1N9KA

Crystal structure of the bromide adduct of apha class b acid phosphatase/phosphotransferase from e. coli at 2.2 a resolution
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
209
structure length
209
Chain Sequence
SPLNPGTNVARLAEQAPIHWVSVAQIENSLAGRPPMAVGFDIDDTVLFSSPGFWRGKKTFSPESEDYLKNPVFWEKMNNGWDEFSIPKEVARQLIDMHVRRGDAIFFVTGRSPTKTETVSKTLADNFHIPATNMNPVIFAGDKPGQNTKSQWLQDKNIRIFYGDSDNDITAARDVGARGIRILRASNSTYKPLPQAGAFGEEVIVNSEY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The first structure of a bacterial class B Acid phosphatase reveals further structural heterogeneity among phosphatases of the haloacid dehalogenase fold.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase
molecule keywords Class B acid phosphatase
total genus 71
structure length 209
sequence length 209
chains with identical sequence B
ec nomenclature ec 3.1.3.2: Acid phosphatase.
pdb deposition date 2002-11-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 1n9kA00
1RKUA 1U7OA 5AW3A 1JUDA 2MSNA 2OYCA 2HI0A 2FPXA 4UAUA 3QLEA 1O08A 2C8LA 3ZTYA 4MWOA 2B0CA 1U2SA 3N8GA 2AH5A 5AW9A 2WM8A 3M1YA 4CF5A 5E0OA 3NUQA 3MC1A 2YN4A 1WVIA 3QNMA 1PW5A 1N8NA 2YMPA 4RETA 4EZEA 3I6BA 4YIKA 4XE5A 3WKCA 3WKAA 2WF9A 3ZTWA 1RC8A 2B82A 3KBBA 4C4RA 5AESA 2RARA 3J7TA 3MMZA 4Y2XA 2I54A 4OCZA 4E88A 2AGVA 4NWIA 5AVRA 2IOFK 4FE3A 2OM6A 5AVQA 4AS3A 3W5AA 2CN1A 5AK6A 5ALLA 4DCCA 1ZD3A 3AR3A 2P69A 5T41A 4J2TA 2R8ZA 3A1EA 3L7YA 1RQNA 1YNSA 4L57A 1NRWA 2HF7A 3ONNA 4IG4A 3ZWDA 4F71A 2FUCA 5ALFA 1T9ZA 2I55A 4BX2A 1LTQA 3U7EB 3DAOA 4HAIA 2EAUA 1Z4QA 4GIBA 4Y2PA 5AI9A 5ALVA 5AW8A 2JGAA 5AI6A 1J8DA 5ALYA 5AVSA 1U2TA 4CF4A 1Z4NA 1Q92A 2C8KA 4G63A 3ET5A 5ALGA 5AM0A 3MN1A 4Y2TA 5AHXA 2HF2A 3WKBA 2Q4RA 3OCUA 4MUMA 2YMLA 3RFUA 3CZ4A 1L7NA 3R9KA 3OCWA 1J97A 2FDRA 1Z4OA 4Y2QA 2CFSA 4YCMA 2YJ5A 3WK4A 3ESRA 2HOQA 2WFAA 4NFLA 3WK8A 1KYTA 4YIHA 3I76A 3L8EA 1VFPA 2WF8A 3U26A 5AKZA 5ALSA 2HHLA 1Q91A 5AW4A 2B8EA 5ALJA 4NABA 5AVTA 2G0AA 2YJ4A 3FGOA 4DWOA 3E8MA 4QJBA 4EENA 3FM9A 4UASA 4BEVA 5ALPA 1LVHA 1WPGA 1SWVA 4UMVA 4BX0A 3ZX4A 4L6AA 4CE6A 1U02A 4YGYA 1RMQA 3NANA 3OTQA 5ALZA 4BEWA 1Z4JA 3L0CA 3ZX5A 4HGOA 3ET4A 2IYEA 1WZCA 2ZOSA 2GHTA 4NV0A 3DV9A 5AIAA 3AR5A 2JAWA 3ZW7A 3AR8A 3N5KA 1XVIA 2HEGA 2FPUA 1RPZA 2O2XA 2GO7A 3I28A 4ZEVA 5ALWA 1XPJA 3ESQA 4YH1A 3KD3A 4KYTA 1SWWA 4HGPA 3M9LA 3U13A 3OCYA 3QX7A 1X42A 2FPSA 3L8FA 1TJ4A 2QLTA 3EF1A 4Y2SA 5AVZA 3R09A 3RF6A 2C88A 3S6JA 5IT4A 3B9RA 2W43A 4UM7A 4Y2VA 3HYCA 3EF0A 3ZU6A 2GMWA 3P96A 3A1DA 2HDOA 1EK2A 4B6JA 3ZVLA 3OCZA 4C4SA 3U7HB 2R8YA 4XOUA 2G07A 5AVWA 4UU0A 3FVVA 3NALA 2JAOA 1TE2A 3I1YA 5AI5A 4DW8A 2EARA 2YMMA 4GXTA 2AMYA 2W11A 2FPWA 5ALOA 4UU1A 1S8OA 3WKDA 3W5DA 1S2OA 1RLTA 5ALUA 4BNDB 3N1UA 1FEZA 4BBJA 2RBKA 1ZD5A 1YV9A 5AW2A 3PDWA 2G06A 5AM1A 2WF6A 5ALMA 3WK5A 4UAVA 2IOFA 1RLMA 3NAMA 1T5SA 3OCVA 2HX1A 3D6JA 1QYIA 4ZEXA 2EATA 3SF0A 2C9MA 1Z88A 3N28A 3PCTA 4BKMA 1Z4IA 3B9BA 4OFZA 3CNHA 5AKKA 3SKYA 4KN8A 3ZVNA 2NO5A 3NIWA 1QQ6A 1YDFA 5A3RA 3L8GA 2HSZA 1ZRNA 2I34A 2B1RA 2CFRA 4UW9A 3AR2A 2G1AA 5ALDA 3WK6A 4OHFA 2NYVA 1Z4PX 3QU9A 3L0BA 2I7DA 3HLTA 1RQLA 3SLRA 2WF7A 4UMFA 1YJ5A 3WGUA 5AK3A 2OBBA 2BY4A 4I9GA 1RRCA 4YCNA 3DDHA 4HGQA 1Z4MA 1SU4A 5AKXA 2Q5EA 2Q4TA 2GHQA 2G80A 2WHEA 3WGVA 1L8OA 1N9KA 2PQ0A 1ZRMA 1YS9A 3F9RA 3KDPA 4BX3A 5ALEA 3UMGA 1TA0A 5AVVA 3R4CA 5AM2A 4Y2UA 4BNDA 4HYTA 1ZJJA 2C4NA 2G08A 3SD7A 1QQ5A 4KNVA 4OD0A 4KX5A 2X4DA 2B1QA 3W5CA 3ED5A 5ALHA 3SMVA 5AVUA 3L8HA 1F5SA 2FI1A 2BDEA 4C4TA 2ZXEA 2FEAA 1RMYA 5AM4A 3QU5A 5FP0A 1ZS9A 2QYHA 1YMQA 4NAVA 5AM3A 3VAYA 2BDUA 2DQSA 3AR6A 1Z4LA 2D2VA 2P27A 2R8XA 2YJ6A 2WF5A 3OCXA 1ZD4A 2JAUA 5AKJA 5ALKA 3SKXA 2PKEA 3AR7A 2ZBFA 2I6XA 3WKEA 1NNLA 3GYGA 3QYPA 5AI8A 3ZVMA 4RESA 5ALIA 4JB3A 4Y2JA 3ZI4A 3IRUA 3FZQA 4FFDA 5AW7A 3WK9A 5ALTA 4EX6A 4AS2A 5AK4A 5AW5A 1EK1A 3NRJA 2YFYA 3FPSA 4IFTA 4JDPA 5AVXA 2R8EA 5AI4A 4F72A 5AKEA 2W4MA 3E84A 4G9BA 1RLOA 2ZBEA 3W5BA 3QUTA 5IS2A 3L1UA 4O8CA 2YMQA 2GFHA 3UMCA 2RB5A 2B30A 3A3YA 1CR6A 5AKIA 2P11A 1ZOLA 3N07A 5ALNA 1NF2A 3SHQA 2OA0A 1O03A 3QXGA 2ZG6A 3WK7A 3ZWKA 3QGMA 4H1WA 1QQ7A 1VJ5A 3DNPA 5IT0A 1Z5UA 4HGRA 4UM5A 4KNWA 3NASA 1Y8AA 3K1ZA 5A3QA 2P9JA 4Y3UA 3IB6A 4HGNA 5AIBA 5ALRA 2IA5A 2YY6A 4EX7A 4BYGA 3FPBA 2YBDA 4Y2RA 4KX3A 5AM5A 4CF3A 4EEKA 3BWVA 2NO4A 1RDFA 1RKVA 2MU1A 4UARA 3L5KA 5AICA 3UM9A 2G09A 3L0YA 3KOOA 5AI0A 4UMEA 3UMBA 5JJBA 3U7FB 4J03A 3MPOA 5AK5A 5AW6A 4FYPA 3U7GA 3E81A 3IJ5A 5A3SA 5AKGA 3PGVA 3ZUPA 3QU2A 3QUCA 1U7PA 5AW0A 3AR9A 1WR8A 1IWOA 1TJ3A 2YJ3A 3KC2A 1L7MA 2I33A 3PGLA 4ZEWA 4DFDA 3E58A 2FUEA 2PR7A 2VKQA 2IOHA 2ZBDA 1L7PA 3QU4A 2HCFA 1QH9A 1AQ6A 1ZD2P 4UATA 2FPRA 5AW1A 3U19A 5AVYA 4CNQA 4AP9A 3L1VA 1Z4KA 3QU7A 1RMTA 1TJ5A 3KZXA 1RKQA 4QQFA 1CQZA 2O9JA 2ZBGA 2CFTA 4I9FA 4YCLA 1XP5A 5AKLA 4EELA 3TLMA 4XQ0A 5ALXA 1VJRA 1L8LA 3EPRA 3OPXA 2RAVA 3AR4A 3BA6A 4Y2YA 2JARA 2B8JA 3QUQA 4L6CA 4XPZA 1MH9A 4UMDA 3QUBA 2AUTA 5AKHA 1T5TA 3A1CA 3EWIA 1Z5GA 1L6RA 4PNHA 5AKYA 2HO4A 5ALQA 3B8EA 1L7OA 2ODAA 1K1EA
chains in the Genus database with same CATH superfamily
3LGAA 1FF9A 1CEEA 3RDPA 2R85A 3R24A 1YDEA 4EA8A 2WWXA 3G13A 3GGPA 2B0CA 3W5IA 1U2SA 1L7EA 1SRQA 1C1DB 1Y7IA 3AP3A 2BHSA 1EUDB 1PX0A 2IQIA 1E7WA 1O9GA 1W6RA 3IVMA 5AW9A 4DMHA 2QQGA 2DPYA 1S8AA 1RD4A 4PO9A 2QS9A 4J49A 1GTJ1 4P93A 4POOA 1Y4SA 2BBOA 2PZAA 1EVYA 3IQZA 4KXYA 4LWZA 4MYTA 2Z6AA 2X8WA 3VC1A 3O3OB 2NU9B 2XEDA 3WKCA 3L0SA 1X94A 3L1JA 3OQIB 2V7BA 4XJSA 5WRFA 4KV7A 1FVFA 3S2UA 3WLIA 4BNGA 3QG1A 4DR1B 1RC8A 2C1EA 2QSYA 5DLYA 1A1VA 3OZFA 3PFHA 5FBQB 2IPAB 1BHSA 1FRNA 5CVEA 4AECA 1SCNE 5K03A 2ATXA 2XRYA 3UK6A 3O4HA 4LTNA 5CB6A 3ZD7A 3HVIA 1V5FA 4NK5A 2AKYA 3KVOA 4QTXA 4W63A 4EG4A 4Z1MD 3AIOA 3HKCB 5ADWA 2ZTHA 4MVJH 4NFSA 5I51A 3ADBA 1ZZEA 3AUFA 5SICE 7ABPA 3G0BA 4KDRA 2V5VA 5CDFE 3ZHQA 4LGYA 5AHKA 2WZBA 2UVPB 3NM6B 1NXVA 5KQRA 5GMOA 1D2AA 4DT1A 1DT5A 2YS6A 3OP1A 4DY6A 4ENPA 3KO8A 4BRZA 4HNUA 4EIWA 2VNIA 2MYPA 1K2WA 5AXCA 3AY6A 5JZSA 1ILWA 3FPFA 1G6KA 2Y0EA 2JGAA 4M1YA 1JZQA 2WFZA 1E9SA 4MW1A 5EZ5A 5F2NA 2ZUEA 1JFTA 5JJKA 4ZAFA 3CX7A 4M88A 2BFEA 1Q92A 5CLIA 5I9SA 4YCCA 4ZD6A 4D8TA 5K0LA 3QVXA 4Y2TA 2PWYA 1M1YE 2C84A 5JS7A 1NR1A 3CNEA 3R8FA 2Q4RA 1W5FA 3DXFA 4LZZA 2BL4A 1BRTA 1Q0QA 3NHBA 2GRUA 4CIAA 1QFZA 4LWOA 1X1QA 2IXFA 4RHEA 4BQEA 3LT1A 4FGZA 3R9KA 1L9XA 3LUKA 4X5OA 3FYUA 3AVXA 2OZEA 1H65A 1AN0A 2RK3A 3FTCA 4TRJA 3UT0A 8ABPA 1I1HA 3INYA 5FRDA 3GB9A 3M7IA 3R6TA 2SKDA 1P2DA 4UNSA 3EIXA 3RC1A 1QS0B 1R18A 2E5FA 5JO0A 1HSOA 2QX4A 1B8NA 2VOJA 5LIPA 1ZYUA 4GE0A 3DPSA 4PE5B 1NJ8A 5GTDA 4ZV7A 5JANA 4V03A 5KU1A 1KE1A 1EHCA 3TAUA 2H9AA 2O05A 4PAGA 4QJBA 5LQRA 3TXXA 4LPKA 1G38A 3T4EA 3KSDO 4QHTA 2CV2A 3HY3A 3TTWA 2JAHA 2G28A 5L3SA 5D7BA 1O6GA 4MS4A 4XFDA 4CLXA 3E3MA 3IIMA 2P62A 3EGCA 4MB2A 1U02A 4YGYA 3DEIA 2AL7A 3D4PA 3RWBA 4LFCB 3QRWA 3QKIA 3ONFA 5FL7D 5SY4A 2UUBB 1WU7A 2CMFA 4ARZB 1QO9A 2PPLA 3G9ZA 1IQPA 3ANLA 3SDSA 1T3HA 3BL5A 3HJHA 3DBIA 2EBUA 4BASA 1JMKC 1GL6A 4GAEA 2EZ8A 5K05A 3JRXA 2QNRA 2G1UA 4I55A 1LW7A 2D6FA 1M34A 1W9HA 4R1QA 3KUCA 1Z56C 4KQHA 3T7IA 3CF4G 3CLUD 3EFBA 1AF4A 1FU7A 1D4ZA 2WJ3A 2A9PA 5BOSB 1HFEL 1SUDA 3HBAA 2X76A 3L41A 4I55F 4MVYA 1EFCA 1VL1A 4B4OA 4S05A 4HAZA 2AX4A 3AF5A 3AKEA 3I2JA 2W90A 3W5HA 1FFCA 1J1ZA 4U7FA 3BK2A 3LHSA 3GEBA 1AIPA 2F8MA 2ZAMA 2MHCA 3I6MA 1U7WA 4J0DA 2Y8EA 4U3JB 3EOBI 1O97C 1JA1A 1BVYF 1SWWA 1Z6QA 3NJ8A 3QJGA 1U2RA 2NQ8A 1AS2A 4YAEA 5IT5A 4DABA 1X7YA 2QTTA 4UBJA 4YJHA 5REQB 2VDMB 1L1QA 1V3VA 3B1FA 5A6SB 3T5MA 4IUDS 1J5PA 4CF6A 1N78A 4B76A 3EF0A 4ZCMA 3WLLA 5F64A 3NAZA 5JY1A 1JQ5A 1USIA 1YZTA 3TZHA 3UJ6A 1Q22A 5BVGB 3D6VA 5KWEA 4KTTE 2Q2OA 2SCUB 1DE0A 2E37A 2NXWA 2BWJA 4DQUA 3FFAA 1XXHE 3MT0A 3X1ZA 5HZMA 2A9FA 2D62A 1YF3A 2NTYC 2AOTA 2FOLA 3GUZA 4QM6A 5I9TA 1CUYA 5ALDA 1YKGA 5J2UA 5GP1A 3PF8A 4RQUA 1A4XA 2HA2A 3CB4A 3O0TA 1MABB 3EGOA 3HXQA 5HBRA 1JZSA 2GBGA 4HX2A 2AMYA 1QQAA 2YVUA 5IT9A 2XVAA 3ZLJA 5CXXA 1UJNA 1CJSA 1S8OA 3M2PA 2FWNA 5C18A 1XLVA 3ONVA 3CNQS 4C0BA 2AKEA 1WXDA 2PAFA 3PD1A 2WUDA 1RLTA 5J47A 3K92A 3DVAB 1FFYA 3N2LA 4JJEA 4MV3A 5KYXA 1FEZA 1BS9A 3NP9A 4UU7A 3ZDYB 4CETA 1EIZA 1CEQA 2YC4C 4P3NA 4N7JA 1YTLA 3JAKA 3TRKA 2N3ZA 2GNOA 3SZGA 3PI7A 5I4CA 1BWRA 4UOQA 5F2EA 3V1KA 4IJKA 2VSYA 3AK4A 5E0KB 4BEJA 4CJXA 5MGNA 4M9UA 2C4KA 3KQQA 3D59A 3VR0A 3I72A 5BN4B 1E1LA 3FPCA 2B3TA 3N39C 3RC9A 4ZVUA 1GU1A 4PPNA 1MF7A 2WT9A 2M98A 3N28A 4HEJA 3TPFA 2II6A 3CZRA 1T0UA 1P3Y1 1ZONA 1SU7A 1VKOA 1POWA 3FMIA 5TPWA 2J3IA 2OE2A 2XX3A 3W7AA 5FH9A 4W5TA 2RGAA 1SGWA 1ZD9A 4OFZA 2BFWA 2ECOA 3LX5A 4E5UA 2GEDA 1XE3A 3C8UA 2J3KA 3IAM1 4MYSA 4UEKA 1PG0A 2A88A 2JH8A 3ZU5A 5A0TA 3VKUA 1SD2A 5DZSA 3UO8B 2VKTA 5CBKA 2G5PA 3UJHA 4H7EA 2YWCA 1IPEA 4BNIA 5GVSA 5IJ9A 3F73A 5HS4A 4EPTA 2WSLA 1THZA 3D6HA 4TMWA 3PPIA 3RW9A 1GTRA 4FSXA 4G4JA 2EQAA 1JT2A 4A36A 1ZJ6A 3SE0A 1RAGA 4QJ5A 3WV4A 4B75A 1QHGA 2DUJA 1QOQB 2FX3A 5L4SA 3STWA 1MLDA 5CP8A 4UMFA 3U7RA 1MNAA 1BX3A 4BFUA 5ES4B 3AERB 4H08A 4CVNA 2C4UA 4B46A 3WNZA 4FZJA 3IPXA 1CY6A 2J3JA 5FOXA 2ZJOA 3GRPA 4MVJD 5DCUA 3KXLA 3TQIA 4FFVA 2JIQA 1Q1BA 3ETEA 4LRWA 4OH7A 2PT7A 2HYIC 4HPWA 1FPMA 2Y6UA 2Z5FA 2PMDA 3DBLB 2FWJA 1DC5A 2QTRA 3HKBA 3KDPA 2HU2A 1YASA 4ZDWA 3URMA 3KFVA 2ZUWA 3FJOA 3MMSA 4JI1B 5KNDA 2A9KA 2NP6A 1W5AA 3W6ZA 1VBMA 3WGLA 2PXAA 2HV8A 2OTCA 5BN1A 4OHCA 3UAWA 1YDGA 1YKFA 5CHEA 1Z6TA 2ZW9A 4QSHA 3CXRA 2MT9A 3DZJA 1HQDA 4OI2A 2KLHA 2I66A 3B5JA 3S99A 1UBTS 1DQPA 3QPUA 4EYEA 1RIFA 4C4TA 2Q1TA 4RELA 1X70A 3EEYA 1IVNA 1FYWA 1W76A 2BMDA 3CWZA 3FBTA 3FNEA 3PNOA 4YREA 1K5GA 3VZQA 4C4OA 3WA6A 1N7HA 3PE3A 1VJ0A 1UL1X 2BD0A 3WQBA 3VI4B 2WFMA 1QCYA 1SN7A 1DCTA 2VDWA 2MINB 1MOSA 4RBNA 1NVAA 4XUGB 5A4FS 1VKNA 2PLFA 2RG7A 1M2HA 2Q6KA 1HM5A 3EK2A 1BU5A 3LCRA 5D6OA 5AKJA 1X7HA 4CYMA 4D7AA 1XTRA 3SICE 3ZJVA 3RAPR 3TMKA 1Y7LA 3U3XA 2I6GA 5TQ0A 4Q9LA 2PYDA 1DLIA 4I0WB 4DSAA 1Q3TA 4JB3A 5DTMA 5BR8B 1F2DA 3FZQA 4H15A 1K6MA 3IAS6 4WUTA 1L7XA 3R5JA 1YB1A 6YASA 4U00A 3U6KA 3CG0A 7REQA 3T3HA 4M9QA 1CJMA 4C4PA 3MWJA 5B12A 3V48A 3IQFA 1K7EB 2A35A 2C96A 2MTBA 4O2AF 4WVFA 3L1HA 2DHQA 4ZYUA 3GGOA 3IS3A 3AW9A 3LW7A 3G0HA 1EQUA 1JG2A 2J7KA 4YTEA 3RVPA 5HYVA 2JGRA 3BKXA 4MQFB 1RRKA 1WY5A 3FWKA 3QUTA 3B5EA 1PK7A 3LH5A 4S1OA 3D2BA 3VPHA 4O3MA 3KE9A 1LS1A 1X0XA 2FW9A 2GFHA 4JYMA 2OYRA 1YFLA 1US8A 2CXNA 2E85A 2X40A 3ID6C 5H8WA 2QXUA 2P11A 2VUUA 2VP2A 5C8VA 4X8LA 1T91A 3N2NA 2WYUA 5FXMA 3QXGA 1UJ6A 4PTLA 5KNBD 2DR3A 3F78A 1ZLXA 4I36A 3CE6A 5KJ6A 3OKFA 2KHZA 2VJMA 3QPDA 4BZXA 1UK9A 2NU8B 4HY3A 2I8AA 5EKSA 3ZK8A 1IQ0A 3HJBA 3KKOA 5I7EA 3QGMA 3RTDA 1NI4A 1JIKA 5GONB 4QG7A 1PZXA 1C30B 2P7HA 1P3DA 2D0DA 2FN4A 4EW1A 5CCDA 1IOLA 4CCYA 4YAKA 1P4RA 4YDRA 1JRLA 3DPUA 3M5PA 4JB8A 4AZ3A 4C4YA 2FOIA 5CLJA 2XITA 3FLBA 1H8HD 1E4EB 1K8XB 1TZKA 2GXQA 5CDUA 3NHPA 1FS5A 2C5EA 2J6BA 1CUBA 2YUTA 3KOUA 2NAFA 2HFKA 3Q0TA 1KJZA 4JVNA 4M9XA 5ENZA 3WRVA 2IL1A 3FUXA 4GOJA 2YIJA 1E63A 2B5WA 2MU1A 2VJLA 4YYZA 3TXYA 3ZVKA 3H04A 3A14A 4US2R 4I4TB 1U1DA 2IHBA 3PQ8A 3AYZB 5B58T 3WZLA 4JBLA 1Q0UA 3FVWA 3M5WA 4QBGB 1JEOA 4A0GA 2BW0A 2KMLA 2H1RA 3ZCVA 2R65A 4F8JA 2E87A 1E2GA 3U4GA 4MZXA 5ECGC 4Q24A 5K9ZA 3MMPA 1EP2B 1E5XA 5JARA 4UHCA 4A4DA 1VQ1A 2AFHB 1Y5IA 3LWDA 4KE7A 3WJ1A 2J09A 4WKNA 3W0LB 1HTTA 3AJDA 5IAKA 1E6EA 1E1NA 3TGPA 2ZDGA 3KXKA 1RPTA 2YJ3A 3C3CA 5LB4A 4DCOA 5KTNA 5CM2Z 1BGXT 3GUHA 3I2FA 2EWWA 4DDKA 4Z4IA 4JYAB 2AR7A 1DS6A 1GQRA 5LZ7A 3R0VA 1MGOA 1I2MA 1CB7A 3G8CA 3FOAA 4IHJB 1Z12A 5DBHX 1W581 2G17A 3ICWA 3WAGA 3QOXA 1JALA 1KJYA 2WKQA 4AICA 3BBLA 5F78A 1Q83A 4DA0A 4DUZB 1ZX1A 5CT9A 5ED0A 3RJ5A 4F2DA 4AN0A 4E5KA 3GROA 3HCBA 3KKLA 4DUPA 1IIRA 4WZAA 2ZT8A 4CT4B 2NT4A 2RGYA 1JU4A 3NZEA 4RVFA 3NETA 2RI0A 2Q7DA 3SCZA 3RS9A 1X9GA 4IV5A 4P81A 2AXNA 3KK0A 3REQA 2HWXA 4FZVA 4AJEA 5FDFA 2X5XA 3FFXA 4QU0A 2WAYA 2JHFA 2E4YA 3TLMA 3DOJA 2QR3A 2VPIA 5HQ3A 3QPBA 1VJRA 3K5WA 1V11B 1KBZA 2CUZA 4ND5A 1SH7A 2PXHA 4B6QA 1G9XA 2HV9A 4KQWA 4FIDA 4E4TA 4TKVB 1GTZA 1L1RA 2VXBA 3GELA 3GFRA 4JJKA 3OPQA 2ZZNA 2HC9A 5TE9A 2H06A 3NHLA 3Q6MA 2BEVA 3OEWA 4HNTA 1JHXA 4K2AA 2M1ZA 2OSVA 4ESOA 5LOVA 2XNDD 1WCIB 5AKHA 3A1CA 1KK1A 1J0CA 1VBFA 1Z22A 3LKVA 4HQKA 2VTEA 4MROA 3SGLA 2EBHX 4MK4A 2F2TA 3MWYW 4N12A 2QD5A 4WJKB 1DELA 1NY5A 4IZOA 1BNCA 4HPJB 1P7PA 3NHZA 1PDWA 1VGRA 4TV9F 3R7SA 5ICEA 4AJ4A 3I2IA 5IKXA 2JG3A 1T4DA 3JTEA 9GPBA 4KYUA 2A0UA 1X38A 2V7WA 5IYZB 5A5DA 4E4RA 4F2WA 1RQXA 5F51A 4PU0A 3NTVA 4HX9A 3PGMA 1XJWA 1EZ1A 4L85A 3SR0A 1WM1A 3JQFA 3QX8A 5DHAA 3GN2A 5DIFA 3TNJA 4S0ZA 5TGZA 4CF5A 3GBVA 4PC3A 4M0PA 4C7VA 4PXAA 4YQFA 5C5EA 3MWDB 4HB2A 3DDNA 3VU8A 3OTGA 2I22A 5KNCD 1ZVVA 4EZEA 1NJ5A 2UV8A 2WSSA 3R6DA 4YJ3B 1RYEA 2Y68A 4AX8A 3I6IA 1K92A 4W5RA 2PX5A 3K16A 3HP4A 1MFZA 4EHHA 3OU6A 2EGHA 3QE4A 5AWFC 3E3LA 2WF9A 3ECSA 2RHCA 1CTQA 3DTVA 1V9CA 2C29D 4OHKA 1I3NA 1V0JA 3EEQA 3HB1A 4L75A 2J9RA 2JLBA 2CYAA 4WZ6A 4ZWNA 2AZTA 2XAAA 1Y7TA 2C7VA 2K87A 2YOGA 4ZDJA 1DEOA 3U9LA 5FEMA 1KZ4A 4DXDA 5AVRA 5EMJA 2FN9A 1TGVA 2PL1A 5GJWC 3C1UA 4BJHB 4C08A 3NWPA 2J5BA 1LZKA 4TRMA 2WTUA 1TAQA 2IUSA 4KWIA 4LV6A 4R81A 3SQXA 2R4TA 3ZVRA 4J0EA 5JS1A 1O2DA 2ES4A 1BTOA 2XIQA 5BWMA 1QO0A 1BHJA 1AE1A 1FVXA 4H27A 5FWYA 2NUPB 3A9VA 1F2TA 1MAVA 3OZDA 1A9SA 1CD5A 1NMZA 2FUCA 1R0CA 2JH9A 5C2JB 2QTNA 5THKA 3OMLA 3SJAA 5IF9A 3THWB 1R3DA 3ZE8A 3HDTA 1RYFA 5DGXA 5F33A 5LXTA 4E2WA 1E3IA 4ATNA 2QM7A 2PGLA 3C3YA 3OT4A 1O94C 3AKZA 3LVFO 5CEJA 4RIFA 1YCFA 2GUGA 1C9KA 5L45A 2C8KA 2NZJA 1TLLA 1R9MA 5EJMA 1DFHA 2QEQA 1R0KA 1WPXA 5AM0A 3ZE6A 6PFKA 1AX9A 2XZTA 1ZBQA 3T1NA 4AWXA 1D4OA 1XZEA 3L8ZA 2PWBA 3LFTA 1TMGE 2REOA 5DT9A 1XRMA 3DOCA 3JS5A 3ISTA 3R9XB 5FFMA 2YQZA 3CKMA 3IQIX 1O5OA 4YYEA 1QTNA 4JJFA 3V7WA 2Y0CA 2HHCA 2DETA 1Z25A 1UPBA 2GF0A 1WULS 1GV0A 2WJVA 1M2VA 4PNPA 3T9AA 1O0SA 4ZO7A 1V2GA 1XAGA 3D1JA 3KTAA 3ZGYA 3W78A 3I76A 4NNPA 4PQFA 4PR3A 4D82A 3MNFA 4CEIA 3C14C 2GKSA 4F04A 2VUTA 2BFNA 2V58A 4N5HX 1A8UA 5LJIA 4RO0A 2B61A 2G0AA 2YJ4A 1P3JA 5EMLA 4C6TA 3CV3A 2KM1A 4EY3A 5KBYA 3FSGD 3E8MA 4N6OA 1GUYA 3I62A 4F5WA 1KXZA 1NBAA 2W9XA 4W5HA 4X94A 4C43A 5FPSA 5JH7A 2QLFA 1S9DA 2ZUCA 4Y0NA 3B52X 3RLIA 3G7UA 1Y8QA 1QYRA 3O1IC 4PHGA 3WLRA 5KCMA 2LDXA 1W94A 1KBQA 3KZNA 4MDHA 4WRRA 3QKUA 1YQGA 3OPMA 2Q3EA 1IOZA 4UVGA 1OXTA 2HYDA 1QDLB 1RNLA 2HMWA 3V34A 5BN5A 5LIRA 2VHWA 1ENPA 1KP3A 4LYAA 2O0JA 2GETA 3QNWA 1BDMA 1GTMA 1BEEA 4HQNA 5EJIA 1CUZA 2R1VB 3N53A 2J48A 5JYCA 4GI3A 4XJTA 3K0FB 1M1NA 4UZEA 2JIOA 1K68A 3WMEA 4O4JF 3HUEA 1NASA 1NQ5A 2FAXA 3NDRA 3PFGA 3I28A 3UV7A 1G60A 1Q1EA 5KOHA 4MOWA 1GCGA 2Q62A 2W2TA 3KD3A 4CM3A 4R8LA 3VQTA 1IDN1 4UEOA 2PE5A 4D8YA 4DTIA 2FKNA 4G5YA 4RJLA 2QP4A 1EX9A 1M1YB 4CU2A 4Z49A 3PX7A 5TARA 4PAQA 2JLCA 2DKFA 5HJ2A 4C6RA 5CDSA 5CCEA 4GMXA 3QNUA 2QUHA 1JZTA 1LF0A 4ZP1A 4B7CA 4O6VA 4BU0A 3CMMA 4JT9A 1SBQA 3ZWVA 1LV8A 1WUKS 2DJ5A 4HDNB 4HYEA 4TTVA 4L4YA 3A6PC 1B8PA 2FGKA 2ZRDA 4ND2A 4AROA 1QWSA 3ILSA 4OJNA 4K3UA 2CJWB 3PUVA 1TIBA 2WJIA 4QXOA 2BVNA 3D3EA 3U7QA 4N0EA 3UFBA 2KS6A 1EUCB 3K31A 4RVGA 3BREA 2GBFA 4BU1A 1JL3A 1W48A 4TS4A 5EPOA 5KVAA 4DV7B 1JMYA 4S35A 1TF5A 2AT1A 2BZ0A 4NYIQ 4XOUA 3SI7A 3W9BA 4DLNA 1ORTA 4XD7A 5FUWA 4UTVA 4RTPA 4H3SA 1L0BA 1ZU5A 3P0RA 3H2SA 2ZUTA 3I1YA 5AI5A 3QXHA 1E3DA 1KR2A 4F5YA 4JEUA 1QCDA 3FNGA 1XTBA 3K9QO 1CJBA 1EXWA 2XYRA 4QU5A 1H3NA 3UK1A 3V4PB 2GCOA 5JXGA 4M1TA 2FZCA 2XVMA 2RC6A 4E6PA 1KGDA 3IAS1 1JXOA 2QV7A 3HWWA 4RE6A 3WB2A 3I2KA 3WGQA 2NSHA 3DZKA 3DHEA 4QC2A 3VC3A 1C9DB 2RBKA 1IJKA 3OO0A 4URHA 3ADOA 2XT9A 1BXGA 3CLUC 3IOMA 3P9IA 2X4IA 1GFZA 3NC4A 1COWA 2FWRA 4G89A 2AUMA 3L8DA 1HA3A 4C5CA 1DRUA 4LF7B 1YI0A 4MJ7A 1GN9A 1GGEA 2VJNA 4DM3A 3E82A 2Z8YM 3ELUA 3EQ8A 4ZZIA 2VDUE 2FWIA 3MINA 4EGCB 1WB5A 3GXOA 3UKJA 2NUTB 4EMTA 5B4VA 4Y18A 5DLEA 5KJEA 1V8PA 2YZKA 1T5IA 2FMUA 3IHWA 4PIMA 4CTJA 3KPVA 1JTFA 2ZREA 3AVWA 1KI6A 4FWBA 5AXBA 1DCMA 2WT8A 4NU6A 3TLBA 3PXDA 5D2CA 2Z5VA 2PLRA 4KMRA 1HORA 4XA8A 3UYLA 1SQFA 1I7DA 3B1YA 4M1WA 4EP1A 5HCUA 4UFPA 4R2HA 2DUUA 1FUEA 4UKDA 3DT6A 1QQ6A 1I2CA 5BUQA 4LJ9A 1KAGA 4P3PA 2RHLA 3UMRA 3I1IA 1ABFA 1P1BA 3N2KB 4BN0A 4DA7A 1ACLA 2OC9A 3AR2A 3MWLA 2QGFA 2DR0A 1WUTA 1F6WA 4OHFA 3RUEA 3HBMA 3GY0A 2IELA 2QVLA 2YHIB 2AZMA 2E9SA 2RHHA 1LK7A 3Q10A 2I7DA 4V0KA 1JSXA 5IJZA 4N65A 5DX8A 3UB3A 4PGGA 5IFKA 3DEHA 4LJ5A 2GSWA 2GXUA 4WW0A 1SB9A 4HHEA 4Z7QB 5ICGA 1TX4B 4GR4A 2RHGB 3DG9A 1U94A 2ON6A 4CMAA 1FLNA 3P9RA 3GAZA 4I9HA 3KPYA 3MMXA 4ND4A 4YAFA 5H80A 3CYFA 2O2EA 1ISMA 1ZHHA 2BGRA 4HLUC 5BP7A 2XHZA 2REQA 4BZQA 5D00A 3O9VA 3MLBA 1AUPA 1BE6A 4TXNA 1NX9A 2CLDX 4B87A 1GKKA 3H75A 3EZ6A 3QKSA 2PSEA 1JDUA 3IH5A 5LQNA 2RIRA 2VJBA 4KH1A 1ZJJA 3Q87B 2REXB 5F12A 4A03A 4CKEB 3W2TA 2BT4A 1U8TA 2XCUA 4XFJA 1S3FA 1RWVA 4CQJA 4I55B 1U1FA 2D8MA 3OQ1A 1OMOA 1HY3A 4M38A 3BM5A 3SC3A 3E1SA 3TLKA 4NY1A 1JR4A 1IRIA 1V37A 1RI5A 5KNDH 3ELBA 3G7SA 3SMVA 4RPIA 2Z08A 3DQQA 1U04A 4JU8A 2MJLA 5F3WB 1D03A 3COVA 1KZGB 1NW5A 2QIOA 3GMIA 3O4RA 4J0KA 2GKGA 3VDQA 1EXMA 1NAHA 1K3UB 1A9ZA 1ZS9A 4KVAA 2A1TS 4JL8A 4CTKA 3STYA 1JG3A 2IPLA 3TTTA 3K71B 1N34B 3HRHA 4FZRA 1L5HB 1Z7EA 4IIGA 1W4CA 3E0XA 5JWRA 4KUEA 1G7SA 2H5LA 5K3FA 3ASUA 5ARBA 3HKDA 5DYYA 4NYJQ 1ZD4A 2NZ2A 4QODA 4L8VA 1OHHA 3B3GA 1XTPA 3IEPA 3KJQA 5ALKA 3L8MA 5HRCA 3VPGA 1XRRA 2BGUA 4JJIA 1PUXA 4JEHA 2I6XA 4LWQA 1FUKA 1FLDA 2TS1A 1EG7A 2H0RA 3WBFA 5K99A 4JVOA 2ID9A 5GM1A 5J4YA 2FFAA 5F7XA 5A6SA 2WABA 4F2HA 2Y76A 3IOEA 3B7GA 4V0LA 1C2YA 5FPTA 3S1LA 4XWKA 5H59A 3KB8A 1B26A 3QVGB 2JHGA 2QN9A 2JLWA 4TVOA 2GESA 4JGBA 4E32A 1RQGA 1THTA 3ZGXA 2P6RA 4AS2A 4CKWA 4JLAA 3DD1A 4ZOLF 1NG9A 5B53A 3SIWA 4DCNA 3LPLA 4GQAA 4P22A 1P2UA 4EQZA 1D5CA 1LY1A 6CHYA 1IOWA 4FMDF 1OWPA 2W4MA 4ZVOA 3S2IA 5EJ5A 3G0GA 4OU5A 1DAFA 3E4DA 3GO4A 3N59A 4M83A 1P1FA 1JHAA 1W73A 3L1UA 3AFGA 4YJ3F 2VEDA 1ONPA 1UKVY 3H7IA 1PNTA 3AEUB 3OM0A 2O2DA 5KHAA 4DNOA 4MIEA 5AKIA 5BSKA 3WR5A 1W4ZA 1CJCA 1ZICA 4QTTB 4PV7A 1V9LA 1CDDA 4BO4A 5KYYA 3QJ5A 4IV8A 1NF2A 3UVEA 5B2FA 2SKCA 3DLBA 1X80B 2A5JA 2ZKIA 3ERCA 1KI9A 1CF4A 1ECBA 4GI2A 4R0NA 2QUAA 4L3WA 2ZB3A 2J46A 4IOJA 3DDSA 4ZJZA 1TW3A 1Z7GA 3ZU3A 3BTUA 2Q5IA 4BVGA 4H1WA 2FDXA 2A4KA 5IT0A 4ZV9A 2PBFA 1P33A 1U3GA 4LUCA 4F56A 3OEHD 2PWZA 1IMOA 1UFKA 1NYQA 4GLFA 3H6KA 3SSOA 4GPIB 1EX7A 5J5AA 1YO6A 5K20A 1LU9A 2VF5X 1K4KA 4R7TA 2PA3A 1U2EA 3BXHA 4M60A 4D0RA 2YBDA 4BQQA 3EAFA 5CXUA 4AF6A 4EEKA 2CNBA 3TQRA 1FUIA 5CYGA 1NU6A 4IUYA 4LF4B 3D3WA 2ZYIA 3JWIA 4KREA 1RDFA 3JPYA 1RKVA 4GO1A 4AJKA 3P9CA 4C3ZA 4AN1A 5IJWA 5B58C 2HHJA 3TG2A 2O7VA 4KVFA 1UKAA 3B6EA 4PC1A 3VR5A 4YUZA 4CUJA 2B4AA 1Y9EA 2EG9A 1E0JA 4C4AA 3G82C 2VATA 3KU4A 1I9CA 1T3LA 1WTCA 1XG5A 4OA5A 4JSRA 4L74A 1H85A 3W90A 1IZYA 2BMEA 3S0JA 4XFKA 4K6CA 1N2CA 3EG5A 5J3JA 1HLPA 4BQIA 3VH4A 3L9WA 4N49A 2WHXA 1P7YA 5KCZA 4FU0A 1RE0A 4B8ZA 1PJAA 1QG0A 3PS9A 4MVWA 1R9GA 3O6VA 5HDQA 3V2IA 1V43A 3RRYA 1I01A 1ICIA 1S8FA 3AOGA 1X1CA 2Y9MB 5ENDA 5I7AA 2HXYA 1H2BA 4CLHA 5KSOA 4IVPA 3HR8A 1WU8A 4M0LA 3GJ3A 1RCTE 3GRFA 4WOCA 1L7PA 2Q8QA 3EYAA 2XOKA 4TT8A 3ZH2A 3EG9A 2Y0PA 2ZWOA 4AY5A 3SY8A 4XUDA 1UXIA 2CJYA 4EKDA 5JWOA 1ISIA 3QXSA 3WO1A 2O5CA 1O4WA 1QJCA 1XU7A 2FX2A 2QU8A 4J0FA 4C3UA 5JI3E 1IK4A 1R15A 1PR6A 2HCJB 3L1VA 1Z4KA 1UR5A 5GM2A 4KPUA 1MC8A 3TKLA 5D87A 4KXWA 3GLIB 4HCJA 5EXPA 1TTPB 3QVJA 1MDBA 4HAVA 4PBRA 1J22A 5JMPA 3ZCTA 1CZHA 2PVCA 3KSBC 4OLBA 2CFTA 2HQ1A 2XUPA 4RHXA 4W5OA 3JY6A 3WMRA 2VL7A 3C7CB 1ZK2A 3PICA 1V1MB 4UXIA 5AKLA 3U9TA 4BFCA 1RPAA 1X15A 2ARKA 3EPRA 4WY8A 1TYZA 2PRKA 4HYYA 1W5EA 1JG1A 4D9FA 3COPA 1CPYA 1P91A 1UOQA 2EFJA 2QYSA 1II8B 1ZVMA 2JARA 3E1GA 4YUVA 4YLEA 2ODBA 2IYPA 5JFOA 1TVEA 2X0FA 1U3FA 2QI9C 4AMUA 1OTHA 3BH7A 4ZOLA 3QWBA 2I6QA 5H82A 2E5LB 1F6BA 2VN8A 1CULC 1M73E 2JI7A 3COYA 3EOAI 3ILHA 3G79A 1Z38A 4HN4B 5HIKA 5JISA 3U7JA 3KPWA 1YS7A 3D6MA 3WWZA 2YDYA 4HAOA 4XWGA 3AY7A 4DR6B 2GLUA 3QVUA 3LC1O 3WBBA 3INNA 4RQAA 3HVJA 3L0ZA 4MR7A 4YRLA 2R68A 5IAEA 4EI9A 4ZI2A 2H0QA 5I7RA 1SOMA 2HI0A 3Q5DA 2XBUA 3KALA 3IHLA 4NFYA 3IUPA 4CDNA 4QUKA 4Y9UA 1MQ8B 2DHDA 2HD4A 2HMTA 1Z6AA 2OV2A 3MLAA 3MILA 4G0ZA 4IINA 3W79A 2F43B 2GN2A 2JFYA 1V8BA 1DKPA 1QAQA 1A7UA 2APJA 3GBSA 5F2OA 5E0OA 4QBFA 1AGYA 1JG7A 3QNMA 3JZDA 4NZ9A 2X9GA 5E2IA 1QYDA 1M72A 1Q3KA 2O1WA 3RVSA 2VHTA 4CI0B 4RD6A 4QGFA 1P1IA 1Z34A 1UBKS 1D0SA 1SQ6A 2CDCA 3MCVA 4FYMA 3JD1A 4HFMA 2ZWIA 4BNMA 3UAVA 2ZYRA 4MPDA 1L1EA 3O8QB 4AI6A 3KLBA 1IN4A 1JQJC 2H1FA 2WB4A 4ZI7B 5IJ0B 4J3FA 3CEMA 3MGBA 3AB7A 5EP2A 3ZDDA 3GCWA 2ZK7A 4D74A 1G4HA 1CJVC 2ODNA 4ZO6A 2IDMA 4RCZA 4ZN6A 1EFTA 1ORWA 2ID4A 2VIIA 3THSA 1DBPA 4MZDA 1TT5B 3FAKA 4MLDA 3QSGA 5BV2P 1HDYA 5GONF 2XQJA 1N75A 2AW5A 4IF4A 5T41A 3KS9A 6GPBA 3A2KA 4YRZA 1APBA 2BKXA 1R0WA 4LKOA 4GM0A 3QLUC 1R9JA 2BKEA 3AI2A 3E0QA 4J91A 3RRJA 5GOZA 4LDZA 1LSUA 3ANXA 5TJHA 3VNAA 3JAMA 4S1WA 4J1TC 4YLYA 2R84A 4YEDA 3WLHA 3RSLA 5C5DA 2WR8A 3GPLA 3CIFA 3IFSA 721PA 4JI2B 3V46A 4ARAA 4HR7A 4QUBA 1VC2A 5BT9A 3FROA 3KYIB 4LQ4A 1K5PA 3JARB 3A10A 4X1IA 3DTYA 4KQKA 2O57A 5AHXA 3H4IA 1NN5A 3KXDA 2D59A 3QX9A 4GPZA 1M6WA 3EF3A 3OCUA 1VECA 2EF1A 5TVKA 1X8KA 4LXHA 3C3DA 1S5PA 3TUIC 3UATA 2Z43A 3HYTA 2RMKA 4HBZA 3ROTA 3JASA 4DDHA 3EBLA 1UBJS 1WBJB 2FRVA 2WW8A 3L18A 3GWZA 2HCBA 1T2CA 3NFRA 4X6LA 4YFYA 3WLAA 4D8WA 4ZHQF 3IKTA 1C3EA 4HBGA 1KKUA 2DPXA 2Q8PA 3MVEA 4UTZA 5DSXA 3R44A 2W6ZA 1JSLA 2IUYA 2R3SA 4FSHA 2D1FA 4MKRA 3VISA 1KYTA 3F6YA 3WK8A 4RTLA 1PEYA 2XBLA 1VB3A 3AUUA 3EQ9A 1LX7A 4MV6A 3BWCA 5CXSA 5B1SA 4DJJA 2OMEA 3OF2A 1UAAA 2AWOA 3C1OA 4PSDA 4J43A 2EQ5A 4QG3A 2F8TA 2GYUA 1RAFA 1QH0A 1W4BA 4Z53A 2W2NA 5AW4A 4NABA 4P36A 5EJGA 1O87A 1D1QA 4B80A 1P2SA 4FVTA 1UP6A 1PFWA 2HM7A 3BIXA 2PGNA 4DLVA 1NJSA 4NLLA 4Z0PA 4YWJA 4C0SA 3CHYA 1VPLA 4BEVA 4YXFA 1FMFA 3QUAA 4PFQA 2QDXA 6REQB 1QIHA 1SRRA 4UMVA 5F9MA 1QZUA 4Q1BA 2Y93A 4IIDA 3DP9A 1ZIDA 2A1UB 4I4IA 2ZYDA 3QIVA 4PZUA 3R5XA 5A4DA 1EXVA 5EP1A 4PANA 2AEMA 4AD8A 1QX4A 4B0PA 2HW8A 1X1TA 4BTLA 1VCOA 1CYDA 1GP2A 2B7LA 1RADA 4CFSA 3NYIA 3PUYA 4RQTA 2WG1A 4FOLA 4S1NA 5B37A 5A7FA 1V11A 1C4OA 3RTAA 1XAHA 1JJIA 2QTVA 3OJCA 2D2IA 4UBKA 1ZC3A 1TAUA 1F12A 3TQSA 4WCFB 1V16B 2DQZA 2GJAA 1NLMA 2W6JD 4EPWA 2HEGA 2VHVA 2XSZA 3CUYA 1RRGA 2FJ0A 2DVMA 4B3HA 2Q1YA 1XPJA 2CFCA 2WD7A 3B12A 3ESQA 3PRKE 3L46A 2O2CA 3QV2A 2WNIA 3R0XA 5L3SB 4L72A 4KYTA 3T38A 1A7JA 3UG6A 1R6TA 4ZYXA 3UJBA 4L0QA 2FPSA 1P9WA 2GCNA 4LJ4A 4C7OB 4LRSB 1I4EB 4LFAB 1PBTA 2CLLB 4ZKDA 2ZRMA 3VO1A 5HK8A 3BE5A 1OIVA 4Y2SA 3M4XA 1PDVA 3NWBA 2GZ2A 1F3LA 3A36A 4IZIA 1XEXA 2O1EA 1XMJA 2ODQA 4MJ3A 5IT4A 4MS3B 2J3HA 1Z5NA 1EQ2A 4RWZA 1FYVA 3GLIE 4HQFA 4B32A 2J5XA 5CD1A 1Y8ZA 5CT8A 4I9NA 3D8TA 4J0QA 2CXHA 1P5JA 2VQ3A 4BQOA 4XCVA 1XZAA 2HDOA 1E2EA 3FAZA 5CYFA 3WGOA 3ZVLA 4NEQA 3ZCQA 4DLYA 1DIGA 4ZMRA 3UCFA 1GTL1 1W8IA 2CJXA 1TEHA 5DJ5A 3EPJA 1FRFS 1ZISA 3TE7A 2VQFB 5A03A 1X6VA 1YE3A 3FLAA 1WDLA 3JR3A 4TTIA 3WLSA 4ZYVA 1G3MA 5BSHA 3WWDA 1Y8RA 4ZI3A 2OGSA 1YZYA 1OLUB 2P2SA 3VX4A 1DUVG 5E9JA 3AHDA 3I9V1 3GLGE 4RK4A 1F60A 1LC3A 2YHBA 2XNCA 3DAHA 4X91A 4BNWA 4L8LA 3EOZA 5K51A 2PGAA 4ZYLA 3LPAA 3KT6A 3PR3A 4LKRA 4NCNA 5G4KA 4OHPA 1NQWA 2HA5A 3FOBA 1NUAA 2OAGA 4AIIA 4BBJA 5CJ2A 1F2UA 1Y3DE 4GZ5A 1N7IA 4Z1OA 1DIRA 5FWYB 3A26A 4YI5A 1SCUB 4OSEA 2ZITA 3ENZA 1U8AA 1I4DD 2DBRA 1I6KA 3HCEA 3SQLA 5C8YB 4LMPA 3QXCA 1GQQA 2X14A 4ZVRA 1U3WA 1GGNA 2X0IA 3KJGA 2O23A 1U81A 2BTQB 1KDOA 2IS6A 3BL6A 3HDQA 5GV7A 2OQVA 2RH9B 2O8CA 1LLUA 2F3SA 3ROPA 1BCSB 2JIRA 1S4MA 3A04A 4JI6B 5IG2A 3GVXA 5HKLA 2NMVA 1Z88A 1L5ZA 4FJ0A 2FEPA 5M2QA 4KFSA 2W98A 3FUCA 1BDJA 2C3PA 3KT3A 2FMTA 4D80A 5C7OO 1L4FA 2O0HA 2BISA 2QD2A 2XMGA 4M36A 2E4XA 4QFMA 3A6KA 4U2GA 4YDSA 5KSPA 4BVAA 4KN8A 4B0OA 3ZVNA 5JPIA 3LQ2A 5FF9A 4NKRA 1SCDA 2XUKA 2VNKA 4CM9A 4CLEA 2HY7A 2E0IA 2RIPA 2IU0A 2PUHA 3TIFA 4B1FA 5FULA 1AKUA 4B7ZA 1UXGA 2YWHA 3A3NA 3BFKA 5HGXA 3PHLA 3NIDB 3LECA 5D51S 4BVBA 3D2LA 1NXWA 3MXTA 3KWMA 3FKSA 1MB3A 1GQFA 2C04A 4KE6A 2WSBA 4D9KA 4RM2A 1PV4A 2H6EA 3KZ1E 3FOEC 1V3QE 3QBEA 1BG6A 2E55A 5KEIA 1NBOA 3OBIA 2C57A 1O54A 1X74A 2OO5C 4IDCA 2ZRAA 1N5MA 5AR1A 2W2OA 1XFAA 1SVKA 1HZZA 3L7KA 2QX6A 1ZCFA 1H1LB 3A6JA 3WB1A 4RF2A 2OB1A 1YGYA 4I9GA 4F46A 2NN3C 3N3AC 5FWNA 2ZRNA 1I9GA 2HLDD 3MW8A 3N8NA 1XLTA 4JLVA 4WJZA 1R5BA 1G5PA 4C0KA 3LWZA 3OIDA 4P5PA 1QV6A 1GLNA 2IGBA 1XNRB 2LUOA 1VIYA 2QI9F 3DHVA 5HUQA 2IHUA 4GXQA 1WXIA 2ISCA 3KTFA 4CQNA 1IMJA 1T2VA 5FA8A 1ECFA 4P2GA 1NKSA 1VG0B 5AP9A 5J1SB 3EXIB 5FHQA 1HQYE 1J2TA 5F76A 3CZPA 1AD2A 1KEEB 3I9LA 2AK3A 3R3JA 4N6GA 5HKAA 3UGJA 5JSZB 3D4NA 4WJLA 5CT5A 4OMUA 5ER9A 1W0JA 3UC5A 1MV8A 3WE7A 2QLNA 4QVGA 5I3CA 2O8DA 1VIDA 1QXSA 5B36A 3UQZA 2O4CA 4Z5XA 2HPAA 1EJ2A 3PFBA 2GARA 1VPEA 2FEAA 2VH1A 4IIFA 4KPFC 2C7BA 4DF3A 4CTNA 1P1RA 5A6VA 1GA1A 4NATA 1GT91 2G82A 2ZYUX 2Q7XA 4NQRA 2ZZMA 5CFOA 1VIAA 4M9RA 3EQ7A 1NI3A 1MA3A 1QDUA 4KITB 1YJQA 4QYSA 1FFDA 2ZRJA 2X0NA 1XO1A 1U8YA 2CHVA 3TBKA 3JX9A 5HG0A 3VPFA 1ZINA 2D5IA 4KQFA 4PTZA 2ZBFA 4INZA 1CLEA 3T7EA 2NX2A 2OGZA 4NEGA 4Y0AA 1QMGA 3O38A 2ZP1A 3CCCA 3K6JA 4MX8A 2H4YA 4RIIA 2DULA 2AYXA 2WMYA 4WNAB 3W8EA 1QFYA 3H1TA 4I1YA 3SBXA 3N70A 5DTEA 1ONBA 4GPBA 2QVBA 1A69A 1J20A 1MP0A 2HT6A 2I3BA 1OBCA 3IAXA 1QFXA 4IWNA 4JQSA 4X93A 1GZ7A 3ICQB 4KYVA 2ZDHA 3B7PA 2V0NA 4HDAA 3GUYA 1T4CA 1HLFA 1ZEMA 2ZQYA 3ZW8A 3C7AA 3H84A 1EK1A 2O06A 1G42A 3NCHA 1BMDA 3TZKA 4B4VA 4IFTA 4RH3A 3TE6A 3NHYA 3PRJA 4Q3EA 1A4IA 1YZLA 3LLSA 3SJBA 1CUEA 1ZIOA 5AKEA 3BA1A 1P4HA 1Z0ZA 1BFUA 1JJBA 1VJGA 2VDWB 4N01A 5ED4A 2RGNA 1E98A 4H59A 5THQA 3UMCA 4BNKA 2OV1A 5KC9A 3GFFA 1CR6A 1BSVA 1SPXA 5E2AA 4TYNA 1EFKA 3GLFA 3EEBA 3O21A 3KHUA 2OAP1 4GP9A 1FP4A 2PTGA 1BC5A 3HACA 1FNNA 2BLLA 4K28A 3AHCA 3DLCA 3F67A 1OQAA 4LNAA 3DEYX 2ZXUA 3FWPA 2INGX 3E7PA 3EWSA 3R3WA 3UN1A 1PLLA 2PZMA 4YP6A 1X9HA 4BP1A 4ZGGA 1ZN9A 2GWRA 2IEIA 4BMXA 2CBGA 1VRWA 4TMXA 3AEYA 4RJ2A 3VR4A 3IURA 4ALNA 4CI9A 1EWVA 4F2PA 1U63A 2Y0BA 5EGSA 4A3SA 4F85A 1OYOA 1U9IC 4URUR 1TU3A 3THYB 2A1TR 2CKMA 1Y5NA 4D9BA 1SVMA 1PZNA 4HRYA 4KO2S 1ZXBA 1Y6ZA 1N2OA 2G9RA 2JGFA 4A0RA 4IO0A 4NU5A 2CCJA 2DAPA 1DPFA 3ESBA 5PGMA 4DCTA 4E15A 4JCOA 1UMDA 2OAQ1 5AICA 1XJ0A 2Y77A 3ASYA 3NMUF 4ZT6A 5DU2A 1Y7HA 5DBIA 1DL5A 2OG1A 3GLGA 2XGSA 2D00A 4HNGA 1D5WA 4K86A 1KO7A 3IA7A 5A02A 3DOIA 2FPMA 1JDTA 3PKIA 4GDMA 4GYWA 1MXFA 3Q72A 4QTYA 2G1PA 2VAXA 5AD1A 1P73A 4U2EA 4YO8A 5GZ6A 3IJ5A 4HAYA 1PR9A 2Z1DA 2G4VA 3ZUPA 1COZA 4RAOA 5KNBA 1UMBB 1VE3A 4YJ2A 1F7UA 3VAZA 4OYHA 3IP9A 4JOBA 3KUXA 4D8UA 1YA6A 3QFFA 3FOCA 1UT6A 3RFCA 4PX5A 4DFDA 1EXNA 2BDTA 3GVPA 5BYAA 2UAGA 2FUEA 2BI8A 4IDDA 4QYWA 3LKZA 5JZVA 4WBNA 4LOJA 1MQ9A 1ZXXA 1FA9A 2ZT6A 4AVYA 4B45A 1DKMA 2ZUVA 1J8YF 3MWEA 3BMOA 1E66A 1K3FA 2VG8A 2VCYA 4KI0A 4NBTA 3SF8B 1A5TA 2J3DA 1P7VA 3PA6A 3KQUA 4BB9A 1FY2A 2PGOA 3FGPA 1YJ8A 2CHQA 5I4BA 1FSSA 4HMPA 3NM4A 2Q4DA 1YU6A 1XWWA 5M7EA 4JJ6A 5IKOA 4NP6A 3VV2A 1BX1A 1MKYA 1ECLA 2C2OA 2R00A 3P2JA 1K0FA 1ECCA 1XP5A 3BQMB 1H23A 3LF1A 4EPYA 3GNSA 2QLBA 2ZS9A 2A0XA 2OXTA 1HG1A 1XZBA 4GBED 3Q6IA 5BPHA 5ITZA 3WZMA 1JH9A 3ZK9A 1QJ4A 4O0LA 5BUSA 3UWOA 1AGRA 2FYTA 1CNFA 1JFFB 2MCFA 4UU8A 3IP6A 3HTXA 4JBWA 5AH0A 4BNVA 4G0XA 3UUGA 5DGIA 3SQMA 1XIVA 2VSXA 1N1EA 2AE1A 1L5HA 1EGVB 1GEGA 2QW1A 1Y5MA 1LFDB 2M2IA 2P0EA 1UBGA 5BYBA 3ROXA 4QDJA 2BEWB 5IVHA 3AV3A 4IJ6A 5TSDA 5U1PA 4HDSB 2Z2KA 3LUHA 1E9DA 3KZOA 3VPAA 2ZYVX 5IULC 4W4TA 4Z9BA 4BNLA 5KYKA 1FS6A 1FXUA 4OXKA 2A3NA 3AM5A 4NHOA 4PHHA 3OVMA 1K1EA 1SKBA 1KU6A 3G1TA 1GPMA 4O8ZA 4YMWA 2AX3A 2B9EA 3C98A 3QK7A 2G76A 1YQXA 1MIOB 1GTG1 2XMRA 4LOAA 4MTCA 4WEOA 5LBTA 3UC9A 2JH3A 3VC7A 3DLTA 4FD3A 1K63A 4RF3A 3VZCA 5HQ3B 1ULZA 2HJRA 1OZFA 4L02A 4NAHA 2AH5A 3IIJA 2NXJA 3WISA 4D45A 4R68A 2AN9A 4RPJA 2PAAA 3A9TA 3EEFA 3P71T 2E18A 1TDJA 2F3QA 4RGYA 3NVMB 2RGNC 1DI0A 2IK8A 2XMPA 3C8ZA 3EXG2 1SU8A 3HR4A 2CNDA 4PF1A 5DN6A 2BR5A 3G9TA 4E5SA 2YASA 4BECA 3BRWA 4DBLC 4EL0A 1K2VN 2EFHB 2O50A 5EI5A 3EUAA 5CRIA 1UDWA 2B20A 2VDRB 2C2MA 4CM6A 3NJ4A 5TPZA 4EUNA 3W9YA 4ZC1A 2VHYA 5JHGB 1JI0A 1E3WA 4KMSA 2O19A 3KQTA 4LRQA 5D01A 1U4NA 1U6JA 2QL5A 2ZRQA 4KRYA 4RABA 4WK2B 1G16A 3OUUA 2ZJ0A 2KB0A 3LNCA 5AK6A 5DHPA 1BVRA 1Z7YA 3O8RA 4EJMA 2WWYA 5J23A 2RGWA 1P31A 4HWPA 3L05A 5HFJA 3A1EA 2DERA 3ONDA 1QU2A 3LPDA 4URYR 4TV9A 5IHPA 4XIJA 1JPVA 2MWMA 1VRCA 2GDJA 3A37A 3LNTA 5LP6B 2CWWA 3G0CA 3MWDA 1EGAA 2Z1NA 3IODA 1UC9A 2WUVA 3CZQA 3K0AA 2CYBA 5I4IA 3VNSA 2WNSA 3DAOA 1SQ0A 2EAUA 3CX8A 3F4KA 4ZCTA 3HCFA 5ALVA 1W5SA 2IYXA 4NK4A 4U4AA 3VZBA 3D0OA 2DTXA 4U9HS 4JLNA 1EJBA 4CG0A 1UIRA 3EXAA 3R0QA 3HGMA 5ERGB 1V26A 3CZMA 4ZU3A 3FUUA 1NXTA 4HB3A 1G5FA 3WKBA 2P1RA 3ENKA 1L5OA 2ZIGA 3L43A 1XN4A 1A7AA 2CVFA 3DV0B 1X7YB 5DM0A 2JDIA 4N3BA 1A1SA 5JQGA 1LDEA 4EQ6A 1P0CA 4AG5A 2XW6A 4BNNA 1MRNA 2QUJA 3FIUA 3I37X 3MSXA 4EYQA 1Z4OA 1ZKDA 3ICCA 2I2AA 3FCOA 4IEFB 3THRA 3BMQB 5A9TA 2PRIA 3VOAA 4AXBA 2NUPA 2QUKA 1HQKA 3F0TA 4JR1A 5FFFA 1G6HA 1H0HA 2XNSA 4ETNA 3DLAA 3HYSA 5DB4A 4PHCA 1U0SY 4S0XA 5BVGA 4G0VA 1H8HA 2UZ4A 1T24A 2TMKA 3IEIA 3FY4A 2QPTA 2Y4OA 1AXRA 3C3PA 4Q3CA 5JTUA 1WS6A 3U26A 5EEGA 1PK9A 4ISCA 3MOSA 5ALSA 3K9BA 1E92A 1PT5A 1J42A 2FZWA 2V7UA 3H8JA 3RBZA 4O0MA 1C0IA 4C20A 1SUPA 1P4SA 4HC4A 5KREA 2JGLA 1MO2A 2B6HA 2Z5GA 1LBTA 1UM9B 2G9VA 3M6AA 1FQOA 1MOZA 1RWWA 1T3SA 3T7RA 2PRJA 1H93A 4N7RA 4EMSA 5ER6A 3M6XA 2G1KA 3IILA 5GIOE 5DYWA 2AN3A 3O73A 3QENA 2XZPA 4LY0A 3HU2A 4LBVA 4QXMA 1XCGB 4MWSA 4BEWA 4Q4AA 4M53A 3EH1A 3ZD6A 3E7XA 1A9TA 5FBRB 2V9CA 1SKYE 3DL0A 3AKCA 4Q9JA 4GP7A 4NH4A 3CX6A 1MU0A 2NNWB 1IZ0A 1M2VB 3ECCA 4KE9A 4OM7A 1T6YA 3A6ZA 4XWAA 3ZZUA 1BWSA 4LF5B 3JCZA 2DWCA 3GRRA 3OWXA 4H35A 4MYCA 4D9NA 4CEIB 2Y1LA 3P1JA 5AUNB 3AJ9A 1JB1A 1LNQA 3OH8A 1IUPA 4Q02A 4J7UA 2IGTA 2DTDA 3OT1A 2WQZA 3BWYA 4FGWA 6ADHA 1LPSA 2HBRA 2I65A 2HA7A 4RZSA 4YH1A 1JEQB 5CDGA 4ZQHA 3ZBUA 5HIMA 3VO8A 2BGJA 1OXMA 1YRHA 1YVUA 3GRYA 3NAQA 3OCYA 5JZOA 5K0SA 2C9DA 2ANCA 3FA2A 4GKBA 1TOAA 1Y3BE 3V1UA 3C16C 3PSAA 4WESB 3SE7A 5BT8A 5BPFA 2IBMA 3OUZA 4DV2B 2HL6A 4MKFA 1UIMA 2ZRPA 2IE8A 4QUIA 1XZHA 3LCVB 2PMCA 4QX6A 3V4VB 2NXEA 2VDQB 4C1NA 5L7TA 2BGNA 2ZBRA 2JRLA 3E9MA 1NJGA 3HMQA 3BGIA 2G5GX 3BERA 4JLBA 2ONJA 5E6UB 4L3OA 2C92A 4V0ME 1Z6PA 1PGOA 1XLWA 2R1VA 1NVKA 4TKMA 2IYTA 3D43A 5I9NA 1T1GA 2CF6A 2JJ2A 3NRCA 4O2BB 3V1YA 4XEHA 4BWFB 3PQDA 3VR2D 2Q9CA 3GJ7A 1U2DC 4V02A 1FX0B 2Y2VA 4O4IB 1NYRA 2BTOA 4Q9AA 4ENVA 1Y1KE 1G8SA 3DT8A 2V9ZA 2YZGA 2K6GA 2JI4A 1P62B 2VYQA 4RHUA 3PDUA 4HGYA 5JJCA 2ZYGA 2E21A 5G1PA 4BMPB 3WNDA 1QE3A 4MV4A 3GEPA 1XWIA 1GHTA 4WSOA 1D2RA 5IJ0A 1W2HA 5IWAB 4EZIA 3DXZA 1JJAA 2J5KA 2VT7A 4R9UC 4FC6A 2QE7A 4FX2A 1ZJWA 4D43A 1KI8A 4I4NA 4E2FA 4PAOA 4HDCA 3OTHA 3QKRB 1C81A 4LRYA 4PQEA 1JDVA 2FEOA 2OKGA 4URFA 2EJCA 1NXPA 4RS3A 4YHBA 2E5WA 1KIFA 3KJHA 3SXJA 5HKKA 2M6LA 1KS9A 2WOOA 2R48A 3H5IA 4JP3A 1E2PA 2BSXA 5LC1A 2FU5C 1DC8A 2JS7A 3FNBA 2QOEA 1XVUA 2ORWA 3EC7A 1QZTA 1TZMA 3GEDA 3AVTA 3D6JA 3NUZA 2EATA 3SF0A 1DUIA 3ZKWA 3AHFA 4BRUA 4GDFA 4AYTA 5DGHA 4IGIA 4PQGA 5CIWA 2FR0A 1P1JA 3BZUA 3N74A 3A3PA 5LQUA 2BP7A 2XTNA 3K1JA 1FOEB 3GFPA 1E7QA 2OFPA 4ZAVA 4R3UC 5JD6A 2ABWA 1P75A 1WSWA 1KOGA 5FTNA 3LTEA 2O3JA 1JIQA 1M6VB 1ULHA 2AR9A 4W6QA 4YDQA 5ECDA 4DMKA 2VAVA 2H4ZA 2WHPA 2XUAA 2WJGA 1G2PA 2FK8A 3QWIA 3O83A 1G8HA 2PZKA 4KQXA 1I0IA 3TTVA 3AZQA 2HPZA 3IGFA 4ROTA 1QP8A 4LBZA 1KDRA 2PN1A 2PSSA 3AGQA 1OXVA 1RBYA 1D2HA 3E9NA 4OLAA 1BXGB 4YXWD 1D4AA 3SSNA 3AETA 3JVIA 1VOTA 4RTOA 5KDOA 1T5DX 1BD3A 2RSLA 3SLGA 2GERA 2LRHA 3JWHA 4G0YA 4QXQA 4B3BA 4DJ5X 1WHSB 3UK2A 3SP1A 1GZDA 3C4JA 2A9RA 2VEOA 3NKLA 1KO5A 2I2BA 2F64A 1Z26A 3R5TA 3KTDA 1DKOA 4BGEA 1T15A 1T1EA 2VZ9A 4MICA 1A04A 3A9SA 4QEDA 2FWAA 4BGIA 2H1SA 3DMTA 2NUTA 2PUTA 3DDHA 4X8HA 1AHIA 3FYTA 5CVCA 2WWFA 4FDTA 1JWBB 4KGZA 4ZT4A 2G80A 4YXWA 3WGVA 2X5KO 5F4ZA 1T9GS 2JIBA 5DNYB 4U7GA 2C9ZA 2X42A 1BW9A 3BJEA 5A4JA 1QDEA 2GX6A 4UZFA 4DBZA 4C2AA 2DPLA 1TT7A 1OI2A 2B8WA 4K2HA 4OMCA 4R9VA 2BKVA 1QUFA 4HYTA 2O48X 1AY0A 3LLMA 1SHZA 2IF2A 1I2BA 4EPRA 2G08A 2YXNA 3ITEA 4FE7A 1QQ5A 3LT4A 5GONA 3DE3X 4DV5B 3FB1A 2Z3ZA 1H2AS 2B1IA 4Q7LA 3TTXA 1R37A 4D8VA 3OIFA 1ZAYA 2B1QA 2HSEA 1T2DA 2WVJA 2IVFA 3MT8A 1XMOB 2DBZA 3VSEA 1AZSC 2BI4A 1K9SA 1WZNA 2EFYA 3M6IA 1O7JA 4WUVA 4D1YA 4YT2A 5AM3A 3OI7A 5BQXA 2WD7B 1OUMA 4PO3X 3B1ZA 3TZCA 1SC9A 3MFYA 3ZV6A 4ZVQA 3MTJA 3QE3A 1R6BX 2REQB 4M0DA 1HC7A 1JI3A 3CG4A 3FNHA 4KWTA 1W87A 2OECA 4LZJA 3VNBA 3NV7A 3NONA 4I4TA 2JW5A 1OH8A 4KXMA 2IS2A 3PHIA 4C04A 4YRCA 5MFZA 1FRZA 1V48A 3GYGA 3NHKA 3ZJ5A 1T4BA 4I1IA 4MS3A 2ADFA 1E7RA 1O5TA 4IIVA 3U1BA 2I99A 2RHMA 4A92A 3SC6A 3R3HA 4MVXA 1B3BA 5FAKA 1OA0A 5B7PA 4RW0A 4ZQBA 2JGJA 4XVRA 1FBTA 3GFBA 4FMPA 4AU1A 3E23A 3GUCA 4NOLA 3D8RA 3OQJA 3PQ2A 3DE1X 4S24A 2QZ4A 3H1EA 1HYBA 3L84A 4GR5A 2QW8A 4TMVA 1T0PA 3RFXA 2VT2A 3IUBA 3KZCA 2OFWA 1L5KA 4F72A 4WZBA 1Y8RB 2C3OA 2JGIA 1OBFO 1X7DA 3TIIA 4EY8A 4MCJA 2GK6A 3UAGA 5CBPA 5IS2A 1O94D 1U3VA 5JR3A 4YMUA 1NZJA 1TK2A 1JKIA 1C3LA 2FVYA 3QHPA 4KUHA 5I48A 2FUNB 3OZAA 4IH9A 4OFWA 4JLDA 4OLJA 2PKCA 3IIIA 1T2UA 2FG6C 1E32A 2GT1A 4WZAB 1Z37A 3I6QA 5G4KB 3TAHA 1R5JA 5J58A 5KMGA 3A58B 1AMNA 1GDHA 2NACA 1ZD8A 1YB2A 3EDMA 4R5HA 1G7CA 2PVPA 3NAGA 1SEVA 2PVSA 4NICA 5ERXA 2OPHA 1H3FA 1JIVA 3OC6A 4LX0A 5FD8A 2W6PA 4DLLA 5K6RA 3AVUA 1X92A 3PGKA 2CZQA 4EB6A 1HDCA 3B3AA 1HDEA 3SQOA 4JKYA 1GVNB 2IV2X 1YZ3A 2JD0A 3KVNA 3OFNA 4J7XA 3QI7A 4CKWB 5LZ8A 5B6IA 2JZOA 1YBHA 1DAHA 2GTIA 4X9XA 3WIVA 2UXBB 4OOFA 2BBTA 4TRNA 2J07A 2Q6OA 3MUEA 7MDHA 1S2IA 1G8YA 4MDEA 1WWKA 3C43A 5CX1A 4C01A 3F5DA 4WD3A 5SV2A 1XRLA 2Y1DA 4IDPA 2P9CA 4HVAA 4F97A 3KB6A 1PZGA 2C4TA 4RSHA 5K0NA 1ITZA 4HNSA 4UARA 3L5KA 3UGQA 1CS0B 1FW8A 1N0WA 2BKAA 1GRQA 2G09A 2ZVJA 4UHFA 3SZ3A 4CEJA 3AP2A 2Q5QA 3W6NA 4B8WA 1U7UA 2GF9A 5IYZA 1EVEA 2DZDA 1WSBA 2G6BA 2FQWA 3G2HA 2VI5A 2B37A 4G5SA 2MOKA 2ZI5A 4IMJB 4P82A 3RNLA 4E2YA 1NVTA 1MZPA 2C5FA 1GPNA 1LJLA 1V1RB 3VTZA 3VVCA 4AKGA 5NULA 2QUBA 3HDYA 4Q4JB 3RUAA 2ZGVA 1MQSA 4PY2A 5KTRA 4DARA 3ZCRA 3SYNA 1PS0A 4FYXA 1P45A 1IYZA 4K9PA 1ZGGA 3DCIA 4TLDA 4C0JA 2XCSB 5IFLA 1AH2A 3QBJA 4EJ0A 3DTVB 1U65A 4FBGA 2DG2A 5IVDA 3NHUA 1TVKB 1M2JA 3JQGB 4GOND 3DLPX 4NOKA 4E5VA 4EWLA 3SVLA 3AVOA 2RJ3A 1ZD2P 4OB7A 4CODB 4ENUA 4QBKA 5LSAA 2VO1A 3RYCB 4MLCA 2IY9A 5F77A 1P0QA 4MV8A 2DUWA 1QC5A 4AKHA 1YR2A 3QU7A 1RMTA 2KW5A 2P2CA 3Q3VA 2JI9A 4I50F 4Q9DA 2AMJA 2WTAA 1Z6YA 4JSYA 4QASA 1DC6A 2O9JA 2VSOA 2B5OA 1VDMA 2PFGA 3DYBA 4C3OB 2XADA 5G41A 4RK7A 5JSZA 2ORED 2CV1A 3FWHA 2FSVC 3L1KA 1ZL0A 2PCJA 3B70A 3WDSA 2E1RA 4YA6A 4EELA 4L6IA 4AAYA 4KZPA 4KJXA 1NDQA 4AZ0B 3RO7A 1XDGA 2J45A 5JXJA 4FI3C 3WQRA 3L6EA 1Q14A 1JHZA 3I9MA 3OEEA 3E03A 5H7XA 3MCTA 3P9PA 4RPLA 1XVTA 3BWEA 4EG0A 3W34A 3AHJA 3Q9LA 4WN9B 2ZTVA 2JA1A 4BMCA 2XMCA 3HJRA 2JCSA 3FDZB 1SAYA 3EG9B 3IALA 3E9YA 3I5MA 1KK0A 5CT6A 1N4AA 1JA9A 4Y2GA 4IFEA 1A0OA 3UCEA 4BMSA 3M70A 5GQSA 3G2PA 3S28A 3EVGA 3LQ1A 5AKYA 4MRMA 3QWAA 4B48A 3CKLA 2J4CA 1WJGA 2YINC 3K09C 1TTHA 1IBLB 4F3YA 1L7QA 3HWRA 2G25A 2ST1A 5HMMA 3WZ2A 1T3ZA 4E70A 5LLTA 3LA6A 5FA6A 4BMNA 4BBAA 1GAXA 2C8LA 3LXXA 3LL4A 4MWOA 2ZZKA 1Y4DE 4FGSA 1PWYE 4ML3A 4O2RA 4I4CA 2V3WA 4RPHA 4FXOA 4YT8A 3FYCA 1T10A 4JXZA 1EM8B 4BC1A 3SS8A 5JNSA 4TKZA 5HF5A 4DADA 4Z54A 2H2DA 4M1KA 2V3CC 2ZI3A 4JKIA 4M8SA 4Y30A 3WXBA 4C0WA 3PE6A 1CJKC 1BKSB 3D7NA 3IMEA 4PCUA 4RXUA 2Q5FA 5DN9A 1GZVA 1ZUNA 4BV8A 5IDXA 3VYWA 1N2GA 2GBIA 2P65A 3PPWA 4N39A 4OHZA 4TKLA 3AF6A 3AFHA 3H1BA 4ZQIA 4Y2XA 1QU3A 2HJHA 1KORA 4LOHA 2XGMA 2B3DA 3FB4A 4G86A 3LM8A 3T7AA 4RJJA 1K5DA 1RHKA 2GNAA 2WM9B 3PNBA 5GWXA 3NNDA 4MR7B 5T4EA 3RJZA 5IK2A 1CEYA 1WXGA 3HDGA 1XLTC 5DLQC 3GRUA 1OFHA 2RGRA 3B1WA 3OPNA 1QGED 1RC0A 1KQPA 1PEKE 5K3BA 5HF6A 3TG8A 3CZCA 4GZMA 2P69A 3HY4A 1JHUA 2M6SA 4CLOA 5I47A 1ZN8A 4TMKA 2HF7A 4WZAE 4JUFA 2DWPA 1ELOA 1UBSB 3UEOA 2VPWA 3DJFA 3VPSA 4G1MB 1KARA 3H5WA 4XM0A 4B35A 2OGWA 5IDYA 1KA9H 4IDQA 3AERA 3JYPA 2OHOA 4OVKA 3DWIA 4TTJA 5CVJA 2Q6VA 4QYMA 3R7WB 1G21B 3TLZA 1K27A 5DNWA 4LE2A 3PC3A 1F9EA 3ETHA 4G24A 5ADUS 4ZPXA 3U1VA 5EJ8A 3PNMA 4GHWA 3MN1A 3JD4A 4LHEA 4TZ0A 5LQAA 1KFKB 3NHWA 5I8WA 4INPA 3A4TA 3AC0A 3ZR4B 4B2YA 5DM70 2GDZA 5H1YA 4NI5A 1XTTA 2R2AA 3B6IA 5EWJA 5FNVF 4AMYA 5JXWA 1WL8A 4MR8A 3ORFA 1HI9A 4K9NA 3SR4A 1CQJA 2GD1O 4U6NA 4LYEA 1W4RA 2HLHA 5E7QA 1IJEA 3GJ4A 2YXEA 1UDAA 3LQKA 4CHGA 1JQLB 3CW2A 3ZE1B 1XF1A 1E77A 4G0QA 4GOLD 2CFSA 3E9DA 3KETA 1TUGA 4HMOA 4CMEC 3U4QA 2R1ZA 3ETNA 2NZXA 1SC3A 1OWOA 1H4QA 4AYXA 1ZIPA 2WQ7A 1P5HA 1OIXA 5JOQA 3SX0A 4OUKX 3PDJA 4P54A 2PKYX 3R9WA 2YYAA 1TI7A 4YCMA 4OBWA 5C80A 4BVFA 1GDDA 1P29A 4EI2A 1FXWF 1S9HA 2ZXFA 3HJUA 3RCBA 1XRPA 4WBNB 5EZYB 4L8WB 1WXEA 1Z0SA 1L4KA 1EQAA 3G9QA 4DWOA 4ZK6A 3T3MB 1JR3A 1YJBA 2UZIR 3WTCA 3UIEA 1V3TA 5AQEA 2B2CA 4FT4A 4K9RA 5CJJA 3GJZA 4YRTA 3A1WA 3A3OA 3PUKA 3ZX4A 1P81A 2VHQA 1CQXA 3AM3A 4D41A 1NM5C 1DBQA 1MG0A 1PJ2A 4R2JA 5KYGA 2X8BA 3OTQA 5GVRA 3HNOA 5CM8B 4RH0A 3TR0A 4HZIA 5LVAA 5CIYA 3DUFA 4YP9A 2VK1A 4EFDA 2PL9A 3BE6A 4Z8YA 1PV2A 2AI1A 5KTYA 1IN7A 4L5AA 1J5EB 4FX5A 2AG5A 1WZCA 3X1JA 5HZGA 4KCGA 4F6LA 2LVBA 1UKCA 1ZGHA 3AUKA 1KMHB 1XVVA 3I1FA 4TMZA 2I7CA 4TLAA 1FFAA 2FPGB 2XB6A 1OVGA 4EPVA 2ONCA 3RUPA 1B73A 4Z7JA 1CUFA 2VJOA 3IDSA 5LZ4A 2B25A 1R00A 3G9XA 4LTMA 4RS4A 5J1TB 2QRUA 3WRYA 4CMBA 5H9WA 2WK1A 5JG7A 4LY6A 3CSSA 5CFZA 2WHYA 3O26A 5LA6B 2BAGA 2YOHA 1GA6A 1VHDA 1E1RA 3BBPA 2XOXA 4G23A 4NYMR 5F21A 2PJUA 4ER5A 5DASA 2R1TA 4JASB 5EXSA 1JAXA 4LDJA 4PTYA 2NU6B 5K0BA 1NQAO 2WI8A 2FWBA 3E4CA 1QLJA 3IV9A 1V5IA 4KHZA 1GPWB 2OP0A 3WIBA 1JW9B 2C03A 4LE1A 2OHXA 4M1MA 4WA8A 4AXXA 1AQNA 2A6PA 4J0GA 3LT0A 1QTIA 3RSFA 3K3PA 1N32B 3GWGA 2OCIA 5HJ5A 3DP7A 4Q1AA 3RWOA 3BCRA 3D8BA 4IIXA 3FZGA 1FC0A 1E6WA 2H1WA 3OMXA 1N5KA 2AFHE 2EYQA 1K6JA 5BSRA 2QN6A 4PXSA 5DN6D 3CR3C 3N2YA 3DR5A 4UPDA 5FI1B 3D6FA 3P96A 2IYWA 3A1DA 3GGGA 2H2HA 4KN9S 3SHVA 1NQVA 1PT8A 5FLEX 2OBLA 1G3QA 4CRWB 3VRHA 1EFHA 1V2HE 4JJGA 2TRSB 5CMLA 1G5TA 2GEKA 3I5AA 2GHRA 3GHYA 2X4LA 5AJHA 4UTOA 4UNPA 4MRVA 3SEZA 3LT5A 2R44A 3T06B 1HETA 3JVVA 3N2EA 3QEOA 3C5HA 3CLTC 1H94A 3OX4A 3Q0EA 1I2ZA 4UDOA 2BFFA 3CSDA 2DWQA 1NOJA 4KFRA 4CKYA 4FFSA 4DIDA 4YCSA 2R8OA 4GXTA 4LZPA 3KTOA 3VJMA 10MHA 4OSOA 3E6AA 3RREA 3R75A 2QMUA 3EEIA 5COQA 3WKDA 3IMFA 2HGSA 3EIOA 3FSRA 4GYJA 2ZATA 1E1DA 4PSCA 3VR5D 1AQJA 1NT4A 1W0JD 3GXBA 3C85A 3A2LA 2ZQZA 3RSZA 4V39A 4DJTA 4MB0A 4RX1A 1PV1A 4DEVA 2A9OA 4EYKA 5JJLA 2QUZA 3BGVA 3R3SA 4PW0A 1SVUA 1G5QA 1W2WB 2XD4A 1ZOPA 1JNXX 3GNLA 3E1KA 2Q3FA 3KVRA 4L2IA 3ZY5A 4CZ2A 1DOHA 1ANKA 4UVDA 5JZ9A 1FTNA 1AGXA 1KZ7B 1TMYA 4ARCA 5EINA 2YWFA 3VR6H 3KNZA 4Q82A 1UKBA 4XH9B 5EMNA 2VUHB 3LX6A 3RADC 4P9NA 5GOTA 4EGFA 3C1TA 1H0SA 2AB0A 3D7SA 5EJ7A 1UZMA 4G5HA 2PZLA 2K7ZA 2BFAA 3FFWA 1U0FA 2NU9A 2C8JA 3M3PA 4COKA 4HDRA 1M1UA 2DSTA 4V24A 4B44A 2MR5A 1YZQA 4HFJA 3RJ9A 1XDUA 2I80A 3ELWA 5KYWA 2BF7A 4RPGA 4QUJA 1S7GA 4F92B 2GK7A 2X1MA 1EX6A 1GZHB 3GIDA 2C4HA 2ZRKA 3KQOA 1GARA 3PNQA 5KI6A 4MMYB 3CFYA 1F1BA 4IDHA 3GFGA 5FORA 3KLMX 1C8KA 1U6KA 1W5TA 4PWZA 1XRJA 2DPMA 1SCUA 1FLVA 3IERA 4PO8A 3ETLA 5JSYA 3WK6A 1AKMA 4GE3A 4RD2A 1O6FA 4FGJA 2ZAIA 1XJQA 1PVVA 1ZHOA 2GZ3A 1FW6A 1AC5A 3OPYB 3WWOA 1BOOA 4GZ3A 3AESB 3OA2A 4TKVA 4TV8F 5HOEA 1JHPA 2CSXA 3TTYA 3QTTA 1VXRA 2AQ8A 2NV0A 2W37A 1KH3A 4O63O 5EKDA 3C5VA 5BYJA 3W9UA 4GU5A 3ROQA 2D5BA 3C6XA 4KAJA 2IUTA 5LOVB 5HRUA 3PZBA 2OBBA 2P6NA 1RP7A 1ICEA 4OHRA 2FR1A 4R6XA 1S2MA 2HUNA 1K7CA 1SKUA 4WE3A 4JC5A 4B3SB 5EMMA 3DDUA 2F55A 1TAGA 5JU6A 1YD7A 1DARA 3N0VA 3OT5A 4MGZR 1RZ3A 4Q4AB 1A9YA 1TU0A 4MRAA 4TROA 4TS3A 1Z9BA 3OETA 1TK9A 4UBLA 3V32A 3WL6A 3TOSA 3ZXUB 1RABA 2YJGA 5AM2A 1JPJA 2DT8A 1DBSA 1V7PC 2P8JA 2WJ6A 1FUYB 4F86A 4IDAA 1WHTB 1QG6A 5J4LA 3GMTA 4JOSA 1QVAA 3I4FA 2VRWA 5TS2A 1XZJA 4GMHA 1USKA 2EP7A 3D9QX 3W5JA 2BBWA 2YHAA 3H8VA 5A2GA 2IZ1A 3HI4A 4JUAA 4KK3A 1J0DA 4C0XA 1P2FA 3IESA 3SZOA 1F5SA 4UHBA 1L4YA 1HDXA 1OVMA 1C9EA 3L6OO 1NW3A 1W9MA 4MW4A 1G5IA 3DCJA 3C41J 4HNHA 5AJWA 4O1HA 2W42A 2AXQA 1J90A 1C1XB 3K8ZA 1NXQA 2IKQA 1DIBA 1WZIA 3FCEA 3WRWA 1QR2A 2BDUA 1ENZA 4B3TB 3DZCA 1Y3HA 3T9DA 4RM3A 2A30A 3D54D 7ADHA 3URKA 2P9HA 4FYYA 4TQUS 1WQ4A 1MRZA 4X7BA 3SZMA 4WESA 2UKDA 4M3NA 5AK0A 1GKLA 2IUFA 4CLRB 1VA5A 2R7KA 1JHRA 3V2UA 4WLUA 2O54A 3UANA 2H4XA 2C42A 2C77A 5FPPA 4DA8A 3CVUA 4IH4A 4DUGD 4FDAA 1EVJA 3UAYA 4QIHA 3EPKA 3GLFE 1MV5A 3DHNA 4N82A 5LZ5A 2VDNB 2VWHA 3TUZC 3MCUA 4IZHA 4E7OA 2FFHA 2BI7A 5T6MA 2EYUA 1JDJA 3LBYA 4IQ4A 1Q3HA 1AOXA 4ASUD 2P5UA 2NTVA 2VBCA 3P19A 4GWKA 4O5OA 3G8BA 1ENYA 3AYXB 2A2ZA 5KYUB 2O8BA 2IQ5A 4URWR 5AI4A 3G3EA 3IBSA 3PWKA 3JVEA 2FPPB 1PBNA 1H9CA 3UOAB 1W36D 1H22A 5EP3A 4P92A 4YACA 1SCJA 1UXKA 4MQ5A 2O3RA 4TLBA 3A3YA 5TC4A 3ZHRA 4UM9D 4EKYA 4ARSA 2A0WA 2OILA 3CRW1 1FTQA 1KJWA 4J2OA 2JB9A 3D7MA 3N07A 4GQIA 1RHQA 2XUIA 1TW2A 2ONYA 2R1UA 3JR7A 3OD5A 4JBNA 3VA7A 1RCUA 3FYSA 1WCWA 1JILA 2WDPA 2GKOA 3C48A 4FUTA 5I7FA 1G3RA 1GEEA 3PQEA 2X9QA 4P84A 1WG8A 1Z15A 4GKVA 1WTAA 3TOXA 4EKNB 3J81A 4ENSA 1JR2A 4P7BA 4OF4A 2XYQA 2CXRA 4IYJA 5CLGA 1TM2A 3OLXA 5A4MS 4UUAA 1CRQA 4NDNE 1I3KA 3NASA 1UZNA 4IIJF 5KWIA 1OV4A 3Q98A 3RFFA 2OO7A 3NDJA 1ZQ1A 4MUKA 2P9JA 5DP1A 4MP6A 4ACBA 2IIBA 4B09A 4RDHA 2W6JA 1OBVA 1HEIA 1I0LA 2P9EA 2RJOA 4GX2A 4MQ4A 4QDXA 5ALRA 4NCAA 4AWBA 2WZDA 5D1NA 1VYVA 5A7HA 4MWGA 1DINA 3DDZX 1IBMB 3VR2A 2GLTA 2ETVA 4WCFC 1MABA 4M7PA 5FI0B 1CUGA 4P1ZA 5JLJA 3EJ6A 1E0SA 4A73A 3IPYA 1T34A 4EUEA 1NBWB 2GEVA 3AOEC 2G71A 5C3UA 1GQOA 2IU6A 2RGGA 5HWSA 1A9QA 2NQ2C 4L73A 4HD8A 3UJ8A 4X97A 2FMKA 4MUJA 3DVAA 3QEBZ 3RF7A 3HCPA 3ANMA 3UV6A 4MPRA 2HZ7A 3QA9A 5AW6A 1U8EA 2F43A 3EXF