1N7SA

High resolution structure of a truncated neuronal snare complex
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
63
structure length
63
Chain Sequence
b'GSNRRLQQTQAQVDEVVDIMRVNVDKVLERDQKLSELDDRADALQAGASQFETSAAKLKRKYW'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords vesicle-associated membrane protein 2
publication title High Resolution Structure, Stability, and Synaptotagmin Binding of a Truncated Neuronal SNARE Complex
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Transport protein
total genus 28
structure length 63
sequence length 63
ec nomenclature
pdb deposition date 2002-11-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.110 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 1n7sA00
4WY4A 3HTKB 3RL0C 2N1TC 2NPSC 3KYQA 2M8RA 3RK3D 2N1TA 2WZ7A 3B5NC 1L4AB 2NPSA 5KJ7A 3HD7B 1GL2D 1URQB 1SFCC 1KILC 3B5NA 1N7SB 1L4AD 5CCHD 1HVVA 3PP5A 1KILA 4JF7A 1JTHA 3RK3B 3M0DC 5KJ7C 1GL2B 5CCGC 4W7YA 4N78E 5CCGA 3RK2C 1URQA 3RL0D 2N1TD 2NPSD 2H8PD 2KOGA 4WY4B 3TSIA 1SFCD 1L4AC 1GL2A 2PP6A 3HD7C 3RL0B 1NHLA 2HG5D 2N1TB 1URQC 2NPSB 4WY4D 1N7SC 1L4AA 3HD7A 3B5NB 4W80A 1N7SA 4W7ZA 5KJ7D 5CCGD 3VOPA 1SFCB 3RK3C 1KILB 3P8CE 2YMYA 3B5ND 1GL2C 3RK2D 1XTGB 1KILD 2HFED 5CCHC 4LGDE 5CCHA 1T3JA 3RK2B 3HD7D 4WY4C 1SFCA 1URQD 4OH8B 2XDJA 1N7SD 1JTHB
chains in the Genus database with same CATH superfamily
1QEXA 3AE5C 2FYNC 2HPCA 3Q2YA 4R4MA 3WUTA 2P67A 3NTNA 3RGUA 4R4LA 1KILA 2A45G 2QVAA 1J2JB 3M0DC 4PD4I 5KJ7C 1KC8Q 4IOIH 2E75B 3AECC 1QGKB 1IFIA 5BU8B 1U7JA 2M3EA 3H32B 4ASVA 1DH3A 2KI7B 3TGUD 3E1IA 2QJPC 1HF9A 1K9MQ 4I6MC 2KXPB 2FFDB 4IL6H 1NGMB 3GG2A 2Q6QA 2CK3H 5KLVJ 1YIJP 3RL0g 3RK3E 4H0LD 2I8DA 3N7NA 3L73E 3G6EP 1KB9D 2YMKA 1YQ3C 1KMIZ 1SQPJ 2KNCA 1FZBA 1LTSC 1IFJA 2WPRA 3RK2D 2E75C 2A06G 2Y0DA 1A02F 1S3JA 2E76D 3HE4A 1FOSE 1IFDA 1ZLLA 5B5EH 3A5TA 1HGVA 2W83C 1YBKA 1LTJB 3OAKA 2FFDC 3AE9C 1URQD 2BEZF 1PGQA 3H1HD 3L74J 2K9JB 3TK1A 1FDOA 3L71J 3PHLA 1MV8A 5GTHH 2OQQA 1NTMJ 1Y47A 2MKVA 2Q7CA 3II6A 1FZEA 5AW2B 2ZYGA 2C9NY 2Y9YA 1L4AD 3L73G 1ZP0C 1N73A 5EFWB 3BASA 3FXDA 5APYA 1QL2A 5H2FH 1USEA 1BDCA 5KLVK 4HB1A 4C7NB 3CC4P 3H1LE 3CCSP 1LTJC 4PD4D 1Y9BA 3HE5B 1URQA 3RL0D 2NPSD 3JSVC 3CC2P 1SQPK 4PV1D 1QX8A 4WY4B 3CCEP 1OFCX 2YXRB 1ZRTD 2FBWC 4JPZB 1KORA 3P7KA 5AVWB 2WPSA 1NTZJ 1L4AA 1NKNA 1XTCC 2Y0EA 3CMEP 5L8RJ 1Q82Q 2AXTH 4GT1A 4KT0J 2YO3A 3BCCJ 2JWDA 1VQ8P 3AE3C 1L0NE 1NTMK 4EYYQ 1PP9J 2ZT9D 5CCHA 3H1LG 2POHA 4WY4C 1BE3E 1AJYA 2R3SA 1MFTA 2Q3EA 3WU2E 3C8VA 1SQBD 2GM4A 1GTWA 2P10A 2N1TA 3AEEC 1W2BO 4I1LA 4JBZA 2KB7P 1M90Q 1SQQD 1RE4C 4UB6H 3CXHI 2ZXXA 3JC22 3L36A 5CJ4A 4PJ0E 1BGYD 3HTKA 5AW5B 1DIPA 1LT9A 1X22A 1EXJA 2RH0A 1NTZK 3KXDA 3RBXA 1L0NG 1JOCA 2LKMA 2O3JA 3MTUE 2K37A 3K5BA 1CI6B 3AE8C 5AVTB 2WMMA 1ZR2A 2LR2A 1KYOI 1N8RQ 5KLVE 2NZ2A 2RN0A 2M3BA 3B5NB 3L75D 1ZW0A 5KJ7D 2H7HA 1S1CX 3LIEA 2K1AA 1ZXGA 2IYPA 2O01J 2IFMA 5APWA 1S5LE 2A45I 4U7JA 3H1IE 2IDBA 1VF5D 1OZHA 4BRYB 1DEEG 2RKLA 2IYOA 1YQ4C 5AVUB 3KYQA 2CPSA 3PJSK 3B5NC 5KJ7A 3HD7B 5E79E 1G1IA 2E75D 1L0LD 5KLVG 1AV1A 2I1KA 3L70D 3D70A 4PD4H 3P8CD 3L72J 3V2NA 3MIWA 2IBZD 1SQPG 1SVFA 2BCCD 1R5SA 1HTLC 1BSNA 2M5AA 4M3LA 3H1IG 4GOFA 1PGPA 1QVFO 1JY2N 1VQ6P 3FGAD 1AQ5A 3HD7C 3ABVC 1N86A 1GZLA 3L74G 2J58A 2W90A 1LTBC 3H32A 1M57D 1FC2C 3VOPA 1FAVA 4MN4C 5DJUB 1VQOP 4EIJA 3I56P 2QEXP 1VQ4P 4DJGA 2QM8A 1RE3C 1S9KD 5AW1B 3L73J 2IPPA 4NPDA 5GTIH 1EXIA 3CCJP 1T3JA 2R32A 1T2KC 2JEEA 1ZMEC 3V5BA 1M8OB 1PPJE 4B86A 1EZVE 2ZVNB 4EOTA 4K3AA 3Q3DA 1LTJA 4Y28J 3W68A 1NTZG 1SQVD 3AE4C 3CCQP 1MZ9A 3M9BA 3GHGA 1FJKA 2QE7H 1HGZA 1NU1D 1PGJA 3IN6A 5AW0B 1NTKJ 2OYIB 3P32A 4QMAA 3KZIE 4L76A 2Z4EA 2A06D 4O9BA 2GA1A 1JMBA 3A0BH 3H1LJ 2XNDH 4C7NA 1PPJG 4OGQD 4NPFX 2WSCJ 3VYIA 1EZVG 3HE5A 4WVZA 1D7MA 1SQXD 1JCCA 2PGDA 4DZOA 2V4HA 3SWFA 1W5CE 2GUVA 2OTKE 2OYIC 3MP7B 4DCKA 4H44D 3FWNA 1S5LX 3WMM0 1Q90D 2XDJA 5AVQB 4Y99B 1L0NJ 2QJYB 3M0AA 1FDMA 4D6TE 1Y8AA 2B87A 4H13B 2OTLP 1NTKK 3A7OA 4RKUJ 2JO1A 3AEBC 4IL6E 2V7QH 3CWBE 3P8MC 1BE3J 3VMXA 4JF7A 3CCUP 3L72E 2HR3A 2JWAA 3FXEA 1KV4A 2WSFH 5BU5A 1HBWA 1S4XA 2Q3IA 2GUSA 2E74B 4Y99C 2QJYC 3T97B 5B5EE 5TJHA 4TLFA 4H13C 2KS1A 1NHLA 3LIDA 4LLHA 2WSEH 2WQYC 1EDKA 4D6TG 5DJTB 2P1JA 1RQUA 5CMZA 3MUDC 5AW3B 1CI6A 1QLED 5GTHE 2YMYA 2WVRA 3R4YA 3PTZA 1L0NK 2QG4A 2FYZA 2FXPA 3L72G 4A7PA 2L91A 2JJLA 2QSIA 3PRJA 4LGDE 4U3FE 3LW5J 1YYCA 1KQLA 2PFXA 2E74C 1BSHA 5H2FE 1YHQP 3HD7D 2HODB 2SPZA 2FYUE 1LNQA 3BVHA 3H1KJ 3TF5A 2G8YA 5CBOA 4YXWH 2Q5UA 2K9YA 1IO4A 2R44A 3H1IJ 2J59M 1CZQA 1P84D 4BWNA 2WT7A 4Z1MH 1KILE 5CCGC 2AXTE 3MD0A 1OMIA 1T2KD 4N78E 1VQPP 2Q1KA 4RESB 3GF3A 2JR8A 1GW3A 1NTKE 2XU6A 3E1RA 1G2CB 1IFNA 3A0HH 3SWYA 1U7MA 1LTGC 3VP8A 1RE3A 2N9YB 4NPEA 2K88A 3AE7C 1VPCA 2YKPA 1RF1B 4UB6E 2AEJA 5KLVD 2P2UA 1VQ7P 1M1JB 3TGUE 3CX5I 4DOJA 1NTKG 3VN0A 1SQPD 1NO4A 5CJ0A 1JY2O 3CI9A 2XKMA 1JMMA 3G71P 2NPSA 4EI2A 1H0TA 1R5LA 1N7SB 2XV5A 3RBZA 1EZVI 1RF1C 1FZCA 3RK3B 5KAIH 3L74D 1N7LA 1GL2B 3L71D 1M1JC 1KD1Q 2Y9ZA 1NTMD 1GK6A 3AE6C 2KK7A 1FS0E 3V4WA 3TGUG 3H1HE 1JY3N 3H25A 1S72P 5AVZB 3W67A 3CL3D 2HPCB 1N7SC 2OYIA 1LJ2A 1K8AQ 1VQKP 3RK3C 1KILB 3C1LA 3CCVP 1GL2C 3AEFC 1KB9H 4YXDC 2FY8A 2L5GB 1BE3G 1JO5A 4CPGA 4ASWA 3V2PA 1IZNB 1NTZD 3H1JJ 1K05A 2Y0CA 4AYCA 1OVVA 4H13D 1X9VA 1WRGA 5AW6B 3OW2O 1OXZA 2QRXA 1GU5A 1P84H 5APQA 4GDOA 1A02J 1PV3A 3H1HG 3BCCD 3H1KE 3O6QA 2M8RA 5AW4B 5APVA 2WZ7A 3D6YA 2C0XA 3CC7P 1PP9D 3PLNA 1KILC 2LXBA 1VQ9P 2MJZA 1RH5B 3Q5SA 1HVVA 1BCCJ 1N2DC 1IJDB 3KPEA 5KAFE 4XE5B 1GD2E 4D6TJ 3HE4B 1EZVD 5AVXB 1PL5A 4PJ0H 3M0DA 2OGUA 3SWKA 1EDIA 2LXCB 2R3CA 3CWBJ 1NH4A 4IFMA 3QWOC 1OX3A 1Q7YQ 3CXHD 5GTIE 3IR9A 3TSIA 1SQBE 2FXMA 3H1KG 2KSEA 1SQQE 3L35A 3D6ZA 1IFPA 5CCGD 1N73B 2E42A 5AVVB 1AVOA 1BGYE 2ZXEB 5APTA 3T97A 4YPCA 1VQLP 3AEGC 1RHZB 1SLQA 5AW7B 2WPVB 3GLMA 2B9BA 1SS1A 2ZJSE 5KLIB 1IFMA 2VRSA 1KYOD 2KUBA 1GK4A 3UIAA 4BXLA 3M9QA 1E5WA 1JTHB 2FFDA 1LGHB 3CX5E 4WB4A 3CMAP 4U3FJ 4AQRD 1L4AB 1EQ7A 2G3AA 1N73C 3L75E 3V6IA 2O01N 1NAFA 1SQQG 3E7KA 3A0BE 3V2QA 1HUCA 2HODA 1HJBA 4KHXA 2B88A 2FYUJ 4RO0A 3B71A 1L2PA 1KFMA 1BGYG 5KLIC 5B66H 3C9IA 4HH2A 4LC1A 1OVRA 5TISH 1KQGB 1QVGO 2AEMA 3L72D 2K9JA 1ZN5A 1L4AC 2PP6A 1PIXA 2N1TB 3WUVA 4WY4D 1JY3P 5C39A 1VQMP 3U1AA 1L0LE 1NOHA 2WPQA 3L70E 4IFFA 1UIXA 1LP1B 3P8CE 3VTPC 3GW6A 2IBZE 5CCHC 1LTTC 2BCCE 1DEBA 4YTPC 2C0WA 5AVRB 3TNUB 1GDTA 3H1JE 2FYUK 1N7SD 3MZWB 3R2PA 2R5DA 3GF7A 4WY4A 2N1TC 2R5BA 1DD4A 1RF1A 2Q9IA 1AVYA 2YIUB 4WBAA 2WWWA 3RK3D 4JQ0D 3V2RA 2BASA 3SFDC 3TYYA 1GL2D 3TGUJ 2QM7A 3L73D 1T6AA 3KDPB 3Q1MA 2KZJA 1AQTA 1L0LG 1RE4A 1WMKA 1IK9A 2ZAEB 1BCCE 2W8ZA 2KYVA 3L70G 2ZYAA 1W2EA 2WSSH 4L73A 4UB8H 1S9KE 3EQ2A 3CXHH 2BCCG 3IAOA 2YXQB 3NXSA 2H8PD 3H1JG 2OYOA 2YIUC 1K04A 3NFQA 1GL2A 1J1EB 2HG5D 3F89A 3M91A 5K5GB 5AW8B 1NTKD 1YTZI 1YTZT 4W80A 1CSBA 1SQVE 3H1HJ 1J1DB 3B5ND 2OYHB 2QA4P 1KYOH 1NU1E 3JCUH 1FDIA 1BCCG 1YI2P 1VF5B 3H1LD 3VMZA 2P7JA 2M5AB 1JY2P 2PRRA 3I5CA 3IFMA 2IX7C 2O01H 1IK7A 4EDFA 2A06E 2D2CB 1J1EC 3CWBG 1FZAA 1JY3O 1VQ5P 4ZMDA 2A45H 3S4RA 1LWUB 3A0HE 1SQXE 2K3RA 2KLVA 3B5NA 1J1DC 3VP9A 2OYHC 1JNMA 3HUSB 2JP3A 1JM0A 1SQVG 1VF5C 1S2EA 4HKZH 4L75A 1L0ND 1RF0C 4W7YA 1NU1G 2W27A 1M1KQ 2D2CC 3VMAA 4BRYA 1KTMA 1QL1A 2E43A 1BE3D 2ITAA 1LWUC 2CPBA 3KQGA 4GODA 3BATA 3HD7A 2KZIA 2FKWB 3HUSC 2QJKB 1FU1A 2H88C 4U3FG 1ZR4A 1SQXG 3CLQA 3B8EB 3U59A 3GHGB 1HH0A 1FE6A 1SQBJ 2FYUG 1KFNA 1Q86Q 1SQQJ 3USSA 2XNXA 1T3UA 5KAIE 5AVSB 1BGYJ 1M56D 4ZKPA 4OH8B 3AEDC 1NAYA 4I2LC 1IC2A 1HWTC 2H43A 1NKZB 1OW8A 3N4XA 3SSUA 2QJKC 1X79B 2PAJA 1OWAA 3OA7A 1VQNP 5CCHD 3GHGC 1PGOA 1Q81Q 2Z5HA 3CPWO 1JTHA 1R8EA 1FZGA 1FJPA 3FWLA 3H1KD 3HRNA 1NYHA 2QIWA 2Z5IA 1DX7A 3L75J 1RQVA 1KZUB 3H1ID 1KQSO 3CD6P 2N1TD 1KB9E 4GKGA 3EWKA 4KJMA 5APSA 1K73Q 3OJAB 4IL6X 4OGQB 2YKOA 1SQBK 2FXOA 1H89A 3F5HA 1LT1A 3NMDA 5KKZB 3AE1C 2B87B 1SQQK 4ZKUA 1TU3F 1P84E 3U1CA 3G9RA 1SFCB 3S9OA 1USDA 2WSCH 2I1JA 2IFNA 4H44B 3MGNA 5AW9B 2KSJA 3VMYA 5KTBA 1FOSF 1L0LJ 2ZYDA 2H89C 4L74A 1OW6A 3L70J 1KQFB 4OGQC 2IBZI 5APXA 1LP1A 3ZDMA 5KKZC 2WTYA 2KS1B 2BCCJ 1YITP 3MHVA 2V7QJ 1JEKA 1RY3A 3TNUA 4PD4E 1GW4A 2JDIH 1SFCC 2AXCA 5CBNA 4K35A 3L37A 4H44C 3PH0A 1ZV8A 2WSFJ 2O1JA 1GU4A 3CX5D 3CCRP 2XZRA 1ZRTE 3WU2H 2C9LY 2WSEJ 2KNCB 1SQPE 2NRGA 1PPJD 2E74D 3G3ZA 1OIPA 2E5TA 2W6AA 2KIKA 1L0LK 1BDDA 2WITA 1CW5A 2ZFCA 2WT7B 3MUDA 5M1BA 2D2CD 3L74E 4H0LB 2IZ1A 3L71E 1PZQA 1EDLA 2B89A 1NTME 1SQVJ 3RK2B 1JUNA 4HYTB 5CHXA 5B66E 2IZ0A 2N9BA 2DW3A 2E76B 2OYHA 4JYBA 1NU1J 3AEAC 3LW5H 4AUWA 5TISE 4XFJA 1RF0A 3M9HA 1NJIQ 1URQB 2OTJP 1EDJA 3H1JD 3IF4A 1S5LH 1YJWP 3PP5A 1JCDA 1Q2NA 2HLOA 4H0LC 3G4SP 1YJ9P 1E79H 3L4FA 1AA0A 1LWUA 5KAFH 4JYCA 1SQBG 1SQXJ 1VDFA 5CCGA 3RK2C 3L71G 1NTZE 3EFFK 1ZOYC 2E76C 1NTMG 4GOEA 3S1KA 4GIFA 3HUSA 3EFGA 5E79H 1BCCD 3QH9A 1FBMA 2HYNA 1GMJA 1YJNP 3BCCE 4D6TD 3RL0B 1OVUA 1URQC 2NPSB 1X0TA 1H0TB 3BRVB 1PP9E 4C46A 4PV1B 4WWIA 1PFIA 1SQVK 4W7ZA 4XA4A 3CWBD 1SP4A 4HJGH 1FZCB 2JKVA 1NU1K 1XTGB 1H8AA 2ZVOB 2J5UA 1T8ZA 3KHUA 1FZFA 2AEFA 2RMZA 3Q5RA 1LTAC 4DT0A 1M7LA 1G2CA 1Z56A 4UB8E 2YNYA 3L75G 3SFEC 3O8ZA 3CXHE 4RJTA 3RL0C 3HTKB 1LT9B 2ZT9B 2NPSC 1LTIC 1VL2A 1H88A 4PV1C 1HJ0A 4C7RA 3AE2C 3BCCG 1SQXK 3CX5H 4I7ZB 3CCLP 2OARA 1FZCC 1PP9G 1EC5A 2E5YA 3M06A 2M0BA 4OVNF 1DD3A 2W6BA 3D71A 1NWQA 1OW7A 4ZNCA 2KP8A 4U3FD 3B4SA 3V4QA 5AVYB 1U57A 1M1JA 1KYOE 3JCUE 4N6JA 1LT9C 2KOGA 2ZT9C 3GMAA 3ITKA 4N3YB 3H6PA 2FYUD 1MFZA 4OWFA 1SFCD 1MUUA 3O6QB 2P58A 1KB9I 2BEQD 2IBZG 4I7ZC 1WT6A 3CCMP 1NVOA 4IFDK 2FYNB 1N7SA 2UWJE 1AFOA 1JB0J 3TDKA 1X8YA 3KZIH 3I55P 5BVZA 1KILD 2HFED 1P84I 2W6JH 1UIIA 3A2AA 4N78D 1MKMA 3Q5PA 4TT3H 5APUA 1G1JA 2O1KA 3FX0A 3BRTB 3A3YB 2YKQA 1SFCA 2KLUA 2YO2A 3WUUA 2QJPB 1KN7A
chains in the Genus database with same CATH topology
4I2LC 5APQA 4B86A 1IC2A 1A02J 1HWTC 2H43A 2M8RA 5AW4B 5APVA 2WZ7A 1NKZB 4EOTA 3N4XA 2C0XA 2HPCA 1X79B 1KILC 2P67A 2PAJA 1LTJA 1OWAA 2MJZA 3OA7A 5CCHD 3GHGC 3NTNA 1HVVA 1N2DC 1KILA 2Z5HA 1MZ9A 1IJDB 1JTHA 3KPEA 1FZGA 3M9BA 2A45G 1FJPA 1J2JB 3GHGA 1FJKA 3M0DC 4XE5B 1GD2E 1HGZA 5KJ7C 3HE4B 5AVXB 3HRNA 3M0DA 5AW0B 1IFIA 2Z5IA 5BU8B 1DX7A 2OYIB 1KZUB 3P32A 2N1TD 3H32B 1DH3A 2R3CA 4GKGA 3E1IA 1NH4A 4IFMA 2Z4EA 5APSA 4I6MC 3OJAB 2YKOA 2FFDB 4O9BA 1SQBK 3IR9A 3TSIA 1H89A 4C7NA 2FXMA 3NMDA 1SQQK 4ZKUA 3VYIA 3HE5A 3N7NA 3L35A 1JCCA 5CCGD 3U1CA 4DZOA 1N73B 1SFCB 5AVVB 2E42A 2WSCH 1FZBA 1LTSC 2I1JA 2ZXEB 5APTA 1IFJA 3T97A 2IFNA 3SWFA 2WPRA 3RK2D 3MGNA 5AW9B 1A02F 1SLQA 5AW7B 2KSJA 2GUVA 3VMYA 3HE4A 5KTBA 1FOSF 2OYIC 1FOSE 1IFDA 1ZLLA 3A5TA 1HGVA 1IFMA 2VRSA 1LTJB 3OAKA 3WMM0 2FFDC 1GK4A 5APXA 3UIAA 1URQD 3M9QA 2XDJA 1E5WA 1JTHB 3TK1A 5AVQB 2FFDA 4Y99B 2WTYA 3M0AA 1FDMA 1LGHB 1MV8A 4WB4A 1RY3A 4AQRD 1L4AB 1NTKK 3TNUA 3A7OA 1EQ7A 1GW4A 2Q7CA 1N73C 1SFCC 3II6A 1FZEA 5AW2B 3L37A 1NAFA 2C9NY 1L4AD 3V2QA 1HUCA 2HODA 4KHXA 1HJBA 1N73A 1ZV8A 3P8MC 3BASA 3VMXA 2O1JA 5APYA 1QL2A 4JF7A 1GU4A 1KFMA 5KLVK 3C9IA 4C7NB 2XZRA 4HH2A 4LC1A 2WSFH 5BU5A 1LTJC 1HBWA 3HE5B 1URQA 3RL0D 2Q3IA 2C9LY 2NPSD 2GUSA 1SQPK 4Y99C 4WY4B 1ZN5A 1L4AC 2PP6A 3G3ZA 1NHLA 2N1TB 4WY4D 3P7KA 5AVWB 1JY3P 3LIDA 2W6AA 2WPSA 2WSEH 4LLHA 1L0LK 1L4AA 1NKNA 1XTCC 3U1AA 2P1JA 1NOHA 2WITA 2WPQA 1CW5A 5CMZA 2ZFCA 5AW3B 1CI6A 4IFFA 2WT7B 3P8CE 3VTPC 2YMYA 4GT1A 3MUDA 2YO3A 1L0NK 2FYZA 5CCHC 1LTTC 1DEBA 1NTMK 2JJLA 2C0WA 5AVRB 4LGDE 3TNUB 1YYCA 1KQLA 5CCHA 1GDTA 2POHA 3RK2B 1JUNA 4HYTB 5CHXA 3HD7D 4WY4C 2HODB 2FYUK 2N9BA 1N7SD 2OYHA 4JYBA 3R2PA 2R5DA 3LW5H 3BVHA 4AUWA 4WY4A 2N1TC 2R5BA 1RF1A 2Q9IA 2GM4A 1GTWA 4WBAA 2Q5UA 2WWWA 2N1TA 3RK3D 1IO4A 2J59M 4I1LA 3V2RA 2BASA 1RF0A 3TYYA 1GL2D 1CZQA 2KB7P 3M9HA 2QM7A 1URQB 1RE4C 3KDPB 3L36A 5CJ4A 1RE4A 3PP5A 2WT7A 1IK9A 1JCDA 2HLOA 2KYVA 3HTKA 5AW5B 1LT9A 1W2EA 3L4FA 5CCGC 3MD0A 1S9KE 3EQ2A 1T2KD 1LWUA 1NTZK 4JYCA 4N78E 1JOCA 4RESB 1VDFA 5CCGA 3RK2C 2LKMA 1GW3A 3MTUE 2XU6A 1G2CB 3NXSA 1IFNA 1CI6B 3SWYA 2H8PD 4GIFA 3HUSA 3EFGA 5AVTB 1ZR2A 1FBMA 2HYNA 3NFQA 1GL2A 1LTGC 3RL0B 1J1EB 2HG5D 1URQC 2NPSB 3M91A 3VP8A 3BRVB 1RE3A 4C46A 5AW8B 2M3BA 3B5NB 1PFIA 1SQVK 1YTZI 1YTZT 4W80A 5KJ7D 4W7ZA 1CSBA 2H7HA 4XA4A 1J1DB 1SP4A 3LIEA 3B5ND 1FZCB 2OYHB 1NU1K 1VPCA 1XTGB 2YKPA 1H8AA 1RF1B 2IFMA 5APWA 3VMZA 2P2UA 1T8ZA 2A45I 2P7JA 1FZFA 1JY2P 1LTAC 1M1JB 3I5CA 3IFMA 1M7LA 2IX7C 2O01H 1G2CA 1Z56A 4DOJA 2YNYA 3VN0A 3O8ZA 1NO4A 5CJ0A 5AVUB 3RL0C 3HTKB 1J1EC 1LT9B 1FZAA 2NPSC 1JY3O 3KYQA 1LTIC 2CPSA 1JY2O 2A45H 3CI9A 1H88A 2XKMA 1JMMA 4C7RA 3B5NC 5KJ7A 1LWUB 2NPSA 1SQXK 3HD7B 1G1IA 2KLVA 3B5NA 1J1DC 1N7SB 3VP9A 2XV5A 2OARA 1FZCC 2OYHC 1JNMA 2I1KA 3M06A 3HUSB 3P8CD 1RF1C 3V2NA 1FZCA 3MIWA 2W6BA 3RK3B 1NWQA 1N7LA 1GL2B 4W7YA 1RF0C 1SVFA 2W27A 1M1JC 2KP8A 1HTLC 3V4QA 1GK6A 5AVYB 4M3LA 1M1JA 3V4WA 4N6JA 1LT9C 2KOGA 4N3YB 3H6PA 1QL1A 1JY3N 2E43A 1MFZA 1JY2N 1SFCD 1MUUA 1AQ5A 1LWUC 5AVZB 3HD7C 1N86A 1GZLA 3CL3D 2CPBA 2HPCB 1N7SC 3KQGA 1WT6A 2J58A 2OYIA 3BATA 3HD7A 4IFDK 1LTBC 3H32A 2FKWB 3HUSC 1N7SA 1FU1A 1ZR4A 1AFOA 3VOPA 1FAVA 3RK3C 1KILB 3CLQA 3B8EB 1GL2C 3U59A 3GHGB 1HH0A 1X8YA 4EIJA 5BVZA 2L5GB 1KILD 2HFED 1JO5A 1KFNA 2QM8A 1RE3C 1S9KD 5AW1B 3A2AA 4N78D 2IPPA 2XNXA 3V2PA 5APUA 1T3UA 1G1JA 2O1KA 3BRTB 1T3JA 4AYCA 5AVSB 2R32A 1X9VA 3A3YB 2YKQA 1SFCA 1WRGA 5AW6B 1T2KC 2JEEA 2YO2A 4ZKPA 4OH8B 3V5BA 1OXZA 1GU5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4WY4 A;  3HTK B;  3RL0 C;  2N1T C;  2NPS C;  3KYQ A;  2M8R A;  3RK3 D;  2N1T A;  2WZ7 A;  3B5N C;  1L4A B;  2NPS A;  5KJ7 A;  3HD7 B;  1GL2 D;  1URQ B;  1SFC C;  1KIL C;  3B5N A;  1N7S B;  1L4A D;  5CCH D;  1HVV A;  3PP5 A;  1KIL A;  4JF7 A;  1JTH A;  3RK3 B;  3M0D C;  5KJ7 C;  1GL2 B;  5CCG C;  4W7Y A;  4N78 E;  5CCG A;  3RK2 C;  1URQ A;  3RL0 D;  2N1T D;  2NPS D;  2H8P D;  2KOG A;  4WY4 B;  3TSI A;  1SFC D;  1L4A C;  1GL2 A;  2PP6 A;  3HD7 C;  3RL0 B;  1NHL A;  2HG5 D;  2N1T B;  1URQ C;  2NPS B;  4WY4 D;  1N7S C;  1L4A A;  3HD7 A;  3B5N B;  4W80 A;  1N7S A;  4W7Z A;  5KJ7 D;  5CCG D;  3VOP A;  1SFC B;  3RK3 C;  1KIL B;  3P8C E;  2YMY A;  3B5N D;  1GL2 C;  3RK2 D;  1XTG B;  1KIL D;  2HFE D;  5CCH C;  4LGD E;  5CCH A;  1T3J A;  3RK2 B;  3HD7 D;  4WY4 C;  1SFC A;  1URQ D;  4OH8 B;  2XDJ A;  1N7S D;  1JTH B; 
#chains in the Genus database with same CATH topology
 1QEX A;  3AE5 C;  2FYN C;  2HPC A;  3Q2Y A;  4R4M A;  3WUT A;  2P67 A;  3NTN A;  3RGU A;  4R4L A;  1KIL A;  2A45 G;  2QVA A;  1J2J B;  3M0D C;  4PD4 I;  5KJ7 C;  1KC8 Q;  4IOI H;  2E75 B;  3AEC C;  1QGK B;  1IFI A;  5BU8 B;  1U7J A;  2M3E A;  3H32 B;  4ASV A;  1DH3 A;  2KI7 B;  3TGU D;  3E1I A;  2QJP C;  1HF9 A;  1K9M Q;  4I6M C;  2KXP B;  2FFD B;  4IL6 H;  1NGM B;  3GG2 A;  2Q6Q A;  2CK3 H;  5KLV J;  1YIJ P;  3RL0 g;  3RK3 E;  4H0L D;  2I8D A;  3N7N A;  3L73 E;  3G6E P;  1KB9 D;  2YMK A;  1YQ3 C;  1KMI Z;  1SQP J;  2KNC A;  1FZB A;  1LTS C;  1IFJ A;  2WPR A;  3RK2 D;  2E75 C;  2A06 G;  2Y0D A;  1A02 F;  1S3J A;  2E76 D;  3HE4 A;  1FOS E;  1IFD A;  1ZLL A;  5B5E H;  3A5T A;  1HGV A;  2W83 C;  1YBK A;  1LTJ B;  3OAK A;  2FFD C;  3AE9 C;  1URQ D;  2BEZ F;  1PGQ A;  3H1H D;  3L74 J;  2K9J B;  3TK1 A;  1FDO A;  3L71 J;  3PHL A;  1MV8 A;  5GTH H;  2OQQ A;  1NTM J;  1Y47 A;  2MKV A;  2Q7C A;  3II6 A;  1FZE A;  5AW2 B;  2ZYG A;  2C9N Y;  2Y9Y A;  1L4A D;  3L73 G;  1ZP0 C;  1N73 A;  5EFW B;  3BAS A;  3FXD A;  5APY A;  1QL2 A;  5H2F H;  1USE A;  1BDC A;  5KLV K;  4HB1 A;  4C7N B;  3CC4 P;  3H1L E;  3CCS P;  1LTJ C;  4PD4 D;  1Y9B A;  3HE5 B;  1URQ A;  3RL0 D;  2NPS D;  3JSV C;  3CC2 P;  1SQP K;  4PV1 D;  1QX8 A;  4WY4 B;  3CCE P;  1OFC X;  2YXR B;  1ZRT D;  2FBW C;  4JPZ B;  1KOR A;  3P7K A;  5AVW B;  2WPS A;  1NTZ J;  1L4A A;  1NKN A;  1XTC C;  2Y0E A;  3CME P;  5L8R J;  1Q82 Q;  2AXT H;  4GT1 A;  4KT0 J;  2YO3 A;  3BCC J;  2JWD A;  1VQ8 P;  3AE3 C;  1L0N E;  1NTM K;  4EYY Q;  1PP9 J;  2ZT9 D;  5CCH A;  3H1L G;  2POH A;  4WY4 C;  1BE3 E;  1AJY A;  2R3S A;  1MFT A;  2Q3E A;  3WU2 E;  3C8V A;  1SQB D;  2GM4 A;  1GTW A;  2P10 A;  2N1T A;  3AEE C;  1W2B O;  4I1L A;  4JBZ A;  2KB7 P;  1M90 Q;  1SQQ D;  1RE4 C;  4UB6 H;  3CXH I;  2ZXX A;  3JC2 2;  3L36 A;  5CJ4 A;  4PJ0 E;  1BGY D;  3HTK A;  5AW5 B;  1DIP A;  1LT9 A;  1X22 A;  1EXJ A;  2RH0 A;  1NTZ K;  3KXD A;  3RBX A;  1L0N G;  1JOC A;  2LKM A;  2O3J A;  3MTU E;  2K37 A;  3K5B A;  1CI6 B;  3AE8 C;  5AVT B;  2WMM A;  1ZR2 A;  2LR2 A;  1KYO I;  1N8R Q;  5KLV E;  2NZ2 A;  2RN0 A;  2M3B A;  3B5N B;  3L75 D;  1ZW0 A;  5KJ7 D;  2H7H A;  1S1C X;  3LIE A;  2K1A A;  1ZXG A;  2IYP A;  2O01 J;  2IFM A;  5APW A;  1S5L E;  2A45 I;  4U7J A;  3H1I E;  2IDB A;  1VF5 D;  1OZH A;  4BRY B;  1DEE G;  2RKL A;  2IYO A;  1YQ4 C;  5AVU B;  3KYQ A;  2CPS A;  3PJS K;  3B5N C;  5KJ7 A;  3HD7 B;  5E79 E;  1G1I A;  2E75 D;  1L0L D;  5KLV G;  1AV1 A;  2I1K A;  3L70 D;  3D70 A;  4PD4 H;  3P8C D;  3L72 J;  3V2N A;  3MIW A;  2IBZ D;  1SQP G;  1SVF A;  2BCC D;  1R5S A;  1HTL C;  1BSN A;  2M5A A;  4M3L A;  3H1I G;  4GOF A;  1PGP A;  1QVF O;  1JY2 N;  1VQ6 P;  3FGA D;  1AQ5 A;  3HD7 C;  3ABV C;  1N86 A;  1GZL A;  3L74 G;  2J58 A;  2W90 A;  1LTB C;  3H32 A;  1M57 D;  1FC2 C;  3VOP A;  1FAV A;  4MN4 C;  5DJU B;  1VQO P;  4EIJ A;  3I56 P;  2QEX P;  1VQ4 P;  4DJG A;  2QM8 A;  1RE3 C;  1S9K D;  5AW1 B;  3L73 J;  2IPP A;  4NPD A;  5GTI H;  1EXI A;  3CCJ P;  1T3J A;  2R32 A;  1T2K C;  2JEE A;  1ZME C;  3V5B A;  1M8O B;  1PPJ E;  4B86 A;  1EZV E;  2ZVN B;  4EOT A;  4K3A A;  3Q3D A;  1LTJ A;  4Y28 J;  3W68 A;  1NTZ G;  1SQV D;  3AE4 C;  3CCQ P;  1MZ9 A;  3M9B A;  3GHG A;  1FJK A;  2QE7 H;  1HGZ A;  1NU1 D;  1PGJ A;  3IN6 A;  5AW0 B;  1NTK J;  2OYI B;  3P32 A;  4QMA A;  3KZI E;  4L76 A;  2Z4E A;  2A06 D;  4O9B A;  2GA1 A;  1JMB A;  3A0B H;  3H1L J;  2XND H;  4C7N A;  1PPJ G;  4OGQ D;  4NPF X;  2WSC J;  3VYI A;  1EZV G;  3HE5 A;  4WVZ A;  1D7M A;  1SQX D;  1JCC A;  2PGD A;  4DZO A;  2V4H A;  3SWF A;  1W5C E;  2GUV A;  2OTK E;  2OYI C;  3MP7 B;  4DCK A;  4H44 D;  3FWN A;  1S5L X;  3WMM 0;  1Q90 D;  2XDJ A;  5AVQ B;  4Y99 B;  1L0N J;  2QJY B;  3M0A A;  1FDM A;  4D6T E;  1Y8A A;  2B87 A;  4H13 B;  2OTL P;  1NTK K;  3A7O A;  4RKU J;  2JO1 A;  3AEB C;  4IL6 E;  2V7Q H;  3CWB E;  3P8M C;  1BE3 J;  3VMX A;  4JF7 A;  3CCU P;  3L72 E;  2HR3 A;  2JWA A;  3FXE A;  1KV4 A;  2WSF H;  5BU5 A;  1HBW A;  1S4X A;  2Q3I A;  2GUS A;  2E74 B;  4Y99 C;  2QJY C;  3T97 B;  5B5E E;  5TJH A;  4TLF A;  4H13 C;  2KS1 A;  1NHL A;  3LID A;  4LLH A;  2WSE H;  2WQY C;  1EDK A;  4D6T G;  5DJT B;  2P1J A;  1RQU A;  5CMZ A;  3MUD C;  5AW3 B;  1CI6 A;  1QLE D;  5GTH E;  2YMY A;  2WVR A;  3R4Y A;  3PTZ A;  1L0N K;  2QG4 A;  2FYZ A;  2FXP A;  3L72 G;  4A7P A;  2L91 A;  2JJL A;  2QSI A;  3PRJ A;  4LGD E;  4U3F E;  3LW5 J;  1YYC A;  1KQL A;  2PFX A;  2E74 C;  1BSH A;  5H2F E;  1YHQ P;  3HD7 D;  2HOD B;  2SPZ A;  2FYU E;  1LNQ A;  3BVH A;  3H1K J;  3TF5 A;  2G8Y A;  5CBO A;  4YXW H;  2Q5U A;  2K9Y A;  1IO4 A;  2R44 A;  3H1I J;  2J59 M;  1CZQ A;  1P84 D;  4BWN A;  2WT7 A;  4Z1M H;  1KIL E;  5CCG C;  2AXT E;  3MD0 A;  1OMI A;  1T2K D;  4N78 E;  1VQP P;  2Q1K A;  4RES B;  3GF3 A;  2JR8 A;  1GW3 A;  1NTK E;  2XU6 A;  3E1R A;  1G2C B;  1IFN A;  3A0H H;  3SWY A;  1U7M A;  1LTG C;  3VP8 A;  1RE3 A;  2N9Y B;  4NPE A;  2K88 A;  3AE7 C;  1VPC A;  2YKP A;  1RF1 B;  4UB6 E;  2AEJ A;  5KLV D;  2P2U A;  1VQ7 P;  1M1J B;  3TGU E;  3CX5 I;  4DOJ A;  1NTK G;  3VN0 A;  1SQP D;  1NO4 A;  5CJ0 A;  1JY2 O;  3CI9 A;  2XKM A;  1JMM A;  3G71 P;  2NPS A;  4EI2 A;  1H0T A;  1R5L A;  1N7S B;  2XV5 A;  3RBZ A;  1EZV I;  1RF1 C;  1FZC A;  3RK3 B;  5KAI H;  3L74 D;  1N7L A;  1GL2 B;  3L71 D;  1M1J C;  1KD1 Q;  2Y9Z A;  1NTM D;  1GK6 A;  3AE6 C;  2KK7 A;  1FS0 E;  3V4W A;  3TGU G;  3H1H E;  1JY3 N;  3H25 A;  1S72 P;  5AVZ B;  3W67 A;  3CL3 D;  2HPC B;  1N7S C;  2OYI A;  1LJ2 A;  1K8A Q;  1VQK P;  3RK3 C;  1KIL B;  3C1L A;  3CCV P;  1GL2 C;  3AEF C;  1KB9 H;  4YXD C;  2FY8 A;  2L5G B;  1BE3 G;  1JO5 A;  4CPG A;  4ASW A;  3V2P A;  1IZN B;  1NTZ D;  3H1J J;  1K05 A;  2Y0C A;  4AYC A;  1OVV A;  4H13 D;  1X9V A;  1WRG A;  5AW6 B;  3OW2 O;  1OXZ A;  2QRX A;  1GU5 A;  1P84 H;  5APQ A;  4GDO A;  1A02 J;  1PV3 A;  3H1H G;  3BCC D;  3H1K E;  3O6Q A;  2M8R A;  5AW4 B;  5APV A;  2WZ7 A;  3D6Y A;  2C0X A;  3CC7 P;  1PP9 D;  3PLN A;  1KIL C;  2LXB A;  1VQ9 P;  2MJZ A;  1RH5 B;  3Q5S A;  1HVV A;  1BCC J;  1N2D C;  1IJD B;  3KPE A;  5KAF E;  4XE5 B;  1GD2 E;  4D6T J;  3HE4 B;  1EZV D;  5AVX B;  1PL5 A;  4PJ0 H;  3M0D A;  2OGU A;  3SWK A;  1EDI A;  2LXC B;  2R3C A;  3CWB J;  1NH4 A;  4IFM A;  3QWO C;  1OX3 A;  1Q7Y Q;  3CXH D;  5GTI E;  3IR9 A;  3TSI A;  1SQB E;  2FXM A;  3H1K G;  2KSE A;  1SQQ E;  3L35 A;  3D6Z A;  1IFP A;  5CCG D;  1N73 B;  2E42 A;  5AVV B;  1AVO A;  1BGY E;  2ZXE B;  5APT A;  3T97 A;  4YPC A;  1VQL P;  3AEG C;  1RHZ B;  1SLQ A;  5AW7 B;  2WPV B;  3GLM A;  2B9B A;  1SS1 A;  2ZJS E;  5KLI B;  1IFM A;  2VRS A;  1KYO D;  2KUB A;  1GK4 A;  3UIA A;  4BXL A;  3M9Q A;  1E5W A;  1JTH B;  2FFD A;  1LGH B;  3CX5 E;  4WB4 A;  3CMA P;  4U3F J;  4AQR D;  1L4A B;  1EQ7 A;  2G3A A;  1N73 C;  3L75 E;  3V6I A;  2O01 N;  1NAF A;  1SQQ G;  3E7K A;  3A0B E;  3V2Q A;  1HUC A;  2HOD A;  1HJB A;  4KHX A;  2B88 A;  2FYU J;  4RO0 A;  3B71 A;  1L2P A;  1KFM A;  1BGY G;  5KLI C;  5B66 H;  3C9I A;  4HH2 A;  4LC1 A;  1OVR A;  5TIS H;  1KQG B;  1QVG O;  2AEM A;  3L72 D;  2K9J A;  1ZN5 A;  1L4A C;  2PP6 A;  1PIX A;  2N1T B;  3WUV A;  4WY4 D;  1JY3 P;  5C39 A;  1VQM P;  3U1A A;  1L0L E;  1NOH A;  2WPQ A;  3L70 E;  4IFF A;  1UIX A;  1LP1 B;  3P8C E;  3VTP C;  3GW6 A;  2IBZ E;  5CCH C;  1LTT C;  2BCC E;  1DEB A;  4YTP C;  2C0W A;  5AVR B;  3TNU B;  1GDT A;  3H1J E;  2FYU K;  1N7S D;  3MZW B;  3R2P A;  2R5D A;  3GF7 A;  4WY4 A;  2N1T C;  2R5B A;  1DD4 A;  1RF1 A;  2Q9I A;  1AVY A;  2YIU B;  4WBA A;  2WWW A;  3RK3 D;  4JQ0 D;  3V2R A;  2BAS A;  3SFD C;  3TYY A;  1GL2 D;  3TGU J;  2QM7 A;  3L73 D;  1T6A A;  3KDP B;  3Q1M A;  2KZJ A;  1AQT A;  1L0L G;  1RE4 A;  1WMK A;  1IK9 A;  2ZAE B;  1BCC E;  2W8Z A;  2KYV A;  3L70 G;  2ZYA A;  1W2E A;  2WSS H;  4L73 A;  4UB8 H;  1S9K E;  3EQ2 A;  3CXH H;  2BCC G;  3IAO A;  2YXQ B;  3NXS A;  2H8P D;  3H1J G;  2OYO A;  2YIU C;  1K04 A;  3NFQ A;  1GL2 A;  1J1E B;  2HG5 D;  3F89 A;  3M91 A;  5K5G B;  5AW8 B;  1NTK D;  1YTZ I;  1YTZ T;  4W80 A;  1CSB A;  1SQV E;  3H1H J;  1J1D B;  3B5N D;  2OYH B;  2QA4 P;  1KYO H;  1NU1 E;  3JCU H;  1FDI A;  1BCC G;  1YI2 P;  1VF5 B;  3H1L D;  3VMZ A;  2P7J A;  2M5A B;  1JY2 P;  2PRR A;  3I5C A;  3IFM A;  2IX7 C;  2O01 H;  1IK7 A;  4EDF A;  2A06 E;  2D2C B;  1J1E C;  3CWB G;  1FZA A;  1JY3 O;  1VQ5 P;  4ZMD A;  2A45 H;  3S4R A;  1LWU B;  3A0H E;  1SQX E;  2K3R A;  2KLV A;  3B5N A;  1J1D C;  3VP9 A;  2OYH C;  1JNM A;  3HUS B;  2JP3 A;  1JM0 A;  1SQV G;  1VF5 C;  1S2E A;  4HKZ H;  4L75 A;  1L0N D;  1RF0 C;  4W7Y A;  1NU1 G;  2W27 A;  1M1K Q;  2D2C C;  3VMA A;  4BRY A;  1KTM A;  1QL1 A;  2E43 A;  1BE3 D;  2ITA A;  1LWU C;  2CPB A;  3KQG A;  4GOD A;  3BAT A;  3HD7 A;  2KZI A;  2FKW B;  3HUS C;  2QJK B;  1FU1 A;  2H88 C;  4U3F G;  1ZR4 A;  1SQX G;  3CLQ A;  3B8E B;  3U59 A;  3GHG B;  1HH0 A;  1FE6 A;  1SQB J;  2FYU G;  1KFN A;  1Q86 Q;  1SQQ J;  3USS A;  2XNX A;  1T3U A;  5KAI E;  5AVS B;  1BGY J;  1M56 D;  4ZKP A;  4OH8 B;  3AED C;  1NAY A;  4I2L C;  1IC2 A;  1HWT C;  2H43 A;  1NKZ B;  1OW8 A;  3N4X A;  3SSU A;  2QJK C;  1X79 B;  2PAJ A;  1OWA A;  3OA7 A;  1VQN P;  5CCH D;  3GHG C;  1PGO A;  1Q81 Q;  2Z5H A;  3CPW O;  1JTH A;  1R8E A;  1FZG A;  1FJP A;  3FWL A;  3H1K D;  3HRN A;  1NYH A;  2QIW A;  2Z5I A;  1DX7 A;  3L75 J;  1RQV A;  1KZU B;  3H1I D;  1KQS O;  3CD6 P;  2N1T D;  1KB9 E;  4GKG A;  3EWK A;  4KJM A;  5APS A;  1K73 Q;  3OJA B;  4IL6 X;  4OGQ B;  2YKO A;  1SQB K;  2FXO A;  1H89 A;  3F5H A;  1LT1 A;  3NMD A;  5KKZ B;  3AE1 C;  2B87 B;  1SQQ K;  4ZKU A;  1TU3 F;  1P84 E;  3U1C A;  3G9R A;  1SFC B;  3S9O A;  1USD A;  2WSC H;  2I1J A;  2IFN A;  4H44 B;  3MGN A;  5AW9 B;  2KSJ A;  3VMY A;  5KTB A;  1FOS F;  1L0L J;  2ZYD A;  2H89 C;  4L74 A;  1OW6 A;  3L70 J;  1KQF B;  4OGQ C;  2IBZ I;  5APX A;  1LP1 A;  3ZDM A;  5KKZ C;  2WTY A;  2KS1 B;  2BCC J;  1YIT P;  3MHV A;  2V7Q J;  1JEK A;  1RY3 A;  3TNU A;  4PD4 E;  1GW4 A;  2JDI H;  1SFC C;  2AXC A;  5CBN A;  4K35 A;  3L37 A;  4H44 C;  3PH0 A;  1ZV8 A;  2WSF J;  2O1J A;  1GU4 A;  3CX5 D;  3CCR P;  2XZR A;  1ZRT E;  3WU2 H;  2C9L Y;  2WSE J;  2KNC B;  1SQP E;  2NRG A;  1PPJ D;  2E74 D;  3G3Z A;  1OIP A;  2E5T A;  2W6A A;  2KIK A;  1L0L K;  1BDD A;  2WIT A;  1CW5 A;  2ZFC A;  2WT7 B;  3MUD A;  5M1B A;  2D2C D;  3L74 E;  4H0L B;  2IZ1 A;  3L71 E;  1PZQ A;  1EDL A;  2B89 A;  1NTM E;  1SQV J;  3RK2 B;  1JUN A;  4HYT B;  5CHX A;  5B66 E;  2IZ0 A;  2N9B A;  2DW3 A;  2E76 B;  2OYH A;  4JYB A;  1NU1 J;  3AEA C;  3LW5 H;  4AUW A;  5TIS E;  4XFJ A;  1RF0 A;  3M9H A;  1NJI Q;  1URQ B;  2OTJ P;  1EDJ A;  3H1J D;  3IF4 A;  1S5L H;  1YJW P;  3PP5 A;  1JCD A;  1Q2N A;  2HLO A;  4H0L C;  3G4S P;  1YJ9 P;  1E79 H;  3L4F A;  1AA0 A;  1LWU A;  5KAF H;  4JYC A;  1SQB G;  1SQX J;  1VDF A;  5CCG A;  3RK2 C;  3L71 G;  1NTZ E;  3EFF K;  1ZOY C;  2E76 C;  1NTM G;  4GOE A;  3S1K A;  4GIF A;  3HUS A;  3EFG A;  5E79 H;  1BCC D;  3QH9 A;  1FBM A;  2HYN A;  1GMJ A;  1YJN P;  3BCC E;  4D6T D;  3RL0 B;  1OVU A;  1URQ C;  2NPS B;  1X0T A;  1H0T B;  3BRV B;  1PP9 E;  4C46 A;  4PV1 B;  4WWI A;  1PFI A;  1SQV K;  4W7Z A;  4XA4 A;  3CWB D;  1SP4 A;  4HJG H;  1FZC B;  2JKV A;  1NU1 K;  1XTG B;  1H8A A;  2ZVO B;  2J5U A;  1T8Z A;  3KHU A;  1FZF A;  2AEF A;  2RMZ A;  3Q5R A;  1LTA C;  4DT0 A;  1M7L A;  1G2C A;  1Z56 A;  4UB8 E;  2YNY A;  3L75 G;  3SFE C;  3O8Z A;  3CXH E;  4RJT A;  3RL0 C;  3HTK B;  1LT9 B;  2ZT9 B;  2NPS C;  1LTI C;  1VL2 A;  1H88 A;  4PV1 C;  1HJ0 A;  4C7R A;  3AE2 C;  3BCC G;  1SQX K;  3CX5 H;  4I7Z B;  3CCL P;  2OAR A;  1FZC C;  1PP9 G;  1EC5 A;  2E5Y A;  3M06 A;  2M0B A;  4OVN F;  1DD3 A;  2W6B A;  3D71 A;  1NWQ A;  1OW7 A;  4ZNC A;  2KP8 A;  4U3F D;  3B4S A;  3V4Q A;  5AVY B;  1U57 A;  1M1J A;  1KYO E;  3JCU E;  4N6J A;  1LT9 C;  2KOG A;  2ZT9 C;  3GMA A;  3ITK A;  4N3Y B;  3H6P A;  2FYU D;  1MFZ A;  4OWF A;  1SFC D;  1MUU A;  3O6Q B;  2P58 A;  1KB9 I;  2BEQ D;  2IBZ G;  4I7Z C;  1WT6 A;  3CCM P;  1NVO A;  4IFD K;  2FYN B;  1N7S A;  2UWJ E;  1AFO A;  1JB0 J;  3TDK A;  1X8Y A;  3KZI H;  3I55 P;  5BVZ A;  1KIL D;  2HFE D;  1P84 I;  2W6J H;  1UII A;  3A2A A;  4N78 D;  1MKM A;  3Q5P A;  4TT3 H;  5APU A;  1G1J A;  2O1K A;  3FX0 A;  3BRT B;  3A3Y B;  2YKQ A;  1SFC A;  2KLU A;  2YO2 A;  3WUU A;  2QJP B;  1KN7 A; 
#chains in the Genus database with same CATH homology
 4I2L C;  5APQ A;  4B86 A;  1IC2 A;  1A02 J;  1HWT C;  2H43 A;  2M8R A;  5AW4 B;  5APV A;  2WZ7 A;  1NKZ B;  4EOT A;  3N4X A;  2C0X A;  2HPC A;  1X79 B;  1KIL C;  2P67 A;  2PAJ A;  1LTJ A;  1OWA A;  2MJZ A;  3OA7 A;  5CCH D;  3GHG C;  3NTN A;  1HVV A;  1N2D C;  1KIL A;  2Z5H A;  1MZ9 A;  1IJD B;  1JTH A;  3KPE A;  1FZG A;  3M9B A;  2A45 G;  1FJP A;  1J2J B;  3GHG A;  1FJK A;  3M0D C;  4XE5 B;  1GD2 E;  1HGZ A;  5KJ7 C;  3HE4 B;  5AVX B;  3HRN A;  3M0D A;  5AW0 B;  1IFI A;  2Z5I A;  5BU8 B;  1DX7 A;  2OYI B;  1KZU B;  3P32 A;  2N1T D;  3H32 B;  1DH3 A;  2R3C A;  4GKG A;  3E1I A;  1NH4 A;  4IFM A;  2Z4E A;  5APS A;  4I6M C;  3OJA B;  2YKO A;  2FFD B;  4O9B A;  1SQB K;  3IR9 A;  3TSI A;  1H89 A;  4C7N A;  2FXM A;  3NMD A;  1SQQ K;  4ZKU A;  3VYI A;  3HE5 A;  3N7N A;  3L35 A;  1JCC A;  5CCG D;  3U1C A;  4DZO A;  1N73 B;  1SFC B;  5AVV B;  2E42 A;  2WSC H;  1FZB A;  1LTS C;  2I1J A;  2ZXE B;  5APT A;  1IFJ A;  3T97 A;  2IFN A;  3SWF A;  2WPR A;  3RK2 D;  3MGN A;  5AW9 B;  1A02 F;  1SLQ A;  5AW7 B;  2KSJ A;  2GUV A;  3VMY A;  3HE4 A;  5KTB A;  1FOS F;  2OYI C;  1FOS E;  1IFD A;  1ZLL A;  3A5T A;  1HGV A;  1IFM A;  2VRS A;  1LTJ B;  3OAK A;  3WMM 0;  2FFD C;  1GK4 A;  5APX A;  3UIA A;  1URQ D;  3M9Q A;  2XDJ A;  1E5W A;  1JTH B;  3TK1 A;  5AVQ B;  2FFD A;  4Y99 B;  2WTY A;  3M0A A;  1FDM A;  1LGH B;  1MV8 A;  4WB4 A;  1RY3 A;  4AQR D;  1L4A B;  1NTK K;  3TNU A;  3A7O A;  1EQ7 A;  1GW4 A;  2Q7C A;  1N73 C;  1SFC C;  3II6 A;  1FZE A;  5AW2 B;  3L37 A;  1NAF A;  2C9N Y;  1L4A D;  3V2Q A;  1HUC A;  2HOD A;  4KHX A;  1HJB A;  1N73 A;  1ZV8 A;  3P8M C;  3BAS A;  3VMX A;  2O1J A;  5APY A;  1QL2 A;  4JF7 A;  1GU4 A;  1KFM A;  5KLV K;  3C9I A;  4C7N B;  2XZR A;  4HH2 A;  4LC1 A;  2WSF H;  5BU5 A;  1LTJ C;  1HBW A;  3HE5 B;  1URQ A;  3RL0 D;  2Q3I A;  2C9L Y;  2NPS D;  2GUS A;  1SQP K;  4Y99 C;  4WY4 B;  1ZN5 A;  1L4A C;  2PP6 A;  3G3Z A;  1NHL A;  2N1T B;  4WY4 D;  3P7K A;  5AVW B;  1JY3 P;  3LID A;  2W6A A;  2WPS A;  2WSE H;  4LLH A;  1L0L K;  1L4A A;  1NKN A;  1XTC C;  3U1A A;  2P1J A;  1NOH A;  2WIT A;  2WPQ A;  1CW5 A;  5CMZ A;  2ZFC A;  5AW3 B;  1CI6 A;  4IFF A;  2WT7 B;  3P8C E;  3VTP C;  2YMY A;  4GT1 A;  3MUD A;  2YO3 A;  1L0N K;  2FYZ A;  5CCH C;  1LTT C;  1DEB A;  1NTM K;  2JJL A;  2C0W A;  5AVR B;  4LGD E;  3TNU B;  1YYC A;  1KQL A;  5CCH A;  1GDT A;  2POH A;  3RK2 B;  1JUN A;  4HYT B;  5CHX A;  3HD7 D;  4WY4 C;  2HOD B;  2FYU K;  2N9B A;  1N7S D;  2OYH A;  4JYB A;  3R2P A;  2R5D A;  3LW5 H;  3BVH A;  4AUW A;  4WY4 A;  2N1T C;  2R5B A;  1RF1 A;  2Q9I A;  2GM4 A;  1GTW A;  4WBA A;  2Q5U A;  2WWW A;  2N1T A;  3RK3 D;  1IO4 A;  2J59 M;  4I1L A;  3V2R A;  2BAS A;  1RF0 A;  3TYY A;  1GL2 D;  1CZQ A;  2KB7 P;  3M9H A;  2QM7 A;  1URQ B;  1RE4 C;  3KDP B;  3L36 A;  5CJ4 A;  1RE4 A;  3PP5 A;  2WT7 A;  1IK9 A;  1JCD A;  2HLO A;  2KYV A;  3HTK A;  5AW5 B;  1LT9 A;  1W2E A;  3L4F A;  5CCG C;  3MD0 A;  1S9K E;  3EQ2 A;  1T2K D;  1LWU A;  1NTZ K;  4JYC A;  4N78 E;  1JOC A;  4RES B;  1VDF A;  5CCG A;  3RK2 C;  2LKM A;  1GW3 A;  3MTU E;  2XU6 A;  1G2C B;  3NXS A;  1IFN A;  1CI6 B;  3SWY A;  2H8P D;  4GIF A;  3HUS A;  3EFG A;  5AVT B;  1ZR2 A;  1FBM A;  2HYN A;  3NFQ A;  1GL2 A;  1LTG C;  3RL0 B;  1J1E B;  2HG5 D;  1URQ C;  2NPS B;  3M91 A;  3VP8 A;  3BRV B;  1RE3 A;  4C46 A;  5AW8 B;  2M3B A;  3B5N B;  1PFI A;  1SQV K;  1YTZ I;  1YTZ T;  4W80 A;  5KJ7 D;  4W7Z A;  1CSB A;  2H7H A;  4XA4 A;  1J1D B;  1SP4 A;  3LIE A;  3B5N D;  1FZC B;  2OYH B;  1NU1 K;  1VPC A;  1XTG B;  2YKP A;  1H8A A;  1RF1 B;  2IFM A;  5APW A;  3VMZ A;  2P2U A;  1T8Z A;  2A45 I;  2P7J A;  1FZF A;  1JY2 P;  1LTA C;  1M1J B;  3I5C A;  3IFM A;  1M7L A;  2IX7 C;  2O01 H;  1G2C A;  1Z56 A;  4DOJ A;  2YNY A;  3VN0 A;  3O8Z A;  1NO4 A;  5CJ0 A;  5AVU B;  3RL0 C;  3HTK B;  1J1E C;  1LT9 B;  1FZA A;  2NPS C;  1JY3 O;  3KYQ A;  1LTI C;  2CPS A;  1JY2 O;  2A45 H;  3CI9 A;  1H88 A;  2XKM A;  1JMM A;  4C7R A;  3B5N C;  5KJ7 A;  1LWU B;  2NPS A;  1SQX K;  3HD7 B;  1G1I A;  2KLV A;  3B5N A;  1J1D C;  1N7S B;  3VP9 A;  2XV5 A;  2OAR A;  1FZC C;  2OYH C;  1JNM A;  2I1K A;  3M06 A;  3HUS B;  3P8C D;  1RF1 C;  3V2N A;  1FZC A;  3MIW A;  2W6B A;  3RK3 B;  1NWQ A;  1N7L A;  1GL2 B;  4W7Y A;  1RF0 C;  1SVF A;  2W27 A;  1M1J C;  2KP8 A;  1HTL C;  3V4Q A;  1GK6 A;  5AVY B;  4M3L A;  1M1J A;  3V4W A;  4N6J A;  1LT9 C;  2KOG A;  4N3Y B;  3H6P A;  1QL1 A;  1JY3 N;  2E43 A;  1MFZ A;  1JY2 N;  1SFC D;  1MUU A;  1AQ5 A;  1LWU C;  5AVZ B;  3HD7 C;  1N86 A;  1GZL A;  3CL3 D;  2CPB A;  2HPC B;  1N7S C;  3KQG A;  1WT6 A;  2J58 A;  2OYI A;  3BAT A;  3HD7 A;  4IFD K;  1LTB C;  3H32 A;  2FKW B;  3HUS C;  1N7S A;  1FU1 A;  1ZR4 A;  1AFO A;  3VOP A;  1FAV A;  3RK3 C;  1KIL B;  3CLQ A;  3B8E B;  1GL2 C;  3U59 A;  3GHG B;  1HH0 A;  1X8Y A;  4EIJ A;  5BVZ A;  2L5G B;  1KIL D;  2HFE D;  1JO5 A;  1KFN A;  2QM8 A;  1RE3 C;  1S9K D;  5AW1 B;  3A2A A;  4N78 D;  2IPP A;  2XNX A;  3V2P A;  5APU A;  1T3U A;  1G1J A;  2O1K A;  3BRT B;  1T3J A;  4AYC A;  5AVS B;  2R32 A;  1X9V A;  3A3Y B;  2YKQ A;  1SFC A;  1WRG A;  5AW6 B;  1T2K C;  2JEE A;  2YO2 A;  4ZKP A;  4OH8 B;  3V5B A;  1OXZ A;  1GU5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...