1N9LA

Crystal structure of the phot-lov1 domain from chlamydomonas reinhardtii in the dark state.
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
109
structure length
109
Chain Sequence
GLRHTFVVADATLPDCPLVYASEGFYAMTGYGPDEVLGHNCRFLQGEGTDPKEVQKIRDAIKKGEACSVRLLNYRKDGTPFWNLLTVTPIKTPDGRVSKFVGVQVDVTS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structures and Molecular Mechanism of a Light-Induced Signaling Switch: The Phot-LOV1 Domain from Chlamydomonas reinhardtii
pubmed rcsb
source organism Chlamydomonas reinhardtii
molecule tags Electron transport
molecule keywords putative blue light receptor
total genus 30
structure length 109
sequence length 109
ec nomenclature
pdb deposition date 2002-11-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13426 PAS_9 PAS domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 1n9lA00
4BBTA 5I5LA 4E04A 1X0OA 3ICYA 3VOLA 3H82B 2VEAA 1OT6A 4PKYG 2WKQA 4EW7A 1XJ3A 4GS9A 2JHEA 4KUKA 1N9OA 3F1NB 4F3LB 2BASA 2WKRA 2PYRA 3LIEA 3NOPC 3P7NA 3LI8A 2L1MA 3D72A 2H28A 4WLAA 4DJ2A 4KUOA 5G4YA 4L9FA 4EXOA 5HDSA 1F9IA 4LRZE 3EEHA 4WF0A 1TS6A 5AVEA 3UB6A 2YKFA 4NXBA 4GS9B 4R38A 4BBUA 4M4XA 1BYWA 4HH2A 4R6LA 4GW9A 3UMDA 1XFQA 4EESA 1D06A 1N9LA 1S66L 3CAXA 4GCZA 4R70A 3B33A 4HP4A 5HWVA 3NOTC 4EERA 3HJIA 4I3JA 1LSVA 4JGOA 2P7JA 4LRYC 1T1AA 2D02A 2W0NA 4EEPA 3MJQA 2GJ3A 3A0VA 4EQ1A 1P0ZA 3G6OA 4LPZA 5DJTA 2V1BA 2JN7A 3LIBA 4B9OA 2V9AA 3ZQ5A 2VV6A 1JNUA 3PYPA 4HP9A 3NJAA 1GSXA 3E4OA 4K08A 1DP6A 4YWZA 1S67L 1T1CA 3OLOA 3F1PA 4GHIB 3C8CA 4LLOB 5KIZA 1OJ5A 2Z6CA 1V9ZA 3EWKA 1EW0A 2ZBBA 1S4SA 2PD7A 3LICA 2Z6DA 5F6AA 4RQ9A 1LL8A 2PYPA 2QKPA 3BY9A 1OTIA 3NOUC 5HD5A 1VB6A 2I9VA 3MFXA 2KX6A 4I5SA 2V1AA 3C2WA 5HWTA 1OTDA 5HZHA 1TS8A 4HOIA 2YKHA 4BBVA 4LRXC 1LT0A 3A0SA 3MQQA 4MN6A 3IBRA 3MQOA 3SW1A 1N9NA 1T1BA 3A0RA 3PHYA 3HJKA 1XJ2A 1G28A 3F1OA 2VV8A 4HH3A 4HIAA 4PKYA 3K3DA 1OTEA 2KDKA 2CMNA 4DJ3A 3MXQA 4EETB 4EEUA 1NWZA 3VE4A 3H7WB 2L4RA 5HDDA 4WN5A 4I39A 4KQDA 3H82A 2PR5A 3RH8B 5DKLA 3IS2A 1UWPX 3UE6A 1T18A 1DRMA 2V0UA 1S4RA 3CWFA 3CLOA 4HNBA 5IU1A 2HV1A 1LSXA 5HDCA 5A8BA 3H7WA 2PR6A 4NXEA 1S1YA 2OOLA 2PDRA 3LIDA 1OT9A 2VV7A 4I3AA 1F98A 4JGQA 4XT2B 3UB8A 5IS1A 5J4EA 5DKKA 3MR0A 1GSWA 5DJUA 5J7EA 1OTAA 3E4PA 3IS2B 2ZOIA 5EFWA 3LI9A 5AVFA 4HJ6A 3H9WA 3GECA 1Y28A 1LSWA 2QHKA 2QWSA 3BY8A 3LIFA 2B02A 4WL9A 3BWLA 5HD3A 1XJ6A 1TS0A 3E4QA 4L9GA 1D7EA 4H6JA 3UB9A 4L9EA 4JGPA 3LIAA 3F1NA 4R3AA 3K3CA 4F3LA 3VE3A 1WA9A 1GSVA 3NHQA 2PHYA 2D01A 4GHIA 4I3IA 3F1OB 4WUJA 5G4ZA 1KOUA 1MZUA 1XFNA 5TBMB 3UB7A 2QJ7A 5HSQA 1P97A 5F5YA 5F69A 4MN5A 2OWHA 2QJ5A 3ULFA 3RTYA 4HQAA 2R78A 4HHDA 2L0WA 1OJGA 2M1CA 4HY8A 4NXFA 1TS7A 2A24A 3F1PB 3LYXA 5J3WA 2EA9A 4JGRA 4NXGA 2VLGA 5F68A 2WKPA 1DP8A 4H6JB 5HWWA 2PD8A 1ODVA 1XJ4A 3KX0X 3GDIA 1S1ZA 1V9YA 1OTBA 1UGUA 2INWA 5TBMA 4XT2A 1UWNX 2A24B 2K7SA 2W27A 4HJ3A 1DP9A 3LUQA 4HI4A 1T19A 2J80A 4I38A 3FC7A 2ZOHA 3FG8A 2OWJA 3UMEA 3T50A 2V0WA 4HJ4A
chains in the Genus database with same CATH superfamily
3QNBA 5AQ9A 2WGWB 3LIEA 5E2EA 3WS1A 3EEHA 4R4RA 3IBJA 4HH2A 4K91A 1S6RA 3HUNA 4GDNA 4R70A 4JGOA 4HBUA 3SS5A 1ZHHB 1EROA 4S2JA 1S67L 4RVAA 4ME4A 1V9ZA 2ZQCA 1XP4A 2Z2LB 3AGEA 1ALQA 3C38A 5HD5A 1YMXA 2XD1A 3VP3A 4Y3IA 2DNSA 2XA7M 3O87A 4HOIA 4DKIA 5DTTA 2EX9A 2WGIA 3VOZA 3W4PA 3F1OA 3CPTA 1H5XA 2QYBA 1TEMA 5DF9A 3LO7A 1KE4A 4OKPA 4KQDA 1W7FA 5GHZA 4WMCD 2VKSA 1LHYA 4X6TA 5GLAA 3T4KA 1IELA 3FPWA 1LSWA 1YLYA 5CTNA 3E4QA 3K3CA 3HLWA 4OH0A 3UB7A 5HSQA 3W8KA 4F94A 4HY8A 2M1CA 5CEBA 4QPRA 5EVEA 2VLGA 3Q82A 2FFYA 1P9WA 1ODVA 1HZOA 3PBNA 4HJ3A 3CUEC 5L10A 5FAPA 4PMAA 2PAVP 2VZWA 1CJFA 1TDLA 3SS4A 4DE0A 1XJ3A 3CZDA 4E6XA 3PBSA 3NOPC 2GZAA 2Y4AA 4LV1A 2Q9MA 2YKFA 2JKRI 1BYWA 5FL3A 2Y59A 3MFDA 4ZTKA 1MKMA 1LI9A 3UPOA 5U47A 2P7JA 3QP2A 3G6OA 1LL9A 2HDRA 2ZL1A 3IHAA 3ZG7B 2VA0A 3T1QB 4QY5A 4K08A 3UPPA 3BRMA 4GHIB 2Z6DA 3WS4A 3O3VA 4LV0A 4CLCA 2H0YA 1YLJA 4LCLA 1DJCA 4LRXC 4YFMA 5JYOA 1XJ2A 3DTEA 5FASA 3OCNA 3IH8A 1W63Q 3HUOA 4FOFA 5DF7A 2PR5A 4L0LA 4X53A 3BQAA 2V20A 4WEJA 4JF6A 1T18A 3OCLA 3H7WA 4PM6A 5J4EA 5DKKA 4R4SA 5DJUA 3IS2B 3H9WA 1Y28A 3JPUA 5L07A 3I7JA 1BZAA 4X69A 4MN7A 3UY6A 1NXYA 4Y0UA 4OPRA 3AGDA 2JKFA 5HPIA 2R78A 3ITAA 2WKPA 3UN7A 1S1ZA 3QP5A 3T4TA 2JCHA 5FEGA 4HEFA 3KSGA 2Y8HA 4BBTA 3WRTA 5HPFA 2Z2MB 3MSHA 4F3LB 1YMSA 2J3TD 1TVFA 4DJ2A 4KUOA 4LRZE 1TS6A 4NXBA 4K0WA 4NKPA 4M4XA 2PU4A 4GW9A 2H0TA 5HWVA 1L0EA 3ZVTA 1GHMA 4WYYA 3LIBA 4N92A 1T1CA 3LY3A 3HLCA 4GKUA 2B95A 1LL8A 5BOHA 3CJMA 2QKPA 1PYYA 4KZ4A 1HD8A 3G31A 3WS2A 3S7PA 3DWZA 4LENA 1IFQA 4UHUA 1BTLA 5TGFA 4DRTA 1ES3A 3HCYA 3RXWA 4EUVA 3ZVWA 2W1TA 3NDGA 1LSXA 3A3FA 5A8BA 3SOIA 5AQ7A 3UDXA 1GSWA 3E4PA 3R7WA 3L9KA 1A0KA 2QWSA 3IT9A 3IF6B 5M18A 3ZDJA 5A93A 4L9EA 3VP0A 4FD8A 3DBAA 5EE8A 1PW1A 3VP4A 4UA9A 1OJGA 4JGRA 5HAPA 4RA7A 2O0YA 1XJ4A 1UGUA 3TSGA 4MCWA 1K0KA 1E3UD 4BLMA 1T19A 2WGVA 3FG8A 2I72A 2QZ6A 3SH7A 2OWJA 4YNRA 3FKVA 3CITA 4KQQA 2BASA 2PYRA 1F9IA 4WF0A 2ZQAA 5AVEA 2KOIA 3MZDA 2JKRM 2P04A 3SH8A 5CERA 3EQUA 2X71A 3VFHA 4EQ1A 4Q8IA 5DJTA 4B9OA 1FCMA 1YQSA 1GSXA 3KSHA 4YWZA 2JKTI 5KMWA 2IWBA 1FOFA 2X01A 1ONGA 4JF4A 4NG2A 3AGFA 3Q7ZA 1F2KA 3C5AA 3TOIA 3HL9A 3UE1A 3VFFA 1N9NA 1L0DA 3VSLA 3IXBA 4PKYA 1PZPA 2WYXA 3MXQA 3CMZA 3TE8A 4DN0A 3OPRA 4G3WA 4I39A 4K0XA 4P87A 1JTDA 3QHYA 2Y2JA 2ZMFA 2HV1A 4MDZA 4LGWA 4N9KA 4OOMA 4PM7A 3UB8A 1PIOA 3IWIA 3ZG5A 4KZ6A 4WUJA 3B42A 5EVIB 1ZG4A 2QJ5A 2WZZA 3OPHA 3BFFA 3BYDA 2W1RA 4S2PA 4IVIA 1NLZA 1SKOA 2PD8A 3KYQA 1OTBA 5FDHA 1IYOA 4OQGA 4Z1WA 3E2KA 4UQIM 3UE3A 4S2OA 3N7WA 5FA7A 3EGXC 2M7VA 1LI0A 3MKFA 4X56A 1TDGA 1CI9A 3TJZC 4GJ4A 4N9LA 4MBFA 1K25A 4EWFA 3O5YA 4NEED 3GSGA 2LB5A 2XFSA 3NOTC 2B18A 4LRYC 4P6ZM 3A3DA 4IUHA 1FSWA 3ZQ5A 1S0WA 4NK3A 5CGXA 4LLOB 5KIZA 2A3UA 1EW0A 2NUPC 3JVUA 2AVXA 3FZCA 1RGZA 1H8YA 2Y2GA 3FV7A 4OVDA 3NI9A 3IBRA 4KENB 1G28A 2EX8A 1XGIA 1JTGA 1XXMA 3PAEA 1F5MA 4BENA 1DJBA 2ZC3B 5KZHA 3IF6A 1OT9A 3ZG9B 5EM1A 4G3VA 4ZDXA 3JVVA 1XA7A 4M3KA 1MPLA 2V1ZA 4OQ0A 4F3LA 4R3AA 3Q7VB 1H8MA 1VEUA 2H5SA 4IBXA 4LFUA 2X02A 4WM9A 5FI7A 3LFVA 2OAQ1 2A24A 2WKIA 4C75A 3IWOA 1YLWA 3FKWA 3P98A 1IKGA 4Y15A 5CECA 4IVKA 2W27A 3BQ8A 3FC7A 1HLUP 2VEAA 4PKYG 5L09A 4GS9A 4MBHA 1N9OA 3F1NB 5EM0A 4DXCA 2EFUA 3LI8A 4X25A 4BD1A 1P9RA 4Y0OA 3D4FA 4BMWA 4WZ5A 2HF6A 1MWSA 1KDWA 3OBFA 3ITBA 3UMDA 1NY0A 1XFQA 5HARA 3GQZA 4GD8A 4E3MA 3PYPA 1OPXA 1FR6A 1TD5A 1OTIA 4C6YA 1RCJA 2V1AA 1BT5A 1YLPA 3G4PA 2UWXA 2DCFA 3IXDA 4U0TA 5F83A 3M6BA 5A90A 4YOFA 3C4OA 2Y55A 2Y2IA 4Q0HA 3FPVA 5DKLA 3SZTA 1FILA 4FSFA 5IHVA 4DE1A 1KGEA 2OV5A 3CPTB 3NBLA 3MR0A 5CGWA 2ZOIA 3LI9A 5HD3A 2XRNA 4D60A 2FH5A 1ES2A 4IJGA 1GSVA 2Y2KA 1MZUA 3KO6A 2ZQ9A 4X1MA 3PBOA 4S2IA 1HVBA 1YSPA 1H3QA 4Y7PA 3IXHA 4ZRRA 1BLSA 2HDSA 4P85A 3GDIA 1NZOA 4KQOA 4XT2A 1AXBA 3NY4A 2PBDP 3T50A 3T4SA 4HJ4A 1ES5A 4R3JA 2J3WA 1ZKJA 1SDNA 2EFXA 4KUKA 3D3OA 5FDSA 1KVLA 2WKHA 2H28A 1PWCA 2VX8A 3VP2A 4E3JA 3V3SA 3P01A 4FTXA 1CK3A 1Q2PA 1CEGA 4ETZA 4Z9QA 2VV6A 3G32A 4HP9A 5EUAA 3E4OA 4OLGA 3HLEA 3ZHHA 3F1PA 4KG5A 2H10A 5FQKA 1S4SA 1W8QA 3GTCA 3M2JA 4I5SA 5E2HA 5E2GA 2C6WB 5L2FA 5LBRA 2PBYA 1CEFA 4XUZA 5EVIA 4E3OA 4OOYA 3KYZA 1K38A 3MF0A 4HNBA 3CLOA 3ZNYA 2A49A 4ZJ2A 1Q2QA 3PAGA 2RCXA 3FYZA 3CI6A 4CPKA 3LR3A 3T12B 4DXBA 5HAIA 3VSKA 4KZBA 4ZBEA 3N6IA 3N8SA 4N1HA 1EWZA 1JWVA 1P97A 3GV9A 4ETXA 4KZ8A 5HX9A 2BTFP 1MWTA 3LYXA 3F1PB 2J9PA 2WGWA 3NC8A 2XH9A 5HAQA 5FAOA 4BL3A 1FCNA 3S7NA 1UWNX 2A24B 5F82A 4HI4A 1EI5A 1YLTA 2OLVA 2WKQA 4CQHA 4GZBA 4KG2A 3DW0A 4B4ZA 4EU0A 3D72A 3LY4A 3QNCA 3C30A 5G4YA 4DDYA 4GS9B 3BFCA 4BBUA 5DFXA 1K55A 2Y2HA 1K6SA 3IQAA 1PWGA 1J3WA 3ZGAB 5L8MA 3O86A 1K54A 5EOEA 5M1AA 2ZBBA 5FATA 4PM5A 4GNUA 5IT5A 4PPRA 3C7VA 4S2MA 5HFOA 3A3JA 3KYEA 1ONHA 2E8JA 2JKTM 1YM1A 3N8RA 4HH3A 5EVLA 2WK0A 4WN5A 4RYEA 3T4QA 3HLBA 4OOLA 3UE6A 5FI2A 1PNEA 3MQ0A 1S4RA 1STZA 3E2LA 4NXEA 2OOLA 1MKIA 3EEAA 4GN2A 1OTAA 4ARZB 3LIFA 4H6JA 3F1NA 5GLBA 2JKGA 1KOUA 5JYPA 2HDQA 1K57A 2GDNA 2XQZA 3GRJA 5F68A 1AWIA 3KX0X 3C4PA 1ACFA 5J8XA 3LUQA 5DVAA 2HJ9C 3U4LP 1FCOA 2V0WA 1IOUA 1X0OA 3H82B 4U0XA 5GHYA 3LR5A 3D9YA 3WRZA 2EX2A 2ZL1B 4GB7A 4FH4A 5CRFA 5TR7A 3MXRA 5CHUA 4EERA 1MC0A 2ZC6B 3RXXA 4Y0TA 1OJ5A 2PD7A 4IHQA 3NDEA 2DMWA 1MXOA 5I94A 2XDMA 2WKEA 4P6BA 2JE5A 1TS8A 1LT0A 2VGLM 2ZD8A 3SW1A 3HREA 2VV8A 1IYSA 1GA9A 5GL9A 2CMNA 2JBFA 3LEQA 2HP6A 1JVJA 1K56D 1ES4A 2ZJ9A 5EVIC 4EBPA 3W4QA 2P08A 5HDCA 4XT2B 3TW8A 4I3AA 3DTMA 3BWLA 1VHMA 3MBZA 4JGPA 2PRFA 2PHYA 5TBMB 4OP8A 4CLCD 1SCWA 5F5YA 2JC7A 4Y17A 2G2WA 5FSRA 4KZAA 1L3LA 2O99A 3BECA 3E98A 3IHBA 4E3LA 4R0QA 3B47A 5GLDA 4PM9A 4E04A 5F1GA 5EECA 5K5BA 1SKOB 1K4EA 4H8RA 4NETA 2W3GA 1KVMA 2RL3A 2ZQ8A 1N9LA 1MY8A 3CAXA 1YSQA 5D3OA 4I3JA 3V5MA 3QP1A 3LGOA 4ZJ1A 3NJAA 4EBLA 3OLOA 3LICA 1BULA 1W8YA 1M6KA 5MC7A 3ZNTA 1PZOA 2XK1A 3R7WB 4IUKA 4GD6A 4JXVA 2J7VA 5A91A 4OPYA 4IBRA 4QWOA 2ZM8A 1LL5A 2L4RA 3IF6C 5E43A 1GHPA 1GA0A 1PI4A 4UQIS 3UDFA 4AFIA 3IWQA 5EFWA 4QY6A 1MBLA 2QHKA 2B02A 4CLCC 3L7HA 1D7EA 5AJGA 5KSHA 1WA9A 4OONA 3F1OB 3WS0A 1NZUA 3OOVA 2IWCA 5I5LA 5KSCA 2L0WA 3G30A 3MMHA 2ZQ7A 1FR1A 2W3EA 3PBTA 3Q7VA 4UAAA 3BW6A 2CC1A 5FAQA 5DTSA 4GDBA 2ZOHA 1Z09A 2XLNA 1D1JA 2XSSA 1N9BA 4JXSA 2ZMVA 2FZ0A 1BLPA 2WAFA 4MEZA 3OZHA 3EOIA 1JWZA 1QMEA 3SS3A 4QD4A 1C3BA 4DF6A 2HDUA 1E25A 2QPNA 1W5DA 1I5QA 3B33A 1LSVA 4LPZA 3M2KA 1JNUA 3LCEA 2WADA 1SHVA 2Y2PA 4R1GA 4RQ9A 3BY9A 3NOUC 1Y4OA 4WZ5C 4QHCA 4ARZA 4HESA 5HZHA 3LR0A 4Y5FA 3BFGA 2Y79A 2HJEA 3UPNA 1SZVA 3BFDA 3A3EA 2BG1A 3ZG0A 5GHXA 3CUEA 1NWZA 2OSUA 5FQMA 2V2FF 4S2NC 3FWLA 4RX3A 4MBKA 5F1FA 1NJ4A 3CWFA 4A5RA 3OPPA 4EV4A 4GOGA 3VE4A 3NECA 2DRWA 3PXPA 4CLCB 4BWIA 1CQAA 1L2SA 3GECA 4WL9A 3QP4A 1SKFA 2XA7S 4MMNA 4JXGA 4L9GA 3ISGA 3LEZA 2Y91A 4DDSA 4BJPA 2J9OA 3G2ZA 2OWHA 1K56A 4HQAA 4NXFA 3EQVA 5J3WA 2EA9A 4Q0JA 1DY6A 4U3TA 1U60A 1V9YA 2ZC5B 3HLDA 2QMIA 1K54C 1YAXA 3R4KA 1DP9A 1FQGA 5AQBA 4E3KA 3UMEA 3PR6A 5AQAA 2O9CA 4O0PA 2WKRA 3P7NA 5EV0A 4WLAA 2GX5A 4ZAMA 4ID4A 4N1XA 1G6AA 1KE0A 1S66L 4UEYA 3RJUA 3S22A 2W0NA 3MJQA 2V1BA 2XD5A 2FFFB 5M19A 2HPBA 4EESA 1VB6A 3PBRA 1PWDA 3Q1FA 2BLSA 4XUXA 1KGFA 4JF5A 1VQQA 1G6OA 1OTDA 2ACGA 2ZC7A 4Y13A 4KQRA 3HJKA 1PFLA 4LV2A 4HIAA 2KDKA 3G35A 3CG5A 4EEUA 3UDIA 5DTKA 5CHJA 3BLMA 1OMEA 5HW3A 3CHWP 1E4DA 4BD0A 1BUEA 3DAVA 2EWWA 2PR6A 2PDRA 4JGQA 4OLDA 3ZFZA 2VGJA 1FSYA 4DE3A 3BJNA 4R3BA 1LLBA 1I2SA 2D01A 3VP1A 4S2KA 5CHMA 1L0FA 5FQQA 3ULFA 1NLYA 3JYIA 1TS7A 3Q07A 1N4OA 3A3IA 2E8IA 5GLCA 3KSFA 4OPQA 3HUMA 3V3RA 1DP8A 1YLZA 1NRJA 2C5WB 2W1TB 3BLSA 2PT7A 3QP6A 2GNXA 4O01A 4I38A 1O07A 1IYPA 4EQIA 3U2AA 3VOLA 1G5UA 1H8ZA 2JHEA 4CJNA 4OPZA 1L0GA 4PM8A 1G68A 4KZ5A 4KZ3A 4B4XA 3KSIA 2VGLS 3BM6A 1NYMA 1D06A 2XR0A 3O88A 4HP4A 2UV0E 2D02A 2EWVA 4FH2A 2GJ3A 5FQJA 4S2LA 3TRCA 2Z6CA 3T1RA 2PYPA 1GCEA 1KE3A 3HLFA 3VOYA 3MFXA 2HP5A 2KX6A 2Y2NA 3PTEA 1IKIA 4JXWA 5HWTA 4ZJ3A 4KZ9A 2R9XA 4B93A 2P9VA 3MQQA 5TFQA 2B5RA 2G2UA 4MN6A 3ZG8B 3IX8A 4E3IA 1ZC2A 1WYBA 1RP5A 3K3DA 4E3NA 3H82A 3NIAA 2V0UA 2ZQDA 4MLLA 3GVBA 2WUQA 4WEKA 3QP8A 1IYQA 1K55C 4PAUA 2Q9NA 2PU2A 3HLGA 3LIAA 1IEMA 3T4OA 3ZCZA 4GHIA 2VGKA 3MKEA 5F69A 5FI6A 3RTYA 2Y2QA 4NXGA 4CLCE 4H6JB 5EVID 3IX4A 3IF5A 3W4OA 4FCFA 2J80A 4EBNA 4HBTA 3G34A 4X1LA 2O9BA 4Q0IA 1PRQA 5E2FA 4EW7A 1OT6A 5HL6A 2W3FA 1VM1A 3VV4A 4QJGA 3P09A 4X55A 4KG6A 1GHIA 2IWDA 5FQ9A 3HVFA 4OQIA 5A92A 4GCZA 2Y2LA 3HJIA 1T1AA 4WBGA 4EUZA 3S7QA 4JLFA 2HGVA 4LCMA 2V9AA 3OC2A 1ZTUA 3Q81A 2ZLYA 3N8LA 2IA2A 2ZM2A 3S4XA 2HZ5A 2I9VA 4UA6A 3C2WA 1BLHA 3ZYTA 3TG9A 4BBVA 1MWRA 4LV3A 3A0RA 1Y54A 5CXWA 3LR4A 3B3XA 4DJ3A 4EETB 5HDDA 2W3HA 3BFEA 1H0MA 1FIKA 1ESIA 1DRMA 2EXBA 2V8FA 4KZ7A 1VETB 1F98A 5FQIA 3UE0A 1KDSA 1BLCA 1QMFA 1JWPA 4D2OA 2O9AA 2J3TC 2XF3A 3IX3A 1ZG6A 3RFBA 3V39A 4OP5A 3T1XA 2XGNA 5HWWA 3MZEA 4C3QA 5C5KA 2G7UA 5TBMA 4GLQA 4II7A 3HBRA 5DFYA 5HL1A 3ICYA 4E6WA 1K57C 2L1MA 1ERQA 1VEUB 1MWUA 2EXAA 4EXOA 1KGGA 3UB6A 4R38A 4OQHA 1XA1A 1XGJA 1K6RA 1CF0A 4JKTA 4WMCA 3G2YA 4EEPA 2WAEA 1PI5A 2HP9A 3GR2A 2R9WA 3SH9A 3WWXA 3T4LA 3C8CA 3S7OA 3EWKA 1YPRA 5F6AA 1J9MA 1RGYA 4ESPA 2P74A 5FEFA 2YKHA 1K4FA 3A0SA 2OAP1 3MQOA 4BL2A 4DMZA 3PHYA 4FUWA 4QU3A 1DJAA 1WE4A 1HTZA 1YKDA 3DTIA 4O8GA 1W79A 2XROA 3RH8B 1PW8A 2EX6A 5IS1A 3LIDA 2VV7A 2KLIA 3MZFA 5J7EA 1O7EA 5AVFA 2WZXA 4HJ6A 1BSGA 2NUTC 3BY8A 2ZC4B 4I3IA 4G3KA 3E0YA 1CI8A 4DE2A 1XKZA 4HHDA 3K2NA 2J8YA 4YINA 3NULA 1ERMA 4S2NA 2K7SA 2Y2MA 4WELA 2V8CA 1E3UA 1NRFA 3MXSA 3V50A 5G18A 4IEDA 2LB9A 4L9FA 2VJWA 5HDSA 1WYCA 3UNWA 4WZ4A 5DF8A 3BEBA 5CX7A 2XFTA 2P9VB 1I2WA 4R6LA 5CGSA 4UA7A 5EPHA 4P6ZS 4JBFA 2VK3A 4Y2FA 3V67A 4BQMA 3A0VA 1P0ZA 2K31A 3IH9A 3W2ZA 2JN7A 2ZM0A 4O7DA 1XX2A 1DP6A 3GMWA 3VMAA 3C7UA 2Y2OA 5EOOA 3NCKA 3N4IA 3PBQA 3EGDC 5TJJA 1M40A 1T1BA 3OPLA 3DTKA 2W3DA 3M6HA 1OTEA 2ZMAA 3H7WB 1ESUA 1VETA 1SDEA 3UB5P 2XEPA 3IS2A 2M7UA 1UWPX 4QB8A 5IU1A 1S1YA 5CEDA 4XXRA 4JPMA 4RX2A 3T1SA 1YT4A 4PHTA 4R23A 3S1YA 1NYYA 1XJ6A 1TS0A 3UB9A 1W63M 3VE3A 3UO9A 2MJ6A 3NHQA 2OLUA 5G4ZA 1XFNA 2QJ7A 1TF1A 4B88A 3MS6A 4MN5A 1Z6FA 1XPBA 3T4JA 5CTMA 3DWKA 3IXGA 2A2LA 3WS5A 2K2NA 2INWA 4MNRA 2Q0OA 4X68A 4P0MA
chains in the Genus database with same CATH topology
1IOUA 3U2AA 1X0OA 3VOLA 3H82B 2JHEA 3LIEA 3LR5A 3TJZC 4GJ4A 3EEHA 3KSIA 2VGLS 3IBJA 4HH2A 3O5YA 1D06A 4R70A 4NEED 4HP4A 2LB5A 3NOTC 4EERA 2B18A 4JGOA 4LRYC 1MC0A 2D02A 2EWVA 2GJ3A 4P6ZM 4IUHA 3ZQ5A 1ZHHB 1S67L 3TRCA 4LLOB 4ME4A 5KIZA 1OJ5A 2Z6CA 1V9ZA 1EW0A 2PD7A 2NUPC 4IHQA 3JVUA 2PYPA 3C38A 5HD5A 3MFXA 2DMWA 2KX6A 4Y3IA 2XA7M 5HWTA 1TS8A 4HOIA 4B93A 1LT0A 3MQQA 2VGLM 4MN6A 3IBRA 3SW1A 1G28A 3F1OA 2VV8A 2QYBA 5DF9A 3K3DA 2CMNA 4KQDA 3H82A 1F5MA 2VKSA 2V0UA 2P08A 5HDCA 4XT2B 3TW8A 1OT9A 4I3AA 4WEKA 4G3VA 3T4KA 3FPWA 1LSWA 4PAUA 3JVVA 3BWLA 1VHMA 3E4QA 4JGPA 3LIAA 4F3LA 4R3AA 3K3CA 3T4OA 4GHIA 2PHYA 5TBMB 3UB7A 1H8MA 5HSQA 4CLCD 5F69A 5F5YA 3RTYA 4HY8A 3LFVA 2M1CA 2OAQ1 2A24A 4QPRA 4NXGA 2VLGA 2O99A 4CLCE 1P9WA 4H6JB 1ODVA 3PBNA 4HJ3A 2W27A 3BQ8A 3E98A 3CUEC 2J80A 3FC7A 3B47A 2VZWA 2O9BA 4E04A 4Q0IA 2VEAA 1OT6A 4PKYG 5HL6A 4EW7A 2W3FA 1XJ3A 4GS9A 5K5BA 1N9OA 3F1NB 3PBSA 3NOPC 3VV4A 2GZAA 3LI8A 1P9RA 4BMWA 2W3GA 2HF6A 2YKFA 2JKRI 1BYWA 3OBFA 5FL3A 3UMDA 1XFQA 1N9LA 3CAXA 4GCZA 1YSQA 1MKMA 3HJIA 4I3JA 2P7JA 1T1AA 3S7QA 3G6OA 2HGVA 2V9AA 3PYPA 2VA0A 3NJAA 3OC2A 1ZTUA 4K08A 3OLOA 4GHIB 1OPXA 2IA2A 3LICA 2Z6DA 5MC7A 1TD5A 1OTIA 2I9VA 3R7WB 4IUKA 4CLCA 2V1AA 3C2WA 3ZYTA 4BBVA 4LRXC 3A0RA 1XJ2A 3OCNA 3LR4A 4YOFA 1W63Q 4FOFA 4DJ3A 4EETB 5HDDA 2L4RA 2W3HA 4Q0HA 2PR5A 4L0LA 3BQAA 3FPVA 5DKLA 4WEJA 1T18A 1DRMA 4FSFA 3OCLA 3H7WA 4UQIS 1F98A 5J4EA 5DKKA 3MR0A 5DJUA 4AFIA 3IS2B 2ZOIA 5EFWA 3LI9A 3H9WA 1Y28A 2QHKA 5HD3A 2B02A 2XRNA 4CLCC 2FH5A 1D7EA 4IJGA 5AJGA 4MN7A 2O9AA 1WA9A 5KSHA 1GSVA 2J3TC 3F1OB 1MZUA 3OOVA 3KO6A 5HPIA 3RFBA 3PBOA 5I5LA 2R78A 2L0WA 3MMHA 1YSPA 1H3QA 2WKPA 5HWWA 2W3EA 4ZRRA 3PBTA 3GDIA 5C5KA 1S1ZA 2G7UA 4KQOA 5TBMA 3BW6A 3T4TA 4XT2A 4GLQA 4II7A 2ZOHA 3KSGA 2XSSA 5DFYA 2ZMVA 4HJ4A 2Y8HA 3T4SA 2FZ0A 3T50A 4BBTA 3ICYA 5HPFA 2J3WA 4KUKA 3EOIA 4F3LB 3D3OA 2J3TD 2L1MA 2H28A 2VX8A 4DJ2A 4KUOA 4EXOA 4LRZE 1TS6A 3UB6A 4R38A 4NXBA 4NKPA 4M4XA 4GW9A 3B33A 5HWVA 3P01A 1LSVA 4EEPA 4ETZA 4LPZA 3LIBA 2VV6A 1JNUA 4HP9A 3E4OA 1T1CA 3T4LA 3F1PA 3C8CA 3S7OA 3EWKA 1S4SA 5F6AA 4RQ9A 1LL8A 2QKPA 3BY9A 3NOUC 4I5SA 4ARZA 5HZHA 3S7PA 2YKHA 3LR0A 3A0SA 2OAP1 3MQOA 4DMZA 4Y5FA 1IFQA 3PHYA 2Y79A 5LBRA 2HJEA 1YKDA 4O8GA 3CUEA 1NWZA 2XROA 3HCYA 3RH8B 3KYZA 3MF0A 4EUVA 3CWFA 4HNBA 3CLOA 2W1TA 1LSXA 5A8BA 3VE4A 5IS1A 3LIDA 2VV7A 2KLIA 5J7EA 1GSWA 3E4PA 3PXPA 5AVFA 3R7WA 4BWIA 4CLCB 2NUTC 3CI6A 3GECA 4HJ6A 3BY8A 2QWSA 4WL9A 3LR3A 2XA7S 4MMNA 4L9GA 4L9EA 4I3IA 4BJPA 4G3KA 3DBAA 1P97A 3E0YA 2OWHA 4ETXA 4HQAA 4NXFA 3EQVA 4HHDA 1OJGA 3K2NA 3LYXA 3F1PB 5J3WA 2EA9A 4Q0JA 4JGRA 2O0YA 1XJ4A 1V9YA 1UGUA 4MCWA 3R4KA 3S7NA 1YAXA 1UWNX 2A24B 2K7SA 1DP9A 4HI4A 4WELA 1T19A 3FG8A 2OWJA 3UMEA 3PR6A 2O9CA 4YNRA 4O0PA 2WKQA 3CITA 4CQHA 2BASA 2WKRA 2PYRA 3P7NA 4EU0A 3D72A 4WLAA 3C30A 5G4YA 2GX5A 2LB9A 4L9FA 2VJWA 5HDSA 1F9IA 4WF0A 5AVEA 2KOIA 4GS9B 4BBUA 5CX7A 4R6LA 5DFXA 2JKRM 2P04A 4P6ZS 1S66L 4UEYA 4Y2FA 3V67A 3EQUA 2W0NA 3MJQA 4EQ1A 3A0VA 1P0ZA 5DJTA 2K31A 3W2ZA 2V1BA 2JN7A 4B9OA 5L8MA 1GSXA 3KSHA 1DP6A 4YWZA 2JKTI 2ZBBA 4EESA 5IT5A 1VB6A 3PBRA 3PBQA 3EGDC 1G6OA 1OTDA 5TJJA 1N9NA 1T1BA 2JKTM 3HJKA 4HH3A 4HIAA 2W3DA 4PKYA 1OTEA 2KDKA 3MXQA 4EEUA 3TE8A 4DN0A 3H7WB 4G3WA 4WN5A 4I39A 3T4QA 3IS2A 4OOLA 1UWPX 2M7UA 3UE6A 3MQ0A 1S4RA 2EWWA 2ZMFA 2HV1A 5IU1A 1STZA 4MDZA 2PR6A 4NXEA 1S1YA 2OOLA 2PDRA 4OOMA 3UB8A 4JGQA 3EEAA 1OTAA 4ARZB 3LIFA 4PHTA 1XJ6A 1TS0A 3BJNA 4H6JA 3UB9A 3F1NA 1W63M 3VE3A 2MJ6A 3NHQA 4WUJA 2D01A 5G4ZA 1KOUA 1XFNA 3B42A 2QJ7A 1TF1A 4MN5A 2QJ5A 3ULFA 1NLYA 3T4JA 1TS7A 2W1RA 3KSFA 5F68A 1NLZA 1DP8A 1NRJA 2PD8A 2A2LA 3KX0X 3KYQA 2W1TB 2K2NA 1OTBA 2PT7A 2GNXA 2INWA 4O01A 4Z1WA 3LUQA 2HJ9C 4I38A 4UQIM 3UE3A 3EGXC 2M7VA 2V0WA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4BBT A;  5I5L A;  4E04 A;  1X0O A;  3ICY A;  3VOL A;  3H82 B;  2VEA A;  1OT6 A;  4PKY G;  2WKQ A;  4EW7 A;  1XJ3 A;  4GS9 A;  2JHE A;  4KUK A;  1N9O A;  3F1N B;  4F3L B;  2BAS A;  2WKR A;  2PYR A;  3LIE A;  3NOP C;  3P7N A;  3LI8 A;  2L1M A;  3D72 A;  2H28 A;  4WLA A;  4DJ2 A;  4KUO A;  5G4Y A;  4L9F A;  4EXO A;  5HDS A;  1F9I A;  4LRZ E;  3EEH A;  4WF0 A;  1TS6 A;  5AVE A;  3UB6 A;  2YKF A;  4NXB A;  4GS9 B;  4R38 A;  4BBU A;  4M4X A;  1BYW A;  4HH2 A;  4R6L A;  4GW9 A;  3UMD A;  1XFQ A;  4EES A;  1D06 A;  1N9L A;  1S66 L;  3CAX A;  4GCZ A;  4R70 A;  3B33 A;  4HP4 A;  5HWV A;  3NOT C;  4EER A;  3HJI A;  4I3J A;  1LSV A;  4JGO A;  2P7J A;  4LRY C;  1T1A A;  2D02 A;  2W0N A;  4EEP A;  3MJQ A;  2GJ3 A;  3A0V A;  4EQ1 A;  1P0Z A;  3G6O A;  4LPZ A;  5DJT A;  2V1B A;  2JN7 A;  3LIB A;  4B9O A;  2V9A A;  3ZQ5 A;  2VV6 A;  1JNU A;  3PYP A;  4HP9 A;  3NJA A;  1GSX A;  3E4O A;  4K08 A;  1DP6 A;  4YWZ A;  1S67 L;  1T1C A;  3OLO A;  3F1P A;  4GHI B;  3C8C A;  4LLO B;  5KIZ A;  1OJ5 A;  2Z6C A;  1V9Z A;  3EWK A;  1EW0 A;  2ZBB A;  1S4S A;  2PD7 A;  3LIC A;  2Z6D A;  5F6A A;  4RQ9 A;  1LL8 A;  2PYP A;  2QKP A;  3BY9 A;  1OTI A;  3NOU C;  5HD5 A;  1VB6 A;  2I9V A;  3MFX A;  2KX6 A;  4I5S A;  2V1A A;  3C2W A;  5HWT A;  1OTD A;  5HZH A;  1TS8 A;  4HOI A;  2YKH A;  4BBV A;  4LRX C;  1LT0 A;  3A0S A;  3MQQ A;  4MN6 A;  3IBR A;  3MQO A;  3SW1 A;  1N9N A;  1T1B A;  3A0R A;  3PHY A;  3HJK A;  1XJ2 A;  1G28 A;  3F1O A;  2VV8 A;  4HH3 A;  4HIA A;  4PKY A;  3K3D A;  1OTE A;  2KDK A;  2CMN A;  4DJ3 A;  3MXQ A;  4EET B;  4EEU A;  1NWZ A;  3VE4 A;  3H7W B;  2L4R A;  5HDD A;  4WN5 A;  4I39 A;  4KQD A;  3H82 A;  2PR5 A;  3RH8 B;  5DKL A;  3IS2 A;  1UWP X;  3UE6 A;  1T18 A;  1DRM A;  2V0U A;  1S4R A;  3CWF A;  3CLO A;  4HNB A;  5IU1 A;  2HV1 A;  1LSX A;  5HDC A;  5A8B A;  3H7W A;  2PR6 A;  4NXE A;  1S1Y A;  2OOL A;  2PDR A;  3LID A;  1OT9 A;  2VV7 A;  4I3A A;  1F98 A;  4JGQ A;  4XT2 B;  3UB8 A;  5IS1 A;  5J4E A;  5DKK A;  3MR0 A;  1GSW A;  5DJU A;  5J7E A;  1OTA A;  3E4P A;  3IS2 B;  2ZOI A;  5EFW A;  3LI9 A;  5AVF A;  4HJ6 A;  3H9W A;  3GEC A;  1Y28 A;  1LSW A;  2QHK A;  2QWS A;  3BY8 A;  3LIF A;  2B02 A;  4WL9 A;  3BWL A;  5HD3 A;  1XJ6 A;  1TS0 A;  3E4Q A;  4L9G A;  1D7E A;  4H6J A;  3UB9 A;  4L9E A;  4JGP A;  3LIA A;  3F1N A;  4R3A A;  3K3C A;  4F3L A;  3VE3 A;  1WA9 A;  1GSV A;  3NHQ A;  2PHY A;  2D01 A;  4GHI A;  4I3I A;  3F1O B;  4WUJ A;  5G4Z A;  1KOU A;  1MZU A;  1XFN A;  5TBM B;  3UB7 A;  2QJ7 A;  5HSQ A;  1P97 A;  5F5Y A;  5F69 A;  4MN5 A;  2OWH A;  2QJ5 A;  3ULF A;  3RTY A;  4HQA A;  2R78 A;  4HHD A;  2L0W A;  1OJG A;  2M1C A;  4HY8 A;  4NXF A;  1TS7 A;  2A24 A;  3F1P B;  3LYX A;  5J3W A;  2EA9 A;  4JGR A;  4NXG A;  2VLG A;  5F68 A;  2WKP A;  1DP8 A;  4H6J B;  5HWW A;  2PD8 A;  1ODV A;  1XJ4 A;  3KX0 X;  3GDI A;  1S1Z A;  1V9Y A;  1OTB A;  1UGU A;  2INW A;  5TBM A;  4XT2 A;  1UWN X;  2A24 B;  2K7S A;  2W27 A;  4HJ3 A;  1DP9 A;  3LUQ A;  4HI4 A;  1T19 A;  2J80 A;  4I38 A;  3FC7 A;  2ZOH A;  3FG8 A;  2OWJ A;  3UME A;  3T50 A;  2V0W A;  4HJ4 A; 
#chains in the Genus database with same CATH topology
 3QNB A;  5AQ9 A;  2WGW B;  3LIE A;  5E2E A;  3WS1 A;  3EEH A;  4R4R A;  3IBJ A;  4HH2 A;  4K91 A;  1S6R A;  3HUN A;  4GDN A;  4R70 A;  4JGO A;  4HBU A;  3SS5 A;  1ZHH B;  1ERO A;  4S2J A;  1S67 L;  4RVA A;  4ME4 A;  1V9Z A;  2ZQC A;  1XP4 A;  2Z2L B;  3AGE A;  1ALQ A;  3C38 A;  5HD5 A;  1YMX A;  2XD1 A;  3VP3 A;  4Y3I A;  2DNS A;  2XA7 M;  3O87 A;  4HOI A;  4DKI A;  5DTT A;  2EX9 A;  2WGI A;  3VOZ A;  3W4P A;  3F1O A;  3CPT A;  1H5X A;  2QYB A;  1TEM A;  5DF9 A;  3LO7 A;  1KE4 A;  4OKP A;  4KQD A;  1W7F A;  5GHZ A;  4WMC D;  2VKS A;  1LHY A;  4X6T A;  5GLA A;  3T4K A;  1IEL A;  3FPW A;  1LSW A;  1YLY A;  5CTN A;  3E4Q A;  3K3C A;  3HLW A;  4OH0 A;  3UB7 A;  5HSQ A;  3W8K A;  4F94 A;  4HY8 A;  2M1C A;  5CEB A;  4QPR A;  5EVE A;  2VLG A;  3Q82 A;  2FFY A;  1P9W A;  1ODV A;  1HZO A;  3PBN A;  4HJ3 A;  3CUE C;  5L10 A;  5FAP A;  4PMA A;  2PAV P;  2VZW A;  1CJF A;  1TDL A;  3SS4 A;  4DE0 A;  1XJ3 A;  3CZD A;  4E6X A;  3PBS A;  3NOP C;  2GZA A;  2Y4A A;  4LV1 A;  2Q9M A;  2YKF A;  2JKR I;  1BYW A;  5FL3 A;  2Y59 A;  3MFD A;  4ZTK A;  1MKM A;  1LI9 A;  3UPO A;  5U47 A;  2P7J A;  3QP2 A;  3G6O A;  1LL9 A;  2HDR A;  2ZL1 A;  3IHA A;  3ZG7 B;  2VA0 A;  3T1Q B;  4QY5 A;  4K08 A;  3UPP A;  3BRM A;  4GHI B;  2Z6D A;  3WS4 A;  3O3V A;  4LV0 A;  4CLC A;  2H0Y A;  1YLJ A;  4LCL A;  1DJC A;  4LRX C;  4YFM A;  5JYO A;  1XJ2 A;  3DTE A;  5FAS A;  3OCN A;  3IH8 A;  1W63 Q;  3HUO A;  4FOF A;  5DF7 A;  2PR5 A;  4L0L A;  4X53 A;  3BQA A;  2V20 A;  4WEJ A;  4JF6 A;  1T18 A;  3OCL A;  3H7W A;  4PM6 A;  5J4E A;  5DKK A;  4R4S A;  5DJU A;  3IS2 B;  3H9W A;  1Y28 A;  3JPU A;  5L07 A;  3I7J A;  1BZA A;  4X69 A;  4MN7 A;  3UY6 A;  1NXY A;  4Y0U A;  4OPR A;  3AGD A;  2JKF A;  5HPI A;  2R78 A;  3ITA A;  2WKP A;  3UN7 A;  1S1Z A;  3QP5 A;  3T4T A;  2JCH A;  5FEG A;  4HEF A;  3KSG A;  2Y8H A;  4BBT A;  3WRT A;  5HPF A;  2Z2M B;  3MSH A;  4F3L B;  1YMS A;  2J3T D;  1TVF A;  4DJ2 A;  4KUO A;  4LRZ E;  1TS6 A;  4NXB A;  4K0W A;  4NKP A;  4M4X A;  2PU4 A;  4GW9 A;  2H0T A;  5HWV A;  1L0E A;  3ZVT A;  1GHM A;  4WYY A;  3LIB A;  4N92 A;  1T1C A;  3LY3 A;  3HLC A;  4GKU A;  2B95 A;  1LL8 A;  5BOH A;  3CJM A;  2QKP A;  1PYY A;  4KZ4 A;  1HD8 A;  3G31 A;  3WS2 A;  3S7P A;  3DWZ A;  4LEN A;  1IFQ A;  4UHU A;  1BTL A;  5TGF A;  4DRT A;  1ES3 A;  3HCY A;  3RXW A;  4EUV A;  3ZVW A;  2W1T A;  3NDG A;  1LSX A;  3A3F A;  5A8B A;  3SOI A;  5AQ7 A;  3UDX A;  1GSW A;  3E4P A;  3R7W A;  3L9K A;  1A0K A;  2QWS A;  3IT9 A;  3IF6 B;  5M18 A;  3ZDJ A;  5A93 A;  4L9E A;  3VP0 A;  4FD8 A;  3DBA A;  5EE8 A;  1PW1 A;  3VP4 A;  4UA9 A;  1OJG A;  4JGR A;  5HAP A;  4RA7 A;  2O0Y A;  1XJ4 A;  1UGU A;  3TSG A;  4MCW A;  1K0K A;  1E3U D;  4BLM A;  1T19 A;  2WGV A;  3FG8 A;  2I72 A;  2QZ6 A;  3SH7 A;  2OWJ A;  4YNR A;  3FKV A;  3CIT A;  4KQQ A;  2BAS A;  2PYR A;  1F9I A;  4WF0 A;  2ZQA A;  5AVE A;  2KOI A;  3MZD A;  2JKR M;  2P04 A;  3SH8 A;  5CER A;  3EQU A;  2X71 A;  3VFH A;  4EQ1 A;  4Q8I A;  5DJT A;  4B9O A;  1FCM A;  1YQS A;  1GSX A;  3KSH A;  4YWZ A;  2JKT I;  5KMW A;  2IWB A;  1FOF A;  2X01 A;  1ONG A;  4JF4 A;  4NG2 A;  3AGF A;  3Q7Z A;  1F2K A;  3C5A A;  3TOI A;  3HL9 A;  3UE1 A;  3VFF A;  1N9N A;  1L0D A;  3VSL A;  3IXB A;  4PKY A;  1PZP A;  2WYX A;  3MXQ A;  3CMZ A;  3TE8 A;  4DN0 A;  3OPR A;  4G3W A;  4I39 A;  4K0X A;  4P87 A;  1JTD A;  3QHY A;  2Y2J A;  2ZMF A;  2HV1 A;  4MDZ A;  4LGW A;  4N9K A;  4OOM A;  4PM7 A;  3UB8 A;  1PIO A;  3IWI A;  3ZG5 A;  4KZ6 A;  4WUJ A;  3B42 A;  5EVI B;  1ZG4 A;  2QJ5 A;  2WZZ A;  3OPH A;  3BFF A;  3BYD A;  2W1R A;  4S2P A;  4IVI A;  1NLZ A;  1SKO A;  2PD8 A;  3KYQ A;  1OTB A;  5FDH A;  1IYO A;  4OQG A;  4Z1W A;  3E2K A;  4UQI M;  3UE3 A;  4S2O A;  3N7W A;  5FA7 A;  3EGX C;  2M7V A;  1LI0 A;  3MKF A;  4X56 A;  1TDG A;  1CI9 A;  3TJZ C;  4GJ4 A;  4N9L A;  4MBF A;  1K25 A;  4EWF A;  3O5Y A;  4NEE D;  3GSG A;  2LB5 A;  2XFS A;  3NOT C;  2B18 A;  4LRY C;  4P6Z M;  3A3D A;  4IUH A;  1FSW A;  3ZQ5 A;  1S0W A;  4NK3 A;  5CGX A;  4LLO B;  5KIZ A;  2A3U A;  1EW0 A;  2NUP C;  3JVU A;  2AVX A;  3FZC A;  1RGZ A;  1H8Y A;  2Y2G A;  3FV7 A;  4OVD A;  3NI9 A;  3IBR A;  4KEN B;  1G28 A;  2EX8 A;  1XGI A;  1JTG A;  1XXM A;  3PAE A;  1F5M A;  4BEN A;  1DJB A;  2ZC3 B;  5KZH A;  3IF6 A;  1OT9 A;  3ZG9 B;  5EM1 A;  4G3V A;  4ZDX A;  3JVV A;  1XA7 A;  4M3K A;  1MPL A;  2V1Z A;  4OQ0 A;  4F3L A;  4R3A A;  3Q7V B;  1H8M A;  1VEU A;  2H5S A;  4IBX A;  4LFU A;  2X02 A;  4WM9 A;  5FI7 A;  3LFV A;  2OAQ 1;  2A24 A;  2WKI A;  4C75 A;  3IWO A;  1YLW A;  3FKW A;  3P98 A;  1IKG A;  4Y15 A;  5CEC A;  4IVK A;  2W27 A;  3BQ8 A;  3FC7 A;  1HLU P;  2VEA A;  4PKY G;  5L09 A;  4GS9 A;  4MBH A;  1N9O A;  3F1N B;  5EM0 A;  4DXC A;  2EFU A;  3LI8 A;  4X25 A;  4BD1 A;  1P9R A;  4Y0O A;  3D4F A;  4BMW A;  4WZ5 A;  2HF6 A;  1MWS A;  1KDW A;  3OBF A;  3ITB A;  3UMD A;  1NY0 A;  1XFQ A;  5HAR A;  3GQZ A;  4GD8 A;  4E3M A;  3PYP A;  1OPX A;  1FR6 A;  1TD5 A;  1OTI A;  4C6Y A;  1RCJ A;  2V1A A;  1BT5 A;  1YLP A;  3G4P A;  2UWX A;  2DCF A;  3IXD A;  4U0T A;  5F83 A;  3M6B A;  5A90 A;  4YOF A;  3C4O A;  2Y55 A;  2Y2I A;  4Q0H A;  3FPV A;  5DKL A;  3SZT A;  1FIL A;  4FSF A;  5IHV A;  4DE1 A;  1KGE A;  2OV5 A;  3CPT B;  3NBL A;  3MR0 A;  5CGW A;  2ZOI A;  3LI9 A;  5HD3 A;  2XRN A;  4D60 A;  2FH5 A;  1ES2 A;  4IJG A;  1GSV A;  2Y2K A;  1MZU A;  3KO6 A;  2ZQ9 A;  4X1M A;  3PBO A;  4S2I A;  1HVB A;  1YSP A;  1H3Q A;  4Y7P A;  3IXH A;  4ZRR A;  1BLS A;  2HDS A;  4P85 A;  3GDI A;  1NZO A;  4KQO A;  4XT2 A;  1AXB A;  3NY4 A;  2PBD P;  3T50 A;  3T4S A;  4HJ4 A;  1ES5 A;  4R3J A;  2J3W A;  1ZKJ A;  1SDN A;  2EFX A;  4KUK A;  3D3O A;  5FDS A;  1KVL A;  2WKH A;  2H28 A;  1PWC A;  2VX8 A;  3VP2 A;  4E3J A;  3V3S A;  3P01 A;  4FTX A;  1CK3 A;  1Q2P A;  1CEG A;  4ETZ A;  4Z9Q A;  2VV6 A;  3G32 A;  4HP9 A;  5EUA A;  3E4O A;  4OLG A;  3HLE A;  3ZHH A;  3F1P A;  4KG5 A;  2H10 A;  5FQK A;  1S4S A;  1W8Q A;  3GTC A;  3M2J A;  4I5S A;  5E2H A;  5E2G A;  2C6W B;  5L2F A;  5LBR A;  2PBY A;  1CEF A;  4XUZ A;  5EVI A;  4E3O A;  4OOY A;  3KYZ A;  1K38 A;  3MF0 A;  4HNB A;  3CLO A;  3ZNY A;  2A49 A;  4ZJ2 A;  1Q2Q A;  3PAG A;  2RCX A;  3FYZ A;  3CI6 A;  4CPK A;  3LR3 A;  3T12 B;  4DXB A;  5HAI A;  3VSK A;  4KZB A;  4ZBE A;  3N6I A;  3N8S A;  4N1H A;  1EWZ A;  1JWV A;  1P97 A;  3GV9 A;  4ETX A;  4KZ8 A;  5HX9 A;  2BTF P;  1MWT A;  3LYX A;  3F1P B;  2J9P A;  2WGW A;  3NC8 A;  2XH9 A;  5HAQ A;  5FAO A;  4BL3 A;  1FCN A;  3S7N A;  1UWN X;  2A24 B;  5F82 A;  4HI4 A;  1EI5 A;  1YLT A;  2OLV A;  2WKQ A;  4CQH A;  4GZB A;  4KG2 A;  3DW0 A;  4B4Z A;  4EU0 A;  3D72 A;  3LY4 A;  3QNC A;  3C30 A;  5G4Y A;  4DDY A;  4GS9 B;  3BFC A;  4BBU A;  5DFX A;  1K55 A;  2Y2H A;  1K6S A;  3IQA A;  1PWG A;  1J3W A;  3ZGA B;  5L8M A;  3O86 A;  1K54 A;  5EOE A;  5M1A A;  2ZBB A;  5FAT A;  4PM5 A;  4GNU A;  5IT5 A;  4PPR A;  3C7V A;  4S2M A;  5HFO A;  3A3J A;  3KYE A;  1ONH A;  2E8J A;  2JKT M;  1YM1 A;  3N8R A;  4HH3 A;  5EVL A;  2WK0 A;  4WN5 A;  4RYE A;  3T4Q A;  3HLB A;  4OOL A;  3UE6 A;  5FI2 A;  1PNE A;  3MQ0 A;  1S4R A;  1STZ A;  3E2L A;  4NXE A;  2OOL A;  1MKI A;  3EEA A;  4GN2 A;  1OTA A;  4ARZ B;  3LIF A;  4H6J A;  3F1N A;  5GLB A;  2JKG A;  1KOU A;  5JYP A;  2HDQ A;  1K57 A;  2GDN A;  2XQZ A;  3GRJ A;  5F68 A;  1AWI A;  3KX0 X;  3C4P A;  1ACF A;  5J8X A;  3LUQ A;  5DVA A;  2HJ9 C;  3U4L P;  1FCO A;  2V0W A;  1IOU A;  1X0O A;  3H82 B;  4U0X A;  5GHY A;  3LR5 A;  3D9Y A;  3WRZ A;  2EX2 A;  2ZL1 B;  4GB7 A;  4FH4 A;  5CRF A;  5TR7 A;  3MXR A;  5CHU A;  4EER A;  1MC0 A;  2ZC6 B;  3RXX A;  4Y0T A;  1OJ5 A;  2PD7 A;  4IHQ A;  3NDE A;  2DMW A;  1MXO A;  5I94 A;  2XDM A;  2WKE A;  4P6B A;  2JE5 A;  1TS8 A;  1LT0 A;  2VGL M;  2ZD8 A;  3SW1 A;  3HRE A;  2VV8 A;  1IYS A;  1GA9 A;  5GL9 A;  2CMN A;  2JBF A;  3LEQ A;  2HP6 A;  1JVJ A;  1K56 D;  1ES4 A;  2ZJ9 A;  5EVI C;  4EBP A;  3W4Q A;  2P08 A;  5HDC A;  4XT2 B;  3TW8 A;  4I3A A;  3DTM A;  3BWL A;  1VHM A;  3MBZ A;  4JGP A;  2PRF A;  2PHY A;  5TBM B;  4OP8 A;  4CLC D;  1SCW A;  5F5Y A;  2JC7 A;  4Y17 A;  2G2W A;  5FSR A;  4KZA A;  1L3L A;  2O99 A;  3BEC A;  3E98 A;  3IHB A;  4E3L A;  4R0Q A;  3B47 A;  5GLD A;  4PM9 A;  4E04 A;  5F1G A;  5EEC A;  5K5B A;  1SKO B;  1K4E A;  4H8R A;  4NET A;  2W3G A;  1KVM A;  2RL3 A;  2ZQ8 A;  1N9L A;  1MY8 A;  3CAX A;  1YSQ A;  5D3O A;  4I3J A;  3V5M A;  3QP1 A;  3LGO A;  4ZJ1 A;  3NJA A;  4EBL A;  3OLO A;  3LIC A;  1BUL A;  1W8Y A;  1M6K A;  5MC7 A;  3ZNT A;  1PZO A;  2XK1 A;  3R7W B;  4IUK A;  4GD6 A;  4JXV A;  2J7V A;  5A91 A;  4OPY A;  4IBR A;  4QWO A;  2ZM8 A;  1LL5 A;  2L4R A;  3IF6 C;  5E43 A;  1GHP A;  1GA0 A;  1PI4 A;  4UQI S;  3UDF A;  4AFI A;  3IWQ A;  5EFW A;  4QY6 A;  1MBL A;  2QHK A;  2B02 A;  4CLC C;  3L7H A;  1D7E A;  5AJG A;  5KSH A;  1WA9 A;  4OON A;  3F1O B;  3WS0 A;  1NZU A;  3OOV A;  2IWC A;  5I5L A;  5KSC A;  2L0W A;  3G30 A;  3MMH A;  2ZQ7 A;  1FR1 A;  2W3E A;  3PBT A;  3Q7V A;  4UAA A;  3BW6 A;  2CC1 A;  5FAQ A;  5DTS A;  4GDB A;  2ZOH A;  1Z09 A;  2XLN A;  1D1J A;  2XSS A;  1N9B A;  4JXS A;  2ZMV A;  2FZ0 A;  1BLP A;  2WAF A;  4MEZ A;  3OZH A;  3EOI A;  1JWZ A;  1QME A;  3SS3 A;  4QD4 A;  1C3B A;  4DF6 A;  2HDU A;  1E25 A;  2QPN A;  1W5D A;  1I5Q A;  3B33 A;  1LSV A;  4LPZ A;  3M2K A;  1JNU A;  3LCE A;  2WAD A;  1SHV A;  2Y2P A;  4R1G A;  4RQ9 A;  3BY9 A;  3NOU C;  1Y4O A;  4WZ5 C;  4QHC A;  4ARZ A;  4HES A;  5HZH A;  3LR0 A;  4Y5F A;  3BFG A;  2Y79 A;  2HJE A;  3UPN A;  1SZV A;  3BFD A;  3A3E A;  2BG1 A;  3ZG0 A;  5GHX A;  3CUE A;  1NWZ A;  2OSU A;  5FQM A;  2V2F F;  4S2N C;  3FWL A;  4RX3 A;  4MBK A;  5F1F A;  1NJ4 A;  3CWF A;  4A5R A;  3OPP A;  4EV4 A;  4GOG A;  3VE4 A;  3NEC A;  2DRW A;  3PXP A;  4CLC B;  4BWI A;  1CQA A;  1L2S A;  3GEC A;  4WL9 A;  3QP4 A;  1SKF A;  2XA7 S;  4MMN A;  4JXG A;  4L9G A;  3ISG A;  3LEZ A;  2Y91 A;  4DDS A;  4BJP A;  2J9O A;  3G2Z A;  2OWH A;  1K56 A;  4HQA A;  4NXF A;  3EQV A;  5J3W A;  2EA9 A;  4Q0J A;  1DY6 A;  4U3T A;  1U60 A;  1V9Y A;  2ZC5 B;  3HLD A;  2QMI A;  1K54 C;  1YAX A;  3R4K A;  1DP9 A;  1FQG A;  5AQB A;  4E3K A;  3UME A;  3PR6 A;  5AQA A;  2O9C A;  4O0P A;  2WKR A;  3P7N A;  5EV0 A;  4WLA A;  2GX5 A;  4ZAM A;  4ID4 A;  4N1X A;  1G6A A;  1KE0 A;  1S66 L;  4UEY A;  3RJU A;  3S22 A;  2W0N A;  3MJQ A;  2V1B A;  2XD5 A;  2FFF B;  5M19 A;  2HPB A;  4EES A;  1VB6 A;  3PBR A;  1PWD A;  3Q1F A;  2BLS A;  4XUX A;  1KGF A;  4JF5 A;  1VQQ A;  1G6O A;  1OTD A;  2ACG A;  2ZC7 A;  4Y13 A;  4KQR A;  3HJK A;  1PFL A;  4LV2 A;  4HIA A;  2KDK A;  3G35 A;  3CG5 A;  4EEU A;  3UDI A;  5DTK A;  5CHJ A;  3BLM A;  1OME A;  5HW3 A;  3CHW P;  1E4D A;  4BD0 A;  1BUE A;  3DAV A;  2EWW A;  2PR6 A;  2PDR A;  4JGQ A;  4OLD A;  3ZFZ A;  2VGJ A;  1FSY A;  4DE3 A;  3BJN A;  4R3B A;  1LLB A;  1I2S A;  2D01 A;  3VP1 A;  4S2K A;  5CHM A;  1L0F A;  5FQQ A;  3ULF A;  1NLY A;  3JYI A;  1TS7 A;  3Q07 A;  1N4O A;  3A3I A;  2E8I A;  5GLC A;  3KSF A;  4OPQ A;  3HUM A;  3V3R A;  1DP8 A;  1YLZ A;  1NRJ A;  2C5W B;  2W1T B;  3BLS A;  2PT7 A;  3QP6 A;  2GNX A;  4O01 A;  4I38 A;  1O07 A;  1IYP A;  4EQI A;  3U2A A;  3VOL A;  1G5U A;  1H8Z A;  2JHE A;  4CJN A;  4OPZ A;  1L0G A;  4PM8 A;  1G68 A;  4KZ5 A;  4KZ3 A;  4B4X A;  3KSI A;  2VGL S;  3BM6 A;  1NYM A;  1D06 A;  2XR0 A;  3O88 A;  4HP4 A;  2UV0 E;  2D02 A;  2EWV A;  4FH2 A;  2GJ3 A;  5FQJ A;  4S2L A;  3TRC A;  2Z6C A;  3T1R A;  2PYP A;  1GCE A;  1KE3 A;  3HLF A;  3VOY A;  3MFX A;  2HP5 A;  2KX6 A;  2Y2N A;  3PTE A;  1IKI A;  4JXW A;  5HWT A;  4ZJ3 A;  4KZ9 A;  2R9X A;  4B93 A;  2P9V A;  3MQQ A;  5TFQ A;  2B5R A;  2G2U A;  4MN6 A;  3ZG8 B;  3IX8 A;  4E3I A;  1ZC2 A;  1WYB A;  1RP5 A;  3K3D A;  4E3N A;  3H82 A;  3NIA A;  2V0U A;  2ZQD A;  4MLL A;  3GVB A;  2WUQ A;  4WEK A;  3QP8 A;  1IYQ A;  1K55 C;  4PAU A;  2Q9N A;  2PU2 A;  3HLG A;  3LIA A;  1IEM A;  3T4O A;  3ZCZ A;  4GHI A;  2VGK A;  3MKE A;  5F69 A;  5FI6 A;  3RTY A;  2Y2Q A;  4NXG A;  4CLC E;  4H6J B;  5EVI D;  3IX4 A;  3IF5 A;  3W4O A;  4FCF A;  2J80 A;  4EBN A;  4HBT A;  3G34 A;  4X1L A;  2O9B A;  4Q0I A;  1PRQ A;  5E2F A;  4EW7 A;  1OT6 A;  5HL6 A;  2W3F A;  1VM1 A;  3VV4 A;  4QJG A;  3P09 A;  4X55 A;  4KG6 A;  1GHI A;  2IWD A;  5FQ9 A;  3HVF A;  4OQI A;  5A92 A;  4GCZ A;  2Y2L A;  3HJI A;  1T1A A;  4WBG A;  4EUZ A;  3S7Q A;  4JLF A;  2HGV A;  4LCM A;  2V9A A;  3OC2 A;  1ZTU A;  3Q81 A;  2ZLY A;  3N8L A;  2IA2 A;  2ZM2 A;  3S4X A;  2HZ5 A;  2I9V A;  4UA6 A;  3C2W A;  1BLH A;  3ZYT A;  3TG9 A;  4BBV A;  1MWR A;  4LV3 A;  3A0R A;  1Y54 A;  5CXW A;  3LR4 A;  3B3X A;  4DJ3 A;  4EET B;  5HDD A;  2W3H A;  3BFE A;  1H0M A;  1FIK A;  1ESI A;  1DRM A;  2EXB A;  2V8F A;  4KZ7 A;  1VET B;  1F98 A;  5FQI A;  3UE0 A;  1KDS A;  1BLC A;  1QMF A;  1JWP A;  4D2O A;  2O9A A;  2J3T C;  2XF3 A;  3IX3 A;  1ZG6 A;  3RFB A;  3V39 A;  4OP5 A;  3T1X A;  2XGN A;  5HWW A;  3MZE A;  4C3Q A;  5C5K A;  2G7U A;  5TBM A;  4GLQ A;  4II7 A;  3HBR A;  5DFY A;  5HL1 A;  3ICY A;  4E6W A;  1K57 C;  2L1M A;  1ERQ A;  1VEU B;  1MWU A;  2EXA A;  4EXO A;  1KGG A;  3UB6 A;  4R38 A;  4OQH A;  1XA1 A;  1XGJ A;  1K6R A;  1CF0 A;  4JKT A;  4WMC A;  3G2Y A;  4EEP A;  2WAE A;  1PI5 A;  2HP9 A;  3GR2 A;  2R9W A;  3SH9 A;  3WWX A;  3T4L A;  3C8C A;  3S7O A;  3EWK A;  1YPR A;  5F6A A;  1J9M A;  1RGY A;  4ESP A;  2P74 A;  5FEF A;  2YKH A;  1K4F A;  3A0S A;  2OAP 1;  3MQO A;  4BL2 A;  4DMZ A;  3PHY A;  4FUW A;  4QU3 A;  1DJA A;  1WE4 A;  1HTZ A;  1YKD A;  3DTI A;  4O8G A;  1W79 A;  2XRO A;  3RH8 B;  1PW8 A;  2EX6 A;  5IS1 A;  3LID A;  2VV7 A;  2KLI A;  3MZF A;  5J7E A;  1O7E A;  5AVF A;  2WZX A;  4HJ6 A;  1BSG A;  2NUT C;  3BY8 A;  2ZC4 B;  4I3I A;  4G3K A;  3E0Y A;  1CI8 A;  4DE2 A;  1XKZ A;  4HHD A;  3K2N A;  2J8Y A;  4YIN A;  3NUL A;  1ERM A;  4S2N A;  2K7S A;  2Y2M A;  4WEL A;  2V8C A;  1E3U A;  1NRF A;  3MXS A;  3V50 A;  5G18 A;  4IED A;  2LB9 A;  4L9F A;  2VJW A;  5HDS A;  1WYC A;  3UNW A;  4WZ4 A;  5DF8 A;  3BEB A;  5CX7 A;  2XFT A;  2P9V B;  1I2W A;  4R6L A;  5CGS A;  4UA7 A;  5EPH A;  4P6Z S;  4JBF A;  2VK3 A;  4Y2F A;  3V67 A;  4BQM A;  3A0V A;  1P0Z A;  2K31 A;  3IH9 A;  3W2Z A;  2JN7 A;  2ZM0 A;  4O7D A;  1XX2 A;  1DP6 A;  3GMW A;  3VMA A;  3C7U A;  2Y2O A;  5EOO A;  3NCK A;  3N4I A;  3PBQ A;  3EGD C;  5TJJ A;  1M40 A;  1T1B A;  3OPL A;  3DTK A;  2W3D A;  3M6H A;  1OTE A;  2ZMA A;  3H7W B;  1ESU A;  1VET A;  1SDE A;  3UB5 P;  2XEP A;  3IS2 A;  2M7U A;  1UWP X;  4QB8 A;  5IU1 A;  1S1Y A;  5CED A;  4XXR A;  4JPM A;  4RX2 A;  3T1S A;  1YT4 A;  4PHT A;  4R23 A;  3S1Y A;  1NYY A;  1XJ6 A;  1TS0 A;  3UB9 A;  1W63 M;  3VE3 A;  3UO9 A;  2MJ6 A;  3NHQ A;  2OLU A;  5G4Z A;  1XFN A;  2QJ7 A;  1TF1 A;  4B88 A;  3MS6 A;  4MN5 A;  1Z6F A;  1XPB A;  3T4J A;  5CTM A;  3DWK A;  3IXG A;  2A2L A;  3WS5 A;  2K2N A;  2INW A;  4MNR A;  2Q0O A;  4X68 A;  4P0M A; 
#chains in the Genus database with same CATH homology
 1IOU A;  3U2A A;  1X0O A;  3VOL A;  3H82 B;  2JHE A;  3LIE A;  3LR5 A;  3TJZ C;  4GJ4 A;  3EEH A;  3KSI A;  2VGL S;  3IBJ A;  4HH2 A;  3O5Y A;  1D06 A;  4R70 A;  4NEE D;  4HP4 A;  2LB5 A;  3NOT C;  4EER A;  2B18 A;  4JGO A;  4LRY C;  1MC0 A;  2D02 A;  2EWV A;  2GJ3 A;  4P6Z M;  4IUH A;  3ZQ5 A;  1ZHH B;  1S67 L;  3TRC A;  4LLO B;  4ME4 A;  5KIZ A;  1OJ5 A;  2Z6C A;  1V9Z A;  1EW0 A;  2PD7 A;  2NUP C;  4IHQ A;  3JVU A;  2PYP A;  3C38 A;  5HD5 A;  3MFX A;  2DMW A;  2KX6 A;  4Y3I A;  2XA7 M;  5HWT A;  1TS8 A;  4HOI A;  4B93 A;  1LT0 A;  3MQQ A;  2VGL M;  4MN6 A;  3IBR A;  3SW1 A;  1G28 A;  3F1O A;  2VV8 A;  2QYB A;  5DF9 A;  3K3D A;  2CMN A;  4KQD A;  3H82 A;  1F5M A;  2VKS A;  2V0U A;  2P08 A;  5HDC A;  4XT2 B;  3TW8 A;  1OT9 A;  4I3A A;  4WEK A;  4G3V A;  3T4K A;  3FPW A;  1LSW A;  4PAU A;  3JVV A;  3BWL A;  1VHM A;  3E4Q A;  4JGP A;  3LIA A;  4F3L A;  4R3A A;  3K3C A;  3T4O A;  4GHI A;  2PHY A;  5TBM B;  3UB7 A;  1H8M A;  5HSQ A;  4CLC D;  5F69 A;  5F5Y A;  3RTY A;  4HY8 A;  3LFV A;  2M1C A;  2OAQ 1;  2A24 A;  4QPR A;  4NXG A;  2VLG A;  2O99 A;  4CLC E;  1P9W A;  4H6J B;  1ODV A;  3PBN A;  4HJ3 A;  2W27 A;  3BQ8 A;  3E98 A;  3CUE C;  2J80 A;  3FC7 A;  3B47 A;  2VZW A;  2O9B A;  4E04 A;  4Q0I A;  2VEA A;  1OT6 A;  4PKY G;  5HL6 A;  4EW7 A;  2W3F A;  1XJ3 A;  4GS9 A;  5K5B A;  1N9O A;  3F1N B;  3PBS A;  3NOP C;  3VV4 A;  2GZA A;  3LI8 A;  1P9R A;  4BMW A;  2W3G A;  2HF6 A;  2YKF A;  2JKR I;  1BYW A;  3OBF A;  5FL3 A;  3UMD A;  1XFQ A;  1N9L A;  3CAX A;  4GCZ A;  1YSQ A;  1MKM A;  3HJI A;  4I3J A;  2P7J A;  1T1A A;  3S7Q A;  3G6O A;  2HGV A;  2V9A A;  3PYP A;  2VA0 A;  3NJA A;  3OC2 A;  1ZTU A;  4K08 A;  3OLO A;  4GHI B;  1OPX A;  2IA2 A;  3LIC A;  2Z6D A;  5MC7 A;  1TD5 A;  1OTI A;  2I9V A;  3R7W B;  4IUK A;  4CLC A;  2V1A A;  3C2W A;  3ZYT A;  4BBV A;  4LRX C;  3A0R A;  1XJ2 A;  3OCN A;  3LR4 A;  4YOF A;  1W63 Q;  4FOF A;  4DJ3 A;  4EET B;  5HDD A;  2L4R A;  2W3H A;  4Q0H A;  2PR5 A;  4L0L A;  3BQA A;  3FPV A;  5DKL A;  4WEJ A;  1T18 A;  1DRM A;  4FSF A;  3OCL A;  3H7W A;  4UQI S;  1F98 A;  5J4E A;  5DKK A;  3MR0 A;  5DJU A;  4AFI A;  3IS2 B;  2ZOI A;  5EFW A;  3LI9 A;  3H9W A;  1Y28 A;  2QHK A;  5HD3 A;  2B02 A;  2XRN A;  4CLC C;  2FH5 A;  1D7E A;  4IJG A;  5AJG A;  4MN7 A;  2O9A A;  1WA9 A;  5KSH A;  1GSV A;  2J3T C;  3F1O B;  1MZU A;  3OOV A;  3KO6 A;  5HPI A;  3RFB A;  3PBO A;  5I5L A;  2R78 A;  2L0W A;  3MMH A;  1YSP A;  1H3Q A;  2WKP A;  5HWW A;  2W3E A;  4ZRR A;  3PBT A;  3GDI A;  5C5K A;  1S1Z A;  2G7U A;  4KQO A;  5TBM A;  3BW6 A;  3T4T A;  4XT2 A;  4GLQ A;  4II7 A;  2ZOH A;  3KSG A;  2XSS A;  5DFY A;  2ZMV A;  4HJ4 A;  2Y8H A;  3T4S A;  2FZ0 A;  3T50 A;  4BBT A;  3ICY A;  5HPF A;  2J3W A;  4KUK A;  3EOI A;  4F3L B;  3D3O A;  2J3T D;  2L1M A;  2H28 A;  2VX8 A;  4DJ2 A;  4KUO A;  4EXO A;  4LRZ E;  1TS6 A;  3UB6 A;  4R38 A;  4NXB A;  4NKP A;  4M4X A;  4GW9 A;  3B33 A;  5HWV A;  3P01 A;  1LSV A;  4EEP A;  4ETZ A;  4LPZ A;  3LIB A;  2VV6 A;  1JNU A;  4HP9 A;  3E4O A;  1T1C A;  3T4L A;  3F1P A;  3C8C A;  3S7O A;  3EWK A;  1S4S A;  5F6A A;  4RQ9 A;  1LL8 A;  2QKP A;  3BY9 A;  3NOU C;  4I5S A;  4ARZ A;  5HZH A;  3S7P A;  2YKH A;  3LR0 A;  3A0S A;  2OAP 1;  3MQO A;  4DMZ A;  4Y5F A;  1IFQ A;  3PHY A;  2Y79 A;  5LBR A;  2HJE A;  1YKD A;  4O8G A;  3CUE A;  1NWZ A;  2XRO A;  3HCY A;  3RH8 B;  3KYZ A;  3MF0 A;  4EUV A;  3CWF A;  4HNB A;  3CLO A;  2W1T A;  1LSX A;  5A8B A;  3VE4 A;  5IS1 A;  3LID A;  2VV7 A;  2KLI A;  5J7E A;  1GSW A;  3E4P A;  3PXP A;  5AVF A;  3R7W A;  4BWI A;  4CLC B;  2NUT C;  3CI6 A;  3GEC A;  4HJ6 A;  3BY8 A;  2QWS A;  4WL9 A;  3LR3 A;  2XA7 S;  4MMN A;  4L9G A;  4L9E A;  4I3I A;  4BJP A;  4G3K A;  3DBA A;  1P97 A;  3E0Y A;  2OWH A;  4ETX A;  4HQA A;  4NXF A;  3EQV A;  4HHD A;  1OJG A;  3K2N A;  3LYX A;  3F1P B;  5J3W A;  2EA9 A;  4Q0J A;  4JGR A;  2O0Y A;  1XJ4 A;  1V9Y A;  1UGU A;  4MCW A;  3R4K A;  3S7N A;  1YAX A;  1UWN X;  2A24 B;  2K7S A;  1DP9 A;  4HI4 A;  4WEL A;  1T19 A;  3FG8 A;  2OWJ A;  3UME A;  3PR6 A;  2O9C A;  4YNR A;  4O0P A;  2WKQ A;  3CIT A;  4CQH A;  2BAS A;  2WKR A;  2PYR A;  3P7N A;  4EU0 A;  3D72 A;  4WLA A;  3C30 A;  5G4Y A;  2GX5 A;  2LB9 A;  4L9F A;  2VJW A;  5HDS A;  1F9I A;  4WF0 A;  5AVE A;  2KOI A;  4GS9 B;  4BBU A;  5CX7 A;  4R6L A;  5DFX A;  2JKR M;  2P04 A;  4P6Z S;  1S66 L;  4UEY A;  4Y2F A;  3V67 A;  3EQU A;  2W0N A;  3MJQ A;  4EQ1 A;  3A0V A;  1P0Z A;  5DJT A;  2K31 A;  3W2Z A;  2V1B A;  2JN7 A;  4B9O A;  5L8M A;  1GSX A;  3KSH A;  1DP6 A;  4YWZ A;  2JKT I;  2ZBB A;  4EES A;  5IT5 A;  1VB6 A;  3PBR A;  3PBQ A;  3EGD C;  1G6O A;  1OTD A;  5TJJ A;  1N9N A;  1T1B A;  2JKT M;  3HJK A;  4HH3 A;  4HIA A;  2W3D A;  4PKY A;  1OTE A;  2KDK A;  3MXQ A;  4EEU A;  3TE8 A;  4DN0 A;  3H7W B;  4G3W A;  4WN5 A;  4I39 A;  3T4Q A;  3IS2 A;  4OOL A;  1UWP X;  2M7U A;  3UE6 A;  3MQ0 A;  1S4R A;  2EWW A;  2ZMF A;  2HV1 A;  5IU1 A;  1STZ A;  4MDZ A;  2PR6 A;  4NXE A;  1S1Y A;  2OOL A;  2PDR A;  4OOM A;  3UB8 A;  4JGQ A;  3EEA A;  1OTA A;  4ARZ B;  3LIF A;  4PHT A;  1XJ6 A;  1TS0 A;  3BJN A;  4H6J A;  3UB9 A;  3F1N A;  1W63 M;  3VE3 A;  2MJ6 A;  3NHQ A;  4WUJ A;  2D01 A;  5G4Z A;  1KOU A;  1XFN A;  3B42 A;  2QJ7 A;  1TF1 A;  4MN5 A;  2QJ5 A;  3ULF A;  1NLY A;  3T4J A;  1TS7 A;  2W1R A;  3KSF A;  5F68 A;  1NLZ A;  1DP8 A;  1NRJ A;  2PD8 A;  2A2L A;  3KX0 X;  3KYQ A;  2W1T B;  2K2N A;  1OTB A;  2PT7 A;  2GNX A;  2INW A;  4O01 A;  4Z1W A;  3LUQ A;  2HJ9 C;  4I38 A;  4UQI M;  3UE3 A;  3EGX C;  2M7V A;  2V0W A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...