1N9JA

Solution structure of the 3d domain swapped dimer of stefin a
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
98
structure length
98
Chain Sequence
b'MIPGGLSEAKPATPEIQEIVDKVKPQLEEKTNETYGKLEAVQYKTQVVAGTNYYIKVRAGDNKYMHLKVFKSLPGQNEDLVLTGYQVDKNKDDELTGF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cystatin A
publication title Three-dimensional domain swapping in the folded and molten-globule states of cystatins, an amyloid-forming structural superfamily
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase inhibitor
total genus 12
structure length 98
sequence length 98
chains with identical sequence B
ec nomenclature
pdb deposition date 2002-11-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00031 Cystatin Cystatin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.10 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 1n9jA00
1CYVA 2O9UX 3PS8A 1RN7A 4N6MA 1CEWI 5ELUA 3GAXA 5LC7A 4N6V0 1GD3A 3KSED 3S67A 1DVCA 1FA3A 2W9QA 1A67A 4LZIA 3LH4A 3K9MC 1N5HA 1CYUA 1WNHA 3UL5A 1PFPA 4ZM8A 1YVBI 3NX0A 4N6OB 3KFQC 2CH9A 1KWIA 1R4CA 3L0RA 2BO9B 3IMAB 1GD4A 1N5PA 4EYCA 5A0OB 1NB5I 4IT7A 2OCTA 3Q2PA 2KXGA 4CCVA 3SVAA 1G96A 1A90A 1IV9A 1TIJA 1LXEA 4N6LA 3QRDA 1NB3I 3MWZA 1ROAA 5LC6A 1N9JA 1DVDA 4N6UA 1FUWA 3PXMA 3PYJA 4N6TA 1M9GA 5EQLA 1MOLA 1EQKA 1MNLA 4N6NB 1IV7A 5ELJA 2W9PA 1STFI 3UL6A 4TX4A
chains in the Genus database with same CATH superfamily
3RGAA 1LOWA 1UI8A 3CNMA 3PS8A 5HGRA 1OF5B 1IVWA 3OV4A 3FCSB 1JBRA 2CFKA 3G713 1UUWB 3RGRA 1RGFA 4N6MA 1CEWI 3U97A 3OX9A 3EBYA 1GMQA 1A2KA 3GAXA 4J9AA 1AR0A 1ZX2A 3JUNA 4N6V0 4RBNA 2ZA4A 1DMMA 1UCIA 1GD3A 1JKGA 1ULIB 1SIIA 3S67A 1BRIA 4EV2A 1K28A 1K9M4 2ML5A 2HMOB 4FMDA 1B2SA 2GEYA 2GEXA 2JDIH 3ER7A 1IVVA 2XFTA 8CHOA 1V58A 3MKIA 1PU4A 1EG9B 2A15A 3CMA3 1SIHA 1YJN3 3PCRA 3K9MC 1BSAA 5TGNA 1YGWA 1Q40B 3WA2X 1FGOA 2C10A 1RN4A 1O7MB 2P0XA 2KF4A 4MMYB 1NJI4 1FYSA 1STDA 2OWPA 3LYGA 2MF7A 1JZDA 1BSBA 3O8YA 1BANA 3CCV3 1RDSA 2W56B 4LYLB 1BRGA 1VQO3 1DE3A 3OWSA 4CDLA 1E3VA 2RCDA 5M1AA 3BIRA 1BSCA 3D79A 1R4YA 1R4CA 3DGYA 1W6GA 4O3VA 1IT8A 5IG5A 2Q07A 5M18A 3B8LA 1T5YA 2Y73A 3KE7A 2IYJA 3F9SA 1TFOA 2L4VA 4LGQA 1RHLA 1G02A 7GSPA 1F8NA 3HOHA 4O8SA 2CG1A 1IDPA 2YX9A 3X3ZA 1NNVA 1BIRA 4R1KA 1QAKA 1MWUA 2B24B 2OCTA 1LQGC 2WOHA 2W0QA 2KXGA 4CCVA 1NU3A 3DUKA 4GSPA 1K41A 3NM7A 4WHAA 3A5EA 2QEX3 4J8TA 1JKGB 3H3HA 3MPHA 3OWUA 4HVNA 1GY6A 2MC8A 4ORLA 1AVKA 1NB3I 6STDA 2WGOA 1SARA 3M8CA 3CCL3 1RLSA 5AYSC 2O3OA 1O7GB 4KVHA 4K90B 2CG0A 1RGCA 1IQYA 1FGTA 5AI1A 5D81A 2XF3A 4JRFA 5BU4A 1I3IA 4XDWA 2H0IA 3CU3A 8RNTA 1X1UA 1Q42A 1MWTA 2CX1A 3JUOA 4R4KA 1IVUA 3K63A 1UGIA 1O7PB 5IEPA 3CCE3 6RNTA 1BRNL 1G0TA 4HYZA 5GSPA 4N6TA 1M9GA 2CKFB 4KFEA 3J7Yd 3G4S3 1I2GA 3FKAA 5EQLA 1MOLA 4WFOA 2CFLA 3RDEA 5M19A 1MNLA 5FW5A 3WHOA 3EQQB 1N8QA 4N3VA 1RGHA 2YFJB 2AAEA 3IJEB 4HOHA 4HKVB 3LTAA 3WA3A 1AV4A 1OPYA 4PEJA 1QVG2 1QVF2 3UL6A 1FGRA 1TP6A 1QJGA 1NWWA 4RNZA 1D6UA 2W6JH 3Q90A 4WYKB 3CXC2 3UJMA 1T2IA 4HBRA 2F56A 3NM2A 1B2MA 3NV0B 3ZG0A 3JVCA 3G8ZA 1RN7A 1UGHI 3GWRA 6GSPA 3EHCA 1I70A 2FNQA 5ELUA 3SOYA 2CW9A 1GMPA 3BNBA 4R9LA 3S5CA 3T8UA 5LC7A 3CCU3 4HM3B 3EF8A 4BTWA 2W56A 2HOHA 5IERA 1BOXA 2IUJA 3EN8A 2L1SA 1W01A 1Q7Y4 4L8OA 1RSNA 2FGTA 1JZOA 2H0GA 2K54A 4MEIA 3HZPA 5FGOA 3SLUA 4H3UA 3EBTA 3DGOA 5D82A 1EA2A 1ISKA 3KZTA 1BVIA 2ZDJA 3FF2A 3CC43 3CCS3 1KQS2 1A67A 3WR2A 2Z77A 5IEOA 3S29A 3AMOA 1EUIC 1RGAA 3LH4A 1LOYA 4XBYA 3BNDA 5AIHA 5KP4A 5IW9A 5RNTA 3CCM3 1RNBA 1OHPA 1IYYA 4CJNA 4I5QA 2XR8B 2QA43 1W00A 1T2HA 3LTCA 1WNHA 3DM8A 3FG3A 1D6YA 1FW7A 1UUGB 3CNXA 1JB4A 1HKXA 4ZM8A 2IA7A 3PCSA 1TRQA 3NX0A 3EN1B 4HAAA 4N6OB 3X40A 1B3SA 1MWRA 1W2ZA 2RGQA 1BNIA 1RRHA 1VQP3 1DMQA 1UI7A 2IUKA 2CFDA 2CFGA 3AGNA 3KFQC 3G0KA 1GY7A 1VQ43 2AADA 3B4OA 5HOHA 1B2ZA 1UUVB 1US1A 3T8NA 5BXQA 4G1MB 1CH0A 2KAAA 3BB9A 2H0HA 1GMRA 2C11A 4BL3A 2CHCA 1YIJ3 4J5KA 2XGLA 2HMMB 1V74A 4MMZB 1BRJA 3MG2A 2PZVA 5IG3A 2UGIA 2WOFA 5KP1A 3G6E3 1JB2A 4HM0B 2CWVA 2HMLB 4STDA 4XBTA 3NUVA 5JPPA 2BIRA 4HM2B 3OXAA 2LYXA 4O2HA 2R4IA 1CQSA 4FMAA 3A76A 3K0ZA 5I97A 1YI23 4BL2A 1LVNA 1A90A 4HZ9B 2XH9A 4K61A 3URPA 3FG4A 1UCJA 1BRSA 1GY5A 3KN4A 1B21A 4ILFA 1LXEA 2KCDA 3FH1A 3KCHA 3QRDA 4L7KA 1B2XA 1TRPA 1K8A4 3N8BA 2CWTA 4EV5A 1SPUA 4HM5B 1OGXA 3CC23 3OW22 1FGMA 3KSPA 4MJDA 3ZG5A 2GXFA 1DVDA 1BU4A 3Q1CA 4N6UA 4RNYA 4IPBA 1VQQA 1YHQ3 3PXMA 3DGLA 3F14A 3DXOA 4WYKA 5KP3A 5JBSA 3AMOB 7RNTA 1W02A 4K1UA 3NV0A 1RCKA 1V57A 1GOUA 3PYJA 4EXRA 3BNEA 3EE1A 2V1LA 2RBIA 2XSOB 3N9HA 3PGBA 4NHFA 1I8VA 5JPUA 2RNTA 2XFSA 1ZS7A 4FCMA 2SBLA 3F40A 2E2TA 3GZXB 4N6NB 1BUJA 3QK9A 3WOFB 1YGEA 3NQZA 2Z6BA 4HM1B 3FGYA 1GS3A 5IG0A 1RGGA 1Q7HA 5EVHA 1TU5A 1IVXA 1BNJA 1N8R4 1BUQA 3AHSA 2W9PA 3FG1A 3X3YA 2F5MA 1TTOA 4X2HA 4X2OA 2J8XB 1VZZA 3RNTA 3T0UA 1WMOA 1JN5A 1FGQA 5AYRB 1TFKA 4GL6A 4GHOA 1CYVA 1BNEA 1NDOB 2O9UX 1NO3A 2IY2A 4EBGA 3DZLA 5AIFA 2E2VA 1GOVA 1VQ53 1BNRA 1I0VA 1RRLA 1IQ8A 3JUMA 5BVBA 2ZL8A 2CFWA 3LTDA 5CLKA 5AIGA 4XDVA 3GSPA 1E97A 2UUGC 3V99A 1QMAA 4OUQA 3KSED 1S5AA 1B27A 1DVCA 4EC6A 5CF2A 1RGEA 1FA3A 2R41A 3K5TA 1A2PA 3KIIA 2F5WA 2HMKB 1JBSA 2F4YA 1S723 4FMCA 1D6ZA 2F86B 3JUPA 2C4BA 1A2VA 3B7CA 3NXJA 4HJLB 1VQK3 1B2UA 4LEHA 2XEPA 4LZIA 9RNTA 1VQ93 2ML6A 4BTXA 2OOVA 1OCVA 2BU4A 3VSYA 1CYUA 2WO0A 3GZRA 5G1LA 2INXA 2BNGA 1TJDA 1KSIA 4KFFA 3JUQA 3ALAA 4QWTA 1PFPA 3D5GA 1GYBA 1UCKA 3UB1A 2CK3H 3HK4A 2KRTA 3CCQ3 4BIRA 1LRAA 2OQEA 1HZ1A 2CIUA 3NQYA 2OOVC 2XGNA 3AGOA 3GZBA 1IU7A 3SOAA 3BU4A 1UCLA 1WMNA 1ROVA 4H61A 2B1XB 1Q9EA 2OQEC 3NBJA 2GBXB 4XM4A 3B4PA 3S28A 2D42A 3N54B 1WMPA 2BHMA 2LQVA 3CCR3 1JN5B 5IF6A 1MWSA 3D3LA 1YVSA 1BSEA 3K7CA 1JNQA 3MG3A 4HM8B 1Q864 2K3DA 2CWUA 2K0MA 1M1K4 1DYUA 3HIGA 3U1WA 2UX0A 3LXUX 1IV9A 2QGUA 3DMCA 1BGSA 3VF1A 3WDGB 4N6LA 2OTJ3 3GZYB 1RN1A 2KF5A 2OTL3 3VGNA 1VQ73 3F7SA 5CF1A 1HU9A 3LOYA 3EJVA 1M904 2KF3A 5LC6A 1LNIA 1N9JA 4K1VA 3SYUA 4AKYA 1FUWA 1YJ93 2GBWB 2STDA 1FZUA 1VQ83 1W5ZA 2Z76A 3DY5A 1VQN3 3MSOA 1ULJB 1BAOA 2PNCA 1I3FA 3OWYA 3I553 1I2EA 3ECFA 3F8HA 3FLJA 2I9WA 4HM6B 1M1XB 1RGKA 1W6YA 2SARA 3WODG 1W2B2 1RKYA 3IPTA 1IV7A 1RJOA 1SQWA 2RSXA 1OUNA 2CX0A 2HMNB 3NHXA 2BT3A 2E2UA 4MMXB 3TDGA 3FSDA 1I2FA 4WP5A 5EEOA 1RNTA 1O7NB 3LTBA 1B20A 1X1WA 2GU1A 3I563 4XBXA 4AEQA 1UDII 2F98A 4HZBB 4TX4A 1BNSA 3Q3FA 4KT3B 1FUTA 1PY3A 1TUHA 3CPW2 2YFLB 3GRDA 1OH0A 3FZWA 2WGQA 1DETA 1YJW3 1YIT3 4OVMA 2HMJB 4I4KA 4U13A 3D5IA 4OK0A 3V92A 3MYTA 4R80A 3S27A 1QALA 3STDA 3UNLA 1MGWA 2ZHXB 1OHSA 3EC9A 3WOEB 2XRXB 1Q824 1L5GB 1K734 5CK6A 5G1KA 3SEDA 2W9QA 3CCJ3 3LT9A 4AKZA 1JRQA 3BNCA 1N9EA 2W2CA 1C54A 7STDA 3CC73 1VQ63 4FMBA 1W4NA 3LT8A 1I0XA 1N5HA 3PZWA 1JJ22 3E99A 4O02B 1X1YA 3G16A 1BNGA 5AEWB 1WTHA 3V98A 4BU4A 2CC3A 1W6CA 1OHOA 3NBRA 1QAFA 3UL5A 1Q814 3EX9A 1C7HA 1RCLA 1UW1A 4NPBA 4R9KA 1YVBI 5STDA 3H51A 3HI7A 1OACA 1BRHA 5IG4A 3NBBA 4RNTA 1E3RA 1HYFA 3SXXA 1IT7A 2CH9A 3HX8A 3LMLA 1KWIA 3L0RA 1W7CA 1AVLA 1LOVA 2GU3A 2BO9B 1ZO2A 2F99A 4XB5A 5CXOA 3ZFZA 4IIAA 2XSHB 3IMAB 1PYLA 3HIIA 4LSOA 1O7HB 1X1XA 1GSPA 1GD4A 1LQMB 3MHEA 1N5PA 2Y74A 4EYCA 5A0OB 3LZAA 4EW5A 3SX1A 1OF5A 1EEJA 1GOYA 1Z1SA 2P05A 4Q53A 1NB5I 2GSPA 4IT7A 1IQXA 3CPOA 2BMRB 3Q2PA 1O7WB 1RGLA 2Z7AA 3DGNA 2JQ5A 1ZGXA 1MGRA 1BNFA 1IK3A 3WMDA 1VQL3 3SVAA 4WWUC 1G96A 2BMQB 2RFRA 2QIYA 3DGMA 3F8XA 1KC84 1TIJA 3EB8A 4NREA 3F7XA 1VQM3 1AY7A 5AIIA 4FCJA 1OGZA 1U8CB 2P38A 1BSDA 1BRKA 1AQZA 5DRVA 1EKMA 1FUSA 3MWZA 1ROAA 3FF0A 3MG1A 2P09A 4J5GA 2BMOB 1RMSA 1Q40A 4GB5A 3X41A 2D1WA 4DKIA 1JB5A 3KKGA 4L8PA 5AEUB 2IMJA 1RTUA 1JBTA 1DMNA 4KFDA 3X3XA 3AHWA 1Y4KA 2YFIB 3DH2A 4JF8A 1U5OA 1EQKA 2W03A 4BTYA 1J2BA 4KZ1A 4HM4B 4CPKA 3CME3 3BLZA 5ELJA 4LMIA 3D9RA 4FR9A 1ASKA 1WQLB 2KF6A 4FCZA 1KD14 3ROBA 5G2GA 1STFI 1JV2B 2W04A 3X42A 2M7OA 5BIRA 5D83A 1SJWA 1LOXA 1YNVX 3CD63 3D4AA 5IENA 4HM7B 4RZMA 3I0YA 1T3BA 1LNHA 2FXTA 2P0MA 5DREA
chains in the Genus database with same CATH topology
3RGAA 1UI8A 3PS8A 3CNMA 5HGRA 1OF5B 1IVWA 3OV4A 3FCSB 2CFKA 3G713 1UUWB 3RGRA 4N6MA 1CEWI 3U97A 3OX9A 3EBYA 4J9AA 1A2KA 3GAXA 4RBNA 1AR0A 1ZX2A 3JUNA 4N6V0 1DMMA 1ULIB 1GD3A 1JKGA 1SIIA 3S67A 4EV2A 1K28A 1K9M4 2ML5A 2HMOB 4FMDA 2GEYA 2GEXA 2JDIH 3ER7A 1IVVA 2XFTA 8CHOA 3MKIA 1PU4A 1EG9B 2A15A 3CMA3 1SIHA 1YJN3 3PCRA 3K9MC 5TGNA 1Q40B 3WA2X 1FGOA 2C10A 1O7MB 2P0XA 4MMYB 1NJI4 1STDA 2OWPA 3LYGA 2MF7A 3O8YA 3CCV3 2W56B 1VQO3 3OWSA 4CDLA 1E3VA 2RCDA 1R4CA 1W6GA 4O3VA 1IT8A 5IG5A 2Q07A 3B8LA 1T5YA 2Y73A 3KE7A 3F9SA 1TFOA 2L4VA 4LGQA 1F8NA 4O8SA 2CG1A 1IDPA 2YX9A 3X3ZA 4R1KA 1QAKA 2B24B 2OCTA 2WOHA 2W0QA 2KXGA 4CCVA 1NU3A 3DUKA 4WHAA 1K41A 3NM7A 2QEX3 4J8TA 1JKGB 3H3HA 3MPHA 3OWUA 4HVNA 1GY6A 2MC8A 4ORLA 1AVKA 1NB3I 6STDA 2WGOA 3M8CA 3CCL3 5AYSC 2O3OA 1O7GB 4KVHA 4K90B 2CG0A 1IQYA 1FGTA 5AI1A 5D81A 2XF3A 4JRFA 4XDWA 3CU3A 1Q42A 4R4KA 3JUOA 1IVUA 3K63A 1O7PB 5IEPA 3CCE3 4HYZA 4N6TA 1M9GA 2CKFB 4KFEA 3J7Yd 3G4S3 3FKAA 5EQLA 1MOLA 4WFOA 2CFLA 3RDEA 1MNLA 5FW5A 3EQQB 1N8QA 4N3VA 2YFJB 3IJEB 4HKVB 3LTAA 3WA3A 1AV4A 1OPYA 4PEJA 1QVG2 1QVF2 3UL6A 1FGRA 1TP6A 1QJGA 1NWWA 4RNZA 2W6JH 1D6UA 3Q90A 4WYKB 3CXC2 3UJMA 4HBRA 3NM2A 3NV0B 3JVCA 3G8ZA 1RN7A 3GWRA 3EHCA 2FNQA 5ELUA 3SOYA 2CW9A 3BNBA 4R9LA 3S5CA 3T8UA 5LC7A 3CCU3 4HM3B 3EF8A 4BTWA 2W56A 5IERA 2IUJA 3EN8A 1W01A 1Q7Y4 4L8OA 2FGTA 5FGOA 3SLUA 2K54A 4MEIA 3HZPA 4H3UA 3EBTA 3DGOA 5D82A 1EA2A 1ISKA 3KZTA 2ZDJA 3FF2A 3CC43 3CCS3 1KQS2 1A67A 2Z77A 5IEOA 3S29A 3AMOA 3LH4A 5AIHA 4XBYA 3BNDA 5KP4A 5IW9A 3CCM3 1OHPA 2XR8B 2QA43 1W00A 3LTCA 1WNHA 3DM8A 3FG3A 1D6YA 3CNXA 1JB4A 1HKXA 4ZM8A 2IA7A 3PCSA 3NX0A 3EN1B 4N6OB 3X40A 1W2ZA 2RGQA 1RRHA 1VQP3 1DMQA 1UI7A 2IUKA 2CFDA 2CFGA 3KFQC 3G0KA 1GY7A 1VQ43 3B4OA 1UUVB 1US1A 3T8NA 5BXQA 4G1MB 3BB9A 2C11A 2CHCA 1YIJ3 2XGLA 2HMMB 1V74A 4MMZB 3MG2A 2PZVA 5IG3A 2WOFA 5KP1A 3G6E3 1JB2A 4HM0B 2CWVA 2HMLB 4STDA 4XBTA 3NUVA 5JPPA 4HM2B 3OXAA 2LYXA 4O2HA 2R4IA 1CQSA 4FMAA 3A76A 3K0ZA 5I97A 1YI23 1LVNA 1A90A 4HZ9B 2XH9A 4K61A 3FG4A 3KN4A 1GY5A 1LXEA 2KCDA 3FH1A 3QRDA 4L7KA 1K8A4 3N8BA 2CWTA 4EV5A 1SPUA 4HM5B 1OGXA 3CC23 3OW22 1FGMA 3KSPA 4MJDA 2GXFA 1DVDA 4N6UA 3Q1CA 4RNYA 1YHQ3 4IPBA 3PXMA 3DGLA 3F14A 3DXOA 4WYKA 5KP3A 5JBSA 3AMOB 1W02A 4K1UA 3NV0A 3PYJA 4EXRA 3BNEA 3EE1A 2V1LA 2XSOB 3N9HA 3PGBA 4NHFA 5JPUA 2XFSA 4FCMA 2SBLA 3F40A 2E2TA 3GZXB 4N6NB 3QK9A 3WOFB 1YGEA 3NQZA 2Z6BA 4HM1B 3FGYA 1GS3A 5IG0A 5EVHA 1TU5A 1N8R4 1IVXA 1BUQA 2W9PA 3FG1A 3X3YA 4X2HA 4X2OA 1VZZA 3T0UA 1WMOA 1JN5A 1FGQA 5AYRB 1TFKA 4GL6A 1CYVA 1NDOB 2O9UX 4EBGA 1NO3A 3DZLA 5AIFA 2E2VA 1VQ53 1RRLA 1IQ8A 3JUMA 5BVBA 2ZL8A 2CFWA 3LTDA 5CLKA 5AIGA 4XDVA 1E97A 3V99A 1QMAA 4OUQA 3KSED 1S5AA 1DVCA 4EC6A 5CF2A 1FA3A 3K5TA 3KIIA 2HMKB 1S723 4FMCA 1D6ZA 2F86B 3JUPA 3B7CA 1A2VA 3NXJA 4HJLB 1VQK3 4LEHA 1VQ93 2XEPA 4LZIA 2ML6A 4BTXA 2OOVA 1OCVA 3VSYA 1CYUA 2WO0A 3GZRA 2INXA 2BNGA 1KSIA 4KFFA 3JUQA 3ALAA 4QWTA 1PFPA 3UB1A 1GYBA 3CCQ3 2CK3H 3HK4A 2KRTA 2OQEA 2CIUA 3NQYA 2OOVC 2XGNA 3GZBA 1IU7A 3SOAA 1WMNA 1ROVA 4H61A 2B1XB 2OQEC 3NBJA 2GBXB 4XM4A 3B4PA 3S28A 2D42A 3N54B 1WMPA 2BHMA 2LQVA 3CCR3 1JN5B 5IF6A 3D3LA 3K7CA 1JNQA 3MG3A 4HM8B 1Q864 2CWUA 2K0MA 1M1K4 1DYUA 3HIGA 3U1WA 2UX0A 3LXUX 1IV9A 2QGUA 3DMCA 3VF1A 3WDGB 4N6LA 2OTJ3 3GZYB 2OTL3 3VGNA 1VQ73 3F7SA 5CF1A 1HU9A 3LOYA 3EJVA 1M904 5LC6A 4K1VA 1N9JA 4AKYA 1FUWA 1YJ93 2GBWB 2STDA 1VQ83 1W5ZA 2Z76A 3DY5A 1VQN3 3MSOA 1ULJB 2PNCA 3OWYA 3I553 3ECFA 3F8HA 3FLJA 2I9WA 4HM6B 1M1XB 1W6YA 3WODG 1W2B2 1RKYA 3IPTA 1IV7A 1RJOA 1SQWA 2RSXA 1OUNA 2HMNB 3NHXA 2BT3A 2E2UA 4MMXB 3TDGA 3FSDA 4WP5A 5EEOA 1O7NB 3LTBA 2GU1A 3I563 4XBXA 4AEQA 2F98A 4HZBB 4TX4A 3CPW2 1TUHA 2YFLB 3GRDA 1OH0A 3FZWA 2WGQA 1YJW3 1YIT3 4OVMA 2HMJB 4I4KA 4U13A 4OK0A 3V92A 3MYTA 4R80A 3S27A 1QALA 3STDA 3UNLA 3EC9A 1OHSA 3WOEB 2XRXB 1Q824 1L5GB 1K734 5CK6A 3SEDA 2W9QA 3CCJ3 3LT9A 4AKZA 1JRQA 3BNCA 1N9EA 2W2CA 7STDA 3CC73 1VQ63 4FMBA 1W4NA 3LT8A 1N5HA 3PZWA 1JJ22 3E99A 4O02B 3G16A 5AEWB 1WTHA 3V98A 2CC3A 1W6CA 1OHOA 3NBRA 1QAFA 3UL5A 1Q814 3EX9A 1C7HA 1UW1A 4R9KA 5STDA 1YVBI 3H51A 3HI7A 1OACA 5IG4A 3NBBA 1E3RA 3SXXA 1IT7A 2CH9A 3HX8A 3LMLA 1KWIA 3L0RA 1W7CA 1AVLA 4XB5A 2GU3A 2BO9B 1ZO2A 2F99A 5CXOA 4IIAA 2XSHB 3IMAB 3HIIA 4LSOA 1O7HB 1GD4A 3MHEA 1N5PA 2Y74A 4EYCA 5A0OB 3LZAA 3SX1A 1OF5A 1Z1SA 2P05A 4Q53A 1NB5I 4IT7A 1IQXA 3CPOA 2BMRB 3Q2PA 1O7WB 2Z7AA 3DGNA 2JQ5A 1VQL3 1IK3A 3WMDA 3SVAA 4WWUC 1G96A 2BMQB 2RFRA 2QIYA 3DGMA 3F8XA 1KC84 1TIJA 3EB8A 4NREA 3F7XA 1VQM3 5AIIA 4FCJA 1OGZA 1U8CB 2P38A 5DRVA 1EKMA 3MWZA 1ROAA 3FF0A 3MG1A 2P09A 2BMOB 4GB5A 1Q40A 3X41A 2D1WA 1JB5A 3KKGA 4L8PA 5AEUB 2IMJA 1DMNA 4KFDA 3X3XA 1Y4KA 2YFIB 4JF8A 1U5OA 1EQKA 2W03A 4BTYA 1J2BA 4KZ1A 4HM4B 3CME3 3BLZA 5ELJA 4LMIA 3D9RA 4FR9A 1ASKA 1WQLB 1KD14 4FCZA 3ROBA 5G2GA 1STFI 1JV2B 2W04A 3X42A 2M7OA 5D83A 1SJWA 1LOXA 3CD63 5IENA 4HM7B 4RZMA 3I0YA 1LNHA 2FXTA 2P0MA 5DREA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1CYV A;  2O9U X;  3PS8 A;  1RN7 A;  4N6M A;  1CEW I;  5ELU A;  3GAX A;  5LC7 A;  4N6V 0;  1GD3 A;  3KSE D;  3S67 A;  1DVC A;  1FA3 A;  2W9Q A;  1A67 A;  4LZI A;  3LH4 A;  3K9M C;  1N5H A;  1CYU A;  1WNH A;  3UL5 A;  1PFP A;  4ZM8 A;  1YVB I;  3NX0 A;  4N6O B;  3KFQ C;  2CH9 A;  1KWI A;  1R4C A;  3L0R A;  2BO9 B;  3IMA B;  1GD4 A;  1N5P A;  4EYC A;  5A0O B;  1NB5 I;  4IT7 A;  2OCT A;  3Q2P A;  2KXG A;  4CCV A;  3SVA A;  1G96 A;  1A90 A;  1IV9 A;  1TIJ A;  1LXE A;  4N6L A;  3QRD A;  1NB3 I;  3MWZ A;  1ROA A;  5LC6 A;  1N9J A;  1DVD A;  4N6U A;  1FUW A;  3PXM A;  3PYJ A;  4N6T A;  1M9G A;  5EQL A;  1MOL A;  1EQK A;  1MNL A;  4N6N B;  1IV7 A;  5ELJ A;  2W9P A;  1STF I;  3UL6 A;  4TX4 A; 
#chains in the Genus database with same CATH topology
 3RGA A;  1LOW A;  1UI8 A;  3CNM A;  3PS8 A;  5HGR A;  1OF5 B;  1IVW A;  3OV4 A;  3FCS B;  1JBR A;  2CFK A;  3G71 3;  1UUW B;  3RGR A;  1RGF A;  4N6M A;  1CEW I;  3U97 A;  3OX9 A;  3EBY A;  1GMQ A;  1A2K A;  3GAX A;  4J9A A;  1AR0 A;  1ZX2 A;  3JUN A;  4N6V 0;  4RBN A;  2ZA4 A;  1DMM A;  1UCI A;  1GD3 A;  1JKG A;  1ULI B;  1SII A;  3S67 A;  1BRI A;  4EV2 A;  1K28 A;  1K9M 4;  2ML5 A;  2HMO B;  4FMD A;  1B2S A;  2GEY A;  2GEX A;  2JDI H;  3ER7 A;  1IVV A;  2XFT A;  8CHO A;  1V58 A;  3MKI A;  1PU4 A;  1EG9 B;  2A15 A;  3CMA 3;  1SIH A;  1YJN 3;  3PCR A;  3K9M C;  1BSA A;  5TGN A;  1YGW A;  1Q40 B;  3WA2 X;  1FGO A;  2C10 A;  1RN4 A;  1O7M B;  2P0X A;  2KF4 A;  4MMY B;  1NJI 4;  1FYS A;  1STD A;  2OWP A;  3LYG A;  2MF7 A;  1JZD A;  1BSB A;  3O8Y A;  1BAN A;  3CCV 3;  1RDS A;  2W56 B;  4LYL B;  1BRG A;  1VQO 3;  1DE3 A;  3OWS A;  4CDL A;  1E3V A;  2RCD A;  5M1A A;  3BIR A;  1BSC A;  3D79 A;  1R4Y A;  1R4C A;  3DGY A;  1W6G A;  4O3V A;  1IT8 A;  5IG5 A;  2Q07 A;  5M18 A;  3B8L A;  1T5Y A;  2Y73 A;  3KE7 A;  2IYJ A;  3F9S A;  1TFO A;  2L4V A;  4LGQ A;  1RHL A;  1G02 A;  7GSP A;  1F8N A;  3HOH A;  4O8S A;  2CG1 A;  1IDP A;  2YX9 A;  3X3Z A;  1NNV A;  1BIR A;  4R1K A;  1QAK A;  1MWU A;  2B24 B;  2OCT A;  1LQG C;  2WOH A;  2W0Q A;  2KXG A;  4CCV A;  1NU3 A;  3DUK A;  4GSP A;  1K41 A;  3NM7 A;  4WHA A;  3A5E A;  2QEX 3;  4J8T A;  1JKG B;  3H3H A;  3MPH A;  3OWU A;  4HVN A;  1GY6 A;  2MC8 A;  4ORL A;  1AVK A;  1NB3 I;  6STD A;  2WGO A;  1SAR A;  3M8C A;  3CCL 3;  1RLS A;  5AYS C;  2O3O A;  1O7G B;  4KVH A;  4K90 B;  2CG0 A;  1RGC A;  1IQY A;  1FGT A;  5AI1 A;  5D81 A;  2XF3 A;  4JRF A;  5BU4 A;  1I3I A;  4XDW A;  2H0I A;  3CU3 A;  8RNT A;  1X1U A;  1Q42 A;  1MWT A;  2CX1 A;  3JUO A;  4R4K A;  1IVU A;  3K63 A;  1UGI A;  1O7P B;  5IEP A;  3CCE 3;  6RNT A;  1BRN L;  1G0T A;  4HYZ A;  5GSP A;  4N6T A;  1M9G A;  2CKF B;  4KFE A;  3J7Y d;  3G4S 3;  1I2G A;  3FKA A;  5EQL A;  1MOL A;  4WFO A;  2CFL A;  3RDE A;  5M19 A;  1MNL A;  5FW5 A;  3WHO A;  3EQQ B;  1N8Q A;  4N3V A;  1RGH A;  2YFJ B;  2AAE A;  3IJE B;  4HOH A;  4HKV B;  3LTA A;  3WA3 A;  1AV4 A;  1OPY A;  4PEJ A;  1QVG 2;  1QVF 2;  3UL6 A;  1FGR A;  1TP6 A;  1QJG A;  1NWW A;  4RNZ A;  1D6U A;  2W6J H;  3Q90 A;  4WYK B;  3CXC 2;  3UJM A;  1T2I A;  4HBR A;  2F56 A;  3NM2 A;  1B2M A;  3NV0 B;  3ZG0 A;  3JVC A;  3G8Z A;  1RN7 A;  1UGH I;  3GWR A;  6GSP A;  3EHC A;  1I70 A;  2FNQ A;  5ELU A;  3SOY A;  2CW9 A;  1GMP A;  3BNB A;  4R9L A;  3S5C A;  3T8U A;  5LC7 A;  3CCU 3;  4HM3 B;  3EF8 A;  4BTW A;  2W56 A;  2HOH A;  5IER A;  1BOX A;  2IUJ A;  3EN8 A;  2L1S A;  1W01 A;  1Q7Y 4;  4L8O A;  1RSN A;  2FGT A;  1JZO A;  2H0G A;  2K54 A;  4MEI A;  3HZP A;  5FGO A;  3SLU A;  4H3U A;  3EBT A;  3DGO A;  5D82 A;  1EA2 A;  1ISK A;  3KZT A;  1BVI A;  2ZDJ A;  3FF2 A;  3CC4 3;  3CCS 3;  1KQS 2;  1A67 A;  3WR2 A;  2Z77 A;  5IEO A;  3S29 A;  3AMO A;  1EUI C;  1RGA A;  3LH4 A;  1LOY A;  4XBY A;  3BND A;  5AIH A;  5KP4 A;  5IW9 A;  5RNT A;  3CCM 3;  1RNB A;  1OHP A;  1IYY A;  4CJN A;  4I5Q A;  2XR8 B;  2QA4 3;  1W00 A;  1T2H A;  3LTC A;  1WNH A;  3DM8 A;  3FG3 A;  1D6Y A;  1FW7 A;  1UUG B;  3CNX A;  1JB4 A;  1HKX A;  4ZM8 A;  2IA7 A;  3PCS A;  1TRQ A;  3NX0 A;  3EN1 B;  4HAA A;  4N6O B;  3X40 A;  1B3S A;  1MWR A;  1W2Z A;  2RGQ A;  1BNI A;  1RRH A;  1VQP 3;  1DMQ A;  1UI7 A;  2IUK A;  2CFD A;  2CFG A;  3AGN A;  3KFQ C;  3G0K A;  1GY7 A;  1VQ4 3;  2AAD A;  3B4O A;  5HOH A;  1B2Z A;  1UUV B;  1US1 A;  3T8N A;  5BXQ A;  4G1M B;  1CH0 A;  2KAA A;  3BB9 A;  2H0H A;  1GMR A;  2C11 A;  4BL3 A;  2CHC A;  1YIJ 3;  4J5K A;  2XGL A;  2HMM B;  1V74 A;  4MMZ B;  1BRJ A;  3MG2 A;  2PZV A;  5IG3 A;  2UGI A;  2WOF A;  5KP1 A;  3G6E 3;  1JB2 A;  4HM0 B;  2CWV A;  2HML B;  4STD A;  4XBT A;  3NUV A;  5JPP A;  2BIR A;  4HM2 B;  3OXA A;  2LYX A;  4O2H A;  2R4I A;  1CQS A;  4FMA A;  3A76 A;  3K0Z A;  5I97 A;  1YI2 3;  4BL2 A;  1LVN A;  1A90 A;  4HZ9 B;  2XH9 A;  4K61 A;  3URP A;  3FG4 A;  1UCJ A;  1BRS A;  1GY5 A;  3KN4 A;  1B21 A;  4ILF A;  1LXE A;  2KCD A;  3FH1 A;  3KCH A;  3QRD A;  4L7K A;  1B2X A;  1TRP A;  1K8A 4;  3N8B A;  2CWT A;  4EV5 A;  1SPU A;  4HM5 B;  1OGX A;  3CC2 3;  3OW2 2;  1FGM A;  3KSP A;  4MJD A;  3ZG5 A;  2GXF A;  1DVD A;  1BU4 A;  3Q1C A;  4N6U A;  4RNY A;  4IPB A;  1VQQ A;  1YHQ 3;  3PXM A;  3DGL A;  3F14 A;  3DXO A;  4WYK A;  5KP3 A;  5JBS A;  3AMO B;  7RNT A;  1W02 A;  4K1U A;  3NV0 A;  1RCK A;  1V57 A;  1GOU A;  3PYJ A;  4EXR A;  3BNE A;  3EE1 A;  2V1L A;  2RBI A;  2XSO B;  3N9H A;  3PGB A;  4NHF A;  1I8V A;  5JPU A;  2RNT A;  2XFS A;  1ZS7 A;  4FCM A;  2SBL A;  3F40 A;  2E2T A;  3GZX B;  4N6N B;  1BUJ A;  3QK9 A;  3WOF B;  1YGE A;  3NQZ A;  2Z6B A;  4HM1 B;  3FGY A;  1GS3 A;  5IG0 A;  1RGG A;  1Q7H A;  5EVH A;  1TU5 A;  1IVX A;  1BNJ A;  1N8R 4;  1BUQ A;  3AHS A;  2W9P A;  3FG1 A;  3X3Y A;  2F5M A;  1TTO A;  4X2H A;  4X2O A;  2J8X B;  1VZZ A;  3RNT A;  3T0U A;  1WMO A;  1JN5 A;  1FGQ A;  5AYR B;  1TFK A;  4GL6 A;  4GHO A;  1CYV A;  1BNE A;  1NDO B;  2O9U X;  1NO3 A;  2IY2 A;  4EBG A;  3DZL A;  5AIF A;  2E2V A;  1GOV A;  1VQ5 3;  1BNR A;  1I0V A;  1RRL A;  1IQ8 A;  3JUM A;  5BVB A;  2ZL8 A;  2CFW A;  3LTD A;  5CLK A;  5AIG A;  4XDV A;  3GSP A;  1E97 A;  2UUG C;  3V99 A;  1QMA A;  4OUQ A;  3KSE D;  1S5A A;  1B27 A;  1DVC A;  4EC6 A;  5CF2 A;  1RGE A;  1FA3 A;  2R41 A;  3K5T A;  1A2P A;  3KII A;  2F5W A;  2HMK B;  1JBS A;  2F4Y A;  1S72 3;  4FMC A;  1D6Z A;  2F86 B;  3JUP A;  2C4B A;  1A2V A;  3B7C A;  3NXJ A;  4HJL B;  1VQK 3;  1B2U A;  4LEH A;  2XEP A;  4LZI A;  9RNT A;  1VQ9 3;  2ML6 A;  4BTX A;  2OOV A;  1OCV A;  2BU4 A;  3VSY A;  1CYU A;  2WO0 A;  3GZR A;  5G1L A;  2INX A;  2BNG A;  1TJD A;  1KSI A;  4KFF A;  3JUQ A;  3ALA A;  4QWT A;  1PFP A;  3D5G A;  1GYB A;  1UCK A;  3UB1 A;  2CK3 H;  3HK4 A;  2KRT A;  3CCQ 3;  4BIR A;  1LRA A;  2OQE A;  1HZ1 A;  2CIU A;  3NQY A;  2OOV C;  2XGN A;  3AGO A;  3GZB A;  1IU7 A;  3SOA A;  3BU4 A;  1UCL A;  1WMN A;  1ROV A;  4H61 A;  2B1X B;  1Q9E A;  2OQE C;  3NBJ A;  2GBX B;  4XM4 A;  3B4P A;  3S28 A;  2D42 A;  3N54 B;  1WMP A;  2BHM A;  2LQV A;  3CCR 3;  1JN5 B;  5IF6 A;  1MWS A;  3D3L A;  1YVS A;  1BSE A;  3K7C A;  1JNQ A;  3MG3 A;  4HM8 B;  1Q86 4;  2K3D A;  2CWU A;  2K0M A;  1M1K 4;  1DYU A;  3HIG A;  3U1W A;  2UX0 A;  3LXU X;  1IV9 A;  2QGU A;  3DMC A;  1BGS A;  3VF1 A;  3WDG B;  4N6L A;  2OTJ 3;  3GZY B;  1RN1 A;  2KF5 A;  2OTL 3;  3VGN A;  1VQ7 3;  3F7S A;  5CF1 A;  1HU9 A;  3LOY A;  3EJV A;  1M90 4;  2KF3 A;  5LC6 A;  1LNI A;  1N9J A;  4K1V A;  3SYU A;  4AKY A;  1FUW A;  1YJ9 3;  2GBW B;  2STD A;  1FZU A;  1VQ8 3;  1W5Z A;  2Z76 A;  3DY5 A;  1VQN 3;  3MSO A;  1ULJ B;  1BAO A;  2PNC A;  1I3F A;  3OWY A;  3I55 3;  1I2E A;  3ECF A;  3F8H A;  3FLJ A;  2I9W A;  4HM6 B;  1M1X B;  1RGK A;  1W6Y A;  2SAR A;  3WOD G;  1W2B 2;  1RKY A;  3IPT A;  1IV7 A;  1RJO A;  1SQW A;  2RSX A;  1OUN A;  2CX0 A;  2HMN B;  3NHX A;  2BT3 A;  2E2U A;  4MMX B;  3TDG A;  3FSD A;  1I2F A;  4WP5 A;  5EEO A;  1RNT A;  1O7N B;  3LTB A;  1B20 A;  1X1W A;  2GU1 A;  3I56 3;  4XBX A;  4AEQ A;  1UDI I;  2F98 A;  4HZB B;  4TX4 A;  1BNS A;  3Q3F A;  4KT3 B;  1FUT A;  1PY3 A;  1TUH A;  3CPW 2;  2YFL B;  3GRD A;  1OH0 A;  3FZW A;  2WGQ A;  1DET A;  1YJW 3;  1YIT 3;  4OVM A;  2HMJ B;  4I4K A;  4U13 A;  3D5I A;  4OK0 A;  3V92 A;  3MYT A;  4R80 A;  3S27 A;  1QAL A;  3STD A;  3UNL A;  1MGW A;  2ZHX B;  1OHS A;  3EC9 A;  3WOE B;  2XRX B;  1Q82 4;  1L5G B;  1K73 4;  5CK6 A;  5G1K A;  3SED A;  2W9Q A;  3CCJ 3;  3LT9 A;  4AKZ A;  1JRQ A;  3BNC A;  1N9E A;  2W2C A;  1C54 A;  7STD A;  3CC7 3;  1VQ6 3;  4FMB A;  1W4N A;  3LT8 A;  1I0X A;  1N5H A;  3PZW A;  1JJ2 2;  3E99 A;  4O02 B;  1X1Y A;  3G16 A;  1BNG A;  5AEW B;  1WTH A;  3V98 A;  4BU4 A;  2CC3 A;  1W6C A;  1OHO A;  3NBR A;  1QAF A;  3UL5 A;  1Q81 4;  3EX9 A;  1C7H A;  1RCL A;  1UW1 A;  4NPB A;  4R9K A;  1YVB I;  5STD A;  3H51 A;  3HI7 A;  1OAC A;  1BRH A;  5IG4 A;  3NBB A;  4RNT A;  1E3R A;  1HYF A;  3SXX A;  1IT7 A;  2CH9 A;  3HX8 A;  3LML A;  1KWI A;  3L0R A;  1W7C A;  1AVL A;  1LOV A;  2GU3 A;  2BO9 B;  1ZO2 A;  2F99 A;  4XB5 A;  5CXO A;  3ZFZ A;  4IIA A;  2XSH B;  3IMA B;  1PYL A;  3HII A;  4LSO A;  1O7H B;  1X1X A;  1GSP A;  1GD4 A;  1LQM B;  3MHE A;  1N5P A;  2Y74 A;  4EYC A;  5A0O B;  3LZA A;  4EW5 A;  3SX1 A;  1OF5 A;  1EEJ A;  1GOY A;  1Z1S A;  2P05 A;  4Q53 A;  1NB5 I;  2GSP A;  4IT7 A;  1IQX A;  3CPO A;  2BMR B;  3Q2P A;  1O7W B;  1RGL A;  2Z7A A;  3DGN A;  2JQ5 A;  1ZGX A;  1MGR A;  1BNF A;  1IK3 A;  3WMD A;  1VQL 3;  3SVA A;  4WWU C;  1G96 A;  2BMQ B;  2RFR A;  2QIY A;  3DGM A;  3F8X A;  1KC8 4;  1TIJ A;  3EB8 A;  4NRE A;  3F7X A;  1VQM 3;  1AY7 A;  5AII A;  4FCJ A;  1OGZ A;  1U8C B;  2P38 A;  1BSD A;  1BRK A;  1AQZ A;  5DRV A;  1EKM A;  1FUS A;  3MWZ A;  1ROA A;  3FF0 A;  3MG1 A;  2P09 A;  4J5G A;  2BMO B;  1RMS A;  1Q40 A;  4GB5 A;  3X41 A;  2D1W A;  4DKI A;  1JB5 A;  3KKG A;  4L8P A;  5AEU B;  2IMJ A;  1RTU A;  1JBT A;  1DMN A;  4KFD A;  3X3X A;  3AHW A;  1Y4K A;  2YFI B;  3DH2 A;  4JF8 A;  1U5O A;  1EQK A;  2W03 A;  4BTY A;  1J2B A;  4KZ1 A;  4HM4 B;  4CPK A;  3CME 3;  3BLZ A;  5ELJ A;  4LMI A;  3D9R A;  4FR9 A;  1ASK A;  1WQL B;  2KF6 A;  4FCZ A;  1KD1 4;  3ROB A;  5G2G A;  1STF I;  1JV2 B;  2W04 A;  3X42 A;  2M7O A;  5BIR A;  5D83 A;  1SJW A;  1LOX A;  1YNV X;  3CD6 3;  3D4A A;  5IEN A;  4HM7 B;  4RZM A;  3I0Y A;  1T3B A;  1LNH A;  2FXT A;  2P0M A;  5DRE A; 
#chains in the Genus database with same CATH homology
 3RGA A;  1UI8 A;  3PS8 A;  3CNM A;  5HGR A;  1OF5 B;  1IVW A;  3OV4 A;  3FCS B;  2CFK A;  3G71 3;  1UUW B;  3RGR A;  4N6M A;  1CEW I;  3U97 A;  3OX9 A;  3EBY A;  4J9A A;  1A2K A;  3GAX A;  4RBN A;  1AR0 A;  1ZX2 A;  3JUN A;  4N6V 0;  1DMM A;  1ULI B;  1GD3 A;  1JKG A;  1SII A;  3S67 A;  4EV2 A;  1K28 A;  1K9M 4;  2ML5 A;  2HMO B;  4FMD A;  2GEY A;  2GEX A;  2JDI H;  3ER7 A;  1IVV A;  2XFT A;  8CHO A;  3MKI A;  1PU4 A;  1EG9 B;  2A15 A;  3CMA 3;  1SIH A;  1YJN 3;  3PCR A;  3K9M C;  5TGN A;  1Q40 B;  3WA2 X;  1FGO A;  2C10 A;  1O7M B;  2P0X A;  4MMY B;  1NJI 4;  1STD A;  2OWP A;  3LYG A;  2MF7 A;  3O8Y A;  3CCV 3;  2W56 B;  1VQO 3;  3OWS A;  4CDL A;  1E3V A;  2RCD A;  1R4C A;  1W6G A;  4O3V A;  1IT8 A;  5IG5 A;  2Q07 A;  3B8L A;  1T5Y A;  2Y73 A;  3KE7 A;  3F9S A;  1TFO A;  2L4V A;  4LGQ A;  1F8N A;  4O8S A;  2CG1 A;  1IDP A;  2YX9 A;  3X3Z A;  4R1K A;  1QAK A;  2B24 B;  2OCT A;  2WOH A;  2W0Q A;  2KXG A;  4CCV A;  1NU3 A;  3DUK A;  4WHA A;  1K41 A;  3NM7 A;  2QEX 3;  4J8T A;  1JKG B;  3H3H A;  3MPH A;  3OWU A;  4HVN A;  1GY6 A;  2MC8 A;  4ORL A;  1AVK A;  1NB3 I;  6STD A;  2WGO A;  3M8C A;  3CCL 3;  5AYS C;  2O3O A;  1O7G B;  4KVH A;  4K90 B;  2CG0 A;  1IQY A;  1FGT A;  5AI1 A;  5D81 A;  2XF3 A;  4JRF A;  4XDW A;  3CU3 A;  1Q42 A;  4R4K A;  3JUO A;  1IVU A;  3K63 A;  1O7P B;  5IEP A;  3CCE 3;  4HYZ A;  4N6T A;  1M9G A;  2CKF B;  4KFE A;  3J7Y d;  3G4S 3;  3FKA A;  5EQL A;  1MOL A;  4WFO A;  2CFL A;  3RDE A;  1MNL A;  5FW5 A;  3EQQ B;  1N8Q A;  4N3V A;  2YFJ B;  3IJE B;  4HKV B;  3LTA A;  3WA3 A;  1AV4 A;  1OPY A;  4PEJ A;  1QVG 2;  1QVF 2;  3UL6 A;  1FGR A;  1TP6 A;  1QJG A;  1NWW A;  4RNZ A;  2W6J H;  1D6U A;  3Q90 A;  4WYK B;  3CXC 2;  3UJM A;  4HBR A;  3NM2 A;  3NV0 B;  3JVC A;  3G8Z A;  1RN7 A;  3GWR A;  3EHC A;  2FNQ A;  5ELU A;  3SOY A;  2CW9 A;  3BNB A;  4R9L A;  3S5C A;  3T8U A;  5LC7 A;  3CCU 3;  4HM3 B;  3EF8 A;  4BTW A;  2W56 A;  5IER A;  2IUJ A;  3EN8 A;  1W01 A;  1Q7Y 4;  4L8O A;  2FGT A;  5FGO A;  3SLU A;  2K54 A;  4MEI A;  3HZP A;  4H3U A;  3EBT A;  3DGO A;  5D82 A;  1EA2 A;  1ISK A;  3KZT A;  2ZDJ A;  3FF2 A;  3CC4 3;  3CCS 3;  1KQS 2;  1A67 A;  2Z77 A;  5IEO A;  3S29 A;  3AMO A;  3LH4 A;  5AIH A;  4XBY A;  3BND A;  5KP4 A;  5IW9 A;  3CCM 3;  1OHP A;  2XR8 B;  2QA4 3;  1W00 A;  3LTC A;  1WNH A;  3DM8 A;  3FG3 A;  1D6Y A;  3CNX A;  1JB4 A;  1HKX A;  4ZM8 A;  2IA7 A;  3PCS A;  3NX0 A;  3EN1 B;  4N6O B;  3X40 A;  1W2Z A;  2RGQ A;  1RRH A;  1VQP 3;  1DMQ A;  1UI7 A;  2IUK A;  2CFD A;  2CFG A;  3KFQ C;  3G0K A;  1GY7 A;  1VQ4 3;  3B4O A;  1UUV B;  1US1 A;  3T8N A;  5BXQ A;  4G1M B;  3BB9 A;  2C11 A;  2CHC A;  1YIJ 3;  2XGL A;  2HMM B;  1V74 A;  4MMZ B;  3MG2 A;  2PZV A;  5IG3 A;  2WOF A;  5KP1 A;  3G6E 3;  1JB2 A;  4HM0 B;  2CWV A;  2HML B;  4STD A;  4XBT A;  3NUV A;  5JPP A;  4HM2 B;  3OXA A;  2LYX A;  4O2H A;  2R4I A;  1CQS A;  4FMA A;  3A76 A;  3K0Z A;  5I97 A;  1YI2 3;  1LVN A;  1A90 A;  4HZ9 B;  2XH9 A;  4K61 A;  3FG4 A;  3KN4 A;  1GY5 A;  1LXE A;  2KCD A;  3FH1 A;  3QRD A;  4L7K A;  1K8A 4;  3N8B A;  2CWT A;  4EV5 A;  1SPU A;  4HM5 B;  1OGX A;  3CC2 3;  3OW2 2;  1FGM A;  3KSP A;  4MJD A;  2GXF A;  1DVD A;  4N6U A;  3Q1C A;  4RNY A;  1YHQ 3;  4IPB A;  3PXM A;  3DGL A;  3F14 A;  3DXO A;  4WYK A;  5KP3 A;  5JBS A;  3AMO B;  1W02 A;  4K1U A;  3NV0 A;  3PYJ A;  4EXR A;  3BNE A;  3EE1 A;  2V1L A;  2XSO B;  3N9H A;  3PGB A;  4NHF A;  5JPU A;  2XFS A;  4FCM A;  2SBL A;  3F40 A;  2E2T A;  3GZX B;  4N6N B;  3QK9 A;  3WOF B;  1YGE A;  3NQZ A;  2Z6B A;  4HM1 B;  3FGY A;  1GS3 A;  5IG0 A;  5EVH A;  1TU5 A;  1N8R 4;  1IVX A;  1BUQ A;  2W9P A;  3FG1 A;  3X3Y A;  4X2H A;  4X2O A;  1VZZ A;  3T0U A;  1WMO A;  1JN5 A;  1FGQ A;  5AYR B;  1TFK A;  4GL6 A;  1CYV A;  1NDO B;  2O9U X;  4EBG A;  1NO3 A;  3DZL A;  5AIF A;  2E2V A;  1VQ5 3;  1RRL A;  1IQ8 A;  3JUM A;  5BVB A;  2ZL8 A;  2CFW A;  3LTD A;  5CLK A;  5AIG A;  4XDV A;  1E97 A;  3V99 A;  1QMA A;  4OUQ A;  3KSE D;  1S5A A;  1DVC A;  4EC6 A;  5CF2 A;  1FA3 A;  3K5T A;  3KII A;  2HMK B;  1S72 3;  4FMC A;  1D6Z A;  2F86 B;  3JUP A;  3B7C A;  1A2V A;  3NXJ A;  4HJL B;  1VQK 3;  4LEH A;  1VQ9 3;  2XEP A;  4LZI A;  2ML6 A;  4BTX A;  2OOV A;  1OCV A;  3VSY A;  1CYU A;  2WO0 A;  3GZR A;  2INX A;  2BNG A;  1KSI A;  4KFF A;  3JUQ A;  3ALA A;  4QWT A;  1PFP A;  3UB1 A;  1GYB A;  3CCQ 3;  2CK3 H;  3HK4 A;  2KRT A;  2OQE A;  2CIU A;  3NQY A;  2OOV C;  2XGN A;  3GZB A;  1IU7 A;  3SOA A;  1WMN A;  1ROV A;  4H61 A;  2B1X B;  2OQE C;  3NBJ A;  2GBX B;  4XM4 A;  3B4P A;  3S28 A;  2D42 A;  3N54 B;  1WMP A;  2BHM A;  2LQV A;  3CCR 3;  1JN5 B;  5IF6 A;  3D3L A;  3K7C A;  1JNQ A;  3MG3 A;  4HM8 B;  1Q86 4;  2CWU A;  2K0M A;  1M1K 4;  1DYU A;  3HIG A;  3U1W A;  2UX0 A;  3LXU X;  1IV9 A;  2QGU A;  3DMC A;  3VF1 A;  3WDG B;  4N6L A;  2OTJ 3;  3GZY B;  2OTL 3;  3VGN A;  1VQ7 3;  3F7S A;  5CF1 A;  1HU9 A;  3LOY A;  3EJV A;  1M90 4;  5LC6 A;  4K1V A;  1N9J A;  4AKY A;  1FUW A;  1YJ9 3;  2GBW B;  2STD A;  1VQ8 3;  1W5Z A;  2Z76 A;  3DY5 A;  1VQN 3;  3MSO A;  1ULJ B;  2PNC A;  3OWY A;  3I55 3;  3ECF A;  3F8H A;  3FLJ A;  2I9W A;  4HM6 B;  1M1X B;  1W6Y A;  3WOD G;  1W2B 2;  1RKY A;  3IPT A;  1IV7 A;  1RJO A;  1SQW A;  2RSX A;  1OUN A;  2HMN B;  3NHX A;  2BT3 A;  2E2U A;  4MMX B;  3TDG A;  3FSD A;  4WP5 A;  5EEO A;  1O7N B;  3LTB A;  2GU1 A;  3I56 3;  4XBX A;  4AEQ A;  2F98 A;  4HZB B;  4TX4 A;  3CPW 2;  1TUH A;  2YFL B;  3GRD A;  1OH0 A;  3FZW A;  2WGQ A;  1YJW 3;  1YIT 3;  4OVM A;  2HMJ B;  4I4K A;  4U13 A;  4OK0 A;  3V92 A;  3MYT A;  4R80 A;  3S27 A;  1QAL A;  3STD A;  3UNL A;  3EC9 A;  1OHS A;  3WOE B;  2XRX B;  1Q82 4;  1L5G B;  1K73 4;  5CK6 A;  3SED A;  2W9Q A;  3CCJ 3;  3LT9 A;  4AKZ A;  1JRQ A;  3BNC A;  1N9E A;  2W2C A;  7STD A;  3CC7 3;  1VQ6 3;  4FMB A;  1W4N A;  3LT8 A;  1N5H A;  3PZW A;  1JJ2 2;  3E99 A;  4O02 B;  3G16 A;  5AEW B;  1WTH A;  3V98 A;  2CC3 A;  1W6C A;  1OHO A;  3NBR A;  1QAF A;  3UL5 A;  1Q81 4;  3EX9 A;  1C7H A;  1UW1 A;  4R9K A;  5STD A;  1YVB I;  3H51 A;  3HI7 A;  1OAC A;  5IG4 A;  3NBB A;  1E3R A;  3SXX A;  1IT7 A;  2CH9 A;  3HX8 A;  3LML A;  1KWI A;  3L0R A;  1W7C A;  1AVL A;  4XB5 A;  2GU3 A;  2BO9 B;  1ZO2 A;  2F99 A;  5CXO A;  4IIA A;  2XSH B;  3IMA B;  3HII A;  4LSO A;  1O7H B;  1GD4 A;  3MHE A;  1N5P A;  2Y74 A;  4EYC A;  5A0O B;  3LZA A;  3SX1 A;  1OF5 A;  1Z1S A;  2P05 A;  4Q53 A;  1NB5 I;  4IT7 A;  1IQX A;  3CPO A;  2BMR B;  3Q2P A;  1O7W B;  2Z7A A;  3DGN A;  2JQ5 A;  1VQL 3;  1IK3 A;  3WMD A;  3SVA A;  4WWU C;  1G96 A;  2BMQ B;  2RFR A;  2QIY A;  3DGM A;  3F8X A;  1KC8 4;  1TIJ A;  3EB8 A;  4NRE A;  3F7X A;  1VQM 3;  5AII A;  4FCJ A;  1OGZ A;  1U8C B;  2P38 A;  5DRV A;  1EKM A;  3MWZ A;  1ROA A;  3FF0 A;  3MG1 A;  2P09 A;  2BMO B;  4GB5 A;  1Q40 A;  3X41 A;  2D1W A;  1JB5 A;  3KKG A;  4L8P A;  5AEU B;  2IMJ A;  1DMN A;  4KFD A;  3X3X A;  1Y4K A;  2YFI B;  4JF8 A;  1U5O A;  1EQK A;  2W03 A;  4BTY A;  1J2B A;  4KZ1 A;  4HM4 B;  3CME 3;  3BLZ A;  5ELJ A;  4LMI A;  3D9R A;  4FR9 A;  1ASK A;  1WQL B;  1KD1 4;  4FCZ A;  3ROB A;  5G2G A;  1STF I;  1JV2 B;  2W04 A;  3X42 A;  2M7O A;  5D83 A;  1SJW A;  1LOX A;  3CD6 3;  5IEN A;  4HM7 B;  4RZM A;  3I0Y A;  1LNH A;  2FXT A;  2P0M A;  5DRE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...