNVTLCEGPNKFKCHSGECITLDKVCNMARDCRDWSDEPIKECGTNECLDNNGGCSHVCNDLKIGYECLCPDGFQLVAQRRCEDIDECQDPDTCSQLCVNLEGGYKCQCEEGFQLDPHTKACKAVGSIAYLFFTNRHERKMTLDRSEYTSLIPNLRNVVALDTEVASNRIYWSDLSQRMICSTQLDRAHGSSYDTVISRDIPDGLAVDWIHSNIYWTDSVLGTVSVADTKGVKRKTLFREQGSKPRAIVVDPVHGFMYWTDWGTPAKIKKGGLNGVDIYSLVTENIQWPNGITLDLLSGRLYWVDSKLHSISSIDVNGGNRKTILEDEKRLAHPFSLAVFEDKVFWTDIINEAIFSANRLTGSDVNLLAENLLSPEDMVLFHQLTQPRGVNWCERTTLSNGGCQYLCLPAPQINPHSPKFTCACPDGMLLARDMRSCLTE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of the LDL receptor extracellular domain at endosomal pH
pubmed doi rcsb
source organism Homo sapiens
molecule tags Lipid transport
molecule keywords Low-density lipoprotein receptor
total genus 37
structure length 639
sequence length 650
ec nomenclature
pdb deposition date 2002-11-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00057 Ldl_recept_a Low-density lipoprotein receptor domain class A
A PF00058 Ldl_recept_b Low-density lipoprotein receptor repeat class B
A PF12662 cEGF Complement Clr-like EGF-like
A PF14670 FXa_inhibition Coagulation Factor Xa inhibitory site
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.25.10 Mainly Beta Ribbon Laminin Laminin 1n7dA08
2.10.25.10 Mainly Beta Ribbon Laminin Laminin 1n7dA07
2.10.25.10 Mainly Beta Ribbon Laminin Laminin 1n7dA10
2.120.10.30 Mainly Beta 6 Propeller Neuraminidase TolB, C-terminal domain 1n7dA09
4.10.400.10 Few Secondary Structures Irregular Low-density Lipoprotein Receptor Low-density Lipoprotein Receptor 1n7dA04
4.10.400.10 Few Secondary Structures Irregular Low-density Lipoprotein Receptor Low-density Lipoprotein Receptor 1n7dA05
4.10.400.10 Few Secondary Structures Irregular Low-density Lipoprotein Receptor Low-density Lipoprotein Receptor 1n7dA03
4.10.400.10 Few Secondary Structures Irregular Low-density Lipoprotein Receptor Low-density Lipoprotein Receptor 1n7dA01
4.10.400.10 Few Secondary Structures Irregular Low-density Lipoprotein Receptor Low-density Lipoprotein Receptor 1n7dA06
4.10.1220.10 Few Secondary Structures Irregular Knottins (small inhibitors, toxins, lectins) EGF-type module 1n7dA02
1C5KA 2WFXB 3Q6PA 2IAXA 4FM5A 2P28B 3NTGA 3OLTA 2XBYL 1KLIL 4OTJA 5KN5C 1PJXA 1P9JA 4ZXXL 2G8SA 3ELAL 4IMBA 2PR3B 2IAUA 2FZZL 5L30L 4COXA 1FE2A 1U8CB 1IQEL 2P3TA 2WG3C 3NTBA 2XC5L 1EQGA 3V64C 3KK6A 2K2TA 3HO4A 4LORA 1LPZA 2POOA 2BMGA 1NZIA 1UZQA 4NG9L 2BQWA 2FCWB 2MGRA 4YT6L 5L2YL 2Y7XB 2XC0L 1C5MF 3EGFA 3A9GA 2P93L 1HREA 2IAOA 5GX1A 2V91A 2BZ6L 2P3FL 5COXA 2FLBL 4YT7L 3N8YB 2RHPA 1RFNB 1PTHA 3PGHA 3V1SA 3BT1A 2DSOA 2GHSA 1N7DA 3TK6B 1Q7FA 2P3FN 1EPGA 4GNCA 2FD6A 4BTUA 1JRFA 1ZAQA 3CFWA 1B9WA 2GVXA 3HLIA 1DX5I 2VJ3A 1LDRA 4RRXA 1IQLL 3CENL 3FW0A 2M0PA 3ZYIB 4JYVL 4BDXA 2YGOA 1DVAL 3HS7A 2Q1JB 3KQCL 3HLHA 3N8WB 5D9BA 4GNAA 3LC5B 1JBUL 3BPSE 4M11A 3ZYJB 4Y7AB 3LAQA 5GTQA 1TLEA 1UZKA 1WHEA 1HCGB 4CUEA 2I9BA 3GCWE 1HT5A 5GX2A 3SW2A 3KGGA 1NPEB 4ISIL 4BTTA 2Y38A 1PXXA 2BQ6A 2Y81B 3LI3A 1NFUB 2WPKE 1H6LA 4R40A 3LN0A 1D2LA 3KQBL 2BQ7A 5JVZA 2IASA 4E1GA 2Y82B 1K7BA 2LGPA 4BXSA 1PFXL 4GNBA 2FYLB 2VVUL 4O1ZA 4X8UL 4ZH8B 1YO8A 5JBCE 2Y7ZB 2OJHA 1Z6EL 1G1TA 3S94A 2UWOB 2IAQA 3KQDL 1I0UA 1LPKA 2BO2A 4JMLA 4IYGA 2JKHL 2BOUA 3ENSA 3IJEB 2VAQA 4RUTA 4NGAL 2D1JB 3M37L 6COXA 2RNLA 3TZIA 4CSYA 3N8VA 2FPBA 2W2NE 2WPJE 2DG0A 1NFWB 2WPME 1NQLB 3KL6B 3LI5A 3H5CB 1EMOA 5IKRA 3S8VA 3GCXE 1CRZA 4D90A 1XDTR 4MMYB 2WG4B 2GD4A 4JZEL 4A0PA 4RRYA 3SOBB 5JVYA 3K9XA 1HRFA 1IGZA 3G4HA 2DDUA 1FSBA 1HT8A 3G4EA 2KNYA 3N8YA 3QMOA 2W2OE 1WU1B 1LQDA 5CKNA 4HHOA 1EGFA 2CJIB 2HQSA 1ATDA 3SRGA 1NFXB 3HS6A 5IKVA 1PGEA 2WFTA 2IAVA 2WPIE 4RS0A 1CR8A 3A9HA 2W26B 3HRPA 4MMXB 4ZHAB 4O5TA 4BTIA 1XKBA 1RWIA 2MGPA 1V04A 2BOHA 3RR3A 1P0SL 3KQEL 1AUTL 2EI7B 5JW1A 1RWLA 2PHBB 1JV2B 5JBBE 4D0EA 4RRWA 4HHQA 3SOQA 3POYA 3LIWB 2QE8A 1YUGA 2Y5FL 2M7PA 2M74A 4BDWA 3Q6TA 4YZUB 1IJQA 2BOKL 2EI6B 3WWAA 1HZ8A 1DQBA 5FDQA 3N8XA 1F0SB 4X8VL 3FBYA 1IVOC 1APOA 3SREA 2P94L 1IOXA 2FP8A 2XBXL 4G1MB 1CQEA 1Q4GA 1A3PA 3FFGL 1CCFA 5CKMA 3IAXA 1FAKL 1MQ6L 3HS5A 3BYCA 2BOXA 4Y6DB 1HAFA 1UZPA 4Z0LA 1CX2A 2OYUP 2YGPA 1L5GB 2VWLL 3MQEA 2ISMA 2FLGA 1CVWL 3ASIA 1G1RA 5CKQA 2G00L 1IQGL 1IQIL 2W86A 4JZDL 3KRKA 3O4PA 2P26A 1YGCL 1E1AA 1PRHA 2J94B 2WYGB 1ATAA 1TPGA 3S8ZA 4ZXYL 3LTFB 1N1IA 1CVMA 4JZFL 3DR2A 2IATA 4C16A 4GN9A 3CS7L 4ZAEB 2FPCA 1DIYA 1ATBA 1W7XL 2UWPB 1HJ7A 1K36A 5E8DA 1F7MA 4PH9A 4NA9L 1EPJA 3Q3KB 1W8BL 3TK5B 1LDLA 4D0FA 3WW9A 3NJPC 2WPLE 1EQHA 2TGFA 2VH0B 3IITB 3AMSA 5F19A 2VWMK 3LC3B 4Y79B 1F7EA 1KLJL 3P5BL 4Y76B 1J9CL 1BF9A 1SZBA 2P3UA 1XKAL 2W2QE 2VWOL 3R05A 1DDXA 1G2LB 5KIRA 2J2UB 3C9AC 1APQA 1CRUA 2I9AA 2J38B 3F1SB 2GVVA 3U73A 1ATEA 1UZJA 2GVWA 1KSNB 1ADXA 1GK5A 2RA0L 4Q1UA 1JL9A 3DASA 3E5ZA 1FFMA 1CEJA 2W3KB 1EMNA 4CUDA 1EZQB 3N8ZA 1YUFA 3TGFA 4TGFA 4GN8A 1FJSL 4CUFA 2FP9A 3FVZA 2VWNL 1CCVA 2P95L 2Y5HL 2WPHE 1M1XB 5D9DA 1OB1C 3TBDA 4RRZA 5K0HB 3QCWA 3GISX 1IQML 1X7AL 1F5YA 1V3XB 1QBIA 1WHFA 2W3IB 2K2SB 2ADXA 1IOEL 2M96A 2W2PE 4O5SA 2B7DL 4XBMA 3LI4A 1QLGA 3KCGL 1K37A 1O5DL 1NPEA 3KYAA 2DG1A 1CVUA 1TOZA 2MHPA 3HO3A 5GX3A 2JM4A 2GVUA 2PUQL 2KL7A 2P16L 4Y7BB 1EAIC 3U0SA 2AYLA 1FAXL 3BT2A 4OTYA 4AQTA 3N8WA 1HAEA 4Y71B 4Z0KB 3QH0A 1J8EA 3U7UG 1POOA 3Q6KA 1MOXC 5CISA 5F1AA 1F0RB 3V65B 4MMZB 2XBWL 2VVCK 1IQJL 3HO5A 2J95B 1G1QA 2W2ME 3LN1A 2IARA 4BXWA 4A7IA 2J34B 2IAWA 2FLRL 1NFYB 2XBVL 3M36L 3LTGD 3AMRA 2IAPA 2H9EL 1Z6CA 5GX5A 5EX7A 5I46L 4ISHL 5JB8E 5D9CA 3S2KA 1EPIA 1IQHL 1EBVA 2Y80B 2OYEP 3F6UL 4O02B 2W8BB 1U67A 2NPRA 4XL1A 1NT0A 3HPTA 2UWLB 4X8SL 1QFKL 3MDLA 2KB9A 2WYJB 4LMFA 1D2JA 2VH6B 3TH3L 1LPGA 2XC4L 1G2MB 1IQKL 3TC9A 1LMJA 1COUA 1XFEA 2F9BL 2KNXA 3ZYGA 3OLUA 4M10A 5GX4A 5IKTA 2I1PA 1FF7A 3SOVA 2P4OA 1L3YA 2KV4A 3FCSB 2W8BA 4ZLRA 4Z6AL 1KLOA 5JB9E 2VVVL 3NT1A 1IQNL 4PWZA 1YUKB 4DG6A 2Y5GL 3CA7A 2FYJA 5IKQA 1HX2A 1KIGL 1IQFL 1URKA 4XLWA 3Q7DA 1CQ1A 1EPHA 2EI8B 5EGMB 3DEMA 4JYUL 1IGXA 1MQ5L 4HW6A 4X8TL 1C9UA 4GN7A 3I1CA 5FWWA 2IVZA 5JBAE 1G1SA 1IP0A 5L2ZL 2J4IB
chains in the Genus database with same CATH superfamily
1C5KA 2WFXB 2QWAA 3CKZA 3Q6PA 2IAXA 4FM5A 4K1JA 2P28B 3NTGA 3OLTA 2XBYL 1KLIL 4OTJA 5KN5C 1PJXA 1P9JA 2VK7A 4ZXXL 2G8SA 3ELAL 1NCCN 4IMBA 2PR3B 2IAUA 4GZOA 4MWXA 4AH4A 2FZZL 5L30L 4COXA 2F13A 1Z4YA 4D52B 1FE2A 1U8CB 1IQEL 2P3TA 2WG3C 4IFLX 1L7HA 2C4LA 3NTBA 7NN9A 2XC5L 1EQGA 3V64C 1NMCA 1WCSA 3KK6A 3TIAA 2K2TA 1INHA 4GJTA 3HO4A 4X6KA 4LORA 1LPZA 2POOA 2BMGA 2HTVA 4FPOB 1MS1A 1NZIA 3OPZA 3GVJA 1UZQA 3NO0A 3K38A 3K36A 4NG9L 2WOZA 3GVLA 3INBA 4HZWA 2BQWA 2FCWB 2MGRA 4QN5A 5FZNA 4YT6L 5L2YL 4K1HA 2Y7XB 2XC0L 1C5MF 1S0JA 3EGFA 2VPJA 3A9GA 2P93L 1INFA 3B69A 4YZ1A 6NN9A 4ZGCA 1HREA 4H53A 2IAOA 5GX1A 2V91A 2ZW9A 3BEQA 4YW1A 2BZ6L 2P3FL 5COXA 4FPGA 2FLBL 4YT7L 3SREA 3N8YB 2RHPA 1S18A 3VNGA 1RFNB 4SLIA 5FNQA 1IVCA 2ZB6A 4YZ5A 4UOUA 1PTHA 3PGHA 3V1SA 4K3YA 3BT1A 2DSOA 2VK5A 4XMAA 3K39A 2GHSA 1N7DA 3TK6B 1Q7FA 1Z4XA 2P3FN 2QWGA 1EPGA 1SLLA 1IUCA 1LK9A 1F8DA 4IFNX 4M3MA 4L7BA 4GNCA 4NN9A 2FD6A 4BTUA 1IVGA 1EUUA 1JRFA 1ZAQA 3CFWA 1DIMA 1B9WA 4FPHA 1NNCA 2AEPA 2GVXA 3HLIA 1DX5I 2VJ3A 1LDRA 4RRXA 1IQLL 3CENL 1S1DA 3FW0A 1NSDA 1W21A 3O9KA 2VVZA 5EO8A 2M0PA 4IQKA 3ZYIB 4JYVL 4BDXA 2YA6A 1NCBN 4KS3A 2YGOA 4GZXA 1DVAL 3HS7A 4XMIA 2Q1JB 3KQCL 3HLHA 3N8WB 3K37A 4QN4A 5D9BA 4MC7A 4GNAA 3TI8A 1QIUA 3H72A 4GEZA 2QWFA 3LC5B 1JBUL 3BPSE 2F26A 4FPLA 4M11A 3ZYJB 4Y7AB 3LAQA 5GTQA 1TLEA 1UZKA 1WHEA 1NNAA 1HCGB 3SANA 4CUEA 2I9BA 3GCWE 2AEQA 1HT5A 1INGA 5GX2A 3O9JA 3SW2A 1V0FA 3KGGA 4MWLA 1NPEB 4M4VA 4ISIL 4BTTA 2Y38A 1KITA 4I00A 1PXXA 2H9EC 2BQ6A 2YDPA 4FQ4A 4QN6A 2Y81B 3LI3A 1NFUB 2WPKE 1H6LA 4XHXA 4R40A 2FLUX 3LN0A 4MJVA 1D2LA 3KQBL 2BQ7A 5JVZA 2IASA 4AGTA 3NN9A 4E1GA 1NSCA 2Y82B 1K7BA 4XJQA 2LGPA 4BXSA 1PFXL 4GNBA 4AHAA 2FYLB 4NC5A 2VVUL 4O1ZA 4X8UL 1NNBA 2SIMA 4D52C 4ZH8B 1YO8A 5JBCE 3A72A 2Y7ZB 2OJHA 1Z6EL 2HTRA 1G1TA 4NCSA 3NSSA 2H2UA 3S94A 1W20A 2UWOB 4MWRA 2IAQA 4XMBA 3KQDL 1NSBA 1I0UA 2W38A 4Q6KA 4ASCA 1LPKA 2BO2A 4JMLA 1LMMA 4IYGA 5NN9A 3TI3A 3CYEA 2JKHL 2BOUA 2SILA 3ENSA 3IJEB 2VAQA 4MZEA 3TI5A 4RUTA 4NGAL 4MZAA 2D1JB 3M37L 2F28A 6COXA 2RNLA 3TZIA 4CSYA 3N8VA 2F11A 2FPBA 2VSKA 2W2NE 2WPJE 2DG0A 1F8EA 1NFWB 2WPME 4GZWA 1NQLB 3KL6B 1V0EA 1N6DA 3LI5A 2BATA 3H5CB 1EMOA 5IKRA 1K32A 4G3NA 3GCXE 1CRZA 2VK6A 1EUSA 3S8VA 1V1HA 1MS4A 4D90A 4WA4A 3ZGDA 1XDTR 2F12A 1W0PA 1X2JA 4MMYB 2WG4B 2GD4A 1IVBA 2AH2A 4FP3A 3H6JA 4B7RA 3TIBA 1N6FA 4JZEL 3W09A 4M4NA 4A0PA 4RRYA 3SOBB 1ZI0A 2X9MA 3SALA 5JVYA 1MS5A 2JKBA 3K9XA 1N1VA 1V1IA 1HRFA 1IGZA 1Z4ZA 3G4HA 2RKCA 2H2NA 2DDUA 1FSBA 4FPCA 1HT8A 4YZ4A 5F72C 3WN7A 1NCDN 2AGSA 2XZKA 3G4EA 4YW3A 2KNYA 3N8YA 4FOWA 3QMOA 2W2OE 1WU1B 1B9SA 1LQDA 5CKNA 4HHOA 4FOYA 1EGFA 2CJIB 1W0OA 3CL2A 2HQSA 1ATDA 5HUGA 1Z4VA 4KS1A 3SRGA 1NFXB 2F25A 3HS6A 5IKVA 2VW1A 1PGEA 2WFTA 1Z50A 2IAVA 2QWDA 2WPIE 4RS0A 4B7QA 2VRSA 1CR8A 3A9HA 3H73A 4HZZA 2W26B 2QWKA 3HRPA 4MMXB 3VNHA 4ZHAB 4O5TA 4CH9A 4BTIA 1XKBA 2W20A 1INWA 1RWIA 2MGPA 1V04A 2BOHA 3RR3A 4FZHA 4QN7A 1P0SL 3KQEL 1AUTL 2EI7B 4FPYA 3L6VA 4J9TA 2F27A 4GDJA 2QWHA 2VSMA 4FVKA 5JW1A 2VW0A 4L7DA 1RWLA 2PHBB 3ADEA 1B9TA 1JV2B 5JBBE 4KS4A 2QWCA 1SO7A 4MX0A 4D0EA 4MWJA 4XIOA 4RRWA 4HHQA 3SOQA 3POYA 3LIWB 2QE8A 1YUGA 2YGQA 1A14N 2ZB5A 2Y5FL 1E8TA 4CPOA 2M7PA 2M74A 5JYYA 4BDWA 2HT8A 3Q6TA 4C1YB 5H47A 4YZUB 4FOQA 1IJQA 2BOKL 2BT7A 2EI6B 3WWAA 1HZ8A 1L7FA 1VCJA 1W1XA 1DQBA 1WCQA 2FHRA 5FDQA 4XOGA 4UF7A 3N8XA 1F0SB 4X8VL 1V3BA 3FBYA 1IVOC 1APOA 2HT5A 2P94L 3S6XA 1IOXA 2FP8A 2XBXL 4X49A 4G1MB 1CQEA 1Q4GA 1A4QA 1A3PA 1MWEA 1USXA 2BERA 2YA5A 3FFGL 3ALWA 4K1KA 2HOXA 1CCFA 5CKMA 3IAXA 1FAKL 1V0ZA 4C1YA 2Z32A 4GU3A 1MQ6L 4AGIA 3HS5A 3BYCA 2BOXA 4Y6DB 1HAFA 4XJ8A 5FZJA 2BZDA 1UZPA 4Z0LA 1CX2A 2OYUP 1NMBN 2YGPA 1L5GB 4FP2A 4B7JA 3SILA 2VWLL 3MQEA 4XJ9A 2ISMA 4CPNA 2FLGA 3B7EA 1CVWL 3ASIA 1G1RA 5CKQA 1L7GA 4JF7A 4A94C 2G00L 1IQGL 1IQIL 4L7CA 2W86A 4DGRA 4JZDL 4WA3A 3KRKA 4D4UA 5F9TA 1MS0A 4WEGA 4YW5A 2XCYA 3O4PA 4MWWA 2P26A 1W8NA 4KS2A 1F8CA 1YGCL 1E1AA 1PRHA 2J94B 4CPMA 2WYGB 1ATAA 1TPGA 3S8ZA 4ZXYL 3LTFB 1N1IA 1KKEA 4CSDA 2F24A 1CVMA 4JZFL 3DR2A 4FPKA 2IATA 4C16A 1INXA 1MS3A 2F10A 2W5NA 2JJLA 3H71A 3CS7L 4ZAEB 4GN9A 4IN4A 2FPCA 1DIYA 1ATBA 1W7XL 2UWPB 1HJ7A 1MS9A 4KS5A 1K36A 5E8DA 1F7MA 4PH9A 4NA9L 1EPJA 3Q3KB 1W8BL 4QN3A 3TK5B 4K1IA 1LDLA 1A4GA 4D0FA 3WW9A 3GVKA 3NJPC 3WDZA 2A75A 2WPLE 1EQHA 2TGFA 4GB1A 2VH0B 3IITB 1MS8A 3AMSA 2DYHA 5F19A 5B2CA 2QWEA 2VWMK 3LC3B 4Y79B 1F7EA 1KLJL 3P5BL 4Y76B 1J9CL 1BF9A 1SZBA 1WP5A 2P3UA 1F8BA 4MWUA 1U6DX 1XKAL 2W2QE 4GZQA 5CGJA 1NMAN 2VWOL 1USRA 3R05A 1DDXA 5HUMA 1G2LB 5KIRA 2J2UB 3C9AC 1APQA 1CRUA 2I9AA 1IVDA 4MWYA 2J38B 3F1SB 1MZ5A 4YZ2A 1N6EA 2GVVA 3U73A 3ALXA 1ATEA 2ZWAA 1UZJA 1VCUA 2GVWA 1KSNB 1ADXA 3D11A 1GK5A 2RA0L 4IFJA 4Q1UA 4QNPA 1JL9A 2YDTA 1DILA 3DASA 4N1BA 1N1YA 3E5ZA 1FFMA 1S0IA 1CEJA 2HT7A 4X47A 5EO7A 2W3KB 1EMNA 4CUDA 1E8UA 1EZQB 3N8ZA 1YUFA 1NN2A 2C4AA 1N1SA 3TGFA 4TGFA 2YA4A 4GN8A 1FJSL 4CUFA 2F0ZA 2FP9A 3FVZA 2VWNL 1CCVA 2P95L 2QWJA 2Y5HL 2WPHE 1M1XB 5D9DA 4CPZA 1OB1C 1IVEA 3TBDA 5HUNA 4WA5A 4BBWA 4FJ6A 5HX0A 4RRZA 5K0HB 3QCWA 3GISX 1ZGKA 1IQML 5FNUA 1X7AL 1MZ6A 4YW2A 5M1ZA 3A71A 1F5YA 4XJUA 4HZXA 1V3XB 4XIKA 4XE9A 1QBIA 1WHFA 2W3IB 2K2SB 2ADXA 1IOEL 2M96A 2W2PE 4O5SA 4WEFA 2F29A 2B7DL 4XBMA 4ZY3A 1BJIA 3LI4A 1QLGA 3KCGL 4GZPA 5HUKA 1K37A 4XJRA 1O5DL 1NPEA 2YA7A 1XOGA 3KYAA 2DG1A 3UC1A 2HTWA 1CVUA 1TOZA 2MHPA 3HO3A 2WZPP 2HTYA 4HZYA 2QWIA 5GX3A 2BT8A 3JU4A 2JM4A 2GVUA 2PUQL 2KL7A 2P16L 4MWVA 4Y7BB 1EAIC 3U0SA 3K3AA 2HU0A 2AYLA 2QWBA 4FOVA 2HTQA 5FNRA 4D52A 1FAXL 3BT2A 4OTYA 4AQTA 3N8WA 1HAEA 2XZIA 4Y71B 4GZSA 4Z0KB 3QH0A 1J8EA 4HIZA 3U7UG 4XILA 1POOA 3T1EA 3Q6KA 4HZVA 1MOXC 5CISA 5F1AA 2KNXA 1INYA 1F0RB 3V65B 4MMZB 3SLIA 1IVFA 2XBWL 2VVCK 1IQJL 1Z4WA 3HO5A 2J95B 1G1QA 2W2ME 3LN1A 2IARA 4BXWA 2W5OA 2SLIA 4A7IA 2B8HA 2J34B 2BF6A 2IAWA 2FLRL 1NFYB 3TICA 2XBVL 3M36L 1OFZA 2HTUA 3LTGD 1B9VA 3AMRA 4FPFA 2IAPA 1V3EA 2H9EL 3ZGCA 4M4UA 1Z6CA 5GX5A 4CPLA 5EX7A 4CHBA 5I46L 4XYXA 4ISHL 1V2IA 5JB8E 4YW4A 5D9CA 3S2KA 1EPIA 1IQHL 1X2RA 4GDIA 5FNSA 4YY8A 1EBVA 1N1TA 2Y80B 2OYEP 3F6UL 2HU4A 4O02B 3CL0A 2W8BB 1U67A 1SUUA 2CMLA 4X4AA 2NPRA 4XL1A 3TI6A 1NT0A 3PJQA 2XN4A 3HPTA 2UWLB 4X8SL 3II7A 1QFKL 3MDLA 2KB9A 2HORA 2WYJB 4LMFA 4XJZA 1INVA 4B7NA 1D2JA 2VH6B 1EURA 3TH3L 1LPGA 4XHBA 2XC4L 1G2MB 1IQKL 4FPJA 1LMJA 2YA8A 1EUTA 1COUA 1XFEA 2F9BL 3TC9A 3ZYGA 5B2DA 3OLUA 4M10A 1XOEA 5IKTA 5GX4A 2I1PA 1FF7A 3TI4A 3SOVA 2P4OA 1L3YA 2KV4A 4FPEA 3FCSB 2W8BA 4ZLRA 1NCAN 4Z6AL 1E8VA 1W8OA 4H52A 4YZ3A 1KLOA 5JB9E 2VVVL 3NT1A 1MR5A 1IQNL 1V3CA 1YUKB 4PWZA 5FNTA 4B7MA 4DG6A 2Y5GL 3CA7A 1V3DA 2FYJA 4XJWA 5IKQA 1HX2A 2VWDA 4GU4A 1KIGL 4MWQA 1IQFL 1URKA 2VW2A 4XLWA 3Q7DA 2XZJA 4XJAA 1CQ1A 2BSFA 1EPHA 2EI8B 5EGMB 3DEMA 4MJUA 4JYUL 1IGXA 1MQ5L 4GZTA 4HW6A 1SNTA 4X8TL 1SLIA 2ZZKA 4CPYA 1C9UA 4GN7A 3I1CA 5FWWA 1IUBA 2KNIA 2IVZA 3D12A 5JBAE 1G1SA 1IP0A 4D8SA 5L2ZL 2J4IB
chains in the Genus database with same CATH topology
1C5KA 2WFXB 3Q6PA 2IAXA 4FM5A 2P28B 3NTGA 3OLTA 2XBYL 1KLIL 4OTJA 5KN5C 1PJXA 1P9JA 4ZXXL 2G8SA 3ELAL 4IMBA 2PR3B 2IAUA 2FZZL 5L30L 4COXA 1FE2A 1U8CB 1IQEL 2P3TA 2WG3C 3NTBA 2XC5L 1EQGA 3V64C 3KK6A 2K2TA 3HO4A 4LORA 1LPZA 2POOA 2BMGA 1NZIA 1UZQA 4NG9L 2BQWA 2FCWB 2MGRA 4YT6L 5L2YL 2Y7XB 2XC0L 1C5MF 3EGFA 3A9GA 2P93L 1HREA 2IAOA 5GX1A 2V91A 2BZ6L 2P3FL 5COXA 2FLBL 4YT7L 3N8YB 2RHPA 1RFNB 1PTHA 3PGHA 3V1SA 3BT1A 2DSOA 2GHSA 1N7DA 3TK6B 1Q7FA 2P3FN 1EPGA 4GNCA 2FD6A 4BTUA 1JRFA 1ZAQA 3CFWA 1B9WA 2GVXA 3HLIA 1DX5I 2VJ3A 1LDRA 4RRXA 1IQLL 3CENL 3FW0A 2M0PA 3ZYIB 4JYVL 4BDXA 2YGOA 1DVAL 3HS7A 2Q1JB 3KQCL 3HLHA 3N8WB 5D9BA 4GNAA 3LC5B 1JBUL 3BPSE 4M11A 3ZYJB 4Y7AB 3LAQA 5GTQA 1TLEA 1UZKA 1WHEA 1HCGB 4CUEA 2I9BA 3GCWE 1HT5A 5GX2A 3SW2A 3KGGA 1NPEB 4ISIL 4BTTA 2Y38A 1PXXA 2H9EC 2BQ6A 2Y81B 3LI3A 1NFUB 2WPKE 1H6LA 4R40A 3LN0A 1D2LA 3KQBL 2BQ7A 5JVZA 2IASA 4E1GA 2Y82B 1K7BA 2LGPA 4BXSA 1PFXL 4GNBA 2FYLB 2VVUL 4O1ZA 4X8UL 4ZH8B 1YO8A 5JBCE 2Y7ZB 2OJHA 1Z6EL 1G1TA 3S94A 2UWOB 2IAQA 3KQDL 1I0UA 1LPKA 2BO2A 4JMLA 1LMMA 4IYGA 2JKHL 2BOUA 3ENSA 3IJEB 2VAQA 4RUTA 4NGAL 2D1JB 3M37L 6COXA 2RNLA 3TZIA 4CSYA 3N8VA 2FPBA 2W2NE 2WPJE 2DG0A 1NFWB 2WPME 1NQLB 3KL6B 3LI5A 3H5CB 1EMOA 5IKRA 3S8VA 3GCXE 1CRZA 4D90A 1XDTR 4MMYB 2WG4B 2GD4A 4JZEL 4A0PA 4RRYA 3SOBB 5JVYA 3K9XA 1HRFA 1IGZA 3G4HA 2DDUA 1FSBA 1HT8A 3G4EA 2KNYA 3N8YA 3QMOA 2W2OE 1WU1B 1LQDA 5CKNA 4HHOA 1EGFA 2CJIB 2HQSA 1ATDA 3SRGA 1NFXB 3HS6A 5IKVA 1PGEA 2WFTA 2IAVA 2WPIE 4RS0A 1CR8A 3A9HA 2W26B 3HRPA 4MMXB 4ZHAB 4O5TA 4BTIA 1XKBA 1RWIA 2MGPA 1V04A 2BOHA 3RR3A 1P0SL 3KQEL 1AUTL 2EI7B 5JW1A 1RWLA 2PHBB 1JV2B 5JBBE 4D0EA 4RRWA 4HHQA 3SOQA 3POYA 3LIWB 2QE8A 1YUGA 2YGQA 2Y5FL 2M7PA 2M74A 4BDWA 3Q6TA 4YZUB 1IJQA 2BOKL 2EI6B 3WWAA 1HZ8A 1DQBA 5FDQA 3N8XA 1F0SB 4X8VL 3FBYA 1IVOC 1APOA 3SREA 2P94L 3S6XA 1IOXA 2FP8A 2XBXL 4G1MB 1CQEA 1Q4GA 1A3PA 3FFGL 1CCFA 5CKMA 3IAXA 1FAKL 1MQ6L 3HS5A 3BYCA 2BOXA 4Y6DB 1HAFA 1UZPA 4Z0LA 1CX2A 2OYUP 2YGPA 1L5GB 2VWLL 3MQEA 2ISMA 2FLGA 1CVWL 3ASIA 1G1RA 5CKQA 4A94C 2G00L 1IQGL 1IQIL 2W86A 4JZDL 3KRKA 3O4PA 2P26A 1YGCL 1E1AA 1PRHA 2J94B 2WYGB 1ATAA 1TPGA 3S8ZA 4ZXYL 3LTFB 1N1IA 1CVMA 4JZFL 3DR2A 2IATA 4C16A 4GN9A 3CS7L 4ZAEB 2FPCA 1DIYA 1ATBA 1W7XL 2UWPB 1HJ7A 1K36A 5E8DA 1F7MA 4PH9A 4NA9L 1EPJA 3Q3KB 1W8BL 3TK5B 1LDLA 4D0FA 3WW9A 3NJPC 2WPLE 1EQHA 2TGFA 2VH0B 3IITB 3AMSA 5F19A 2VWMK 3LC3B 4Y79B 1F7EA 1KLJL 3P5BL 4Y76B 1J9CL 1BF9A 1SZBA 2P3UA 1XKAL 2W2QE 2VWOL 3R05A 1DDXA 1G2LB 5KIRA 2J2UB 3C9AC 1APQA 1CRUA 2I9AA 2J38B 3F1SB 2GVVA 3U73A 1ATEA 1UZJA 2GVWA 1KSNB 1ADXA 1GK5A 2RA0L 4Q1UA 1JL9A 3DASA 3E5ZA 1FFMA 1CEJA 2W3KB 1EMNA 4CUDA 1EZQB 3N8ZA 1YUFA 3TGFA 4TGFA 4GN8A 1FJSL 4CUFA 2FP9A 3FVZA 2VWNL 1CCVA 2P95L 2Y5HL 2WPHE 1M1XB 5D9DA 1OB1C 3TBDA 4RRZA 5K0HB 3QCWA 3GISX 1IQML 1X7AL 1F5YA 1V3XB 1QBIA 1WHFA 2W3IB 2K2SB 2ADXA 1IOEL 2M96A 2W2PE 4O5SA 2B7DL 4XBMA 3LI4A 1QLGA 3KCGL 1K37A 1O5DL 1NPEA 3KYAA 2DG1A 1CVUA 1TOZA 2MHPA 3HO3A 2WZPP 5GX3A 2JM4A 2GVUA 2PUQL 2KL7A 2P16L 4Y7BB 1EAIC 3U0SA 2AYLA 1FAXL 3BT2A 4OTYA 4AQTA 3N8WA 1HAEA 4Y71B 4Z0KB 3QH0A 1J8EA 3U7UG 1POOA 3Q6KA 1MOXC 5CISA 5F1AA 1F0RB 3V65B 4MMZB 2XBWL 2VVCK 1IQJL 3HO5A 2J95B 1G1QA 2W2ME 3LN1A 2IARA 4BXWA 4A7IA 2J34B 2IAWA 2FLRL 1NFYB 2XBVL 3M36L 3LTGD 3AMRA 2IAPA 2H9EL 1Z6CA 5GX5A 5EX7A 5I46L 4ISHL 5JB8E 5D9CA 3S2KA 1EPIA 1IQHL 1EBVA 2Y80B 2OYEP 3F6UL 4O02B 2W8BB 1U67A 2NPRA 4XL1A 1NT0A 3HPTA 2UWLB 4X8SL 1QFKL 3MDLA 2KB9A 2WYJB 4LMFA 1D2JA 2VH6B 3TH3L 1LPGA 2XC4L 1G2MB 1IQKL 3TC9A 1LMJA 1COUA 1XFEA 2F9BL 2KNXA 3ZYGA 3OLUA 4M10A 5GX4A 5IKTA 2I1PA 1FF7A 3SOVA 2P4OA 1L3YA 2KV4A 3FCSB 2W8BA 4ZLRA 4Z6AL 1KLOA 5JB9E 2VVVL 3NT1A 1IQNL 4PWZA 1YUKB 4DG6A 2Y5GL 3CA7A 2FYJA 5IKQA 1HX2A 1KIGL 1IQFL 1URKA 4XLWA 3Q7DA 1CQ1A 1EPHA 2EI8B 5EGMB 3DEMA 4JYUL 1IGXA 1MQ5L 4HW6A 4X8TL 1C9UA 4GN7A 3I1CA 5FWWA 2KNIA 2IVZA 5JBAE 1G1SA 1IP0A 5L2ZL 2J4IB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1C5K A;  2WFX B;  3Q6P A;  2IAX A;  4FM5 A;  2P28 B;  3NTG A;  3OLT A;  2XBY L;  1KLI L;  4OTJ A;  5KN5 C;  1PJX A;  1P9J A;  4ZXX L;  2G8S A;  3ELA L;  4IMB A;  2PR3 B;  2IAU A;  2FZZ L;  5L30 L;  4COX A;  1FE2 A;  1U8C B;  1IQE L;  2P3T A;  2WG3 C;  3NTB A;  2XC5 L;  1EQG A;  3V64 C;  3KK6 A;  2K2T A;  3HO4 A;  4LOR A;  1LPZ A;  2POO A;  2BMG A;  1NZI A;  1UZQ A;  4NG9 L;  2BQW A;  2FCW B;  2MGR A;  4YT6 L;  5L2Y L;  2Y7X B;  2XC0 L;  1C5M F;  3EGF A;  3A9G A;  2P93 L;  1HRE A;  2IAO A;  5GX1 A;  2V91 A;  2BZ6 L;  2P3F L;  5COX A;  2FLB L;  4YT7 L;  3N8Y B;  2RHP A;  1RFN B;  1PTH A;  3PGH A;  3V1S A;  3BT1 A;  2DSO A;  2GHS A;  1N7D A;  3TK6 B;  1Q7F A;  2P3F N;  1EPG A;  4GNC A;  2FD6 A;  4BTU A;  1JRF A;  1ZAQ A;  3CFW A;  1B9W A;  2GVX A;  3HLI A;  1DX5 I;  2VJ3 A;  1LDR A;  4RRX A;  1IQL L;  3CEN L;  3FW0 A;  2M0P A;  3ZYI B;  4JYV L;  4BDX A;  2YGO A;  1DVA L;  3HS7 A;  2Q1J B;  3KQC L;  3HLH A;  3N8W B;  5D9B A;  4GNA A;  3LC5 B;  1JBU L;  3BPS E;  4M11 A;  3ZYJ B;  4Y7A B;  3LAQ A;  5GTQ A;  1TLE A;  1UZK A;  1WHE A;  1HCG B;  4CUE A;  2I9B A;  3GCW E;  1HT5 A;  5GX2 A;  3SW2 A;  3KGG A;  1NPE B;  4ISI L;  4BTT A;  2Y38 A;  1PXX A;  2BQ6 A;  2Y81 B;  3LI3 A;  1NFU B;  2WPK E;  1H6L A;  4R40 A;  3LN0 A;  1D2L A;  3KQB L;  2BQ7 A;  5JVZ A;  2IAS A;  4E1G A;  2Y82 B;  1K7B A;  2LGP A;  4BXS A;  1PFX L;  4GNB A;  2FYL B;  2VVU L;  4O1Z A;  4X8U L;  4ZH8 B;  1YO8 A;  5JBC E;  2Y7Z B;  2OJH A;  1Z6E L;  1G1T A;  3S94 A;  2UWO B;  2IAQ A;  3KQD L;  1I0U A;  1LPK A;  2BO2 A;  4JML A;  4IYG A;  2JKH L;  2BOU A;  3ENS A;  3IJE B;  2VAQ A;  4RUT A;  4NGA L;  2D1J B;  3M37 L;  6COX A;  2RNL A;  3TZI A;  4CSY A;  3N8V A;  2FPB A;  2W2N E;  2WPJ E;  2DG0 A;  1NFW B;  2WPM E;  1NQL B;  3KL6 B;  3LI5 A;  3H5C B;  1EMO A;  5IKR A;  3S8V A;  3GCX E;  1CRZ A;  4D90 A;  1XDT R;  4MMY B;  2WG4 B;  2GD4 A;  4JZE L;  4A0P A;  4RRY A;  3SOB B;  5JVY A;  3K9X A;  1HRF A;  1IGZ A;  3G4H A;  2DDU A;  1FSB A;  1HT8 A;  3G4E A;  2KNY A;  3N8Y A;  3QMO A;  2W2O E;  1WU1 B;  1LQD A;  5CKN A;  4HHO A;  1EGF A;  2CJI B;  2HQS A;  1ATD A;  3SRG A;  1NFX B;  3HS6 A;  5IKV A;  1PGE A;  2WFT A;  2IAV A;  2WPI E;  4RS0 A;  1CR8 A;  3A9H A;  2W26 B;  3HRP A;  4MMX B;  4ZHA B;  4O5T A;  4BTI A;  1XKB A;  1RWI A;  2MGP A;  1V04 A;  2BOH A;  3RR3 A;  1P0S L;  3KQE L;  1AUT L;  2EI7 B;  5JW1 A;  1RWL A;  2PHB B;  1JV2 B;  5JBB E;  4D0E A;  4RRW A;  4HHQ A;  3SOQ A;  3POY A;  3LIW B;  2QE8 A;  1YUG A;  2Y5F L;  2M7P A;  2M74 A;  4BDW A;  3Q6T A;  4YZU B;  1IJQ A;  2BOK L;  2EI6 B;  3WWA A;  1HZ8 A;  1DQB A;  5FDQ A;  3N8X A;  1F0S B;  4X8V L;  3FBY A;  1IVO C;  1APO A;  3SRE A;  2P94 L;  1IOX A;  2FP8 A;  2XBX L;  4G1M B;  1CQE A;  1Q4G A;  1A3P A;  3FFG L;  1CCF A;  5CKM A;  3IAX A;  1FAK L;  1MQ6 L;  3HS5 A;  3BYC A;  2BOX A;  4Y6D B;  1HAF A;  1UZP A;  4Z0L A;  1CX2 A;  2OYU P;  2YGP A;  1L5G B;  2VWL L;  3MQE A;  2ISM A;  2FLG A;  1CVW L;  3ASI A;  1G1R A;  5CKQ A;  2G00 L;  1IQG L;  1IQI L;  2W86 A;  4JZD L;  3KRK A;  3O4P A;  2P26 A;  1YGC L;  1E1A A;  1PRH A;  2J94 B;  2WYG B;  1ATA A;  1TPG A;  3S8Z A;  4ZXY L;  3LTF B;  1N1I A;  1CVM A;  4JZF L;  3DR2 A;  2IAT A;  4C16 A;  4GN9 A;  3CS7 L;  4ZAE B;  2FPC A;  1DIY A;  1ATB A;  1W7X L;  2UWP B;  1HJ7 A;  1K36 A;  5E8D A;  1F7M A;  4PH9 A;  4NA9 L;  1EPJ A;  3Q3K B;  1W8B L;  3TK5 B;  1LDL A;  4D0F A;  3WW9 A;  3NJP C;  2WPL E;  1EQH A;  2TGF A;  2VH0 B;  3IIT B;  3AMS A;  5F19 A;  2VWM K;  3LC3 B;  4Y79 B;  1F7E A;  1KLJ L;  3P5B L;  4Y76 B;  1J9C L;  1BF9 A;  1SZB A;  2P3U A;  1XKA L;  2W2Q E;  2VWO L;  3R05 A;  1DDX A;  1G2L B;  5KIR A;  2J2U B;  3C9A C;  1APQ A;  1CRU A;  2I9A A;  2J38 B;  3F1S B;  2GVV A;  3U73 A;  1ATE A;  1UZJ A;  2GVW A;  1KSN B;  1ADX A;  1GK5 A;  2RA0 L;  4Q1U A;  1JL9 A;  3DAS A;  3E5Z A;  1FFM A;  1CEJ A;  2W3K B;  1EMN A;  4CUD A;  1EZQ B;  3N8Z A;  1YUF A;  3TGF A;  4TGF A;  4GN8 A;  1FJS L;  4CUF A;  2FP9 A;  3FVZ A;  2VWN L;  1CCV A;  2P95 L;  2Y5H L;  2WPH E;  1M1X B;  5D9D A;  1OB1 C;  3TBD A;  4RRZ A;  5K0H B;  3QCW A;  3GIS X;  1IQM L;  1X7A L;  1F5Y A;  1V3X B;  1QBI A;  1WHF A;  2W3I B;  2K2S B;  2ADX A;  1IOE L;  2M96 A;  2W2P E;  4O5S A;  2B7D L;  4XBM A;  3LI4 A;  1QLG A;  3KCG L;  1K37 A;  1O5D L;  1NPE A;  3KYA A;  2DG1 A;  1CVU A;  1TOZ A;  2MHP A;  3HO3 A;  5GX3 A;  2JM4 A;  2GVU A;  2PUQ L;  2KL7 A;  2P16 L;  4Y7B B;  1EAI C;  3U0S A;  2AYL A;  1FAX L;  3BT2 A;  4OTY A;  4AQT A;  3N8W A;  1HAE A;  4Y71 B;  4Z0K B;  3QH0 A;  1J8E A;  3U7U G;  1POO A;  3Q6K A;  1MOX C;  5CIS A;  5F1A A;  1F0R B;  3V65 B;  4MMZ B;  2XBW L;  2VVC K;  1IQJ L;  3HO5 A;  2J95 B;  1G1Q A;  2W2M E;  3LN1 A;  2IAR A;  4BXW A;  4A7I A;  2J34 B;  2IAW A;  2FLR L;  1NFY B;  2XBV L;  3M36 L;  3LTG D;  3AMR A;  2IAP A;  2H9E L;  1Z6C A;  5GX5 A;  5EX7 A;  5I46 L;  4ISH L;  5JB8 E;  5D9C A;  3S2K A;  1EPI A;  1IQH L;  1EBV A;  2Y80 B;  2OYE P;  3F6U L;  4O02 B;  2W8B B;  1U67 A;  2NPR A;  4XL1 A;  1NT0 A;  3HPT A;  2UWL B;  4X8S L;  1QFK L;  3MDL A;  2KB9 A;  2WYJ B;  4LMF A;  1D2J A;  2VH6 B;  3TH3 L;  1LPG A;  2XC4 L;  1G2M B;  1IQK L;  3TC9 A;  1LMJ A;  1COU A;  1XFE A;  2F9B L;  2KNX A;  3ZYG A;  3OLU A;  4M10 A;  5GX4 A;  5IKT A;  2I1P A;  1FF7 A;  3SOV A;  2P4O A;  1L3Y A;  2KV4 A;  3FCS B;  2W8B A;  4ZLR A;  4Z6A L;  1KLO A;  5JB9 E;  2VVV L;  3NT1 A;  1IQN L;  4PWZ A;  1YUK B;  4DG6 A;  2Y5G L;  3CA7 A;  2FYJ A;  5IKQ A;  1HX2 A;  1KIG L;  1IQF L;  1URK A;  4XLW A;  3Q7D A;  1CQ1 A;  1EPH A;  2EI8 B;  5EGM B;  3DEM A;  4JYU L;  1IGX A;  1MQ5 L;  4HW6 A;  4X8T L;  1C9U A;  4GN7 A;  3I1C A;  5FWW A;  2IVZ A;  5JBA E;  1G1S A;  1IP0 A;  5L2Z L;  2J4I B; 
#chains in the Genus database with same CATH topology
 1C5K A;  2WFX B;  2QWA A;  3CKZ A;  3Q6P A;  2IAX A;  4FM5 A;  4K1J A;  2P28 B;  3NTG A;  3OLT A;  2XBY L;  1KLI L;  4OTJ A;  5KN5 C;  1PJX A;  1P9J A;  2VK7 A;  4ZXX L;  2G8S A;  3ELA L;  1NCC N;  4IMB A;  2PR3 B;  2IAU A;  4GZO A;  4MWX A;  4AH4 A;  2FZZ L;  5L30 L;  4COX A;  2F13 A;  1Z4Y A;  4D52 B;  1FE2 A;  1U8C B;  1IQE L;  2P3T A;  2WG3 C;  4IFL X;  1L7H A;  2C4L A;  3NTB A;  7NN9 A;  2XC5 L;  1EQG A;  3V64 C;  1NMC A;  1WCS A;  3KK6 A;  3TIA A;  2K2T A;  1INH A;  4GJT A;  3HO4 A;  4X6K A;  4LOR A;  1LPZ A;  2POO A;  2BMG A;  2HTV A;  4FPO B;  1MS1 A;  1NZI A;  3OPZ A;  3GVJ A;  1UZQ A;  3NO0 A;  3K38 A;  3K36 A;  4NG9 L;  2WOZ A;  3GVL A;  3INB A;  4HZW A;  2BQW A;  2FCW B;  2MGR A;  4QN5 A;  5FZN A;  4YT6 L;  5L2Y L;  4K1H A;  2Y7X B;  2XC0 L;  1C5M F;  1S0J A;  3EGF A;  2VPJ A;  3A9G A;  2P93 L;  1INF A;  3B69 A;  4YZ1 A;  6NN9 A;  4ZGC A;  1HRE A;  4H53 A;  2IAO A;  5GX1 A;  2V91 A;  2ZW9 A;  3BEQ A;  4YW1 A;  2BZ6 L;  2P3F L;  5COX A;  4FPG A;  2FLB L;  4YT7 L;  3SRE A;  3N8Y B;  2RHP A;  1S18 A;  3VNG A;  1RFN B;  4SLI A;  5FNQ A;  1IVC A;  2ZB6 A;  4YZ5 A;  4UOU A;  1PTH A;  3PGH A;  3V1S A;  4K3Y A;  3BT1 A;  2DSO A;  2VK5 A;  4XMA A;  3K39 A;  2GHS A;  1N7D A;  3TK6 B;  1Q7F A;  1Z4X A;  2P3F N;  2QWG A;  1EPG A;  1SLL A;  1IUC A;  1LK9 A;  1F8D A;  4IFN X;  4M3M A;  4L7B A;  4GNC A;  4NN9 A;  2FD6 A;  4BTU A;  1IVG A;  1EUU A;  1JRF A;  1ZAQ A;  3CFW A;  1DIM A;  1B9W A;  4FPH A;  1NNC A;  2AEP A;  2GVX A;  3HLI A;  1DX5 I;  2VJ3 A;  1LDR A;  4RRX A;  1IQL L;  3CEN L;  1S1D A;  3FW0 A;  1NSD A;  1W21 A;  3O9K A;  2VVZ A;  5EO8 A;  2M0P A;  4IQK A;  3ZYI B;  4JYV L;  4BDX A;  2YA6 A;  1NCB N;  4KS3 A;  2YGO A;  4GZX A;  1DVA L;  3HS7 A;  4XMI A;  2Q1J B;  3KQC L;  3HLH A;  3N8W B;  3K37 A;  4QN4 A;  5D9B A;  4MC7 A;  4GNA A;  3TI8 A;  1QIU A;  3H72 A;  4GEZ A;  2QWF A;  3LC5 B;  1JBU L;  3BPS E;  2F26 A;  4FPL A;  4M11 A;  3ZYJ B;  4Y7A B;  3LAQ A;  5GTQ A;  1TLE A;  1UZK A;  1WHE A;  1NNA A;  1HCG B;  3SAN A;  4CUE A;  2I9B A;  3GCW E;  2AEQ A;  1HT5 A;  1ING A;  5GX2 A;  3O9J A;  3SW2 A;  1V0F A;  3KGG A;  4MWL A;  1NPE B;  4M4V A;  4ISI L;  4BTT A;  2Y38 A;  1KIT A;  4I00 A;  1PXX A;  2H9E C;  2BQ6 A;  2YDP A;  4FQ4 A;  4QN6 A;  2Y81 B;  3LI3 A;  1NFU B;  2WPK E;  1H6L A;  4XHX A;  4R40 A;  2FLU X;  3LN0 A;  4MJV A;  1D2L A;  3KQB L;  2BQ7 A;  5JVZ A;  2IAS A;  4AGT A;  3NN9 A;  4E1G A;  1NSC A;  2Y82 B;  1K7B A;  4XJQ A;  2LGP A;  4BXS A;  1PFX L;  4GNB A;  4AHA A;  2FYL B;  4NC5 A;  2VVU L;  4O1Z A;  4X8U L;  1NNB A;  2SIM A;  4D52 C;  4ZH8 B;  1YO8 A;  5JBC E;  3A72 A;  2Y7Z B;  2OJH A;  1Z6E L;  2HTR A;  1G1T A;  4NCS A;  3NSS A;  2H2U A;  3S94 A;  1W20 A;  2UWO B;  4MWR A;  2IAQ A;  4XMB A;  3KQD L;  1NSB A;  1I0U A;  2W38 A;  4Q6K A;  4ASC A;  1LPK A;  2BO2 A;  4JML A;  1LMM A;  4IYG A;  5NN9 A;  3TI3 A;  3CYE A;  2JKH L;  2BOU A;  2SIL A;  3ENS A;  3IJE B;  2VAQ A;  4MZE A;  3TI5 A;  4RUT A;  4NGA L;  4MZA A;  2D1J B;  3M37 L;  2F28 A;  6COX A;  2RNL A;  3TZI A;  4CSY A;  3N8V A;  2F11 A;  2FPB A;  2VSK A;  2W2N E;  2WPJ E;  2DG0 A;  1F8E A;  1NFW B;  2WPM E;  4GZW A;  1NQL B;  3KL6 B;  1V0E A;  1N6D A;  3LI5 A;  2BAT A;  3H5C B;  1EMO A;  5IKR A;  1K32 A;  4G3N A;  3GCX E;  1CRZ A;  2VK6 A;  1EUS A;  3S8V A;  1V1H A;  1MS4 A;  4D90 A;  4WA4 A;  3ZGD A;  1XDT R;  2F12 A;  1W0P A;  1X2J A;  4MMY B;  2WG4 B;  2GD4 A;  1IVB A;  2AH2 A;  4FP3 A;  3H6J A;  4B7R A;  3TIB A;  1N6F A;  4JZE L;  3W09 A;  4M4N A;  4A0P A;  4RRY A;  3SOB B;  1ZI0 A;  2X9M A;  3SAL A;  5JVY A;  1MS5 A;  2JKB A;  3K9X A;  1N1V A;  1V1I A;  1HRF A;  1IGZ A;  1Z4Z A;  3G4H A;  2RKC A;  2H2N A;  2DDU A;  1FSB A;  4FPC A;  1HT8 A;  4YZ4 A;  5F72 C;  3WN7 A;  1NCD N;  2AGS A;  2XZK A;  3G4E A;  4YW3 A;  2KNY A;  3N8Y A;  4FOW A;  3QMO A;  2W2O E;  1WU1 B;  1B9S A;  1LQD A;  5CKN A;  4HHO A;  4FOY A;  1EGF A;  2CJI B;  1W0O A;  3CL2 A;  2HQS A;  1ATD A;  5HUG A;  1Z4V A;  4KS1 A;  3SRG A;  1NFX B;  2F25 A;  3HS6 A;  5IKV A;  2VW1 A;  1PGE A;  2WFT A;  1Z50 A;  2IAV A;  2QWD A;  2WPI E;  4RS0 A;  4B7Q A;  2VRS A;  1CR8 A;  3A9H A;  3H73 A;  4HZZ A;  2W26 B;  2QWK A;  3HRP A;  4MMX B;  3VNH A;  4ZHA B;  4O5T A;  4CH9 A;  4BTI A;  1XKB A;  2W20 A;  1INW A;  1RWI A;  2MGP A;  1V04 A;  2BOH A;  3RR3 A;  4FZH A;  4QN7 A;  1P0S L;  3KQE L;  1AUT L;  2EI7 B;  4FPY A;  3L6V A;  4J9T A;  2F27 A;  4GDJ A;  2QWH A;  2VSM A;  4FVK A;  5JW1 A;  2VW0 A;  4L7D A;  1RWL A;  2PHB B;  3ADE A;  1B9T A;  1JV2 B;  5JBB E;  4KS4 A;  2QWC A;  1SO7 A;  4MX0 A;  4D0E A;  4MWJ A;  4XIO A;  4RRW A;  4HHQ A;  3SOQ A;  3POY A;  3LIW B;  2QE8 A;  1YUG A;  2YGQ A;  1A14 N;  2ZB5 A;  2Y5F L;  1E8T A;  4CPO A;  2M7P A;  2M74 A;  5JYY A;  4BDW A;  2HT8 A;  3Q6T A;  4C1Y B;  5H47 A;  4YZU B;  4FOQ A;  1IJQ A;  2BOK L;  2BT7 A;  2EI6 B;  3WWA A;  1HZ8 A;  1L7F A;  1VCJ A;  1W1X A;  1DQB A;  1WCQ A;  2FHR A;  5FDQ A;  4XOG A;  4UF7 A;  3N8X A;  1F0S B;  4X8V L;  1V3B A;  3FBY A;  1IVO C;  1APO A;  2HT5 A;  2P94 L;  3S6X A;  1IOX A;  2FP8 A;  2XBX L;  4X49 A;  4G1M B;  1CQE A;  1Q4G A;  1A4Q A;  1A3P A;  1MWE A;  1USX A;  2BER A;  2YA5 A;  3FFG L;  3ALW A;  4K1K A;  2HOX A;  1CCF A;  5CKM A;  3IAX A;  1FAK L;  1V0Z A;  4C1Y A;  2Z32 A;  4GU3 A;  1MQ6 L;  4AGI A;  3HS5 A;  3BYC A;  2BOX A;  4Y6D B;  1HAF A;  4XJ8 A;  5FZJ A;  2BZD A;  1UZP A;  4Z0L A;  1CX2 A;  2OYU P;  1NMB N;  2YGP A;  1L5G B;  4FP2 A;  4B7J A;  3SIL A;  2VWL L;  3MQE A;  4XJ9 A;  2ISM A;  4CPN A;  2FLG A;  3B7E A;  1CVW L;  3ASI A;  1G1R A;  5CKQ A;  1L7G A;  4JF7 A;  4A94 C;  2G00 L;  1IQG L;  1IQI L;  4L7C A;  2W86 A;  4DGR A;  4JZD L;  4WA3 A;  3KRK A;  4D4U A;  5F9T A;  1MS0 A;  4WEG A;  4YW5 A;  2XCY A;  3O4P A;  4MWW A;  2P26 A;  1W8N A;  4KS2 A;  1F8C A;  1YGC L;  1E1A A;  1PRH A;  2J94 B;  4CPM A;  2WYG B;  1ATA A;  1TPG A;  3S8Z A;  4ZXY L;  3LTF B;  1N1I A;  1KKE A;  4CSD A;  2F24 A;  1CVM A;  4JZF L;  3DR2 A;  4FPK A;  2IAT A;  4C16 A;  1INX A;  1MS3 A;  2F10 A;  2W5N A;  2JJL A;  3H71 A;  3CS7 L;  4ZAE B;  4GN9 A;  4IN4 A;  2FPC A;  1DIY A;  1ATB A;  1W7X L;  2UWP B;  1HJ7 A;  1MS9 A;  4KS5 A;  1K36 A;  5E8D A;  1F7M A;  4PH9 A;  4NA9 L;  1EPJ A;  3Q3K B;  1W8B L;  4QN3 A;  3TK5 B;  4K1I A;  1LDL A;  1A4G A;  4D0F A;  3WW9 A;  3GVK A;  3NJP C;  3WDZ A;  2A75 A;  2WPL E;  1EQH A;  2TGF A;  4GB1 A;  2VH0 B;  3IIT B;  1MS8 A;  3AMS A;  2DYH A;  5F19 A;  5B2C A;  2QWE A;  2VWM K;  3LC3 B;  4Y79 B;  1F7E A;  1KLJ L;  3P5B L;  4Y76 B;  1J9C L;  1BF9 A;  1SZB A;  1WP5 A;  2P3U A;  1F8B A;  4MWU A;  1U6D X;  1XKA L;  2W2Q E;  4GZQ A;  5CGJ A;  1NMA N;  2VWO L;  1USR A;  3R05 A;  1DDX A;  5HUM A;  1G2L B;  5KIR A;  2J2U B;  3C9A C;  1APQ A;  1CRU A;  2I9A A;  1IVD A;  4MWY A;  2J38 B;  3F1S B;  1MZ5 A;  4YZ2 A;  1N6E A;  2GVV A;  3U73 A;  3ALX A;  1ATE A;  2ZWA A;  1UZJ A;  1VCU A;  2GVW A;  1KSN B;  1ADX A;  3D11 A;  1GK5 A;  2RA0 L;  4IFJ A;  4Q1U A;  4QNP A;  1JL9 A;  2YDT A;  1DIL A;  3DAS A;  4N1B A;  1N1Y A;  3E5Z A;  1FFM A;  1S0I A;  1CEJ A;  2HT7 A;  4X47 A;  5EO7 A;  2W3K B;  1EMN A;  4CUD A;  1E8U A;  1EZQ B;  3N8Z A;  1YUF A;  1NN2 A;  2C4A A;  1N1S A;  3TGF A;  4TGF A;  2YA4 A;  4GN8 A;  1FJS L;  4CUF A;  2F0Z A;  2FP9 A;  3FVZ A;  2VWN L;  1CCV A;  2P95 L;  2QWJ A;  2Y5H L;  2WPH E;  1M1X B;  5D9D A;  4CPZ A;  1OB1 C;  1IVE A;  3TBD A;  5HUN A;  4WA5 A;  4BBW A;  4FJ6 A;  5HX0 A;  4RRZ A;  5K0H B;  3QCW A;  3GIS X;  1ZGK A;  1IQM L;  5FNU A;  1X7A L;  1MZ6 A;  4YW2 A;  5M1Z A;  3A71 A;  1F5Y A;  4XJU A;  4HZX A;  1V3X B;  4XIK A;  4XE9 A;  1QBI A;  1WHF A;  2W3I B;  2K2S B;  2ADX A;  1IOE L;  2M96 A;  2W2P E;  4O5S A;  4WEF A;  2F29 A;  2B7D L;  4XBM A;  4ZY3 A;  1BJI A;  3LI4 A;  1QLG A;  3KCG L;  4GZP A;  5HUK A;  1K37 A;  4XJR A;  1O5D L;  1NPE A;  2YA7 A;  1XOG A;  3KYA A;  2DG1 A;  3UC1 A;  2HTW A;  1CVU A;  1TOZ A;  2MHP A;  3HO3 A;  2WZP P;  2HTY A;  4HZY A;  2QWI A;  5GX3 A;  2BT8 A;  3JU4 A;  2JM4 A;  2GVU A;  2PUQ L;  2KL7 A;  2P16 L;  4MWV A;  4Y7B B;  1EAI C;  3U0S A;  3K3A A;  2HU0 A;  2AYL A;  2QWB A;  4FOV A;  2HTQ A;  5FNR A;  4D52 A;  1FAX L;  3BT2 A;  4OTY A;  4AQT A;  3N8W A;  1HAE A;  2XZI A;  4Y71 B;  4GZS A;  4Z0K B;  3QH0 A;  1J8E A;  4HIZ A;  3U7U G;  4XIL A;  1POO A;  3T1E A;  3Q6K A;  4HZV A;  1MOX C;  5CIS A;  5F1A A;  2KNX A;  1INY A;  1F0R B;  3V65 B;  4MMZ B;  3SLI A;  1IVF A;  2XBW L;  2VVC K;  1IQJ L;  1Z4W A;  3HO5 A;  2J95 B;  1G1Q A;  2W2M E;  3LN1 A;  2IAR A;  4BXW A;  2W5O A;  2SLI A;  4A7I A;  2B8H A;  2J34 B;  2BF6 A;  2IAW A;  2FLR L;  1NFY B;  3TIC A;  2XBV L;  3M36 L;  1OFZ A;  2HTU A;  3LTG D;  1B9V A;  3AMR A;  4FPF A;  2IAP A;  1V3E A;  2H9E L;  3ZGC A;  4M4U A;  1Z6C A;  5GX5 A;  4CPL A;  5EX7 A;  4CHB A;  5I46 L;  4XYX A;  4ISH L;  1V2I A;  5JB8 E;  4YW4 A;  5D9C A;  3S2K A;  1EPI A;  1IQH L;  1X2R A;  4GDI A;  5FNS A;  4YY8 A;  1EBV A;  1N1T A;  2Y80 B;  2OYE P;  3F6U L;  2HU4 A;  4O02 B;  3CL0 A;  2W8B B;  1U67 A;  1SUU A;  2CML A;  4X4A A;  2NPR A;  4XL1 A;  3TI6 A;  1NT0 A;  3PJQ A;  2XN4 A;  3HPT A;  2UWL B;  4X8S L;  3II7 A;  1QFK L;  3MDL A;  2KB9 A;  2HOR A;  2WYJ B;  4LMF A;  4XJZ A;  1INV A;  4B7N A;  1D2J A;  2VH6 B;  1EUR A;  3TH3 L;  1LPG A;  4XHB A;  2XC4 L;  1G2M B;  1IQK L;  4FPJ A;  1LMJ A;  2YA8 A;  1EUT A;  1COU A;  1XFE A;  2F9B L;  3TC9 A;  3ZYG A;  5B2D A;  3OLU A;  4M10 A;  1XOE A;  5IKT A;  5GX4 A;  2I1P A;  1FF7 A;  3TI4 A;  3SOV A;  2P4O A;  1L3Y A;  2KV4 A;  4FPE A;  3FCS B;  2W8B A;  4ZLR A;  1NCA N;  4Z6A L;  1E8V A;  1W8O A;  4H52 A;  4YZ3 A;  1KLO A;  5JB9 E;  2VVV L;  3NT1 A;  1MR5 A;  1IQN L;  1V3C A;  1YUK B;  4PWZ A;  5FNT A;  4B7M A;  4DG6 A;  2Y5G L;  3CA7 A;  1V3D A;  2FYJ A;  4XJW A;  5IKQ A;  1HX2 A;  2VWD A;  4GU4 A;  1KIG L;  4MWQ A;  1IQF L;  1URK A;  2VW2 A;  4XLW A;  3Q7D A;  2XZJ A;  4XJA A;  1CQ1 A;  2BSF A;  1EPH A;  2EI8 B;  5EGM B;  3DEM A;  4MJU A;  4JYU L;  1IGX A;  1MQ5 L;  4GZT A;  4HW6 A;  1SNT A;  4X8T L;  1SLI A;  2ZZK A;  4CPY A;  1C9U A;  4GN7 A;  3I1C A;  5FWW A;  1IUB A;  2KNI A;  2IVZ A;  3D12 A;  5JBA E;  1G1S A;  1IP0 A;  4D8S A;  5L2Z L;  2J4I B; 
#chains in the Genus database with same CATH homology
 1C5K A;  2WFX B;  3Q6P A;  2IAX A;  4FM5 A;  2P28 B;  3NTG A;  3OLT A;  2XBY L;  1KLI L;  4OTJ A;  5KN5 C;  1PJX A;  1P9J A;  4ZXX L;  2G8S A;  3ELA L;  4IMB A;  2PR3 B;  2IAU A;  2FZZ L;  5L30 L;  4COX A;  1FE2 A;  1U8C B;  1IQE L;  2P3T A;  2WG3 C;  3NTB A;  2XC5 L;  1EQG A;  3V64 C;  3KK6 A;  2K2T A;  3HO4 A;  4LOR A;  1LPZ A;  2POO A;  2BMG A;  1NZI A;  1UZQ A;  4NG9 L;  2BQW A;  2FCW B;  2MGR A;  4YT6 L;  5L2Y L;  2Y7X B;  2XC0 L;  1C5M F;  3EGF A;  3A9G A;  2P93 L;  1HRE A;  2IAO A;  5GX1 A;  2V91 A;  2BZ6 L;  2P3F L;  5COX A;  2FLB L;  4YT7 L;  3N8Y B;  2RHP A;  1RFN B;  1PTH A;  3PGH A;  3V1S A;  3BT1 A;  2DSO A;  2GHS A;  1N7D A;  3TK6 B;  1Q7F A;  2P3F N;  1EPG A;  4GNC A;  2FD6 A;  4BTU A;  1JRF A;  1ZAQ A;  3CFW A;  1B9W A;  2GVX A;  3HLI A;  1DX5 I;  2VJ3 A;  1LDR A;  4RRX A;  1IQL L;  3CEN L;  3FW0 A;  2M0P A;  3ZYI B;  4JYV L;  4BDX A;  2YGO A;  1DVA L;  3HS7 A;  2Q1J B;  3KQC L;  3HLH A;  3N8W B;  5D9B A;  4GNA A;  3LC5 B;  1JBU L;  3BPS E;  4M11 A;  3ZYJ B;  4Y7A B;  3LAQ A;  5GTQ A;  1TLE A;  1UZK A;  1WHE A;  1HCG B;  4CUE A;  2I9B A;  3GCW E;  1HT5 A;  5GX2 A;  3SW2 A;  3KGG A;  1NPE B;  4ISI L;  4BTT A;  2Y38 A;  1PXX A;  2H9E C;  2BQ6 A;  2Y81 B;  3LI3 A;  1NFU B;  2WPK E;  1H6L A;  4R40 A;  3LN0 A;  1D2L A;  3KQB L;  2BQ7 A;  5JVZ A;  2IAS A;  4E1G A;  2Y82 B;  1K7B A;  2LGP A;  4BXS A;  1PFX L;  4GNB A;  2FYL B;  2VVU L;  4O1Z A;  4X8U L;  4ZH8 B;  1YO8 A;  5JBC E;  2Y7Z B;  2OJH A;  1Z6E L;  1G1T A;  3S94 A;  2UWO B;  2IAQ A;  3KQD L;  1I0U A;  1LPK A;  2BO2 A;  4JML A;  1LMM A;  4IYG A;  2JKH L;  2BOU A;  3ENS A;  3IJE B;  2VAQ A;  4RUT A;  4NGA L;  2D1J B;  3M37 L;  6COX A;  2RNL A;  3TZI A;  4CSY A;  3N8V A;  2FPB A;  2W2N E;  2WPJ E;  2DG0 A;  1NFW B;  2WPM E;  1NQL B;  3KL6 B;  3LI5 A;  3H5C B;  1EMO A;  5IKR A;  3S8V A;  3GCX E;  1CRZ A;  4D90 A;  1XDT R;  4MMY B;  2WG4 B;  2GD4 A;  4JZE L;  4A0P A;  4RRY A;  3SOB B;  5JVY A;  3K9X A;  1HRF A;  1IGZ A;  3G4H A;  2DDU A;  1FSB A;  1HT8 A;  3G4E A;  2KNY A;  3N8Y A;  3QMO A;  2W2O E;  1WU1 B;  1LQD A;  5CKN A;  4HHO A;  1EGF A;  2CJI B;  2HQS A;  1ATD A;  3SRG A;  1NFX B;  3HS6 A;  5IKV A;  1PGE A;  2WFT A;  2IAV A;  2WPI E;  4RS0 A;  1CR8 A;  3A9H A;  2W26 B;  3HRP A;  4MMX B;  4ZHA B;  4O5T A;  4BTI A;  1XKB A;  1RWI A;  2MGP A;  1V04 A;  2BOH A;  3RR3 A;  1P0S L;  3KQE L;  1AUT L;  2EI7 B;  5JW1 A;  1RWL A;  2PHB B;  1JV2 B;  5JBB E;  4D0E A;  4RRW A;  4HHQ A;  3SOQ A;  3POY A;  3LIW B;  2QE8 A;  1YUG A;  2YGQ A;  2Y5F L;  2M7P A;  2M74 A;  4BDW A;  3Q6T A;  4YZU B;  1IJQ A;  2BOK L;  2EI6 B;  3WWA A;  1HZ8 A;  1DQB A;  5FDQ A;  3N8X A;  1F0S B;  4X8V L;  3FBY A;  1IVO C;  1APO A;  3SRE A;  2P94 L;  3S6X A;  1IOX A;  2FP8 A;  2XBX L;  4G1M B;  1CQE A;  1Q4G A;  1A3P A;  3FFG L;  1CCF A;  5CKM A;  3IAX A;  1FAK L;  1MQ6 L;  3HS5 A;  3BYC A;  2BOX A;  4Y6D B;  1HAF A;  1UZP A;  4Z0L A;  1CX2 A;  2OYU P;  2YGP A;  1L5G B;  2VWL L;  3MQE A;  2ISM A;  2FLG A;  1CVW L;  3ASI A;  1G1R A;  5CKQ A;  4A94 C;  2G00 L;  1IQG L;  1IQI L;  2W86 A;  4JZD L;  3KRK A;  3O4P A;  2P26 A;  1YGC L;  1E1A A;  1PRH A;  2J94 B;  2WYG B;  1ATA A;  1TPG A;  3S8Z A;  4ZXY L;  3LTF B;  1N1I A;  1CVM A;  4JZF L;  3DR2 A;  2IAT A;  4C16 A;  4GN9 A;  3CS7 L;  4ZAE B;  2FPC A;  1DIY A;  1ATB A;  1W7X L;  2UWP B;  1HJ7 A;  1K36 A;  5E8D A;  1F7M A;  4PH9 A;  4NA9 L;  1EPJ A;  3Q3K B;  1W8B L;  3TK5 B;  1LDL A;  4D0F A;  3WW9 A;  3NJP C;  2WPL E;  1EQH A;  2TGF A;  2VH0 B;  3IIT B;  3AMS A;  5F19 A;  2VWM K;  3LC3 B;  4Y79 B;  1F7E A;  1KLJ L;  3P5B L;  4Y76 B;  1J9C L;  1BF9 A;  1SZB A;  2P3U A;  1XKA L;  2W2Q E;  2VWO L;  3R05 A;  1DDX A;  1G2L B;  5KIR A;  2J2U B;  3C9A C;  1APQ A;  1CRU A;  2I9A A;  2J38 B;  3F1S B;  2GVV A;  3U73 A;  1ATE A;  1UZJ A;  2GVW A;  1KSN B;  1ADX A;  1GK5 A;  2RA0 L;  4Q1U A;  1JL9 A;  3DAS A;  3E5Z A;  1FFM A;  1CEJ A;  2W3K B;  1EMN A;  4CUD A;  1EZQ B;  3N8Z A;  1YUF A;  3TGF A;  4TGF A;  4GN8 A;  1FJS L;  4CUF A;  2FP9 A;  3FVZ A;  2VWN L;  1CCV A;  2P95 L;  2Y5H L;  2WPH E;  1M1X B;  5D9D A;  1OB1 C;  3TBD A;  4RRZ A;  5K0H B;  3QCW A;  3GIS X;  1IQM L;  1X7A L;  1F5Y A;  1V3X B;  1QBI A;  1WHF A;  2W3I B;  2K2S B;  2ADX A;  1IOE L;  2M96 A;  2W2P E;  4O5S A;  2B7D L;  4XBM A;  3LI4 A;  1QLG A;  3KCG L;  1K37 A;  1O5D L;  1NPE A;  3KYA A;  2DG1 A;  1CVU A;  1TOZ A;  2MHP A;  3HO3 A;  2WZP P;  5GX3 A;  2JM4 A;  2GVU A;  2PUQ L;  2KL7 A;  2P16 L;  4Y7B B;  1EAI C;  3U0S A;  2AYL A;  1FAX L;  3BT2 A;  4OTY A;  4AQT A;  3N8W A;  1HAE A;  4Y71 B;  4Z0K B;  3QH0 A;  1J8E A;  3U7U G;  1POO A;  3Q6K A;  1MOX C;  5CIS A;  5F1A A;  1F0R B;  3V65 B;  4MMZ B;  2XBW L;  2VVC K;  1IQJ L;  3HO5 A;  2J95 B;  1G1Q A;  2W2M E;  3LN1 A;  2IAR A;  4BXW A;  4A7I A;  2J34 B;  2IAW A;  2FLR L;  1NFY B;  2XBV L;  3M36 L;  3LTG D;  3AMR A;  2IAP A;  2H9E L;  1Z6C A;  5GX5 A;  5EX7 A;  5I46 L;  4ISH L;  5JB8 E;  5D9C A;  3S2K A;  1EPI A;  1IQH L;  1EBV A;  2Y80 B;  2OYE P;  3F6U L;  4O02 B;  2W8B B;  1U67 A;  2NPR A;  4XL1 A;  1NT0 A;  3HPT A;  2UWL B;  4X8S L;  1QFK L;  3MDL A;  2KB9 A;  2WYJ B;  4LMF A;  1D2J A;  2VH6 B;  3TH3 L;  1LPG A;  2XC4 L;  1G2M B;  1IQK L;  3TC9 A;  1LMJ A;  1COU A;  1XFE A;  2F9B L;  2KNX A;  3ZYG A;  3OLU A;  4M10 A;  5GX4 A;  5IKT A;  2I1P A;  1FF7 A;  3SOV A;  2P4O A;  1L3Y A;  2KV4 A;  3FCS B;  2W8B A;  4ZLR A;  4Z6A L;  1KLO A;  5JB9 E;  2VVV L;  3NT1 A;  1IQN L;  4PWZ A;  1YUK B;  4DG6 A;  2Y5G L;  3CA7 A;  2FYJ A;  5IKQ A;  1HX2 A;  1KIG L;  1IQF L;  1URK A;  4XLW A;  3Q7D A;  1CQ1 A;  1EPH A;  2EI8 B;  5EGM B;  3DEM A;  4JYU L;  1IGX A;  1MQ5 L;  4HW6 A;  4X8T L;  1C9U A;  4GN7 A;  3I1C A;  5FWW A;  2KNI A;  2IVZ A;  5JBA E;  1G1S A;  1IP0 A;  5L2Z L;  2J4I B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...