1N95A

Aryl tetrahydrophyridine inhbitors of farnesyltranferase: glycine, phenylalanine and histidine derivatives
Total Genus 121
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
121
sequence length
312
structure length
312
Chain Sequence
FLSLDSPTYVLYRDRAEWADIDPVPQNDGPSPVVQIIYSEKFRDVYDYFRAVLQRDERSERAFKLTRDAIELNAANYTVWHFRRVLLRSLQKDLQEEMNYITAIIEEQPKNYQVWHHRRVLVEWLKDPSQELEFIADILNQDAKNYHAWQHRQWVIQEFRLWDNELQYVDQLLKEDVRNNSVWNQRHFVISNTTGYSDRAVLEREVQYTLEMIKLVPHNESAWNYLKGILQDRGLSRYPNLLNQLLDLQPSHSSPYLIAFLVDIYEDMLENQCDNKEDILNKALELCEILAKEKDTIRKEYWRYIGRSLQSK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protein farnesyltransferase alpha subunit
publication title Aryl tetrahydropyridine inhibitors of farnesyltransferase: glycine, phenylalanine and histidine derivatives.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Transferase
total genus 121
structure length 312
sequence length 312
ec nomenclature ec 2.5.1.58: Protein farnesyltransferase.
pdb deposition date 2002-11-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01239 PPTA Protein prenyltransferase alpha subunit repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.120 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Protein prenylyltransferase 1n95A00
3HXBA 1FT1A 1O1SA 4L9PA 1D8DA 1N4SA 2H6GA 1FT2A 3DSTA 1KZOA 4GTOA 2H6IA 3DSWA 3HXDA 2R2LA 3E32A 1TN8A 4LNBA 3HXFA 2IEJA 1TN7A 2H6FA 4GTMA 3Q78A 4GTTA 2H6HA 1N95A 4GTQA 3DSUA 2ZIRA 3HXCA 4GTSA 1N4PA 1QBQA 3Q7FA 4GTPA 3SFXA 3KSQA 3HXEA 1N4RA 3E37A 1X81A 3DPYA 1MZCA 1S64A 3E34A 1SA5A 3DSXA 3DSSA 4GTVA 3E33A 1DCEA 2F0YA 2ZISA 4EHMA 1N94A 3E30A 3PZ3A 3PZ4A 1O5MA 1O1TA 3EU5A 1NI1A 4YDOA 1O1RA 4GTRA 4MBGA 1LD8A 1LD7A 1N9AA 1D8EA 2BEDA 3Q75A 3Q73A 1KZPA 3EUVA 3PZ2A 3Q79A 3KSLA 1TNUA 3C72A 1FPPA 1SA4A 4YDEA 3PZ1A 3DSVA 1JCQA 3SFYA 1TNYA 1TNZA 1LTXA 3DRAA 1NL4A 1S63A 1JCRA 1TNOA 4LNGA 1TN6A 1TNBA 1N4QA 3Q7AA 1JCSA
chains in the Genus database with same CATH superfamily
4KBQA 1O1SA 5KJKA 2KXPC 4DJAA 3PZDA 5KCMA 4L2YA 1BI7B 3B7TA 3DSWA 5LCWJ 2FBNA 3AJIA 4I1AA 2KCKA 3I5PA 2LO6A 3FTZA 1INZA 2H6FA 2C0LA 3U3WA 2CFUA 5G04C 3KS2A 5JA4D 1IQRA 3PUKA 5CERB 1U3CA 4LNUD 3ZXSA 1TJFA 5D0OD 2YNQA 5JJ6A 3D9MA 5HRYA 1YCSB 5KJLA 3OXLA 5KNHD 5LFAA 1QZ2A 1E8ZA 4URKA 3CK9A 5LX8A 5C2YA 5ARFA 3FUJA 1SA5A 4KXKB 3UX4A 3RU0A 2VJ8A 2MRIA 3E33A 2WPVA 4JC8A 3TAXA 5EILA 2UY1A 2DYRE 1H19A 5AARA 3RIBA 4Z68A 1V55E 1RZ4A 4EBAA 3FEYA 4LUNU 4IN3B 2FULA 4K0RA 2Y4UA 1KZPA 3PNLB 4BERA 2X3MA 3C72A 4IRUA 2Y0BG 3DSVA 1N52A 4HS2A 3JUIA 5AIJA 2P9SG 3GZ2A 1JCRA 2L0IA 1TNOA 2MHKA 2QYJA 3CQCB 1MX2A 2E0IA 2IFUA 4CZ2D 1MX4A 2IU1A 2GRNB 3UINC 2AJAA 3GZSA 4AVXA 3E32A 2EIKE 3W9GA 4CT0A 2AXZA 4WNFA 4DX2A 4EZJA 4XE0A 2XPZA 4CEMA 3MV2B 3SNXA 3IHYA 4F53A 3RAUA 2GRMA 3CVVA 4YVOA 2XCBA 3RO2A 2LXMA 2EILE 3IBEA 3L08A 5FQ6A 3FUDA 4ILGA 2V5QC 4UWGA 3JQ0A 5CRUA 2WXHA 3PUJA 2X38A 3D9LA 3PRZA 3MYVA 4FU3A 2I1JA 5FJYA 4GA0A 1OUVA 2FI7A 3NZUA 1HE8A 4JD2G 3B7RL 2X6JA 2ZGGA 3T8KA 4W9RA 2EIME 1FPPA 2WXRA 4YDEA 2C2LA 3PZ1A 4G2VA 1OCCE 3TWWA 5CEDB 1E8XA 4DK5A 1HU3A 2WXMA 2VSNA 1BU9A 4LNGA 2I1KA 2C0MA 1FVHA 1FT1A 4KYOB 3R9AB 1MQSA 1D8DA 3KD7A 3FH5A 5BXOA 4GMRA 4L7TA 3UMVA 4BSZB 4ME2A 4GMLA 4NIKA 1E90A 3U4TA 3UM3A 4I9EA 4GU5A 3TXMA 4ILIA 2VSYA 3D9KA 4DX7D 4OVVA 4JA9A 4GTQA 1DC2A 1BPOA 3DSUA 2XS8A 4O6FA 3V30A 3UKRG 4AXHA 1DCQA 3T5VA 4PS3A 3ZPJA 2X6HA 1AWCB 1PY1A 2P9LG 3FHEA 5FZQA 4FJYA 4AP2A 2FO7A 4KVMA 5FTPA 3UUXA 4CDNA 3TL5A 3LJNA 4B0ZA 1ZB1A 2AXVA 2VYIA 3SBSA 1DCEA 3G2SA 4XIFA 3SO8A 5FIOA 3ZN3A 3OAWA 1UJKA 4N2SA 3EHQA 2DCPA 3EJNA 3FTXA 3VLDA 5ENRD 3AG1E 2BEDA 3ZFWA 3QNKA 3Q73A 5CCMA 4CRWA 3EUVA 4HVBA 1V54E 3Q79A 1NFIE 2IOLA 3SI5A 3CVNA 4JEUA 2NYJA 2R5SA 4WUYA 2KBXA 5B3SE 5CHEE 5ARGA 5G05C 4I1OB 2I6HA 4GA1A 4I2WA 4JVSA 4F6RD 4OAVB 4DRXE 4MS6A 3SGHA 5M72A 4RQIA 3B95A 3CVUA 4FJZA 4WWNA 3IEGA 4XI0A 3T5XA 1H6OA 1VDYA 3ASFA 3LEWA 4HOSA 4XKCA 4J7WA 3TWQA 4HXIA 5ANLA 4J8FA 3Q49B 1OWMA 2ZIRA 3X2QE 4G26A 4RG6A 4FLBA 5LOZA 2ETBA 3LVQE 4HLEA 4E6HA 1LF8A 3CEQA 3FTVA 1MZCA 3FFLA 2XEHA 3MKQA 3ASHA 3MJWA 3P2BA 2P9NG 1FCHA 3DSSA 5ENTD 3FH7A 2HE0A 4TUMA 5AQ7A 3UT4A 4GCNA 3FU5A 1O1RA 2XENA 4GB9A 2ZU6B 2XCCA 4F7AA 1Z3YA 3FP3A 3S2AA 4FHKA 5JHAA 1TNUA 4JL0A 1B89A 2BUGA 4ILHB 4RSYA 4CDMA 4E85A 4N3CA 3CK8A 4BETA 4CYMD 4GMJA 3LJ3A 4AY5A 4RG9A 4EZLA 3QC1A 4WWOA 1A5EA 3DXKG 3G2VA 1HO8A 5BXUA 2R17C 2Y3AA 2IONA 2IO2C 3CIAA 3TWUA 4WNEA 3CQGB 3QJZA 2FF4A 4BSXA 3EDTB 3V79K 1UN9A 3G2UA 5D0QD 3AG3E 4A3TA 3BG1B 2LSVA 3UPVA 4B8AA 4G8LA 4G1TA 3SHFA 2VTBB 3MA5A 2YINA 4UI9C 3DPDA 2BF0X 3U64A 2F0YA 4J8YA 3ZIMA 4CCAA 2RKKA 3PZ3A 1O1TA 3LXUX 4C0MA 4MBGA 3S7JA 2WXLA 3FEXA 4HQDA 5E76A 4EBAG 3FU3A 5BT1A 1S0PA 3JXIA 1HG2A 3QWPA 4BT9A 4J8EA 4HI8A 3TG4A 5ENPD 2CHXA 4HOQA 3Q7AA 4I9CA 1Z3XA 3ULQA 3V2XA 1IYGA 1E7VA 1N4SA 3FUNA 1K3ZD 3AG2E 5AAOA 3J5QB 5EX3A 2HM8A 1KZOA 5DIZA 5JJ7A 1TN8A 5A7DB 2OCCE 4O1OA 1MYOA 2IEJA 5EKQD 4EPZA 4LERA 4KVOA 2V5FA 3CSFA 4UUCA 5CMWA 3C3QA 4BESA 2RFMA 3QAQA 3AS4A 4C9BB 5KNGA 3DPYA 3G2TA 4OVUA 4APFA 1OWLA 1S64A 3DSXA 2QC9A 2P58C 3K9IA 1MX6A 4R7LA 5T8IA 2L0TB 2XGMA 4DUIA 5BW8C 1IKND 4EECA 3MV3B 3ZUVB 5FWQA 3SBTB 3KSLA 3QB2A 2LNIA 1OCRE 1S63A 2PL2A 4J0UA 3ASOE 4UQYA 4UQXA 3MCXA 5B1BE 4QFVA 1EYHA 1N11A 3CGHA 5C1DA 2Y1LE 3DSTA 3CVXA 4GTOA 2DZOA 2R2LA 4J6IA 3DWLG 1JWFA 4HORA 3PREA 2XGOA 3TWXA 2A5UA 2H6HA 2NC9A 4AM9A 4BX8A 2XGSA 3LY9A 2ILRA 2CHZA 4AIFA 4XEIG 1HX8A 3SFXA 4ZHBA 4JHRA 4CGWA 3E37A 4XKBA 2V4LA 1G3NB 1SZAA 3CHQA 3VTXA 3JUEA 1S70B 4K03A 3MZLB 1H6KA 4HBDA 5D2MC 3SF4A 3SFZA 3L16A 4DX5D 4GZCA 2ZISA 4J8SA 2ZGDA 4U63A 1N94A 3TJPA 2PM6A 4NACA 3ULYA 3LYAA 3SD5A 3Q5MA 3AS8A 2ETAA 2VQ2A 3Q9NC 3CK7A 3FUMA 5CRVA 3ENEA 3ZHEA 5B1AE 3VLEA 2PNNA 3JCKC 3RRNB 2VTBA 1ZU2A 1H0AA 2XPIA 3OXFA 4IYPA 1JCQA 4MRUA 3AAAC 2DBAA 2XQ0A 1DNPA 5ANRA 1TN6A 4HB5A 3ML8A 4FP7A 3UIPC 3ZU7B 2YQ8A 3T9KA 2IJGX 3SY2A 4HOTA 2H6GA 5BUZA 2XEVA 3PDNA 4JHKA 3HXDA 3KEZA 3QWVA 1TYQG 2A5EA 2WM9A 2OOEA 1UN8A 3BUAA 5CCLA 3Q78A 3CLJA 4A3VA 4NURA 3URZA 3F6QA 5AQAA 2XRYA 4CDRA 1JPLA 4ANWA 2MYOA 3HXEA 3EIJA 3E4BA 2VGXA 2J07A 3HRAA 5A6CA 2CHWA 1SW6A 2DIWA 4DI4A 4YDOA 3C3OA 4GYWA 4GTRA 5FZSA 2WXQA 3ESKA 4Y6CA 3Q75A 3L9TA 4M3OA 3Q4AB 4J8DA 2PQNA 1P5QA 1WM5A 1BI8B 1EDUA 4I1MA 5AJDA 2NXPA 4KZ0A 3NBNB 2IOSA 1OWNA 1ELWA 2WXGA 2LAIA 2KZTB 3I4GA 3ZYMA 2IQCA 1TNBA 2EIJE 1JCSA 4DI3A 2LSUA 2R05A 5LP0A 3ZRHA 4O1PA 4U0SA 3OXGA 2WXJA 1UJJA 2GRQB 1QYMA 2WQ7A 3APFA 3W9FA 3ZEFA 4HRMB 1EF1C 5EX0A 4BT8A 3ZGQA 3LDZA 4DLQA 4L1BA 3CR3A 4JA7A 2RG8A 4KZCA 2WMOA 3B7BA 2XS1A 3ZXPA 2VGYA 1N4PA 1WAO1 3L13A 1K1BA 2Y4TA 3FU0A 1PC2A 3FUIA 2M63A 3GZ1A 3FDHA 3IXEA 2BKKB 3S7DA 4TUUA 3EIQC 3ESLA 4UI9K 5CBNA 4ANXA 1SQMA 3AS5A 3MKRA 3IKOB 1SVXA 3PZ4A 2MOWA 2F8XK 3BEEA 4G23A 2VSOE 1LD8A 4KT6B 5J08A 2OVFA 4D10C 3ABME 3ZYKA 4QQIA 2XHEA 1OWPA 4V3IA 3C98A 3R7RA 1EPUA 3B7UX 1HS6A 4B8CB 4P29A 1TEZA 3JQ1A 4FADA 2WXPA 3ONLA 4G11A 1U2VG 3RJVA 4C48B 4F1PA 4AY6A 5HKPA 2UY1B 1A17A 3HXBA 5ENOD 2P9IG 4MKTA 2YHEA 2WVIA 1ELKA 2X6KA 3ASNE 2V4HC 1E7UA 1NZNA 2VGEA 2H6IA 4H7XA 3UT7A 2QFCA 4Y6WA 3JXJA 1N0RA 3IHVA 4GA2A 5AYWD 3RRUA 2J49A 2QZAA 1TN7A 5LCWC 4FULA 5HI7A 1W3BA 3PEUB 1WY6A 1N95A 4GYYA 4UWFA 5FZRA 4ABNA 3I3NA 3LS8A 4FLHA 2DVWA 2GW1A 2AXUA 5H7PA 2V0PA 1UW4B 2KATA 4GTVA 2WB2A 5EIDA 3TG5A 4EHMA 2KM4A 1HG5A 2XEEA 1NI1A 4A63B 4DX1A 3ZVVA 1LD7A 3WXXA 1IHBA 2BKGA 3GYZA 2LXLA 1E8YA 3CVLA 4N39A 3SZ7A 1IQUA 3CVYA 4K5BA 5G05J 4N5CA 4U0ZA 4JXTA 2R02A 4U07A 3FTUA 4BTAA 1YMPA 3QKYA 3TWVA 3FTYA 3T8MA 3L22A 1UG3A 3RKVA 1N4QA 2OVBA 2X6IA 3D9JA 3ABLE 4YDWA 3CVQA 3ASDA 3O4ZA 3ZYQA 4HFGA 4JZYA 4XZ4A 5CEAA 4LNBA 4LG6A 2HO1A 5AJLA 4WWPA 1NA3A 5DBKA 3FU6A 2WXKA 5CECB 4HOUA 3PH0C 2I9CA 2J4DA 4FC8A 4LCTA 3UIOC 4XI9A 3HVEB 3WG7E 2AWIA 4GTSA 4O60A 3RO3A 4ACKA 3QARA 5IY5E 1JUQA 4ANVA 1N54A 3AU5A 2ONDA 3E34A 2J08A 3LY8A 3TGOA 3TWSA 5CBOA 4GZ5A 4TV3A 4TXRA 5ENSD 4I6GA 4H7YA 5HQ8A 1H2TC 3CV0A 4PS7A 3FWVA 1NP7A 3V31A 3V2OA 3D9NA 4TXPA 2L9BA 3LY7A 2KCVA 4KMOA 4K5CA 2GRLA 3R9MA 3J5PA 1H2UA 2V8SE 4ATGA 4U0UA 4TXQA 1XNFA 3UKUG 1E96B 1KPSB 4ZFHA 3MGBA 4CGVA 3D9IA 3R7QA 2P9UG 3LKUA 3FH8A 4I17A 1Z6TA 5BPPA 1TR4A 5HS0A 3UTMA 3L54A 3B13A 3EHMA 2I2OA 2GRRB 3OTNA 4XX5A 1KLXA 3ZKJA 3RRMB 4HLLA 3NZSA 2WMNA 1N0QA 4JB8P 4JW1A 3Q7FA 4BTBA 3D3MA 5FT9A 1N4RA 4ATZD 1KT1A 5D66A 4UI9J 2DYSE 5FINA 3FUKA 5AN8A 5T3RA 1OWOA 2EQXA 2P9PG 1Y8MA 5J90A 3N71A 2PQRA 3CHPA 4CT4A 2QY7A 2ZXWE 3RK6A 1TJCA 4GZ3A 3S7FA 2AVPA 5FQ8A 2DWZA 2WXFA 3HHMA 4BY6A 4N3AA 3CHMA 1QQEA 5ITZF 4B89A 3MKQB 4LEUA 2NSZA 4OAUC 4L2LA 1PAQA 3FTSA 3L82A 3AU4A 3JYSA 4ACLA 2WQHA 5A23A 3CKCA 4WNGA 4GPKA 2KCLA 3FUFA 3GW4A 4L9PA 2LUHA 5JMND 1Q2ZA 5AQ9A 1UOHA 3UM1A 3MX3A 4I6JA 1NA0A 4N3BA 3D9HA 2QYUA 2WQ6A 2CG3A 4WAFA 1JWGA 4MLPA 3DEOA 1YYHA 1K1AA 3LCAA 4U8VD 1WG0A 4BEPA 2JLBA 4BWRA 1RW2A 4DX6D 3PE4A 1HXIA 2RD0A 5G04J 5AQBA 1GW6A 3C5RA 4A55A 3NOGD 1OCZE 1SZ9A 4YDYA 5KBAA 3ULEG 4G8KA 4RVBA 4A1SA 2WXNA 2J4BA 3BQOA 4Q94A 5EYPF 3HVEA 4K5AB 3TXNA 3LVRE 2KC7A 2GRPB 4PS8A 5BV1A 1Z5SC 2PZIA 3NF1A 4GAAA 4X8QA 3ABKE 3KEAA 1ELRA 3PZ2A 3FUHA 2B6CA 5EIBE 3S7BA 4U8HA 3SFYA 1TNZA 1LTXA 4BFRA 3BU8A 3ONKA 2A4ZA 4U7EB 3NB2A 4G25A 4M7CA 4GCOA 2XZDG 4GYOA 2L6JA 2WXOA 1XGWA 1OY3D 5FQ4A 4FHJA 3HIZA 2JEKA 2UWJG 2X6FA 3FY4A 4U04A 2RFAA 2OEWA 3AG4E 4B93B 3LPZA 4GTMA 3NQPA 4G24A 3BG0B 2Y69E 3UQ3A 3UM2A 3EHRA 5BV0A 4GTPA 4LSZE 4PH4B 3CHSA 3KSQA 2GROB 4PDXA 1X81A 4U95D 3UI2A 4I2ZA 3EHNA 5EN5D 1HH8A 1OXJA 3PEVB 2LAHA 3E30A 3MEKA 3NOCD 1OCOE 4JPSA 1O5MA 3U66A 4N5QA 3Q9UC 2Q7FA 5EYLA 1MHQA 2AW6A 2E2EA 1D8EA 2J9QA 2DZNA 5AENA 1DVPA 3APDA 5T4YA 3CHRA 1QNFA 4C0EA 2F37A 1L5JA 3DRAA 4TRQA 3CVPA 4AJWA 1OT8A 2XRZA 1HF8A 4I6EA 3DXMG 4JEHA 1BD8A 4WNDA 3FTWA 4DPRA 3UXGA 1H2VC 1U3DA 2HYZA 3PNTB 5JHBA 4GZDA 3PE3A 3PS6A 1FT2A 3CKBA 4HRLA 5ENQD 1X5BA 4BX9A 3QDNA 3HXFA 3CVWA 2P2CP 1Y6IA 2OV8A 4FA6A 2FO1E 4AOFA 1D9SA 4DLOA 4I43A 3TWRA 3DBSA 5JJTA 3ML9A 4EQFA 5E75A 4RLYA 3HG0D 2J09A 3QWWA 2B0OE 3L17A 2L6BA 2BTDA 3QOUA 3APCA 3ZW3A 4OYSA 4NRHB 2IF4A 3FUEA 2IO3C 3EU9A 1E8WA 1H6PA 5KJMA 2FEZA 4Q96A 3UM0A 5FQ7A 1N9AA 4NQ0A 4YNDA 4YVQC 3C3RA 2IY0C 2PM7A 1SA4A 3P1UA 1WDYA 3U9WA 4LRZA 1YA0A 4UWLA 3VTYA 4HI9A 1NL4A 2XZTG 3SQVA 3HYMB 3TWTA 1KT0A 4Q69A 1K8KG 1IXVA 2ETCA 4EZKA 1BLXB 4F1SA 2P9KG 2HR2A 5EDSA 4IULA 2CFZA 3UT8A 4UWHA 3Q47B 3PVLA 1IHGA 3D9OA 3ZHEB 3CHOA 2VSXE 2R03A 2JABA 2YHCA 4JHJA 3G2WA 4GZ6A 5KJNA 5G55A 3QK0A 4GTTA 4AV7A 3ISMC 3DEPA 5ENNA 3HXCA 3CSTA 1QBQA 3IV0A 3Q15A 5CMYA 3O48A 3HDXA 1AP7A 1HFAA 1ZBPA 3B7SA 3VLFA 3ZYLA 2KZTA 2XPYA 4ANUA 2R59A 1FVFA 5BNWA 2EINE 2J8SD 4U8YD 2CG2A 4GPMA 4HNAD 3I4RB 3EU5A 3ZNGA 1HZ4A 4L23A 3D9PA 4AEZC 3RSEG 4UQZA 4PUCA 4UWKA 4B94A 2F8YA 2OEVA 3ASGA 3NAWA 3FULA 2GGFA 1MJ0A 4HRNA 4U96D 4A1GA 1TNYA 4APOA 5G2NA 3KAEA 2WXIA 4F3VA 2VGXB 3L6AA 5KWDA 4N2QA
chains in the Genus database with same CATH topology
3HXBA 1FT1A 1O1SA 4L9PA 1D8DA 1N4SA 2H6GA 1FT2A 3DSTA 1KZOA 4GTOA 2H6IA 3DSWA 3HXDA 2R2LA 3E32A 1TN8A 4LNBA 3HXFA 2IEJA 1TN7A 2H6FA 4GTMA 3Q78A 4GTTA 2H6HA 1N95A 4GTQA 3DSUA 2ZIRA 3HXCA 4GTSA 1N4PA 1QBQA 3Q7FA 4GTPA 3SFXA 3KSQA 3HXEA 1N4RA 3E37A 1X81A 3DPYA 1MZCA 1S64A 3E34A 1SA5A 3DSXA 3DSSA 4GTVA 3E33A 1DCEA 2F0YA 2ZISA 4EHMA 1N94A 3E30A 3PZ3A 3PZ4A 1O5MA 1O1TA 3EU5A 1NI1A 4YDOA 1O1RA 4GTRA 4MBGA 1LD8A 1LD7A 1N9AA 1D8EA 2BEDA 3Q75A 3Q73A 1KZPA 3EUVA 3PZ2A 3Q79A 3KSLA 1TNUA 3C72A 1FPPA 1SA4A 4YDEA 3PZ1A 3DSVA 1JCQA 3SFYA 1TNYA 1TNZA 1LTXA 3DRAA 1NL4A 1S63A 1JCRA 1TNOA 4LNGA 1TN6A 1TNBA 1N4QA 3Q7AA 1JCSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3HXB A;  1FT1 A;  1O1S A;  4L9P A;  1D8D A;  1N4S A;  2H6G A;  1FT2 A;  3DST A;  1KZO A;  4GTO A;  2H6I A;  3DSW A;  3HXD A;  2R2L A;  3E32 A;  1TN8 A;  4LNB A;  3HXF A;  2IEJ A;  1TN7 A;  2H6F A;  4GTM A;  3Q78 A;  4GTT A;  2H6H A;  1N95 A;  4GTQ A;  3DSU A;  2ZIR A;  3HXC A;  4GTS A;  1N4P A;  1QBQ A;  3Q7F A;  4GTP A;  3SFX A;  3KSQ A;  3HXE A;  1N4R A;  3E37 A;  1X81 A;  3DPY A;  1MZC A;  1S64 A;  3E34 A;  1SA5 A;  3DSX A;  3DSS A;  4GTV A;  3E33 A;  1DCE A;  2F0Y A;  2ZIS A;  4EHM A;  1N94 A;  3E30 A;  3PZ3 A;  3PZ4 A;  1O5M A;  1O1T A;  3EU5 A;  1NI1 A;  4YDO A;  1O1R A;  4GTR A;  4MBG A;  1LD8 A;  1LD7 A;  1N9A A;  1D8E A;  2BED A;  3Q75 A;  3Q73 A;  1KZP A;  3EUV A;  3PZ2 A;  3Q79 A;  3KSL A;  1TNU A;  3C72 A;  1FPP A;  1SA4 A;  4YDE A;  3PZ1 A;  3DSV A;  1JCQ A;  3SFY A;  1TNY A;  1TNZ A;  1LTX A;  3DRA A;  1NL4 A;  1S63 A;  1JCR A;  1TNO A;  4LNG A;  1TN6 A;  1TNB A;  1N4Q A;  3Q7A A;  1JCS A; 
#chains in the Genus database with same CATH topology
 4KBQ A;  1O1S A;  5KJK A;  2KXP C;  4DJA A;  3PZD A;  5KCM A;  4L2Y A;  1BI7 B;  3B7T A;  3DSW A;  5LCW J;  2FBN A;  3AJI A;  4I1A A;  2KCK A;  3I5P A;  2LO6 A;  3FTZ A;  1INZ A;  2H6F A;  2C0L A;  3U3W A;  2CFU A;  5G04 C;  3KS2 A;  5JA4 D;  1IQR A;  3PUK A;  5CER B;  1U3C A;  4LNU D;  3ZXS A;  1TJF A;  5D0O D;  2YNQ A;  5JJ6 A;  3D9M A;  5HRY A;  1YCS B;  5KJL A;  3OXL A;  5KNH D;  5LFA A;  1QZ2 A;  1E8Z A;  4URK A;  3CK9 A;  5LX8 A;  5C2Y A;  5ARF A;  3FUJ A;  1SA5 A;  4KXK B;  3UX4 A;  3RU0 A;  2VJ8 A;  2MRI A;  3E33 A;  2WPV A;  4JC8 A;  3TAX A;  5EIL A;  2UY1 A;  2DYR E;  1H19 A;  5AAR A;  3RIB A;  4Z68 A;  1V55 E;  1RZ4 A;  4EBA A;  3FEY A;  4LUN U;  4IN3 B;  2FUL A;  4K0R A;  2Y4U A;  1KZP A;  3PNL B;  4BER A;  2X3M A;  3C72 A;  4IRU A;  2Y0B G;  3DSV A;  1N52 A;  4HS2 A;  3JUI A;  5AIJ A;  2P9S G;  3GZ2 A;  1JCR A;  2L0I A;  1TNO A;  2MHK A;  2QYJ A;  3CQC B;  1MX2 A;  2E0I A;  2IFU A;  4CZ2 D;  1MX4 A;  2IU1 A;  2GRN B;  3UIN C;  2AJA A;  3GZS A;  4AVX A;  3E32 A;  2EIK E;  3W9G A;  4CT0 A;  2AXZ A;  4WNF A;  4DX2 A;  4EZJ A;  4XE0 A;  2XPZ A;  4CEM A;  3MV2 B;  3SNX A;  3IHY A;  4F53 A;  3RAU A;  2GRM A;  3CVV A;  4YVO A;  2XCB A;  3RO2 A;  2LXM A;  2EIL E;  3IBE A;  3L08 A;  5FQ6 A;  3FUD A;  4ILG A;  2V5Q C;  4UWG A;  3JQ0 A;  5CRU A;  2WXH A;  3PUJ A;  2X38 A;  3D9L A;  3PRZ A;  3MYV A;  4FU3 A;  2I1J A;  5FJY A;  4GA0 A;  1OUV A;  2FI7 A;  3NZU A;  1HE8 A;  4JD2 G;  3B7R L;  2X6J A;  2ZGG A;  3T8K A;  4W9R A;  2EIM E;  1FPP A;  2WXR A;  4YDE A;  2C2L A;  3PZ1 A;  4G2V A;  1OCC E;  3TWW A;  5CED B;  1E8X A;  4DK5 A;  1HU3 A;  2WXM A;  2VSN A;  1BU9 A;  4LNG A;  2I1K A;  2C0M A;  1FVH A;  1FT1 A;  4KYO B;  3R9A B;  1MQS A;  1D8D A;  3KD7 A;  3FH5 A;  5BXO A;  4GMR A;  4L7T A;  3UMV A;  4BSZ B;  4ME2 A;  4GML A;  4NIK A;  1E90 A;  3U4T A;  3UM3 A;  4I9E A;  4GU5 A;  3TXM A;  4ILI A;  2VSY A;  3D9K A;  4DX7 D;  4OVV A;  4JA9 A;  4GTQ A;  1DC2 A;  1BPO A;  3DSU A;  2XS8 A;  4O6F A;  3V30 A;  3UKR G;  4AXH A;  1DCQ A;  3T5V A;  4PS3 A;  3ZPJ A;  2X6H A;  1AWC B;  1PY1 A;  2P9L G;  3FHE A;  5FZQ A;  4FJY A;  4AP2 A;  2FO7 A;  4KVM A;  5FTP A;  3UUX A;  4CDN A;  3TL5 A;  3LJN A;  4B0Z A;  1ZB1 A;  2AXV A;  2VYI A;  3SBS A;  1DCE A;  3G2S A;  4XIF A;  3SO8 A;  5FIO A;  3ZN3 A;  3OAW A;  1UJK A;  4N2S A;  3EHQ A;  2DCP A;  3EJN A;  3FTX A;  3VLD A;  5ENR D;  3AG1 E;  2BED A;  3ZFW A;  3QNK A;  3Q73 A;  5CCM A;  4CRW A;  3EUV A;  4HVB A;  1V54 E;  3Q79 A;  1NFI E;  2IOL A;  3SI5 A;  3CVN A;  4JEU A;  2NYJ A;  2R5S A;  4WUY A;  2KBX A;  5B3S E;  5CHE E;  5ARG A;  5G05 C;  4I1O B;  2I6H A;  4GA1 A;  4I2W A;  4JVS A;  4F6R D;  4OAV B;  4DRX E;  4MS6 A;  3SGH A;  5M72 A;  4RQI A;  3B95 A;  3CVU A;  4FJZ A;  4WWN A;  3IEG A;  4XI0 A;  3T5X A;  1H6O A;  1VDY A;  3ASF A;  3LEW A;  4HOS A;  4XKC A;  4J7W A;  3TWQ A;  4HXI A;  5ANL A;  4J8F A;  3Q49 B;  1OWM A;  2ZIR A;  3X2Q E;  4G26 A;  4RG6 A;  4FLB A;  5LOZ A;  2ETB A;  3LVQ E;  4HLE A;  4E6H A;  1LF8 A;  3CEQ A;  3FTV A;  1MZC A;  3FFL A;  2XEH A;  3MKQ A;  3ASH A;  3MJW A;  3P2B A;  2P9N G;  1FCH A;  3DSS A;  5ENT D;  3FH7 A;  2HE0 A;  4TUM A;  5AQ7 A;  3UT4 A;  4GCN A;  3FU5 A;  1O1R A;  2XEN A;  4GB9 A;  2ZU6 B;  2XCC A;  4F7A A;  1Z3Y A;  3FP3 A;  3S2A A;  4FHK A;  5JHA A;  1TNU A;  4JL0 A;  1B89 A;  2BUG A;  4ILH B;  4RSY A;  4CDM A;  4E85 A;  4N3C A;  3CK8 A;  4BET A;  4CYM D;  4GMJ A;  3LJ3 A;  4AY5 A;  4RG9 A;  4EZL A;  3QC1 A;  4WWO A;  1A5E A;  3DXK G;  3G2V A;  1HO8 A;  5BXU A;  2R17 C;  2Y3A A;  2ION A;  2IO2 C;  3CIA A;  3TWU A;  4WNE A;  3CQG B;  3QJZ A;  2FF4 A;  4BSX A;  3EDT B;  3V79 K;  1UN9 A;  3G2U A;  5D0Q D;  3AG3 E;  4A3T A;  3BG1 B;  2LSV A;  3UPV A;  4B8A A;  4G8L A;  4G1T A;  3SHF A;  2VTB B;  3MA5 A;  2YIN A;  4UI9 C;  3DPD A;  2BF0 X;  3U64 A;  2F0Y A;  4J8Y A;  3ZIM A;  4CCA A;  2RKK A;  3PZ3 A;  1O1T A;  3LXU X;  4C0M A;  4MBG A;  3S7J A;  2WXL A;  3FEX A;  4HQD A;  5E76 A;  4EBA G;  3FU3 A;  5BT1 A;  1S0P A;  3JXI A;  1HG2 A;  3QWP A;  4BT9 A;  4J8E A;  4HI8 A;  3TG4 A;  5ENP D;  2CHX A;  4HOQ A;  3Q7A A;  4I9C A;  1Z3X A;  3ULQ A;  3V2X A;  1IYG A;  1E7V A;  1N4S A;  3FUN A;  1K3Z D;  3AG2 E;  5AAO A;  3J5Q B;  5EX3 A;  2HM8 A;  1KZO A;  5DIZ A;  5JJ7 A;  1TN8 A;  5A7D B;  2OCC E;  4O1O A;  1MYO A;  2IEJ A;  5EKQ D;  4EPZ A;  4LER A;  4KVO A;  2V5F A;  3CSF A;  4UUC A;  5CMW A;  3C3Q A;  4BES A;  2RFM A;  3QAQ A;  3AS4 A;  4C9B B;  5KNG A;  3DPY A;  3G2T A;  4OVU A;  4APF A;  1OWL A;  1S64 A;  3DSX A;  2QC9 A;  2P58 C;  3K9I A;  1MX6 A;  4R7L A;  5T8I A;  2L0T B;  2XGM A;  4DUI A;  5BW8 C;  1IKN D;  4EEC A;  3MV3 B;  3ZUV B;  5FWQ A;  3SBT B;  3KSL A;  3QB2 A;  2LNI A;  1OCR E;  1S63 A;  2PL2 A;  4J0U A;  3ASO E;  4UQY A;  4UQX A;  3MCX A;  5B1B E;  4QFV A;  1EYH A;  1N11 A;  3CGH A;  5C1D A;  2Y1L E;  3DST A;  3CVX A;  4GTO A;  2DZO A;  2R2L A;  4J6I A;  3DWL G;  1JWF A;  4HOR A;  3PRE A;  2XGO A;  3TWX A;  2A5U A;  2H6H A;  2NC9 A;  4AM9 A;  4BX8 A;  2XGS A;  3LY9 A;  2ILR A;  2CHZ A;  4AIF A;  4XEI G;  1HX8 A;  3SFX A;  4ZHB A;  4JHR A;  4CGW A;  3E37 A;  4XKB A;  2V4L A;  1G3N B;  1SZA A;  3CHQ A;  3VTX A;  3JUE A;  1S70 B;  4K03 A;  3MZL B;  1H6K A;  4HBD A;  5D2M C;  3SF4 A;  3SFZ A;  3L16 A;  4DX5 D;  4GZC A;  2ZIS A;  4J8S A;  2ZGD A;  4U63 A;  1N94 A;  3TJP A;  2PM6 A;  4NAC A;  3ULY A;  3LYA A;  3SD5 A;  3Q5M A;  3AS8 A;  2ETA A;  2VQ2 A;  3Q9N C;  3CK7 A;  3FUM A;  5CRV A;  3ENE A;  3ZHE A;  5B1A E;  3VLE A;  2PNN A;  3JCK C;  3RRN B;  2VTB A;  1ZU2 A;  1H0A A;  2XPI A;  3OXF A;  4IYP A;  1JCQ A;  4MRU A;  3AAA C;  2DBA A;  2XQ0 A;  1DNP A;  5ANR A;  1TN6 A;  4HB5 A;  3ML8 A;  4FP7 A;  3UIP C;  3ZU7 B;  2YQ8 A;  3T9K A;  2IJG X;  3SY2 A;  4HOT A;  2H6G A;  5BUZ A;  2XEV A;  3PDN A;  4JHK A;  3HXD A;  3KEZ A;  3QWV A;  1TYQ G;  2A5E A;  2WM9 A;  2OOE A;  1UN8 A;  3BUA A;  5CCL A;  3Q78 A;  3CLJ A;  4A3V A;  4NUR A;  3URZ A;  3F6Q A;  5AQA A;  2XRY A;  4CDR A;  1JPL A;  4ANW A;  2MYO A;  3HXE A;  3EIJ A;  3E4B A;  2VGX A;  2J07 A;  3HRA A;  5A6C A;  2CHW A;  1SW6 A;  2DIW A;  4DI4 A;  4YDO A;  3C3O A;  4GYW A;  4GTR A;  5FZS A;  2WXQ A;  3ESK A;  4Y6C A;  3Q75 A;  3L9T A;  4M3O A;  3Q4A B;  4J8D A;  2PQN A;  1P5Q A;  1WM5 A;  1BI8 B;  1EDU A;  4I1M A;  5AJD A;  2NXP A;  4KZ0 A;  3NBN B;  2IOS A;  1OWN A;  1ELW A;  2WXG A;  2LAI A;  2KZT B;  3I4G A;  3ZYM A;  2IQC A;  1TNB A;  2EIJ E;  1JCS A;  4DI3 A;  2LSU A;  2R05 A;  5LP0 A;  3ZRH A;  4O1P A;  4U0S A;  3OXG A;  2WXJ A;  1UJJ A;  2GRQ B;  1QYM A;  2WQ7 A;  3APF A;  3W9F A;  3ZEF A;  4HRM B;  1EF1 C;  5EX0 A;  4BT8 A;  3ZGQ A;  3LDZ A;  4DLQ A;  4L1B A;  3CR3 A;  4JA7 A;  2RG8 A;  4KZC A;  2WMO A;  3B7B A;  2XS1 A;  3ZXP A;  2VGY A;  1N4P A;  1WAO 1;  3L13 A;  1K1B A;  2Y4T A;  3FU0 A;  1PC2 A;  3FUI A;  2M63 A;  3GZ1 A;  3FDH A;  3IXE A;  2BKK B;  3S7D A;  4TUU A;  3EIQ C;  3ESL A;  4UI9 K;  5CBN A;  4ANX A;  1SQM A;  3AS5 A;  3MKR A;  3IKO B;  1SVX A;  3PZ4 A;  2MOW A;  2F8X K;  3BEE A;  4G23 A;  2VSO E;  1LD8 A;  4KT6 B;  5J08 A;  2OVF A;  4D10 C;  3ABM E;  3ZYK A;  4QQI A;  2XHE A;  1OWP A;  4V3I A;  3C98 A;  3R7R A;  1EPU A;  3B7U X;  1HS6 A;  4B8C B;  4P29 A;  1TEZ A;  3JQ1 A;  4FAD A;  2WXP A;  3ONL A;  4G11 A;  1U2V G;  3RJV A;  4C48 B;  4F1P A;  4AY6 A;  5HKP A;  2UY1 B;  1A17 A;  3HXB A;  5ENO D;  2P9I G;  4MKT A;  2YHE A;  2WVI A;  1ELK A;  2X6K A;  3ASN E;  2V4H C;  1E7U A;  1NZN A;  2VGE A;  2H6I A;  4H7X A;  3UT7 A;  2QFC A;  4Y6W A;  3JXJ A;  1N0R A;  3IHV A;  4GA2 A;  5AYW D;  3RRU A;  2J49 A;  2QZA A;  1TN7 A;  5LCW C;  4FUL A;  5HI7 A;  1W3B A;  3PEU B;  1WY6 A;  1N95 A;  4GYY A;  4UWF A;  5FZR A;  4ABN A;  3I3N A;  3LS8 A;  4FLH A;  2DVW A;  2GW1 A;  2AXU A;  5H7P A;  2V0P A;  1UW4 B;  2KAT A;  4GTV A;  2WB2 A;  5EID A;  3TG5 A;  4EHM A;  2KM4 A;  1HG5 A;  2XEE A;  1NI1 A;  4A63 B;  4DX1 A;  3ZVV A;  1LD7 A;  3WXX A;  1IHB A;  2BKG A;  3GYZ A;  2LXL A;  1E8Y A;  3CVL A;  4N39 A;  3SZ7 A;  1IQU A;  3CVY A;  4K5B A;  5G05 J;  4N5C A;  4U0Z A;  4JXT A;  2R02 A;  4U07 A;  3FTU A;  4BTA A;  1YMP A;  3QKY A;  3TWV A;  3FTY A;  3T8M A;  3L22 A;  1UG3 A;  3RKV A;  1N4Q A;  2OVB A;  2X6I A;  3D9J A;  3ABL E;  4YDW A;  3CVQ A;  3ASD A;  3O4Z A;  3ZYQ A;  4HFG A;  4JZY A;  4XZ4 A;  5CEA A;  4LNB A;  4LG6 A;  2HO1 A;  5AJL A;  4WWP A;  1NA3 A;  5DBK A;  3FU6 A;  2WXK A;  5CEC B;  4HOU A;  3PH0 C;  2I9C A;  2J4D A;  4FC8 A;  4LCT A;  3UIO C;  4XI9 A;  3HVE B;  3WG7 E;  2AWI A;  4GTS A;  4O60 A;  3RO3 A;  4ACK A;  3QAR A;  5IY5 E;  1JUQ A;  4ANV A;  1N54 A;  3AU5 A;  2OND A;  3E34 A;  2J08 A;  3LY8 A;  3TGO A;  3TWS A;  5CBO A;  4GZ5 A;  4TV3 A;  4TXR A;  5ENS D;  4I6G A;  4H7Y A;  5HQ8 A;  1H2T C;  3CV0 A;  4PS7 A;  3FWV A;  1NP7 A;  3V31 A;  3V2O A;  3D9N A;  4TXP A;  2L9B A;  3LY7 A;  2KCV A;  4KMO A;  4K5C A;  2GRL A;  3R9M A;  3J5P A;  1H2U A;  2V8S E;  4ATG A;  4U0U A;  4TXQ A;  1XNF A;  3UKU G;  1E96 B;  1KPS B;  4ZFH A;  3MGB A;  4CGV A;  3D9I A;  3R7Q A;  2P9U G;  3LKU A;  3FH8 A;  4I17 A;  1Z6T A;  5BPP A;  1TR4 A;  5HS0 A;  3UTM A;  3L54 A;  3B13 A;  3EHM A;  2I2O A;  2GRR B;  3OTN A;  4XX5 A;  1KLX A;  3ZKJ A;  3RRM B;  4HLL A;  3NZS A;  2WMN A;  1N0Q A;  4JB8 P;  4JW1 A;  3Q7F A;  4BTB A;  3D3M A;  5FT9 A;  1N4R A;  4ATZ D;  1KT1 A;  5D66 A;  4UI9 J;  2DYS E;  5FIN A;  3FUK A;  5AN8 A;  5T3R A;  1OWO A;  2EQX A;  2P9P G;  1Y8M A;  5J90 A;  3N71 A;  2PQR A;  3CHP A;  4CT4 A;  2QY7 A;  2ZXW E;  3RK6 A;  1TJC A;  4GZ3 A;  3S7F A;  2AVP A;  5FQ8 A;  2DWZ A;  2WXF A;  3HHM A;  4BY6 A;  4N3A A;  3CHM A;  1QQE A;  5ITZ F;  4B89 A;  3MKQ B;  4LEU A;  2NSZ A;  4OAU C;  4L2L A;  1PAQ A;  3FTS A;  3L82 A;  3AU4 A;  3JYS A;  4ACL A;  2WQH A;  5A23 A;  3CKC A;  4WNG A;  4GPK A;  2KCL A;  3FUF A;  3GW4 A;  4L9P A;  2LUH A;  5JMN D;  1Q2Z A;  5AQ9 A;  1UOH A;  3UM1 A;  3MX3 A;  4I6J A;  1NA0 A;  4N3B A;  3D9H A;  2QYU A;  2WQ6 A;  2CG3 A;  4WAF A;  1JWG A;  4MLP A;  3DEO A;  1YYH A;  1K1A A;  3LCA A;  4U8V D;  1WG0 A;  4BEP A;  2JLB A;  4BWR A;  1RW2 A;  4DX6 D;  3PE4 A;  1HXI A;  2RD0 A;  5G04 J;  5AQB A;  1GW6 A;  3C5R A;  4A55 A;  3NOG D;  1OCZ E;  1SZ9 A;  4YDY A;  5KBA A;  3ULE G;  4G8K A;  4RVB A;  4A1S A;  2WXN A;  2J4B A;  3BQO A;  4Q94 A;  5EYP F;  3HVE A;  4K5A B;  3TXN A;  3LVR E;  2KC7 A;  2GRP B;  4PS8 A;  5BV1 A;  1Z5S C;  2PZI A;  3NF1 A;  4GAA A;  4X8Q A;  3ABK E;  3KEA A;  1ELR A;  3PZ2 A;  3FUH A;  2B6C A;  5EIB E;  3S7B A;  4U8H A;  3SFY A;  1TNZ A;  1LTX A;  4BFR A;  3BU8 A;  3ONK A;  2A4Z A;  4U7E B;  3NB2 A;  4G25 A;  4M7C A;  4GCO A;  2XZD G;  4GYO A;  2L6J A;  2WXO A;  1XGW A;  1OY3 D;  5FQ4 A;  4FHJ A;  3HIZ A;  2JEK A;  2UWJ G;  2X6F A;  3FY4 A;  4U04 A;  2RFA A;  2OEW A;  3AG4 E;  4B93 B;  3LPZ A;  4GTM A;  3NQP A;  4G24 A;  3BG0 B;  2Y69 E;  3UQ3 A;  3UM2 A;  3EHR A;  5BV0 A;  4GTP A;  4LSZ E;  4PH4 B;  3CHS A;  3KSQ A;  2GRO B;  4PDX A;  1X81 A;  4U95 D;  3UI2 A;  4I2Z A;  3EHN A;  5EN5 D;  1HH8 A;  1OXJ A;  3PEV B;  2LAH A;  3E30 A;  3MEK A;  3NOC D;  1OCO E;  4JPS A;  1O5M A;  3U66 A;  4N5Q A;  3Q9U C;  2Q7F A;  5EYL A;  1MHQ A;  2AW6 A;  2E2E A;  1D8E A;  2J9Q A;  2DZN A;  5AEN A;  1DVP A;  3APD A;  5T4Y A;  3CHR A;  1QNF A;  4C0E A;  2F37 A;  1L5J A;  3DRA A;  4TRQ A;  3CVP A;  4AJW A;  1OT8 A;  2XRZ A;  1HF8 A;  4I6E A;  3DXM G;  4JEH A;  1BD8 A;  4WND A;  3FTW A;  4DPR A;  3UXG A;  1H2V C;  1U3D A;  2HYZ A;  3PNT B;  5JHB A;  4GZD A;  3PE3 A;  3PS6 A;  1FT2 A;  3CKB A;  4HRL A;  5ENQ D;  1X5B A;  4BX9 A;  3QDN A;  3HXF A;  3CVW A;  2P2C P;  1Y6I A;  2OV8 A;  4FA6 A;  2FO1 E;  4AOF A;  1D9S A;  4DLO A;  4I43 A;  3TWR A;  3DBS A;  5JJT A;  3ML9 A;  4EQF A;  5E75 A;  4RLY A;  3HG0 D;  2J09 A;  3QWW A;  2B0O E;  3L17 A;  2L6B A;  2BTD A;  3QOU A;  3APC A;  3ZW3 A;  4OYS A;  4NRH B;  2IF4 A;  3FUE A;  2IO3 C;  3EU9 A;  1E8W A;  1H6P A;  5KJM A;  2FEZ A;  4Q96 A;  3UM0 A;  5FQ7 A;  1N9A A;  4NQ0 A;  4YND A;  4YVQ C;  3C3R A;  2IY0 C;  2PM7 A;  1SA4 A;  3P1U A;  1WDY A;  3U9W A;  4LRZ A;  1YA0 A;  4UWL A;  3VTY A;  4HI9 A;  1NL4 A;  2XZT G;  3SQV A;  3HYM B;  3TWT A;  1KT0 A;  4Q69 A;  1K8K G;  1IXV A;  2ETC A;  4EZK A;  1BLX B;  4F1S A;  2P9K G;  2HR2 A;  5EDS A;  4IUL A;  2CFZ A;  3UT8 A;  4UWH A;  3Q47 B;  3PVL A;  1IHG A;  3D9O A;  3ZHE B;  3CHO A;  2VSX E;  2R03 A;  2JAB A;  2YHC A;  4JHJ A;  3G2W A;  4GZ6 A;  5KJN A;  5G55 A;  3QK0 A;  4GTT A;  4AV7 A;  3ISM C;  3DEP A;  5ENN A;  3HXC A;  3CST A;  1QBQ A;  3IV0 A;  3Q15 A;  5CMY A;  3O48 A;  3HDX A;  1AP7 A;  1HFA A;  1ZBP A;  3B7S A;  3VLF A;  3ZYL A;  2KZT A;  2XPY A;  4ANU A;  2R59 A;  1FVF A;  5BNW A;  2EIN E;  2J8S D;  4U8Y D;  2CG2 A;  4GPM A;  4HNA D;  3I4R B;  3EU5 A;  3ZNG A;  1HZ4 A;  4L23 A;  3D9P A;  4AEZ C;  3RSE G;  4UQZ A;  4PUC A;  4UWK A;  4B94 A;  2F8Y A;  2OEV A;  3ASG A;  3NAW A;  3FUL A;  2GGF A;  1MJ0 A;  4HRN A;  4U96 D;  4A1G A;  1TNY A;  4APO A;  5G2N A;  3KAE A;  2WXI A;  4F3V A;  2VGX B;  3L6A A;  5KWD A;  4N2Q A; 
#chains in the Genus database with same CATH homology
 3HXB A;  1FT1 A;  1O1S A;  4L9P A;  1D8D A;  1N4S A;  2H6G A;  1FT2 A;  3DST A;  1KZO A;  4GTO A;  2H6I A;  3DSW A;  3HXD A;  2R2L A;  3E32 A;  1TN8 A;  4LNB A;  3HXF A;  2IEJ A;  1TN7 A;  2H6F A;  4GTM A;  3Q78 A;  4GTT A;  2H6H A;  1N95 A;  4GTQ A;  3DSU A;  2ZIR A;  3HXC A;  4GTS A;  1N4P A;  1QBQ A;  3Q7F A;  4GTP A;  3SFX A;  3KSQ A;  3HXE A;  1N4R A;  3E37 A;  1X81 A;  3DPY A;  1MZC A;  1S64 A;  3E34 A;  1SA5 A;  3DSX A;  3DSS A;  4GTV A;  3E33 A;  1DCE A;  2F0Y A;  2ZIS A;  4EHM A;  1N94 A;  3E30 A;  3PZ3 A;  3PZ4 A;  1O5M A;  1O1T A;  3EU5 A;  1NI1 A;  4YDO A;  1O1R A;  4GTR A;  4MBG A;  1LD8 A;  1LD7 A;  1N9A A;  1D8E A;  2BED A;  3Q75 A;  3Q73 A;  1KZP A;  3EUV A;  3PZ2 A;  3Q79 A;  3KSL A;  1TNU A;  3C72 A;  1FPP A;  1SA4 A;  4YDE A;  3PZ1 A;  3DSV A;  1JCQ A;  3SFY A;  1TNY A;  1TNZ A;  1LTX A;  3DRA A;  1NL4 A;  1S63 A;  1JCR A;  1TNO A;  4LNG A;  1TN6 A;  1TNB A;  1N4Q A;  3Q7A A;  1JCS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...