1N7SA

High resolution structure of a truncated neuronal snare complex
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
63
structure length
63
Chain Sequence
GSNRRLQQTQAQVDEVVDIMRVNVDKVLERDQKLSELDDRADALQAGASQFETSAAKLKRKYW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords vesicle-associated membrane protein 2
publication title High Resolution Structure, Stability, and Synaptotagmin Binding of a Truncated Neuronal SNARE Complex
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Transport protein
total genus 28
structure length 63
sequence length 63
ec nomenclature
pdb deposition date 2002-11-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.110 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 1n7sA00
3HD7C 3PP5A 2H8PD 4WY4D 1GL2D 1JTHA 2N1TD 4WY4A 1GL2A 2N1TA 1N7SD 1HVVA 2HG5D 1XTGB 2NPSB 3B5NC 3RK2B 1N7SA 5CCHD 2M8RA 4LGDE 2NPSD 5CCHA 3RK2D 1SFCC 5CCGC 2YMYA 2HFED 1L4AC 4N78E 3HD7B 2KOGA 1URQC 3HD7D 1N7SC 1KILC 5KJ7C 3RK3C 3TSIA 3HD7A 3B5NB 3M0DC 2NPSA 3VOPA 3B5ND 1SFCB 2PP6A 1NHLA 3B5NA 4W7ZA 3RL0C 3KYQA 3P8CE 2XDJA 1SFCD 4WY4C 1GL2C 2N1TC 1SFCA 4JF7A 2WZ7A 3HTKB 1L4AB 1JTHB 5CCGD 1L4AD 5CCHC 5CCGA 1URQB 1N7SB 2NPSC 1L4AA 1KILB 3RK3B 3RK2C 1URQD 1T3JA 4OH8B 1KILD 5KJ7D 3RK3D 1URQA 4W80A 1KILA 5KJ7A 3RL0B 4W7YA 4WY4B 1GL2B 2N1TB 3RL0D
chains in the Genus database with same CATH superfamily
1SQPG 3GW6A 3T97B 4IFFA 1JY2P 1SQQJ 3ABVC 5DJTB 3SWFA 2KLVA 1QL1A 5BU8B 1KQLA 1PP9J 1M1KQ 1OVUA 3RK2D 1Q81Q 3FX0A 1H8AA 2JKVA 4KJMA 4U3FE 3Q5SA 2OYHA 1MZ9A 1PPJD 1IFPA 1S1CX 3M0AA 3H1JD 3PTZA 4PD4I 3NXSA 1W5CE 3AE3C 1BE3E 1WRGA 1N7LA 3KZIH 5CJ4A 2BCCJ 2IFNA 1KB9E 2KIKA 3A5TA 4OGQD 3CCRP 1W2BO 1USDA 2JWAA 2E74D 1KQSO 1FZCB 1ZP0C 1K05A 2M5AA 1YYCA 2QJPC 1RY3A 1J1DB 1PPJE 3N4XA 2POHA 5AVWB 4PV1C 3AE2C 1KN7A 4RO0A 2RH0A 3G71P 1SQVK 3H1LD 3KHUA 2PGDA 3H1HG 2RKLA 2QJYB 1R5SA 2K88A 1Z56A 1M1JA 2OARA 1L0LK 2ITAA 1SQBG 1ZR4A 1YJNP 1S5LE 1JY2O 1CW5A 1YQ3C 1Q2NA 2WSEJ 5KAIE 2KS1A 2YO2A 3AE8C 3VYIA 1BE3J 3GHGB 3ZDMA 2QJKC 3WU2E 4L76A 5KKZC 5C39A 1RQUA 4A7PA 4PD4H 1PFIA 3PJSK 4L74A 3AEDC 1N73B 1MFZA 1VQ6P 2Q3IA 1RH5B 1ZXGA 2G8YA 2Y9ZA 1OXZA 2XU6A 3M9HA 1FS0E 3P32A 2H7HA 1DEBA 2A45I 3CXHI 2XDJA 1AVYA 3L73D 2FYUG 1EDIA 3F89A 2YKPA 3TF5A 2BEZF 3IR9A 2WSCJ 2N9BA 1YQ4C 2P67A 2ZT9D 1VQ4P 2NZ2A 5APQA 2QM8A 1FZAA 4GOEA 1SQVD 2IBZE 5CBOA 2D2CB 3MIWA 5K5GB 2YMKA 4JBZA 2Y0DA 5AVXB 1NTMK 3VMYA 1PGPA 2E75B 2ZT9C 1USEA 2QIWA 3GMAA 3L74D 1FDOA 1FE6A 2QSIA 1KILE 2NPSD 3L73E 4U7JA 2WT7B 3LW5J 1KD1Q 5KLVK 1FJPA 3I56P 3G3ZA 3E1RA 1R5LA 2E5YA 3CD6P 5AW8B 2KOGA 3M0DC 3E1IA 3WUTA 2MJZA 1L0LE 5TJHA 1L2PA 4H0LD 2Q9IA 2WPRA 2A45H 3CXHH 2N1TC 1GU5A 2AXCA 1IZNB 2GA1A 4I2LC 5CCHC 2Y9YA 1EDKA 3HTKA 1NTMD 2WQYC 2WPVB 4Z1MH 2HLOA 3EQ2A 4OVNF 3VMAA 3L71D 4W80A 2KYVA 3CX5H 2Q6QA 4C46A 1RF0A 1YHQP 2B88A 1JEKA 1OWAA 2JDIH 1ZLLA 3P8CD 1QL2A 3L73J 4NPDA 4C7RA 5M1BA 1NTZD 1SQQK 1S5LX 2CPSA 4UB6E 2DW3A 5L8RJ 3QH9A 1DD4A 3BRVB 1KORA 2I8DA 3A2AA 3UIAA 1RF0C 1KMIZ 1IFIA 2QJPB 1VQ8P 2WSSH 1X0TA 3KDPB 2ZAEB 4PV1B 2FFDA 3V6IA 1NVOA 1LTJA 1VQPP 3VP9A 3HRNA 1NTME 1L0LJ 4L73A 1VQ5P 3L71E 3D71A 4JYCA 5APVA 1QVGO 1NKZB 3H1JG 4N3YB 4PJ0H 4D6TE 2Y0CA 1NU1K 3KYQA 3P8CE 2FFDC 5CJ0A 1M90Q 5KLVE 2WTYA 1T2KC 3V4WA 4Y28J 1LWUA 1OW8A 2QJKB 5KKZB 1A02F 1LT9A 4BWNA 5KJ7D 5KJ7A 3V2PA 1JO5A 3L75E 3NMDA 1SQQD 4UB8H 2AEJA 3PHLA 1EXJA 3TNUA 5BU5A 5AVQB 1LWUC 1A02J 1PP9D 4WY4D 2FYZA 1PGOA 4WY4A 2I1KA 2C0XA 3B5NC 1FOSE 3H1LG 1D7MA 2AEFA 1BCCG 1KYOI 4LC1A 4HKZH 1H88A 2FBWC 1PZQA 1G2CB 2V7QJ 1YIJP 3EWKA 5AVTB 4H44C 4EIJA 2A06D 3L71J 2SPZA 2O1KA 1VQMP 3CLQA 3OJAB 2OTLP 2WVRA 3G4SP 4D6TJ 4BXLA 3HD7D 3CCEP 3HD7A 4I7ZC 5GTHH 1HH0A 4IL6H 3GF3A 3C8VA 5KLVJ 1NOHA 3USSA 3BATA 3MZWB 1JY3P 3KZIE 2QRXA 2YXRB 2YXQB 1N86A 1NTKK 1S9KD 1NWQA 1YITP 1IFJA 3V2NA 4ZKPA 1BSNA 1VF5D 3AE6C 4H13C 2OTJP 1FOSF 3L75J 2B87B 3M9QA 3RK3D 1GTWA 2A06E 2BEQD 1OVRA 1NU1E 4PD4D 2N1TB 2AEMA 2QE7H 3TGUG 1JTHA 2OQQA 1RE4A 1NH4A 2M3EA 3FXDA 4YXWH 2IYOA 1K73Q 1SQXG 2OYIA 1RF1A 1CZQA 1KYOH 3MHVA 1NGMB 2PAJA 3L74G 3CC4P 4IFMA 3H1KD 1L4AC 3TYYA 4IOIH 3M91A 3V2QA 5B66H 1BDCA 3IFMA 2K37A 2B89A 3RK3E 5CMZA 5H2FH 1L0NG 1ZOYC 2OYIC 2WWWA 3P7KA 1RF1C 3VOPA 3LIDA 1S72P 4PD4E 1NHLA 2N9YB 2QG4A 1SFCD 1Q90D 1SFCA 2YO3A 3HUSA 4KT0J 1CSBA 4I6MC 5CCGD 4JPZB 1JMBA 1JY3O 5CCGA 1FC2C 4TLFA 1U7JA 3RK2C 1X8YA 3GLMA 1NU1J 1T3JA 3CMEP 2OYHC 4TT3H 4M3LA 2AXTH 2HODB 4XE5B 5B5EH 3H1KE 4R4MA 4JYBA 2FFDB 1QLED 3W68A 3NFQA 1XTGB 1NTKE 2H8PD 3AE1C 3WUVA 1EZVG 1UIIA 3H1IG 1VQKP 2GUSA 3CXHD 3JSVC 4OGQC 1W2EA 5DJUB 1JMMA 1NTZG 2YIUC 1DIPA 1LP1A 3U1AA 2O01N 1JCCA 2E74C 4HYTB 1LWUB 5APUA 1S3JA 1IK7A 4DOJA 2QA4P 3NTNA 4HJGH 3CX5D 3BCCD 3AE7C 1RE3A 2YNYA 3B5NB 3G6EP 1NAFA 2KUBA 3L72D 2IBZD 3CWBG 1GDTA 1IJDB 2K9JA 4H44B 1PV3A 1CI6B 2R5DA 2KNCA 3CCVP 1S2EA 3H32A 1M1JC 2HPCA 3CXHE 3U59A 1Q86Q 4DT0A 3B71A 3H1KJ 4WVZA 1SQPK 5GTIH 1URQD 1GU4A 2P10A 5E79E 2J59M 1KILD 1VQ7P 1URQA 1NTKJ 2RN0A 1J1EC 1KILA 1GW4A 1Y47A 3KPEA 1FAVA 2P7JA 3EFFK 3CX5E 3BCCE 1OVVA 4H13B 2JJLA 3L72E 1MKMA 2HG5D 3R4YA 1KFMA 1OW6A 1VQOP 3L37A 2VRSA 2OGUA 4LGDE 1HUCA 5KTBA 1L0LD 4BRYB 1QX8A 3AE4C 4K3AA 2H43A 2LKMA 3WUUA 1YTZT 1HGZA 2K3RA 1DEEG 1JOCA 5AW6B 1P84I 2O01J 3L70E 3TDKA 5AW1B 2BCCG 2NPSA 3V2RA 3A0BE 2V4HA 1OFCX 1BGYE 1SQPD 5KAFH 3B8EB 3U1CA 4PJ0E 3GF7A 1L4AB 1JTHB 4RESB 1NYHA 2UWJE 5KLIC 2W6JH 2O01H 2KSJA 2NPSC 2Q3EA 1YJ9P 5BVZA 1JNMA 1RF1B 3BCCJ 1WT6A 4AQRD 2FYNC 1VQNP 3L72J 3TGUE 4GIFA 3RL0D 1SQBK 5E79H 1SLQA 5APWA 4UB8E 3PP5A 1GL2D 1KQFB 2JWDA 1EDLA 1FZFA 4EOTA 1PIXA 2PFXA 2WITA 1GL2A 1LTBC 1N8RQ 4U3FG 3R2PA 1IC2A 4AYCA 1H89A 3RK2B 2IYPA 1OZHA 4H0LC 2K1AA 2OYHB 1SQPE 2BASA 1GK6A 3KQGA 3W67A 1QEXA 4D6TD 3RBXA 2WMMA 3L70J 1BE3G 4Y99C 5KLVD 4B86A 2QEXP 3Q5PA 2FYUK 2LXCB 2YKOA 3SWYA 1BGYJ 3D6ZA 1P84H 2WSFH 4OGQB 5GTHE 2YIUB 1FZGA 2L91A 3L75D 5APSA 4IL6E 1LTSC 2E74B 3TK1A 1JUNA 1Y9BA 3A0BH 1PPJG 1KYOD 3II6A 2IZ0A 2M5AB 2FXPA 2R3SA 1SQBD 3TGUJ 1YJWP 2W90A 2E43A 2W6AA 1FZCA 5AVSB 1T6AA 1LTJC 3MD0A 4ASWA 4NPFX 3RL0g 5AVVB 3O6QA 1FU1A 4K35A 5EFWB 2XKMA 3OAKA 5AVRB 1M1JB 2ZYGA 1SQPJ 3C9IA 4DCKA 1JY2N 4O9BA 1N7SD 2J58A 1EZVI 4GKGA 2ZFCA 1N7SA 3N7NA 1AV1A 3CCMP 2KS1B 3SFEC 2FYUD 3KXDA 1J1EB 3IN6A 3JCUE 3H1HE 1UIXA 1J1DC 2KNCB 1KYOE 2YMYA 2E5TA 4ZKUA 1LT9C 2KK7A 1SQBE 3L4FA 3AEFC 3A3YB 1ZRTD 1N7SC 3AE5C 3L35A 5KJ7C 3CWBE 4XA4A 3GHGA 5B66E 2IFMA 1FZBA 1FDIA 2P58A 5H2FE 1M57D 4WWIA 1N73A 4WY4C 1NU1D 2XNXA 2ZT9B 1DH3A 3MP7B 1IFNA 3MUDA 2KSEA 1KTMA 2FYUE 3FWNA 2Z5HA 3Q2YA 1ZMEC 1HJBA 1LJ2A 2R32A 1SP4A 2D2CD 2AXTE 5B5EE 2R44A 1ZRTE 3HD7C 3L73G 1EXIA 5AW3B 5KLIB 3H1HJ 1X9VA 2JEEA 2NPSB 2E75D 3A0HH 1GMJA 1EDJA 5CBNA 1XTCC 4XFJA 1SQVG 1N2DC 1SQBJ 2KI7B 1T8ZA 1DX7A 2FYNB 2W83C 1VF5C 3CWBJ 1Y8AA 3V5BA 2WT7A 1L0LG 1LTTC 3CCLP 2LR2A 1EC5A 1VPCA 4HH2A 3JCUH 1GZLA 1OW7A 2RMZA 4C7NA 3RK3C 1T3UA 1HGVA 4IL6X 4H0LB 1S4XA 1K04A 2ZJSE 3I5CA 1RE4C 1OMIA 2FYUJ 3HTKB 4Y99B 3VMXA 4LLHA 1NTKD 3P8MC 2YKQA 2W6BA 4N78D 1LTIC 1K8AQ 5TISH 2W8ZA 1K9MQ 2E76D 3CC2P 5GTIE 2WPSA 1BSHA 1SS1A 3WMM0 1KFNA 3FWLA 2QM7A 3VP8A 4ZNCA 1LT1A 4EDFA 3OW2O 3GG2A 1KC8Q 1LTAC 2E76C 2WPQA 1NO4A 1NKNA 1NTMG 1SFCC 3M06A 3HUSC 1LTJB 3L71G 3H25A 5CCGC 1MV8A 2P1JA 1U7MA 3SSUA 4N78E 4PV1D 4D6TG 3V4QA 1IFDA 3PLNA 3SFDC 3CCUP 1KV4A 1KB9I 1ZN5A 5AVUB 5KLVG 1RQVA 1AA0A 4W7ZA 2O3JA 3O6QB 3VN0A 2QVAA 1IO4A 3AECC 1LT9B 3AEAC 5KAFE 3H6PA 3H1JE 2XZRA 3L75G 1Q7YQ 2NRGA 1N7SB 1BCCD 1NAYA 1U57A 1FZEA 3I55P 3LIEA 3TNUB 1E79H 4U3FJ 2JO1A 2J5UA 4WB4A 1ZW0A 2C0WA 3MGNA 3CCJP 3CI9A 1HBWA 1SQXK 4W7YA 1P84D 4WY4B 1RE3C 1GD2E 1H0TA 1BDDA 3S1KA 4I7ZB 4DJGA 1HVVA 3L70D 2ZXEB 3CL3D 3G9RA 3ITKA 4EI2A 2Z4EA 2Y0EA 1LNQA 1YBKA 1PL5A 2ZYDA 4N6JA 1L0NK 1BGYD 1SQQG 1G2CA 2WSEH 2HFED 1FJKA 3H1LE 3HD7B 3BRTB 1BCCE 1R8EA 1PP9G 1URQC 2C9NY 3S4RA 1KILC 1PGQA 3TSIA 1KB9H 4DZOA 4MN4C 1P84E 2PP6A 3H1JJ 4L75A 3CX5I 1QVFO 4GDOA 1VF5B 3TGUD 1RHZB 2A06G 1E5WA 2IBZI 3IAOA 4ASVA 1G1IA 1GW3A 1SQXD 2WSCH 1NU1G 3D6YA 1VDFA 3RK3B 2HYNA 1ZR2A 2OTKE 4OH8B 1OIPA 1Q82Q 1MUUA 3M0DA 2B87A 2JP3A 2M0BA 5AW9B 1NTZK 5CHXA 2N1TD 1M7LA 2K9YA 1L0ND 4C7NB 2OYIB 2N1TA 2GUVA 1HF9A 2FXMA 4IFDK 3HE5A 1FDMA 1S5LH 1SQVE 5CCHD 1AFOA 2M8RA 5KAIH 1WMKA 5CCHA 2ZVOB 3H1LJ 1BCCJ 2M3BA 1SVFA 3HE4A 4AUWA 1VL2A 1J2JB 3LW5H 1LTGC 3WU2H 1SQXE 2H88C 3T97A 1HJ0A 1MFTA 1IFMA 2KXPB 1M8OB 1GK4A 3L74E 2WSFJ 2IX7C 5AW7B 2E76B 2KZJA 4HB1A 1HTLC 2KLUA 1SFCB 1JB0J 3HUSB 2R5BA 2L5GB 3RL0C 1JY3N 3AE9C 1GL2C 1YI2P 1L0NE 1EZVD 2WZ7A 3H1ID 2MKVA 3BASA 3H1KG 1DD3A 1AQTA 3A7OA 3K5BA 4OWFA 2FKWB 2Q5UA 4KHXA 4GT1A 2IPPA 1IK9A 3PH0A 3Q5RA 1JCDA 2CPBA 1NTKG 4JQ0D 1ZV8A 1X22A 1YTZI 3H1HD 5AVYB 3S9OA 3AEGC 2HODA 3B4SA 1SQVJ 2G3AA 2PRRA 3CMAP 1T2KD 3RGUA 3CWBD 4RJTA 4CPGA 1LP1B 3CPWO 2LXBA 1QGKB 1SQXJ 2XV5A 3A0HE 2C9LY 1EZVE 2KZIA 3H1IE 3VTPC 3L74J 2R3CA 3CC7P 1M56D 3OA7A 2Q7CA 5APTA 1NTZE 1FZCC 2W27A 3CCQP 3AEBC 1KZUB 3PRJA 4YXDC 4ZMDA 3FXEA 2FY8A 2K9JB 1L0NJ 3B5ND 4RKUJ 2A45G 3VMZA 3B5NA 1KQGB 3H32B 2HPCB 1JM0A 3IF4A 1H0TB 4JF7A 4H44D 2B9BA 4GOFA 1EQ7A 2QJYC 4R4LA 1X79B 2H89C 1URQB 1CI6A 1KILB 3QWOC 3RBZA 5AW5B 3BCCG 5AW2B 3E7KA 3Q3DA 1AVOA 5TISE 3L72G 2IBZG 3FGAD 2ZVNB 1NTMJ 4UB6H 2JR8A 3GHGC 1AQ5A 3M9BA 1HWTC 3CCSP 1PGJA 3L36A 2BCCD 4H13D 3H1IJ 5AW0B 1G1JA 1FBMA 1N73C 3BVHA 1LGHB 4NPEA 1SQQE 1TU3F 3L70G 1NTZJ 2V7QH 2ZXXA 1VQLP 4WBAA 2FXOA 1PP9E 3EFGA 4BRYA 3MUDC 2Q1KA 1VQ9P 3MTUE 5APYA 1BGYG 3D70A 2CK3H 3F5HA 2ZYAA 4I1LA 5AVZB 5AW4B 2IZ1A 2D2CC 1NJIQ 3Q1MA 2E42A 2BCCE 4U3FD 3AEEC 3JC22 2E75C 5APXA 2GM4A 1L4AD 2OYOA 4EYYQ 3HE5B 3O8ZA 1L4AA 4QMAA 4GODA 4YPCA 2O1JA 2Z5IA 2HR3A 2KB7P 2KP8A 1AJYA 2I1JA 3HE4B 1BE3D 4YTPC 2P2UA 3RL0B 3C1LA 1OX3A 1GL2B 3SWKA 1S9KE 1KB9D 2IDBA 2XNDH
chains in the Genus database with same CATH topology
1LWUC 1A02J 1SLQA 5APWA 3PP5A 4WY4D 1GL2D 2FYZA 1FZFA 4IFFA 4EOTA 2WITA 1GL2A 1JY2P 4WY4A 1LTBC 3R2PA 1IC2A 2I1KA 1HVVA 4AYCA 2ZXEB 3CL3D 2C0XA 3B5NC 1FOSE 1H89A 3RK2B 3SWFA 2Z4EA 2KLVA 1QL1A 5BU8B 1KQLA 2OYHB 4LC1A 2BASA 3RK2D 1H88A 1G2CB 1GK6A 3KQGA 4N6JA 1L0NK 1H8AA 5AVTB 4EIJA 2OYHA 1MZ9A 1G2CA 2O1KA 1GD2E 2WSEH 2HFED 4Y99C 1FJKA 3HD7B 3BRTB 3CLQA 4B86A 3OJAB 3M0AA 1URQC 2FYUK 2C9NY 3HD7D 2YKOA 3SWYA 1KILC 3NXSA 3TSIA 3HD7A 1HH0A 4DZOA 1WRGA 1N7LA 5CJ4A 2WSFH 1NOHA 3BATA 2PP6A 2IFNA 1JY3P 1FZGA 5APSA 3A5TA 1LTSC 1N86A 1NTKK 3TK1A 1S9KD 1NWQA 1JUNA 1IFJA 3V2NA 4ZKPA 1E5WA 1G1IA 3II6A 1GW3A 1FOSF 2WSCH 1FZCB 1VDFA 3RK3B 2HYNA 1ZR2A 4OH8B 3M9QA 2E43A 3RK3D 1GTWA 2W6AA 1MUUA 1FZCA 5AVSB 1LTJC 1YYCA 1RY3A 1J1DB 3M0DA 3MD0A 3N4XA 2POHA 5AVWB 5AVVB 1FU1A 2N1TB 5AW9B 1SQVK 1NTZK 2XKMA 3OAKA 5CHXA 1M1JB 5AVRB 1JTHA 2N1TD 1M7LA 3C9IA 1RE4A 4C7NB 2OYIB 2N1TA 1JY2N 2GUVA 1NH4A 4O9BA 1N7SD 2J58A 2FXMA 4IFDK 3HE5A 1FDMA 1Z56A 2ZFCA 4GKGA 1N7SA 1M1JA 2OARA 1L0LK 5CCHD 1AFOA 3N7NA 2M8RA 2OYIA 5CCHA 1RF1A 1ZR4A 1CZQA 1J1EB 1JY2O 2M3BA 1CW5A 2PAJA 1SVFA 3HE4A 4AUWA 1J2JB 4IFMA 3LW5H 1LTGC 1J1DC 2YO2A 2YMYA 1L4AC 3VYIA 4ZKUA 1LT9C 3TYYA 3M91A 3GHGB 3T97A 3V2QA 1IFMA 3L4FA 3IFMA 3A3YB 1GK4A 1N7SC 3L35A 5KJ7C 5CMZA 4XA4A 1PFIA 2OYIC 2IX7C 2WWWA 3GHGA 3P7KA 1RF1C 3VOPA 2IFMA 1MFZA 5AW7B 1N73B 1FZBA 2Q3IA 3LIDA 1HTLC 1OXZA 1SFCB 3HUSB 2XU6A 3M9HA 2R5BA 1NHLA 3P32A 2L5GB 3RL0C 2H7HA 1DEBA 1JY3N 2A45I 2XDJA 1SFCD 1N73A 4WY4C 1GL2C 1SFCA 2YO3A 2YKPA 3HUSA 2WZ7A 1CSBA 2XNXA 1DH3A 3IR9A 3BASA 4I6MC 5CCGD 2N9BA 3A7OA 1IFNA 1JY3O 2P67A 5CCGA 2FKWB 2Q5UA 4KHXA 4GT1A 3MUDA 3RK2C 2IPPA 1IK9A 5APQA 1X8YA 2QM8A 1FZAA 1JCDA 2CPBA 1T3JA 2OYHC 1ZV8A 2Z5HA 4XE5B 4M3LA 2HODB 1YTZI 3MIWA 1HJBA 4JYBA 2R32A 5AVYB 1SP4A 2FFDB 3NFQA 1XTGB 5AVXB 1NTMK 2HODA 3HD7C 2H8PD 3VMYA 5AW3B 1T2KD 2GUSA 1X9VA 2JEEA 2NPSB 1XTCC 2NPSD 1W2EA 2XV5A 1JMMA 1N2DC 2C9LY 2WT7B 3U1AA 5KLVK 1T8ZA 1DX7A 1FJPA 3VTPC 1JCCA 4HYTB 2R3CA 3G3ZA 1LWUB 3V5BA 5APUA 2WT7A 1LTTC 4DOJA 3NTNA 3OA7A 1VPCA 5AW8B 2KOGA 4HH2A 2Q7CA 5APTA 1GZLA 1FZCC 1RE3A 4C7NA 2YNYA 3RK3C 2W27A 3B5NB 3M0DC 1KZUB 1HGVA 1T3UA 3E1IA 1NAFA 2MJZA 3B5ND 1GDTA 2A45G 1IJDB 2Q9IA 3VMZA 3B5NA 3I5CA 3H32B 2HPCB 2WPRA 1RE4C 2A45H 2N1TC 1GU5A 4JF7A 1CI6B 3HTKB 2R5DA 4Y99B 3VMXA 3H32A 4LLHA 1M1JC 3P8MC 4I2LC 2HPCA 2YKQA 1EQ7A 3U59A 1X79B 5CCHC 1URQB 2W6BA 4N78D 1CI6A 3HTKA 1KILB 1LTIC 1SQPK 5AW5B 1URQD 1GU4A 2HLOA 3EQ2A 2J59M 1KILD 5AW2B 1URQA 4W80A 2KYVA 1J1EC 1KILA 1GW4A 2WPSA 4C46A 1RF0A 3KPEA 1FAVA 3WMM0 2P7JA 1OWAA 1KFNA 1ZLLA 3P8CD 2QM7A 3GHGC 3VP8A 1AQ5A 1QL2A 3M9BA 1HWTC 4C7RA 3L36A 2JJLA 1SQQK 2HG5D 1KFMA 2CPSA 5AW0B 3L37A 1G1JA 1LTAC 1FBMA 1N73C 2VRSA 2WPQA 4LGDE 1HUCA 3BRVB 3BVHA 1NO4A 1LGHB 1NKNA 3A2AA 3UIAA 1SFCC 1RF0C 3HUSC 3M06A 5KTBA 1IFIA 1LTJB 2H43A 3KDPB 2LKMA 5CCGC 4WBAA 1MV8A 2P1JA 2FFDA 3EFGA 1YTZT 1LTJA 1HGZA 4N78E 3VP9A 3HRNA 3MTUE 5APYA 1JOCA 5AW6B 3V4QA 1IFDA 4JYCA 5APVA 1ZN5A 5AW1B 5AVUB 2NPSA 1NKZB 3V2RA 4I1LA 5AVZB 5AW4B 4N3YB 1NU1K 4W7ZA 3KYQA 3P8CE 2FFDC 3VN0A 5CJ0A 3B8EB 3U1CA 1IO4A 2E42A 1L4AB 1JTHB 2WTYA 1LT9B 4RESB 1T2KC 3V4WA 3H6PA 1LWUA 2XZRA 5APXA 2GM4A 1L4AD 2O01H 2KSJA 3HE5B 3O8ZA 1A02F 1N7SB 2NPSC 1L4AA 1LT9A 1FZEA 5BVZA 1JNMA 2O1JA 2Z5IA 3LIEA 1RF1B 5KJ7D 3TNUB 2KB7P 2KP8A 5KJ7A 3V2PA 4WB4A 1WT6A 2I1JA 3HE4B 1JO5A 2P2UA 3NMDA 2C0WA 3RL0B 4AQRD 3MGNA 3CI9A 1HBWA 1SQXK 4W7YA 3TNUA 5BU5A 4GIFA 1GL2B 4WY4B 1S9KE 5AVQB 1RE3C 3RL0D 1SQBK
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3HD7 C;  3PP5 A;  2H8P D;  4WY4 D;  1GL2 D;  1JTH A;  2N1T D;  4WY4 A;  1GL2 A;  2N1T A;  1N7S D;  1HVV A;  2HG5 D;  1XTG B;  2NPS B;  3B5N C;  3RK2 B;  1N7S A;  5CCH D;  2M8R A;  4LGD E;  2NPS D;  5CCH A;  3RK2 D;  1SFC C;  5CCG C;  2YMY A;  2HFE D;  1L4A C;  4N78 E;  3HD7 B;  2KOG A;  1URQ C;  3HD7 D;  1N7S C;  1KIL C;  5KJ7 C;  3RK3 C;  3TSI A;  3HD7 A;  3B5N B;  3M0D C;  2NPS A;  3VOP A;  3B5N D;  1SFC B;  2PP6 A;  1NHL A;  3B5N A;  4W7Z A;  3RL0 C;  3KYQ A;  3P8C E;  2XDJ A;  1SFC D;  4WY4 C;  1GL2 C;  2N1T C;  1SFC A;  4JF7 A;  2WZ7 A;  3HTK B;  1L4A B;  1JTH B;  5CCG D;  1L4A D;  5CCH C;  5CCG A;  1URQ B;  1N7S B;  2NPS C;  1L4A A;  1KIL B;  3RK3 B;  3RK2 C;  1URQ D;  1T3J A;  4OH8 B;  1KIL D;  5KJ7 D;  3RK3 D;  1URQ A;  4W80 A;  1KIL A;  5KJ7 A;  3RL0 B;  4W7Y A;  4WY4 B;  1GL2 B;  2N1T B;  3RL0 D; 
#chains in the Genus database with same CATH topology
 1SQP G;  3GW6 A;  3T97 B;  4IFF A;  1JY2 P;  1SQQ J;  3ABV C;  5DJT B;  3SWF A;  2KLV A;  1QL1 A;  5BU8 B;  1KQL A;  1PP9 J;  1M1K Q;  1OVU A;  3RK2 D;  1Q81 Q;  3FX0 A;  1H8A A;  2JKV A;  4KJM A;  4U3F E;  3Q5S A;  2OYH A;  1MZ9 A;  1PPJ D;  1IFP A;  1S1C X;  3M0A A;  3H1J D;  3PTZ A;  4PD4 I;  3NXS A;  1W5C E;  3AE3 C;  1BE3 E;  1WRG A;  1N7L A;  3KZI H;  5CJ4 A;  2BCC J;  2IFN A;  1KB9 E;  2KIK A;  3A5T A;  4OGQ D;  3CCR P;  1W2B O;  1USD A;  2JWA A;  2E74 D;  1KQS O;  1FZC B;  1ZP0 C;  1K05 A;  2M5A A;  1YYC A;  2QJP C;  1RY3 A;  1J1D B;  1PPJ E;  3N4X A;  2POH A;  5AVW B;  4PV1 C;  3AE2 C;  1KN7 A;  4RO0 A;  2RH0 A;  3G71 P;  1SQV K;  3H1L D;  3KHU A;  2PGD A;  3H1H G;  2RKL A;  2QJY B;  1R5S A;  2K88 A;  1Z56 A;  1M1J A;  2OAR A;  1L0L K;  2ITA A;  1SQB G;  1ZR4 A;  1YJN P;  1S5L E;  1JY2 O;  1CW5 A;  1YQ3 C;  1Q2N A;  2WSE J;  5KAI E;  2KS1 A;  2YO2 A;  3AE8 C;  3VYI A;  1BE3 J;  3GHG B;  3ZDM A;  2QJK C;  3WU2 E;  4L76 A;  5KKZ C;  5C39 A;  1RQU A;  4A7P A;  4PD4 H;  1PFI A;  3PJS K;  4L74 A;  3AED C;  1N73 B;  1MFZ A;  1VQ6 P;  2Q3I A;  1RH5 B;  1ZXG A;  2G8Y A;  2Y9Z A;  1OXZ A;  2XU6 A;  3M9H A;  1FS0 E;  3P32 A;  2H7H A;  1DEB A;  2A45 I;  3CXH I;  2XDJ A;  1AVY A;  3L73 D;  2FYU G;  1EDI A;  3F89 A;  2YKP A;  3TF5 A;  2BEZ F;  3IR9 A;  2WSC J;  2N9B A;  1YQ4 C;  2P67 A;  2ZT9 D;  1VQ4 P;  2NZ2 A;  5APQ A;  2QM8 A;  1FZA A;  4GOE A;  1SQV D;  2IBZ E;  5CBO A;  2D2C B;  3MIW A;  5K5G B;  2YMK A;  4JBZ A;  2Y0D A;  5AVX B;  1NTM K;  3VMY A;  1PGP A;  2E75 B;  2ZT9 C;  1USE A;  2QIW A;  3GMA A;  3L74 D;  1FDO A;  1FE6 A;  2QSI A;  1KIL E;  2NPS D;  3L73 E;  4U7J A;  2WT7 B;  3LW5 J;  1KD1 Q;  5KLV K;  1FJP A;  3I56 P;  3G3Z A;  3E1R A;  1R5L A;  2E5Y A;  3CD6 P;  5AW8 B;  2KOG A;  3M0D C;  3E1I A;  3WUT A;  2MJZ A;  1L0L E;  5TJH A;  1L2P A;  4H0L D;  2Q9I A;  2WPR A;  2A45 H;  3CXH H;  2N1T C;  1GU5 A;  2AXC A;  1IZN B;  2GA1 A;  4I2L C;  5CCH C;  2Y9Y A;  1EDK A;  3HTK A;  1NTM D;  2WQY C;  2WPV B;  4Z1M H;  2HLO A;  3EQ2 A;  4OVN F;  3VMA A;  3L71 D;  4W80 A;  2KYV A;  3CX5 H;  2Q6Q A;  4C46 A;  1RF0 A;  1YHQ P;  2B88 A;  1JEK A;  1OWA A;  2JDI H;  1ZLL A;  3P8C D;  1QL2 A;  3L73 J;  4NPD A;  4C7R A;  5M1B A;  1NTZ D;  1SQQ K;  1S5L X;  2CPS A;  4UB6 E;  2DW3 A;  5L8R J;  3QH9 A;  1DD4 A;  3BRV B;  1KOR A;  2I8D A;  3A2A A;  3UIA A;  1RF0 C;  1KMI Z;  1IFI A;  2QJP B;  1VQ8 P;  2WSS H;  1X0T A;  3KDP B;  2ZAE B;  4PV1 B;  2FFD A;  3V6I A;  1NVO A;  1LTJ A;  1VQP P;  3VP9 A;  3HRN A;  1NTM E;  1L0L J;  4L73 A;  1VQ5 P;  3L71 E;  3D71 A;  4JYC A;  5APV A;  1QVG O;  1NKZ B;  3H1J G;  4N3Y B;  4PJ0 H;  4D6T E;  2Y0C A;  1NU1 K;  3KYQ A;  3P8C E;  2FFD C;  5CJ0 A;  1M90 Q;  5KLV E;  2WTY A;  1T2K C;  3V4W A;  4Y28 J;  1LWU A;  1OW8 A;  2QJK B;  5KKZ B;  1A02 F;  1LT9 A;  4BWN A;  5KJ7 D;  5KJ7 A;  3V2P A;  1JO5 A;  3L75 E;  3NMD A;  1SQQ D;  4UB8 H;  2AEJ A;  3PHL A;  1EXJ A;  3TNU A;  5BU5 A;  5AVQ B;  1LWU C;  1A02 J;  1PP9 D;  4WY4 D;  2FYZ A;  1PGO A;  4WY4 A;  2I1K A;  2C0X A;  3B5N C;  1FOS E;  3H1L G;  1D7M A;  2AEF A;  1BCC G;  1KYO I;  4LC1 A;  4HKZ H;  1H88 A;  2FBW C;  1PZQ A;  1G2C B;  2V7Q J;  1YIJ P;  3EWK A;  5AVT B;  4H44 C;  4EIJ A;  2A06 D;  3L71 J;  2SPZ A;  2O1K A;  1VQM P;  3CLQ A;  3OJA B;  2OTL P;  2WVR A;  3G4S P;  4D6T J;  4BXL A;  3HD7 D;  3CCE P;  3HD7 A;  4I7Z C;  5GTH H;  1HH0 A;  4IL6 H;  3GF3 A;  3C8V A;  5KLV J;  1NOH A;  3USS A;  3BAT A;  3MZW B;  1JY3 P;  3KZI E;  2QRX A;  2YXR B;  2YXQ B;  1N86 A;  1NTK K;  1S9K D;  1NWQ A;  1YIT P;  1IFJ A;  3V2N A;  4ZKP A;  1BSN A;  1VF5 D;  3AE6 C;  4H13 C;  2OTJ P;  1FOS F;  3L75 J;  2B87 B;  3M9Q A;  3RK3 D;  1GTW A;  2A06 E;  2BEQ D;  1OVR A;  1NU1 E;  4PD4 D;  2N1T B;  2AEM A;  2QE7 H;  3TGU G;  1JTH A;  2OQQ A;  1RE4 A;  1NH4 A;  2M3E A;  3FXD A;  4YXW H;  2IYO A;  1K73 Q;  1SQX G;  2OYI A;  1RF1 A;  1CZQ A;  1KYO H;  3MHV A;  1NGM B;  2PAJ A;  3L74 G;  3CC4 P;  4IFM A;  3H1K D;  1L4A C;  3TYY A;  4IOI H;  3M91 A;  3V2Q A;  5B66 H;  1BDC A;  3IFM A;  2K37 A;  2B89 A;  3RK3 E;  5CMZ A;  5H2F H;  1L0N G;  1ZOY C;  2OYI C;  2WWW A;  3P7K A;  1RF1 C;  3VOP A;  3LID A;  1S72 P;  4PD4 E;  1NHL A;  2N9Y B;  2QG4 A;  1SFC D;  1Q90 D;  1SFC A;  2YO3 A;  3HUS A;  4KT0 J;  1CSB A;  4I6M C;  5CCG D;  4JPZ B;  1JMB A;  1JY3 O;  5CCG A;  1FC2 C;  4TLF A;  1U7J A;  3RK2 C;  1X8Y A;  3GLM A;  1NU1 J;  1T3J A;  3CME P;  2OYH C;  4TT3 H;  4M3L A;  2AXT H;  2HOD B;  4XE5 B;  5B5E H;  3H1K E;  4R4M A;  4JYB A;  2FFD B;  1QLE D;  3W68 A;  3NFQ A;  1XTG B;  1NTK E;  2H8P D;  3AE1 C;  3WUV A;  1EZV G;  1UII A;  3H1I G;  1VQK P;  2GUS A;  3CXH D;  3JSV C;  4OGQ C;  1W2E A;  5DJU B;  1JMM A;  1NTZ G;  2YIU C;  1DIP A;  1LP1 A;  3U1A A;  2O01 N;  1JCC A;  2E74 C;  4HYT B;  1LWU B;  5APU A;  1S3J A;  1IK7 A;  4DOJ A;  2QA4 P;  3NTN A;  4HJG H;  3CX5 D;  3BCC D;  3AE7 C;  1RE3 A;  2YNY A;  3B5N B;  3G6E P;  1NAF A;  2KUB A;  3L72 D;  2IBZ D;  3CWB G;  1GDT A;  1IJD B;  2K9J A;  4H44 B;  1PV3 A;  1CI6 B;  2R5D A;  2KNC A;  3CCV P;  1S2E A;  3H32 A;  1M1J C;  2HPC A;  3CXH E;  3U59 A;  1Q86 Q;  4DT0 A;  3B71 A;  3H1K J;  4WVZ A;  1SQP K;  5GTI H;  1URQ D;  1GU4 A;  2P10 A;  5E79 E;  2J59 M;  1KIL D;  1VQ7 P;  1URQ A;  1NTK J;  2RN0 A;  1J1E C;  1KIL A;  1GW4 A;  1Y47 A;  3KPE A;  1FAV A;  2P7J A;  3EFF K;  3CX5 E;  3BCC E;  1OVV A;  4H13 B;  2JJL A;  3L72 E;  1MKM A;  2HG5 D;  3R4Y A;  1KFM A;  1OW6 A;  1VQO P;  3L37 A;  2VRS A;  2OGU A;  4LGD E;  1HUC A;  5KTB A;  1L0L D;  4BRY B;  1QX8 A;  3AE4 C;  4K3A A;  2H43 A;  2LKM A;  3WUU A;  1YTZ T;  1HGZ A;  2K3R A;  1DEE G;  1JOC A;  5AW6 B;  1P84 I;  2O01 J;  3L70 E;  3TDK A;  5AW1 B;  2BCC G;  2NPS A;  3V2R A;  3A0B E;  2V4H A;  1OFC X;  1BGY E;  1SQP D;  5KAF H;  3B8E B;  3U1C A;  4PJ0 E;  3GF7 A;  1L4A B;  1JTH B;  4RES B;  1NYH A;  2UWJ E;  5KLI C;  2W6J H;  2O01 H;  2KSJ A;  2NPS C;  2Q3E A;  1YJ9 P;  5BVZ A;  1JNM A;  1RF1 B;  3BCC J;  1WT6 A;  4AQR D;  2FYN C;  1VQN P;  3L72 J;  3TGU E;  4GIF A;  3RL0 D;  1SQB K;  5E79 H;  1SLQ A;  5APW A;  4UB8 E;  3PP5 A;  1GL2 D;  1KQF B;  2JWD A;  1EDL A;  1FZF A;  4EOT A;  1PIX A;  2PFX A;  2WIT A;  1GL2 A;  1LTB C;  1N8R Q;  4U3F G;  3R2P A;  1IC2 A;  4AYC A;  1H89 A;  3RK2 B;  2IYP A;  1OZH A;  4H0L C;  2K1A A;  2OYH B;  1SQP E;  2BAS A;  1GK6 A;  3KQG A;  3W67 A;  1QEX A;  4D6T D;  3RBX A;  2WMM A;  3L70 J;  1BE3 G;  4Y99 C;  5KLV D;  4B86 A;  2QEX P;  3Q5P A;  2FYU K;  2LXC B;  2YKO A;  3SWY A;  1BGY J;  3D6Z A;  1P84 H;  2WSF H;  4OGQ B;  5GTH E;  2YIU B;  1FZG A;  2L91 A;  3L75 D;  5APS A;  4IL6 E;  1LTS C;  2E74 B;  3TK1 A;  1JUN A;  1Y9B A;  3A0B H;  1PPJ G;  1KYO D;  3II6 A;  2IZ0 A;  2M5A B;  2FXP A;  2R3S A;  1SQB D;  3TGU J;  1YJW P;  2W90 A;  2E43 A;  2W6A A;  1FZC A;  5AVS B;  1T6A A;  1LTJ C;  3MD0 A;  4ASW A;  4NPF X;  3RL0 g;  5AVV B;  3O6Q A;  1FU1 A;  4K35 A;  5EFW B;  2XKM A;  3OAK A;  5AVR B;  1M1J B;  2ZYG A;  1SQP J;  3C9I A;  4DCK A;  1JY2 N;  4O9B A;  1N7S D;  2J58 A;  1EZV I;  4GKG A;  2ZFC A;  1N7S A;  3N7N A;  1AV1 A;  3CCM P;  2KS1 B;  3SFE C;  2FYU D;  3KXD A;  1J1E B;  3IN6 A;  3JCU E;  3H1H E;  1UIX A;  1J1D C;  2KNC B;  1KYO E;  2YMY A;  2E5T A;  4ZKU A;  1LT9 C;  2KK7 A;  1SQB E;  3L4F A;  3AEF C;  3A3Y B;  1ZRT D;  1N7S C;  3AE5 C;  3L35 A;  5KJ7 C;  3CWB E;  4XA4 A;  3GHG A;  5B66 E;  2IFM A;  1FZB A;  1FDI A;  2P58 A;  5H2F E;  1M57 D;  4WWI A;  1N73 A;  4WY4 C;  1NU1 D;  2XNX A;  2ZT9 B;  1DH3 A;  3MP7 B;  1IFN A;  3MUD A;  2KSE A;  1KTM A;  2FYU E;  3FWN A;  2Z5H A;  3Q2Y A;  1ZME C;  1HJB A;  1LJ2 A;  2R32 A;  1SP4 A;  2D2C D;  2AXT E;  5B5E E;  2R44 A;  1ZRT E;  3HD7 C;  3L73 G;  1EXI A;  5AW3 B;  5KLI B;  3H1H J;  1X9V A;  2JEE A;  2NPS B;  2E75 D;  3A0H H;  1GMJ A;  1EDJ A;  5CBN A;  1XTC C;  4XFJ A;  1SQV G;  1N2D C;  1SQB J;  2KI7 B;  1T8Z A;  1DX7 A;  2FYN B;  2W83 C;  1VF5 C;  3CWB J;  1Y8A A;  3V5B A;  2WT7 A;  1L0L G;  1LTT C;  3CCL P;  2LR2 A;  1EC5 A;  1VPC A;  4HH2 A;  3JCU H;  1GZL A;  1OW7 A;  2RMZ A;  4C7N A;  3RK3 C;  1T3U A;  1HGV A;  4IL6 X;  4H0L B;  1S4X A;  1K04 A;  2ZJS E;  3I5C A;  1RE4 C;  1OMI A;  2FYU J;  3HTK B;  4Y99 B;  3VMX A;  4LLH A;  1NTK D;  3P8M C;  2YKQ A;  2W6B A;  4N78 D;  1LTI C;  1K8A Q;  5TIS H;  2W8Z A;  1K9M Q;  2E76 D;  3CC2 P;  5GTI E;  2WPS A;  1BSH A;  1SS1 A;  3WMM 0;  1KFN A;  3FWL A;  2QM7 A;  3VP8 A;  4ZNC A;  1LT1 A;  4EDF A;  3OW2 O;  3GG2 A;  1KC8 Q;  1LTA C;  2E76 C;  2WPQ A;  1NO4 A;  1NKN A;  1NTM G;  1SFC C;  3M06 A;  3HUS C;  1LTJ B;  3L71 G;  3H25 A;  5CCG C;  1MV8 A;  2P1J A;  1U7M A;  3SSU A;  4N78 E;  4PV1 D;  4D6T G;  3V4Q A;  1IFD A;  3PLN A;  3SFD C;  3CCU P;  1KV4 A;  1KB9 I;  1ZN5 A;  5AVU B;  5KLV G;  1RQV A;  1AA0 A;  4W7Z A;  2O3J A;  3O6Q B;  3VN0 A;  2QVA A;  1IO4 A;  3AEC C;  1LT9 B;  3AEA C;  5KAF E;  3H6P A;  3H1J E;  2XZR A;  3L75 G;  1Q7Y Q;  2NRG A;  1N7S B;  1BCC D;  1NAY A;  1U57 A;  1FZE A;  3I55 P;  3LIE A;  3TNU B;  1E79 H;  4U3F J;  2JO1 A;  2J5U A;  4WB4 A;  1ZW0 A;  2C0W A;  3MGN A;  3CCJ P;  3CI9 A;  1HBW A;  1SQX K;  4W7Y A;  1P84 D;  4WY4 B;  1RE3 C;  1GD2 E;  1H0T A;  1BDD A;  3S1K A;  4I7Z B;  4DJG A;  1HVV A;  3L70 D;  2ZXE B;  3CL3 D;  3G9R A;  3ITK A;  4EI2 A;  2Z4E A;  2Y0E A;  1LNQ A;  1YBK A;  1PL5 A;  2ZYD A;  4N6J A;  1L0N K;  1BGY D;  1SQQ G;  1G2C A;  2WSE H;  2HFE D;  1FJK A;  3H1L E;  3HD7 B;  3BRT B;  1BCC E;  1R8E A;  1PP9 G;  1URQ C;  2C9N Y;  3S4R A;  1KIL C;  1PGQ A;  3TSI A;  1KB9 H;  4DZO A;  4MN4 C;  1P84 E;  2PP6 A;  3H1J J;  4L75 A;  3CX5 I;  1QVF O;  4GDO A;  1VF5 B;  3TGU D;  1RHZ B;  2A06 G;  1E5W A;  2IBZ I;  3IAO A;  4ASV A;  1G1I A;  1GW3 A;  1SQX D;  2WSC H;  1NU1 G;  3D6Y A;  1VDF A;  3RK3 B;  2HYN A;  1ZR2 A;  2OTK E;  4OH8 B;  1OIP A;  1Q82 Q;  1MUU A;  3M0D A;  2B87 A;  2JP3 A;  2M0B A;  5AW9 B;  1NTZ K;  5CHX A;  2N1T D;  1M7L A;  2K9Y A;  1L0N D;  4C7N B;  2OYI B;  2N1T A;  2GUV A;  1HF9 A;  2FXM A;  4IFD K;  3HE5 A;  1FDM A;  1S5L H;  1SQV E;  5CCH D;  1AFO A;  2M8R A;  5KAI H;  1WMK A;  5CCH A;  2ZVO B;  3H1L J;  1BCC J;  2M3B A;  1SVF A;  3HE4 A;  4AUW A;  1VL2 A;  1J2J B;  3LW5 H;  1LTG C;  3WU2 H;  1SQX E;  2H88 C;  3T97 A;  1HJ0 A;  1MFT A;  1IFM A;  2KXP B;  1M8O B;  1GK4 A;  3L74 E;  2WSF J;  2IX7 C;  5AW7 B;  2E76 B;  2KZJ A;  4HB1 A;  1HTL C;  2KLU A;  1SFC B;  1JB0 J;  3HUS B;  2R5B A;  2L5G B;  3RL0 C;  1JY3 N;  3AE9 C;  1GL2 C;  1YI2 P;  1L0N E;  1EZV D;  2WZ7 A;  3H1I D;  2MKV A;  3BAS A;  3H1K G;  1DD3 A;  1AQT A;  3A7O A;  3K5B A;  4OWF A;  2FKW B;  2Q5U A;  4KHX A;  4GT1 A;  2IPP A;  1IK9 A;  3PH0 A;  3Q5R A;  1JCD A;  2CPB A;  1NTK G;  4JQ0 D;  1ZV8 A;  1X22 A;  1YTZ I;  3H1H D;  5AVY B;  3S9O A;  3AEG C;  2HOD A;  3B4S A;  1SQV J;  2G3A A;  2PRR A;  3CMA P;  1T2K D;  3RGU A;  3CWB D;  4RJT A;  4CPG A;  1LP1 B;  3CPW O;  2LXB A;  1QGK B;  1SQX J;  2XV5 A;  3A0H E;  2C9L Y;  1EZV E;  2KZI A;  3H1I E;  3VTP C;  3L74 J;  2R3C A;  3CC7 P;  1M56 D;  3OA7 A;  2Q7C A;  5APT A;  1NTZ E;  1FZC C;  2W27 A;  3CCQ P;  3AEB C;  1KZU B;  3PRJ A;  4YXD C;  4ZMD A;  3FXE A;  2FY8 A;  2K9J B;  1L0N J;  3B5N D;  4RKU J;  2A45 G;  3VMZ A;  3B5N A;  1KQG B;  3H32 B;  2HPC B;  1JM0 A;  3IF4 A;  1H0T B;  4JF7 A;  4H44 D;  2B9B A;  4GOF A;  1EQ7 A;  2QJY C;  4R4L A;  1X79 B;  2H89 C;  1URQ B;  1CI6 A;  1KIL B;  3QWO C;  3RBZ A;  5AW5 B;  3BCC G;  5AW2 B;  3E7K A;  3Q3D A;  1AVO A;  5TIS E;  3L72 G;  2IBZ G;  3FGA D;  2ZVN B;  1NTM J;  4UB6 H;  2JR8 A;  3GHG C;  1AQ5 A;  3M9B A;  1HWT C;  3CCS P;  1PGJ A;  3L36 A;  2BCC D;  4H13 D;  3H1I J;  5AW0 B;  1G1J A;  1FBM A;  1N73 C;  3BVH A;  1LGH B;  4NPE A;  1SQQ E;  1TU3 F;  3L70 G;  1NTZ J;  2V7Q H;  2ZXX A;  1VQL P;  4WBA A;  2FXO A;  1PP9 E;  3EFG A;  4BRY A;  3MUD C;  2Q1K A;  1VQ9 P;  3MTU E;  5APY A;  1BGY G;  3D70 A;  2CK3 H;  3F5H A;  2ZYA A;  4I1L A;  5AVZ B;  5AW4 B;  2IZ1 A;  2D2C C;  1NJI Q;  3Q1M A;  2E42 A;  2BCC E;  4U3F D;  3AEE C;  3JC2 2;  2E75 C;  5APX A;  2GM4 A;  1L4A D;  2OYO A;  4EYY Q;  3HE5 B;  3O8Z A;  1L4A A;  4QMA A;  4GOD A;  4YPC A;  2O1J A;  2Z5I A;  2HR3 A;  2KB7 P;  2KP8 A;  1AJY A;  2I1J A;  3HE4 B;  1BE3 D;  4YTP C;  2P2U A;  3RL0 B;  3C1L A;  1OX3 A;  1GL2 B;  3SWK A;  1S9K E;  1KB9 D;  2IDB A;  2XND H; 
#chains in the Genus database with same CATH homology
 1LWU C;  1A02 J;  1SLQ A;  5APW A;  3PP5 A;  4WY4 D;  1GL2 D;  2FYZ A;  1FZF A;  4IFF A;  4EOT A;  2WIT A;  1GL2 A;  1JY2 P;  4WY4 A;  1LTB C;  3R2P A;  1IC2 A;  2I1K A;  1HVV A;  4AYC A;  2ZXE B;  3CL3 D;  2C0X A;  3B5N C;  1FOS E;  1H89 A;  3RK2 B;  3SWF A;  2Z4E A;  2KLV A;  1QL1 A;  5BU8 B;  1KQL A;  2OYH B;  4LC1 A;  2BAS A;  3RK2 D;  1H88 A;  1G2C B;  1GK6 A;  3KQG A;  4N6J A;  1L0N K;  1H8A A;  5AVT B;  4EIJ A;  2OYH A;  1MZ9 A;  1G2C A;  2O1K A;  1GD2 E;  2WSE H;  2HFE D;  4Y99 C;  1FJK A;  3HD7 B;  3BRT B;  3CLQ A;  4B86 A;  3OJA B;  3M0A A;  1URQ C;  2FYU K;  2C9N Y;  3HD7 D;  2YKO A;  3SWY A;  1KIL C;  3NXS A;  3TSI A;  3HD7 A;  1HH0 A;  4DZO A;  1WRG A;  1N7L A;  5CJ4 A;  2WSF H;  1NOH A;  3BAT A;  2PP6 A;  2IFN A;  1JY3 P;  1FZG A;  5APS A;  3A5T A;  1LTS C;  1N86 A;  1NTK K;  3TK1 A;  1S9K D;  1NWQ A;  1JUN A;  1IFJ A;  3V2N A;  4ZKP A;  1E5W A;  1G1I A;  3II6 A;  1GW3 A;  1FOS F;  2WSC H;  1FZC B;  1VDF A;  3RK3 B;  2HYN A;  1ZR2 A;  4OH8 B;  3M9Q A;  2E43 A;  3RK3 D;  1GTW A;  2W6A A;  1MUU A;  1FZC A;  5AVS B;  1LTJ C;  1YYC A;  1RY3 A;  1J1D B;  3M0D A;  3MD0 A;  3N4X A;  2POH A;  5AVW B;  5AVV B;  1FU1 A;  2N1T B;  5AW9 B;  1SQV K;  1NTZ K;  2XKM A;  3OAK A;  5CHX A;  1M1J B;  5AVR B;  1JTH A;  2N1T D;  1M7L A;  3C9I A;  1RE4 A;  4C7N B;  2OYI B;  2N1T A;  1JY2 N;  2GUV A;  1NH4 A;  4O9B A;  1N7S D;  2J58 A;  2FXM A;  4IFD K;  3HE5 A;  1FDM A;  1Z56 A;  2ZFC A;  4GKG A;  1N7S A;  1M1J A;  2OAR A;  1L0L K;  5CCH D;  1AFO A;  3N7N A;  2M8R A;  2OYI A;  5CCH A;  1RF1 A;  1ZR4 A;  1CZQ A;  1J1E B;  1JY2 O;  2M3B A;  1CW5 A;  2PAJ A;  1SVF A;  3HE4 A;  4AUW A;  1J2J B;  4IFM A;  3LW5 H;  1LTG C;  1J1D C;  2YO2 A;  2YMY A;  1L4A C;  3VYI A;  4ZKU A;  1LT9 C;  3TYY A;  3M91 A;  3GHG B;  3T97 A;  3V2Q A;  1IFM A;  3L4F A;  3IFM A;  3A3Y B;  1GK4 A;  1N7S C;  3L35 A;  5KJ7 C;  5CMZ A;  4XA4 A;  1PFI A;  2OYI C;  2IX7 C;  2WWW A;  3GHG A;  3P7K A;  1RF1 C;  3VOP A;  2IFM A;  1MFZ A;  5AW7 B;  1N73 B;  1FZB A;  2Q3I A;  3LID A;  1HTL C;  1OXZ A;  1SFC B;  3HUS B;  2XU6 A;  3M9H A;  2R5B A;  1NHL A;  3P32 A;  2L5G B;  3RL0 C;  2H7H A;  1DEB A;  1JY3 N;  2A45 I;  2XDJ A;  1SFC D;  1N73 A;  4WY4 C;  1GL2 C;  1SFC A;  2YO3 A;  2YKP A;  3HUS A;  2WZ7 A;  1CSB A;  2XNX A;  1DH3 A;  3IR9 A;  3BAS A;  4I6M C;  5CCG D;  2N9B A;  3A7O A;  1IFN A;  1JY3 O;  2P67 A;  5CCG A;  2FKW B;  2Q5U A;  4KHX A;  4GT1 A;  3MUD A;  3RK2 C;  2IPP A;  1IK9 A;  5APQ A;  1X8Y A;  2QM8 A;  1FZA A;  1JCD A;  2CPB A;  1T3J A;  2OYH C;  1ZV8 A;  2Z5H A;  4XE5 B;  4M3L A;  2HOD B;  1YTZ I;  3MIW A;  1HJB A;  4JYB A;  2R32 A;  5AVY B;  1SP4 A;  2FFD B;  3NFQ A;  1XTG B;  5AVX B;  1NTM K;  2HOD A;  3HD7 C;  2H8P D;  3VMY A;  5AW3 B;  1T2K D;  2GUS A;  1X9V A;  2JEE A;  2NPS B;  1XTC C;  2NPS D;  1W2E A;  2XV5 A;  1JMM A;  1N2D C;  2C9L Y;  2WT7 B;  3U1A A;  5KLV K;  1T8Z A;  1DX7 A;  1FJP A;  3VTP C;  1JCC A;  4HYT B;  2R3C A;  3G3Z A;  1LWU B;  3V5B A;  5APU A;  2WT7 A;  1LTT C;  4DOJ A;  3NTN A;  3OA7 A;  1VPC A;  5AW8 B;  2KOG A;  4HH2 A;  2Q7C A;  5APT A;  1GZL A;  1FZC C;  1RE3 A;  4C7N A;  2YNY A;  3RK3 C;  2W27 A;  3B5N B;  3M0D C;  1KZU B;  1HGV A;  1T3U A;  3E1I A;  1NAF A;  2MJZ A;  3B5N D;  1GDT A;  2A45 G;  1IJD B;  2Q9I A;  3VMZ A;  3B5N A;  3I5C A;  3H32 B;  2HPC B;  2WPR A;  1RE4 C;  2A45 H;  2N1T C;  1GU5 A;  4JF7 A;  1CI6 B;  3HTK B;  2R5D A;  4Y99 B;  3VMX A;  3H32 A;  4LLH A;  1M1J C;  3P8M C;  4I2L C;  2HPC A;  2YKQ A;  1EQ7 A;  3U59 A;  1X79 B;  5CCH C;  1URQ B;  2W6B A;  4N78 D;  1CI6 A;  3HTK A;  1KIL B;  1LTI C;  1SQP K;  5AW5 B;  1URQ D;  1GU4 A;  2HLO A;  3EQ2 A;  2J59 M;  1KIL D;  5AW2 B;  1URQ A;  4W80 A;  2KYV A;  1J1E C;  1KIL A;  1GW4 A;  2WPS A;  4C46 A;  1RF0 A;  3KPE A;  1FAV A;  3WMM 0;  2P7J A;  1OWA A;  1KFN A;  1ZLL A;  3P8C D;  2QM7 A;  3GHG C;  3VP8 A;  1AQ5 A;  1QL2 A;  3M9B A;  1HWT C;  4C7R A;  3L36 A;  2JJL A;  1SQQ K;  2HG5 D;  1KFM A;  2CPS A;  5AW0 B;  3L37 A;  1G1J A;  1LTA C;  1FBM A;  1N73 C;  2VRS A;  2WPQ A;  4LGD E;  1HUC A;  3BRV B;  3BVH A;  1NO4 A;  1LGH B;  1NKN A;  3A2A A;  3UIA A;  1SFC C;  1RF0 C;  3HUS C;  3M06 A;  5KTB A;  1IFI A;  1LTJ B;  2H43 A;  3KDP B;  2LKM A;  5CCG C;  4WBA A;  1MV8 A;  2P1J A;  2FFD A;  3EFG A;  1YTZ T;  1LTJ A;  1HGZ A;  4N78 E;  3VP9 A;  3HRN A;  3MTU E;  5APY A;  1JOC A;  5AW6 B;  3V4Q A;  1IFD A;  4JYC A;  5APV A;  1ZN5 A;  5AW1 B;  5AVU B;  2NPS A;  1NKZ B;  3V2R A;  4I1L A;  5AVZ B;  5AW4 B;  4N3Y B;  1NU1 K;  4W7Z A;  3KYQ A;  3P8C E;  2FFD C;  3VN0 A;  5CJ0 A;  3B8E B;  3U1C A;  1IO4 A;  2E42 A;  1L4A B;  1JTH B;  2WTY A;  1LT9 B;  4RES B;  1T2K C;  3V4W A;  3H6P A;  1LWU A;  2XZR A;  5APX A;  2GM4 A;  1L4A D;  2O01 H;  2KSJ A;  3HE5 B;  3O8Z A;  1A02 F;  1N7S B;  2NPS C;  1L4A A;  1LT9 A;  1FZE A;  5BVZ A;  1JNM A;  2O1J A;  2Z5I A;  3LIE A;  1RF1 B;  5KJ7 D;  3TNU B;  2KB7 P;  2KP8 A;  5KJ7 A;  3V2P A;  4WB4 A;  1WT6 A;  2I1J A;  3HE4 B;  1JO5 A;  2P2U A;  3NMD A;  2C0W A;  3RL0 B;  4AQR D;  3MGN A;  3CI9 A;  1HBW A;  1SQX K;  4W7Y A;  3TNU A;  5BU5 A;  4GIF A;  1GL2 B;  4WY4 B;  1S9K E;  5AVQ B;  1RE3 C;  3RL0 D;  1SQB K; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...