1N9LA

Crystal structure of the phot-lov1 domain from chlamydomonas reinhardtii in the dark state.
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
109
structure length
109
Chain Sequence
GLRHTFVVADATLPDCPLVYASEGFYAMTGYGPDEVLGHNCRFLQGEGTDPKEVQKIRDAIKKGEACSVRLLNYRKDGTPFWNLLTVTPIKTPDGRVSKFVGVQVDVTS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structures and Molecular Mechanism of a Light-Induced Signaling Switch: The Phot-LOV1 Domain from Chlamydomonas reinhardtii
pubmed rcsb
source organism Chlamydomonas reinhardtii
molecule tags Electron transport
molecule keywords putative blue light receptor
total genus 30
structure length 109
sequence length 109
ec nomenclature
pdb deposition date 2002-11-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13426 PAS_9 PAS domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 1n9lA00
3P7NA 1V9YA 2W27A 4R38A 2BASA 3H9WA 1D06A 3MQQA 3NJAA 3CAXA 2OWHA 1OTDA 3ICYA 4JGPA 5HD5A 4NXEA 2QJ7A 2VLGA 4B9OA 5G4YA 2ZOHA 1TS6A 4WF0A 5HD3A 3LYXA 1S66L 3NOTC 1BYWA 1NWZA 3GDIA 3EWKA 3UB6A 3ZQ5A 1XJ6A 4WLAA 5HWTA 5TBMB 1UWNX 1XJ2A 4H6JB 4K08A 5AVFA 4NXGA 4GW9A 1V9ZA 3UB9A 4BBUA 2K7SA 4WN5A 4DJ2A 1T1CA 3IS2B 4EEPA 2B02A 3LI9A 4KQDA 4GHIB 3LIBA 3NHQA 2ZBBA 3HJIA 4KUKA 4LRZE 4R6LA 3UMDA 1T19A 4F3LB 4I38A 1Y28A 2J80A 2PDRA 4E04A 4HJ6A 5DJUA 2PD7A 1GSVA 5KIZA 1OJ5A 4M4XA 5F6AA 3LIAA 2H28A 2CMNA 2QHKA 4GCZA 4LRYC 1XFQA 3ULFA 4EQ1A 4PKYG 3UMEA 1OTEA 2PHYA 3CLOA 4BBTA 5HWVA 1T1AA 4EW7A 1JNUA 1LL8A 5HZHA 5J4EA 3B33A 1XJ4A 1TS8A 4JGOA 5HDSA 3SW1A 2D01A 1OT9A 1KOUA 2KDKA 3C2WA 1OTAA 3D72A 3E4OA 3MXQA 3OLOA 4HH2A 5AVEA 4F3LA 3BWLA 3HJKA 3G6OA 4L9GA 4DJ3A 3E4PA 2WKPA 2Z6CA 1S1YA 2YKFA 3MJQA 1TS0A 1LSXA 1EW0A 3K3DA 4XT2B 2L1MA 2VEAA 3LICA 2INWA 5DKLA 3UB8A 1UGUA 2OOLA 3F1PB 4BBVA 4EESA 3F1OB 4RQ9A 2PYPA 5DKKA 1DP6A 1XFNA 4JGRA 3IS2A 4L9EA 4PKYA 3UB7A 1OTIA 4HIAA 3UE6A 4HQAA 4HHDA 5J7EA 3LIEA 1DP8A 4HJ4A 1G28A 2QWSA 4EETB 2VV6A 4I39A 4MN6A 1XJ3A 3C8CA 1OT6A 1S4RA 3IBRA 1N9NA 2PR6A 4I5SA 5DJTA 3A0RA 3F1PA 4HI4A 3H7WA 1S4SA 3F1OA 1UWPX 4I3AA 3MR0A 1DRMA 3VOLA 5IS1A 2L4RA 2V9AA 2VV7A 2A24A 2PD8A 3GECA 5HDDA 3E4QA 3LIFA 5EFWA 2PR5A 1F98A 1ODVA 4GS9A 3LUQA 2PYRA 4HY8A 3MFXA 5HWWA 2M1CA 1LT0A 2GJ3A 5J3WA 3H7WB 1S1ZA 4XT2A 3A0VA 3VE3A 5IU1A 3F1NA 3FC7A 2W0NA 3KX0X 2L0WA 3EEHA 4LPZA 2JHEA 3H82B 3BY9A 1F9IA 1N9OA 4WUJA 2A24B 1D7EA 4I3JA 4LRXC 5A8BA 4EEUA 3CWFA 2EA9A 3PYPA 4HP4A 1LSWA 2V0WA 4NXFA 1X0OA 2ZOIA 5TBMA 1DP9A 3NOUC 4H6JA 3RH8B 4EXOA 4GS9B 2QJ5A 5G4ZA 2Z6DA 1P97A 2KX6A 1OJGA 2V0UA 3BY8A 3FG8A 3MQOA 4HNBA 4HOIA 2VV8A 4R3AA 1T18A 5F69A 2I9VA 2P7JA 4GHIA 3PHYA 4LLOB 3F1NB 1OTBA 4R70A 4I3IA 3H82A 3K3CA 2D02A 4KUOA 4HP9A 2V1AA 5F5YA 2V1BA 2HV1A 1GSXA 1N9LA 1TS7A 3LI8A 1LSVA 4WL9A 5I5LA 3T50A 2QKPA 4JGQA 4YWZA 2YKHA 4NXBA 1P0ZA 2OWJA 4L9FA 4MN5A 4HH3A 1GSWA 3VE4A 4EERA 2WKQA 4HJ3A 1S67L 1MZUA 2JN7A 5F68A 3RTYA 5HSQA 2R78A 1T1BA 1VB6A 3LIDA 3NOPC 5HDCA 2WKRA 1WA9A 3A0SA
chains in the Genus database with same CATH superfamily
3R7WA 4D2OA 3RJUA 3IHBA 5FI6A 4WF0A 4X25A 3PAGA 5HWTA 5FEFA 3QHYA 4II7A 3ZCZA 2B02A 4KUKA 2JBFA 4EWFA 1FOFA 4UHUA 1JTGA 1RP5A 4XUXA 4QU3A 3WRZA 5TFQA 2GX5A 1LL8A 2G7UA 1TS8A 1CEGA 3OPRA 4ZJ1A 1H3QA 1PWCA 5M1AA 4UAAA 1BUEA 4DXBA 1MKIA 1PWDA 4WMCA 1NY0A 4JXSA 2VEAA 1UGUA 2GZAA 3TJZC 2Q9MA 2WKIA 1GHIA 3C8CA 1N9NA 3HLFA 3DW0A 3A0RA 5FQJA 4EBNA 4WEJA 4P6ZM 3ITAA 2ZLYA 4Z9QA 2Y55A 3IBJA 2Y2LA 3GTCA 5HAQA 1W8QA 1ODVA 1YMXA 3OPHA 1PI4A 5HWWA 3F1NA 4NEED 4CPKA 3H82B 1F9IA 2A24B 2V1ZA 3QP1A 3TE8A 1NLZA 3EGDC 4EXOA 2Z6DA 4WBGA 2V0UA 4DE3A 1CQAA 1YLPA 2P7JA 2JKRI 3PAEA 3W8KA 4GD6A 5E2GA 4I3IA 5JYOA 2PBYA 3DAVA 1QMEA 3ZVTA 2EFUA 4KG6A 4NXBA 1G5UA 1LI0A 5EOOA 3NOPC 2XR0A 1DP8A 3H9WA 3T4OA 4S2IA 3S7QA 5DTSA 1MBLA 3GDIA 2Q0OA 1XJ6A 1V9ZA 4KZ6A 2W1RA 4DE1A 3S7NA 2XF3A 2IWCA 5CX7A 4F3LB 2EWVA 4S2NA 4IHQA 4EU0A 3P01A 4E6WA 3IWOA 5L2FA 3ULFA 3QNCA 3VP2A 5M18A 3B33A 1FSYA 5EVIC 4DJ3A 5FATA 2INWA 4ARZB 1STZA 3Q7ZA 3DTEA 1IFQA 2PYPA 3IWQA 1OTIA 4LFUA 4KQRA 1I2SA 2P04A 4I39A 4ZBEA 3IX3A 2Y2HA 4JPMA 4GD8A 2HPBA 2ZQAA 1SHVA 4OOLA 5K5BA 1LL5A 2O0YA 1F98A 3SZTA 1U60A 4UQIM 3MFXA 4UEYA 2Y2QA 4GKUA 3FC7A 5KSHA 2O99A 3PBNA 1X0OA 1P97A 4HNBA 2JC7A 4GB7A 4ETZA 5I94A 1KVLA 2FFFB 1XP4A 5A91A 2P74A 1JTDA 2V1AA 1GSXA 3T50A 1I5QA 4N1XA 1K54A 2YKHA 3D3OA 3A3JA 4LV1A 4ETXA 2HP6A 4QWOA 5AJGA 5KSCA 2H10A 3BLMA 2XA7S 3MQQA 1BTLA 5TR7A 4B9OA 3ZQ5A 1ZG4A 1FR6A 4A5RA 4MBHA 3TSGA 1YLYA 2ZBBA 2PRFA 4JXVA 3WRTA 3D4FA 5E2HA 1OMEA 4KENB 5F6AA 4M3KA 1XFQA 5EE8A 4PKYG 5EM1A 1FIKA 1VQQA 5CXWA 3T4JA 4JGOA 5HDSA 1FCNA 1KOUA 2W3GA 3ZNTA 4E3OA 4E3LA 3VFHA 5L10A 2K31A 1AWIA 5DKLA 3F1PB 3DBAA 3IS2A 3SH9A 4OPRA 3VMAA 2XD1A 4KZ9A 4N9KA 2V8CA 3KSHA 4I5SA 3VOYA 4OLGA 1UWPX 1ACFA 2VJWA 1EWZA 5EFWA 4R0QA 4CLCC 2XQZA 4ZJ3A 3HUMA 3MXRA 5EVEA 4G3WA 4Y0UA 3H7WB 4RVAA 4CLCD 3KX0X 4LPZA 1VETB 2JHEA 3T4TA 3ZG0A 1LSWA 3WS1A 3HCYA 1L2SA 1T18A 3SS4A 3G2YA 1KE3A 3P09A 4LENA 1TDLA 4GN2A 1LSVA 3G35A 5F82A 4YWZA 3ZYTA 2OV5A 4DDYA 1P9WA 4X55A 3W4QA 5HSQA 1O7EA 1T1BA 1K38A 3IWIA 2XA7M 5TGFA 3CAXA 3S7OA 2I72A 2OAP1 3PBTA 3TW8A 2X71A 1PZOA 5HAIA 4EUZA 1G6OA 3VSLA 4LRZE 1T19A 4NETA 1E25A 3G32A 2HDSA 4IBXA 1YPRA 3A3DA 2A3UA 5EVID 2C5WB 2PHYA 3GVBA 4S2JA 4EW7A 1FILA 5EPHA 5EECA 3LEQA 5HW3A 2WKPA 1Z6FA 4UQIS 2EX8A 2UV0E 3S7PA 4Q0HA 2WAFA 1XXMA 1ALQA 4NKPA 5HL6A 2V9AA 3L9KA 3NC8A 1E3UA 2MJ6A 4ZTKA 1MWRA 4G3KA 5J3WA 3PBOA 2W0NA 5F1FA 5GLCA 3MKFA 1NLYA 2WGWB 4Q0IA 4KQQA 1LLBA 1IYOA 2XEPA 1OTBA 3H82A 3E98A 2DCFA 3BM6A 3BQAA 2VK3A 3LR4A 1MC0A 3IF6A 4LCLA 2JN7A 1PI5A 5HDCA 3AGEA 1KDWA 2Y2OA 4Q8IA 3OC2A 4ID4A 3IXGA 1OTDA 2VLGA 3N8RA 5DF9A 1TS6A 1KGFA 2RCXA 5TBMB 5AVFA 1ESIA 2Y2PA 3A3IA 3Q81A 4GHIB 3HJIA 1CF0A 4B4ZA 4S2MA 1NZOA 4K91A 3BW6A 3IF5A 2XD5A 3ZHHA 2HDRA 3S1YA 1XA1A 4JF5A 1Y54A 4OOMA 1K57A 1LSXA 4XT2B 1YMSA 3CPTB 1ESUA 1LI9A 1D1JA 4HIAA 2XDMA 4HBUA 1S4RA 3UDIA 3V50A 3ZDJA 2X02A 1GCEA 4I3AA 3IF6B 3O5YA 3OZHA 1W5DA 2Y2IA 4B93A 2IA2A 3LUQA 2OLUA 1CJFA 1LT0A 1H0MA 4BBTA 2NUTC 4EEUA 3IX8A 5TBMA 3NOUC 2B18A 5KZHA 1IKGA 1K57C 3N8LA 4BWIA 1G68A 4O0PA 3N7WA 3HUNA 4KUOA 5A92A 4FOFA 3P98A 5I5LA 3VP1A 4KG5A 4ZDXA 3T1QB 3BLSA 3BQ8A 5J8XA 4JKTA 1S66L 2HF6A 4XUZA 5FSRA 2ZL1A 3C5AA 4R6LA 1K55A 1FCMA 1Q2PA 5KIZA 4QY6A 3OOVA 4LRYC 1BT5A 1GHMA 5E2FA 5CERA 1XJ4A 2GNXA 1CI8A 2KDKA 3C2WA 3T1SA 3HJKA 4PHTA 3G6OA 5F83A 5FQIA 3DWKA 3UNWA 2Z6CA 1S1YA 1YLJA 4R23A 4BBVA 1CEFA 1ONGA 2ZC4B 4JGRA 3S4XA 4PKYA 4X1MA 3LIEA 4EETB 2QWSA 3VP4A 5EOEA 1XJ3A 2H0TA 4O01A 1WYCA 5DJTA 5GLAA 3VV4A 5IS1A 3WS2A 3BJNA 1ZKJA 5GLDA 2HGVA 2GJ3A 2ZJ9A 1PNEA 1M6KA 4IUHA 2XFSA 1BLCA 2O9BA 3OPLA 2KOIA 1AXBA 4GDNA 3UE3A 4HOIA 1OJGA 3KYQA 4Y15A 5A93A 3AGFA 3T4LA 3PHYA 1VETA 3PBQA 5BOHA 2W3DA 4HP9A 3HL9A 4JGQA 4S2LA 5L8MA 4HH3A 1BULA 2WAEA 4HJ3A 3WS5A 1PWGA 3LEZA 2G2WA 2WKRA 4BJPA 3JPUA 4PMAA 5DFXA 4WYYA 4NXEA 5GHZA 2ZMAA 3NOTC 3L7HA 1SKOA 3DWZA 4X56A 4B88A 3UDFA 4KZ7A 5CGXA 2VGKA 2HP9A 1T1AA 4DKIA 2D01A 3MXQA 5AVEA 2Y91A 3ZG8B 4WEKA 1DJBA 1ES5A 3HLEA 3RXWA 3BRMA 4PPRA 4PM6A 4K0XA 4BD0A 2JKRM 2WGVA 4HJ4A 5CHMA 5CTNA 3T1XA 4YINA 3HLCA 4HI4A 3ZGAB 3RXXA 3E0YA 1ES4A 3LIFA 2PR5A 2PBDP 5HAPA 2M1CA 3LY4A 5DVAA 1N9OA 2VX8A 4BQMA 3ZFZA 1TF1A 4GS9B 3FG8A 5HX9A 3M6BA 2A49A 1SKOB 4R70A 2BG1A 4CLCB 3HBRA 4YFMA 1ERQA 4CQHA 4OOYA 4EERA 3ISGA 4U3TA 3HLDA 3KSGA 2HZ5A 3FPWA 5G4YA 1HLUP 2PU2A 1IYSA 1NXYA 1XJ2A 3FZCA 1W63M 3UB9A 4HESA 4WN5A 3DTIA 1SCWA 4KQDA 1K55C 3MZFA 3HREA 4MBKA 4E04A 1W79A 3CUEC 4S2OA 2J9OA 2Z2MB 5C5KA 2Y8HA 5JYPA 3ZG5A 3T4SA 3OLOA 2WZZA 1JWZA 1DJCA 1MWUA 3SS3A 2O9AA 1L0FA 1TS0A 3O86A 5IHVA 3BECA 4OP5A 2OOLA 2WYXA 3CI6A 4FSFA 2FZ0A 4DMZA 1MWTA 1Y4OA 3FYZA 1OT6A 3CPTA 3OBFA 4CJNA 2VKSA 4E3NA 1JVJA 4Y7PA 2A24A 1HVBA 3NECA 4JF4A 3NBLA 3B42A 2ACGA 4U0XA 3ZVWA 4JBFA 5FQQA 2WKEA 5DF7A 3VE3A 1ES2A 5FAOA 3PYPA 2EA9A 2EWWA 2JE5A 1SZVA 4YOFA 4B4XA 3Q82A 2OAQ1 4R3AA 2ZD8A 5FDHA 1LL9A 1PW8A 4WL9A 1TS7A 3NI9A 3G34A 3GV9A 1WA9A 3NULA 4FD8A 3ICYA 4ZRRA 3NY4A 1TEMA 3EWKA 3V5MA 5FI2A 1IELA 1HD8A 3TRCA 3G30A 4DF6A 1YSPA 4DXCA 2ZM0A 4Y2FA 3UMDA 4AFIA 1Q2QA 2J80A 4YNRA 4OPYA 4WELA 1XGJA 5FAPA 1OJ5A 2ZL1B 1EI5A 2QHKA 2Y79A 5L07A 3UMEA 3DTMA 4LGWA 3IX4A 1WE4A 1KE0A 1H8YA 3E4PA 3C30A 4DE0A 1G6AA 3K3DA 4MMNA 2FH5A 3IHAA 3MZDA 2X01A 4X69A 1VHMA 1XKZA 2ZC6B 3R4KA 4JLFA 2G2UA 5AQAA 4HQAA 4C75A 5EM0A 4UA6A 4MN6A 3C7UA 4MCWA 4DDSA 4Y13A 4E3JA 3QP6A 1TVFA 3AGDA 3F1OA 1DRMA 5HFOA 1ES3A 3GECA 1C3BA 1N9BA 4FH2A 2VGJA 3IXBA 2ZC5B 4KZ4A 1D7EA 3LR3A 2VGLS 1MXOA 2ZOIA 2W1TB 4OQHA 1K54C 5AQ9A 2P9VA 3C38A 1N9LA 3IH8A 4OONA 4EBLA 3VE4A 1JWPA 1NZUA 5FEGA 3O88A 4WUJA 3CWFA 3GR2A 3SH7A 2J3WA 2BASA 3BYDA 2OWHA 3EGXC 4JGPA 5CHUA 3MKEA 2WUQA 4E6XA 2Y59A 3IS2B 3LIBA 3NHQA 3PBRA 2OLVA 2PDRA 1GSVA 3CJMA 4Y0OA 3IT9A 2ZQ8A 3T4KA 1KE4A 3GSGA 3MJQA 2JKFA 1YQSA 3PTEA 3W4PA 4R4RA 2EX2A 2XGNA 5MC7A 3GRJA 1L0EA 4RQ9A 1K4FA 3LY3A 1XX2A 3NCKA 3BFGA 1J3WA 3EQVA 4HHDA 5CGSA 3V3SA 2EX9A 5CEBA 5IT5A 3KSIA 3QP4A 2FFYA 1NRJA 3H7WA 5A90A 5CTMA 1RGYA 3QP5A 3VOLA 3MS6A 3BEBA 3HVFA 2L4RA 3HLGA 4OPZA 1BSGA 3UPNA 5G18A 5HDDA 2B95A 3E4QA 1I2WA 4QPRA 3DTKA 4HEFA 3UE6A 1J9MA 4RA7A 4WZ5C 3N6IA 4HP4A 4KZ8A 1H8MA 3LCEA 4NG2A 3T12B 2QJ5A 4OH0A 3TOIA 3F1NB 3LFVA 2IWBA 3HUOA 2HV1A 5FI7A 4FH4A 4FUWA 5E43A 3BFEA 4GLQA 1ZG6A 3I7JA 3FV7A 4R38A 2Y2KA 1K0KA 2Y2GA 2J7VA 3LYXA 1BYWA 3Q7VA 4GNUA 1H8ZA 1BZAA 4NXGA 4RX3A 3IQAA 2Y2MA 5L09A 5DTTA 1W8YA 3KSFA 3KO6A 4LV3A 4M4XA 3LIAA 2H28A 5FL3A 4MN7A 3LR5A 2VA0A 4S2NC 4DRTA 3E4OA 4F3LA 4KZ5A 4Q0JA 4KZ3A 2J3TC 2W3FA 1ZC2A 1O07A 3UB8A 1RCJA 4EESA 4KZBA 1DP6A 2EXBA 2ZQ9A 1IOUA 4X6TA 5J7EA 1L0DA 1YKDA 3OCNA 2JKGA 3IBRA 3HLWA 2JKTM 4QB8A 4GOGA 1S4SA 2E8JA 4Y5FA 5FA7A 1TDGA 4BD1A 4RX2A 2J8YA 3NDEA 2PYRA 3TG9A 2Y4AA 2W3HA 2QMIA 4LCMA 3BY9A 4PM5A 4BL2A 3MF0A 1FCOA 2I9VA 3CHWP 4GHIA 3C4OA 4LLOB 4R3JA 4PAUA 4WZ5A 2EFXA 2PT7A 3EQUA 5FQ9A 4BLMA 3UO9A 3RTYA 3LO7A 2HJEA 5LBRA 4QY5A 4IEDA 4E3IA 4K0WA 4UA9A 2ZC3B 1NWZA 3V3RA 4PM9A 4GW9A 4PM8A 3UB5P 4IVIA 1YSQA 1SDNA 3PBSA 1XGIA 3PXPA 3A3EA 4S2KA 3S22A 1JWVA 4HJ6A 3SS5A 2CMNA 1JNUA 5J4EA 2V20A 3HLBA 3SW1A 3D72A 2WK0A 1IYPA 4G3VA 3C4PA 2DMWA 4Y3IA 4DE2A 3CITA 4QD4A 2Y2NA 4X1LA 3O3VA 4R1GA 2HDUA 5KMWA 1XFNA 2VGLM 3SOIA 1PRQA 1G28A 3WS4A 4WMCD 1VM1A 3F1PA 5CHJA 1IYQA 2OSUA 5HPIA 3MR0A 2UWXA 4P0MA 2IWDA 5DF8A 1VEUA 4KQOA 1SDEA 1FSWA 2DNSA 2AVXA 3B3XA 4L0LA 3VP3A 4QHCA 4LRXC 2V0WA 3RH8B 3BY8A 5HARA 4MBFA 2C6WB 4LV0A 2QPNA 4JF6A 3EOIA 3K3CA 1Z09A 3LI8A 4IVKA 1K6RA 4KZAA 1P0ZA 3MMHA 4U0TA 3MZEA 1S67L 1MZUA 3V67A 2R78A 4UA7A 3KYZA 2P9VB 5EVLA 4JXWA 3A0SA 3D9YA 2EXAA 2M7VA 1YM1A 3VP0A 3E2LA 5HD5A 2K2NA 2E8IA 4K08A 4BBUA 3M6HA 3UN7A 2PAVP 1T1CA 5HL1A 3UPOA 5FDSA 1YLWA 2BLSA 1ZHHB 5DJUA 5EV0A 1TD5A 3G2ZA 1W7FA 3SH8A 2ZMVA 4E3MA 2LB5A 1OTAA 3BWLA 4N1HA 1M40A 5GLBA 4CLCE 3OPPA 2V8FA 3UE0A 2RL3A 2H0YA 3QP2A 3BFCA 3N4IA 2B5RA 3BFDA 5EUAA 2M7UA 1EROA 2BTFP 1BLHA 2CC1A 1MY8A 3T4QA 4P6ZS 2H5SA 4FTXA 3UDXA 1SKFA 1K25A 2VV7A 4HBTA 2PD8A 1RGZA 3ITBA 1KVMA 4S2PA 3A0VA 4Y0TA 5IU1A 1KGEA 1GA0A 5A8BA 5HPFA 1K56D 3BFFA 1S0WA 4PM7A 5G4ZA 3FKVA 4IUKA 2VV8A 2KLIA 5F69A 4N9LA 1MWSA 1KGGA 5CRFA 2WGWA 2HDQA 2JKTI 1FQGA 2QKPA 1K4EA 2ZM2A 3N8SA 3QNBA 1GSWA 4NK3A 2VZWA 5F68A 1VB6A 3LIDA 1K56A 2W27A 4EV4A 3NJAA 1A0KA 5F1GA 5D3OA 1BLPA 4O7DA 1YLTA 4OVDA 1UWNX 4ME4A 4C3QA 1BLSA 2XH9A 5AQBA 3Q7VB 4R3BA 4X53A 4GCZA 4EQ1A 5GL9A 5E2EA 2JCHA 3CLOA 1OT9A 1PFLA 1IEMA 4H8RA 4GZBA 3G31A 3UY6A 4E3KA 1W63Q 2YKFA 1L3LA 3V39A 2Q9NA 3B47A 4DN0A 1DJAA 2WKHA 1YT4A 3T1RA 4P85A 5DKKA 4L9EA 4EBPA 1NYYA 1F5MA 2O9CA 3UPPA 4OQ0A 4CLCA 2R9XA 2XLNA 4QJGA 2HJ9C 4OPQA 4EQIA 3FPVA 2A2LA 4XXRA 4BL3A 1H5XA 4GS9A 4HY8A 4Y17A 4XT2A 2ZQ7A 1DY6A 4EUVA 1F2KA 3A3FA 2HP5A 3LR0A 3CZDA 2ZMFA 4OQGA 2V2FF 3K2NA 4X68A 3MSHA 5F5YA 3EEAA 1MKMA 2OWJA 3WWXA 4KG2A 1PW1A 2Y2JA 4D60A 2PU4A 3P7NA 1V9YA 2XRNA 3MBZA 1NJ4A 3O87A 3MQ0A 5HD3A 4LV2A 3NDGA 3VFFA 4H6JB 2K7SA 5AQ7A 4OKPA 4MLLA 4I38A 1ZTUA 3WS0A 3GQZA 2PD7A 1FR1A 3VSKA 1P9RA 3G4PA 1PYYA 1MPLA 3OCLA 5HWVA 4ARZA 4R4SA 1XA7A 3MFDA 4HH2A 1E4DA 4MNRA 3IH9A 4ZAMA 3NIAA 1EW0A 4IBRA 1GHPA 1YLZA 3CG5A 5EVIA 4JXGA 3U2AA 3ZNYA 5FQMA 1YAXA 4P87A 5U47A 4OQIA 2XSSA 1CI9A 2J3TD 4F94A 4RYEA 4OLDA 2W3EA 1KDSA 1S1ZA 4BMWA 2L0WA 1S6RA 3W4OA 1VEUB 4NXFA 5TJJA 4H6JA 1E3UD 3RFBA 2KX6A 3JVUA 1OPXA 3IF6C 1CK3A 4C6YA 3PR6A 2ZQCA 2XROA 4GJ4A 1NYMA 2D02A 5DTKA 2ZC7A 3M2JA 3LGOA 3JYIA 4MN5A 2XFTA 4MEZA 2QZ6A 3VOZA 1LHYA 4N92A 5DFYA 1D06A 2GDNA 4WM9A 3FWLA 2QJ7A 2NUPC 2ZOHA 3UB6A 2Z2LB 5EVIB 2ZM8A 5CGWA 3M2KA 4WLAA 1XPBA 3IXHA 4ZJ2A 4DJ2A 5FAQA 4EEPA 3LI9A 1PIOA 1L0GA 1Y28A 1NRFA 2ZQDA 1N4OA 1OTEA 2P08A 2WADA 5HZHA 5FQKA 3QP8A 2XK1A 3R7WB 4L9GA 2WGIA 4Z1WA 3UE1A 3CUEA 2L1MA 3C7VA 3LICA 2DRWA 3F1OB 2EX6A 2J9PA 4GDBA 3CMZA 2W1TA 3UB7A 2LB9A 5M19A 3Q1FA 2VV6A 2PR6A 3JVVA 1HZOA 5GHXA 3ZG9B 4MDZA 4O8GA 3GMWA 4FCFA 1PZPA 2QYBA 1GA9A 5FASA 2R9WA 5CECA 3EEHA 4I3JA 1WYBA 3FKWA 3U4LP 4ESPA 1DP9A 1IKIA 4WZ4A 3IXDA 3W2ZA 1QMFA 3MQOA 4P6BA 1K6SA 1HTZA 3Q07A 5CEDA 3MXSA 2WZXA 5GHYA 3E2KA 2V1BA 1ONHA 4BENA 4IJGA 1ERMA 4L9FA 2WKQA 3ZG7B 4OP8A 3KYEA
chains in the Genus database with same CATH topology
3R7WA 3OC2A 2M7VA 1OTDA 3ICYA 5HD5A 4ZRRA 2VLGA 5DF9A 2K2NA 1TS6A 4WF0A 3EWKA 5TBMB 5HWTA 4K08A 5AVFA 3TRCA 4BBUA 4II7A 1T1CA 1YSPA 2B02A 4GHIB 4KUKA 3HJIA 4Y2FA 3UMDA 4AFIA 2J80A 4YNRA 1ZHHB 4WELA 5DJUA 1TD5A 1OJ5A 2QHKA 2ZMVA 2Y79A 3UMEA 2GX5A 1LL8A 3BW6A 2G7UA 2LB5A 1TS8A 1OTAA 1H3QA 3BWLA 3E4PA 3C30A 4CLCE 4OOMA 1LSXA 3K3DA 4XT2B 4MMNA 2VEAA 1UGUA 2GZAA 2FH5A 3TJZC 2M7UA 1VHMA 3R4KA 4HIAA 4HQAA 3T4QA 4P6ZS 4MN6A 3C8CA 1S4RA 4MCWA 1N9NA 3A0RA 4WEJA 3F1OA 4P6ZM 4I3AA 3O5YA 1DRMA 3IBJA 4B93A 2VV7A 2IA2A 2PD8A 3GECA 1ODVA 3LUQA 5HWWA 1LT0A 3A0VA 5IU1A 3F1NA 4NEED 4BBTA 3H82B 1F9IA 5A8BA 2A24B 1D7EA 2NUTC 3LR3A 5HPFA 4EEUA 2VGLS 3TE8A 1NLZA 2ZOIA 5TBMA 3NOUC 2B18A 3EGDC 4EXOA 2W1TB 5G4ZA 2Z6DA 2V0UA 4IUKA 2VV8A 2KLIA 5F69A 2P7JA 2JKRI 4BWIA 4I3IA 4O0PA 4KUOA 4FOFA 3C38A 1N9LA 2JKTI 5I5LA 2QKPA 4NXBA 1GSWA 3VE4A 2VZWA 5F68A 1VB6A 3LIDA 3NOPC 4WUJA 1DP8A 3CWFA 2W27A 2J3WA 2BASA 3H9WA 3BQ8A 3NJAA 2OWHA 3T4OA 3EGXC 3S7QA 4JGPA 1S66L 2HF6A 3GDIA 1XJ6A 1UWNX 1V9ZA 2W1RA 3S7NA 3IS2B 3LIBA 3NHQA 4ME4A 4R6LA 5CX7A 4F3LB 2EWVA 3PBRA 4IHQA 2PDRA 4EU0A 3P01A 1GSVA 5KIZA 3OOVA 4GCZA 4LRYC 3ULFA 4EQ1A 3CLOA 3B33A 1XJ4A 2GNXA 1OT9A 2KDKA 3C2WA 3T4KA 3HJKA 4PHTA 3G6OA 4DJ3A 2Z6CA 1S1YA 1W63Q 2YKFA 3MJQA 3B47A 2INWA 4ARZB 4BBVA 5MC7A 4DN0A 1STZA 1IFQA 4RQ9A 2PYPA 5DKKA 4JGRA 4L9EA 4PKYA 1OTIA 3EQVA 4HHDA 3LIEA 4EETB 2QWSA 2P04A 1F5MA 4I39A 5IT5A 1XJ3A 4O01A 2O9CA 5DJTA 3KSIA 1NRJA 3H7WA 4CLCA 3VV4A 4OOLA 3VOLA 5IS1A 2L4RA 5K5BA 2HJ9C 3BJNA 3FPVA 2A2LA 5HDDA 2O0YA 3E4QA 1F98A 4GS9A 2HGVA 4QPRA 4HY8A 4UQIM 3MFXA 4UEYA 2GJ3A 4XT2A 4IUHA 4EUVA 3FC7A 2O9BA 3UE6A 5KSHA 3PBNA 2O99A 3LR0A 2KOIA 4HP4A 1H8MA 1X0OA 2ZMFA 2QJ5A 3UE3A 1P97A 4HOIA 1OJGA 3KYQA 4HNBA 4ETZA 3K2NA 3T4LA 3PHYA 3F1NB 3LFVA 3PBQA 2W3DA 4HP9A 2V1AA 5F5YA 2HV1A 1GSXA 3EEAA 3T50A 4JGQA 5L8MA 2YKHA 3D3OA 1MKMA 2OWJA 4ETXA 4HH3A 4HJ3A 5AJGA 4GLQA 2WKRA 2XA7S 3P7NA 1V9YA 2XRNA 4R38A 4BJPA 3MQQA 5DFXA 4NXEA 4B9OA 3MQ0A 5HD3A 3LYXA 3NOTC 1BYWA 3ZQ5A 4H6JB 4NXGA 2K7SA 3KSFA 2ZBBA 3KO6A 4I38A 1ZTUA 2PD7A 5F6AA 4M4XA 3LIAA 2H28A 5FL3A 1XFQA 1P9RA 4PKYG 4MN7A 3OCLA 5HWVA 1T1AA 3LR5A 4ARZA 2VA0A 3T4JA 4JGOA 5HDSA 2D01A 3MXQA 1KOUA 4HH2A 2W3GA 3E4OA 4F3LA 5AVEA 4Q0JA 2K31A 2J3TC 2W3FA 1EW0A 4WEKA 5DKLA 3UB8A 3F1PB 4EESA 3DBAA 1DP6A 3IS2A 3U2AA 1IOUA 2JKRM 1YAXA 5J7EA 1YKDA 3OCNA 4HJ4A 3IBRA 3KSHA 4I5SA 2JKTM 4HI4A 1S4SA 1UWPX 4Y5FA 2XSSA 3E0YA 2J3TD 2VJWA 3LIFA 5EFWA 2PR5A 4CLCC 2W3EA 2PYRA 2M1CA 4G3WA 3H7WB 1S1ZA 4BMWA 2W3HA 4CLCD 3KX0X 4LPZA 2L0WA 2JHEA 3BY9A 1N9OA 2VX8A 3T4TA 1LSWA 4NXFA 5TJJA 1TF1A 4H6JA 3HCYA 3MF0A 4GS9B 3FG8A 3RFBA 2KX6A 3JVUA 1OPXA 1T18A 2I9VA 4GHIA 4LLOB 3PR6A 4PAUA 4R70A 2PT7A 2XROA 4GJ4A 2D02A 4CLCB 1LSVA 4YWZA 3EQUA 4CQHA 4MN5A 3ZYTA 4EERA 1P9WA 3RTYA 5HSQA 1T1BA 3KSGA 5DFYA 2XA7M 2HJEA 5LBRA 1D06A 3CAXA 3S7OA 3FPWA 2QJ7A 2NUPC 5G4YA 2OAP1 2ZOHA 3UB6A 3PBTA 1NWZA 3TW8A 4WLAA 1XJ2A 4GW9A 1W63M 3UB9A 1YSQA 4WN5A 4DJ2A 4EEPA 3LI9A 4KQDA 1G6OA 3PBSA 4LRZE 1T19A 3PXPA 1Y28A 4E04A 4HJ6A 3CUEC 2CMNA 5C5KA 2Y8HA 1OTEA 2P08A 2PHYA 4EW7A 5HZHA 1JNUA 5J4EA 3T4SA 3SW1A 3D72A 3OLOA 3R7WB 4L9GA 4G3VA 2DMWA 2WKPA 4Y3IA 2O9AA 4Z1WA 3CITA 1TS0A 3CUEA 2L1MA 3LICA 4UQIS 2OOLA 3F1OB 3CI6A 1XFNA 4FSFA 3S7PA 2W1TA 3UB7A 2LB9A 2VGLM 2FZ0A 4DMZA 1G28A 2VV6A 4Q0HA 1OT6A 2PR6A 3JVVA 3OBFA 3F1PA 2VKSA 5HPIA 3MR0A 4NKPA 5HL6A 2V9AA 2A24A 4KQOA 4MDZA 2MJ6A 4O8GA 4G3KA 3B42A 2QYBA 5J3WA 3VE3A 3PBOA 2W0NA 3EEHA 4L0LA 4I3JA 4LRXC 1NLYA 3PYPA 2EA9A 2EWWA 2V0WA 1DP9A 3RH8B 4YOFA 4Q0IA 3BY8A 3MQOA 3W2ZA 2OAQ1 4R3AA 1OTBA 3H82A 3E98A 3EOIA 3K3CA 3LI8A 2V1BA 4WL9A 3BQAA 1TS7A 3LR4A 1MC0A 4IJGA 1P0ZA 4L9FA 3MMHA 2WKQA 1S67L 1MZUA 2JN7A 3V67A 2R78A 3KYZA 5HDCA 1WA9A 3A0SA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3P7N A;  1V9Y A;  2W27 A;  4R38 A;  2BAS A;  3H9W A;  1D06 A;  3MQQ A;  3NJA A;  3CAX A;  2OWH A;  1OTD A;  3ICY A;  4JGP A;  5HD5 A;  4NXE A;  2QJ7 A;  2VLG A;  4B9O A;  5G4Y A;  2ZOH A;  1TS6 A;  4WF0 A;  5HD3 A;  3LYX A;  1S66 L;  3NOT C;  1BYW A;  1NWZ A;  3GDI A;  3EWK A;  3UB6 A;  3ZQ5 A;  1XJ6 A;  4WLA A;  5HWT A;  5TBM B;  1UWN X;  1XJ2 A;  4H6J B;  4K08 A;  5AVF A;  4NXG A;  4GW9 A;  1V9Z A;  3UB9 A;  4BBU A;  2K7S A;  4WN5 A;  4DJ2 A;  1T1C A;  3IS2 B;  4EEP A;  2B02 A;  3LI9 A;  4KQD A;  4GHI B;  3LIB A;  3NHQ A;  2ZBB A;  3HJI A;  4KUK A;  4LRZ E;  4R6L A;  3UMD A;  1T19 A;  4F3L B;  4I38 A;  1Y28 A;  2J80 A;  2PDR A;  4E04 A;  4HJ6 A;  5DJU A;  2PD7 A;  1GSV A;  5KIZ A;  1OJ5 A;  4M4X A;  5F6A A;  3LIA A;  2H28 A;  2CMN A;  2QHK A;  4GCZ A;  4LRY C;  1XFQ A;  3ULF A;  4EQ1 A;  4PKY G;  3UME A;  1OTE A;  2PHY A;  3CLO A;  4BBT A;  5HWV A;  1T1A A;  4EW7 A;  1JNU A;  1LL8 A;  5HZH A;  5J4E A;  3B33 A;  1XJ4 A;  1TS8 A;  4JGO A;  5HDS A;  3SW1 A;  2D01 A;  1OT9 A;  1KOU A;  2KDK A;  3C2W A;  1OTA A;  3D72 A;  3E4O A;  3MXQ A;  3OLO A;  4HH2 A;  5AVE A;  4F3L A;  3BWL A;  3HJK A;  3G6O A;  4L9G A;  4DJ3 A;  3E4P A;  2WKP A;  2Z6C A;  1S1Y A;  2YKF A;  3MJQ A;  1TS0 A;  1LSX A;  1EW0 A;  3K3D A;  4XT2 B;  2L1M A;  2VEA A;  3LIC A;  2INW A;  5DKL A;  3UB8 A;  1UGU A;  2OOL A;  3F1P B;  4BBV A;  4EES A;  3F1O B;  4RQ9 A;  2PYP A;  5DKK A;  1DP6 A;  1XFN A;  4JGR A;  3IS2 A;  4L9E A;  4PKY A;  3UB7 A;  1OTI A;  4HIA A;  3UE6 A;  4HQA A;  4HHD A;  5J7E A;  3LIE A;  1DP8 A;  4HJ4 A;  1G28 A;  2QWS A;  4EET B;  2VV6 A;  4I39 A;  4MN6 A;  1XJ3 A;  3C8C A;  1OT6 A;  1S4R A;  3IBR A;  1N9N A;  2PR6 A;  4I5S A;  5DJT A;  3A0R A;  3F1P A;  4HI4 A;  3H7W A;  1S4S A;  3F1O A;  1UWP X;  4I3A A;  3MR0 A;  1DRM A;  3VOL A;  5IS1 A;  2L4R A;  2V9A A;  2VV7 A;  2A24 A;  2PD8 A;  3GEC A;  5HDD A;  3E4Q A;  3LIF A;  5EFW A;  2PR5 A;  1F98 A;  1ODV A;  4GS9 A;  3LUQ A;  2PYR A;  4HY8 A;  3MFX A;  5HWW A;  2M1C A;  1LT0 A;  2GJ3 A;  5J3W A;  3H7W B;  1S1Z A;  4XT2 A;  3A0V A;  3VE3 A;  5IU1 A;  3F1N A;  3FC7 A;  2W0N A;  3KX0 X;  2L0W A;  3EEH A;  4LPZ A;  2JHE A;  3H82 B;  3BY9 A;  1F9I A;  1N9O A;  4WUJ A;  2A24 B;  1D7E A;  4I3J A;  4LRX C;  5A8B A;  4EEU A;  3CWF A;  2EA9 A;  3PYP A;  4HP4 A;  1LSW A;  2V0W A;  4NXF A;  1X0O A;  2ZOI A;  5TBM A;  1DP9 A;  3NOU C;  4H6J A;  3RH8 B;  4EXO A;  4GS9 B;  2QJ5 A;  5G4Z A;  2Z6D A;  1P97 A;  2KX6 A;  1OJG A;  2V0U A;  3BY8 A;  3FG8 A;  3MQO A;  4HNB A;  4HOI A;  2VV8 A;  4R3A A;  1T18 A;  5F69 A;  2I9V A;  2P7J A;  4GHI A;  3PHY A;  4LLO B;  3F1N B;  1OTB A;  4R70 A;  4I3I A;  3H82 A;  3K3C A;  2D02 A;  4KUO A;  4HP9 A;  2V1A A;  5F5Y A;  2V1B A;  2HV1 A;  1GSX A;  1N9L A;  1TS7 A;  3LI8 A;  1LSV A;  4WL9 A;  5I5L A;  3T50 A;  2QKP A;  4JGQ A;  4YWZ A;  2YKH A;  4NXB A;  1P0Z A;  2OWJ A;  4L9F A;  4MN5 A;  4HH3 A;  1GSW A;  3VE4 A;  4EER A;  2WKQ A;  4HJ3 A;  1S67 L;  1MZU A;  2JN7 A;  5F68 A;  3RTY A;  5HSQ A;  2R78 A;  1T1B A;  1VB6 A;  3LID A;  3NOP C;  5HDC A;  2WKR A;  1WA9 A;  3A0S A; 
#chains in the Genus database with same CATH topology
 3R7W A;  4D2O A;  3RJU A;  3IHB A;  5FI6 A;  4WF0 A;  4X25 A;  3PAG A;  5HWT A;  5FEF A;  3QHY A;  4II7 A;  3ZCZ A;  2B02 A;  4KUK A;  2JBF A;  4EWF A;  1FOF A;  4UHU A;  1JTG A;  1RP5 A;  4XUX A;  4QU3 A;  3WRZ A;  5TFQ A;  2GX5 A;  1LL8 A;  2G7U A;  1TS8 A;  1CEG A;  3OPR A;  4ZJ1 A;  1H3Q A;  1PWC A;  5M1A A;  4UAA A;  1BUE A;  4DXB A;  1MKI A;  1PWD A;  4WMC A;  1NY0 A;  4JXS A;  2VEA A;  1UGU A;  2GZA A;  3TJZ C;  2Q9M A;  2WKI A;  1GHI A;  3C8C A;  1N9N A;  3HLF A;  3DW0 A;  3A0R A;  5FQJ A;  4EBN A;  4WEJ A;  4P6Z M;  3ITA A;  2ZLY A;  4Z9Q A;  2Y55 A;  3IBJ A;  2Y2L A;  3GTC A;  5HAQ A;  1W8Q A;  1ODV A;  1YMX A;  3OPH A;  1PI4 A;  5HWW A;  3F1N A;  4NEE D;  4CPK A;  3H82 B;  1F9I A;  2A24 B;  2V1Z A;  3QP1 A;  3TE8 A;  1NLZ A;  3EGD C;  4EXO A;  2Z6D A;  4WBG A;  2V0U A;  4DE3 A;  1CQA A;  1YLP A;  2P7J A;  2JKR I;  3PAE A;  3W8K A;  4GD6 A;  5E2G A;  4I3I A;  5JYO A;  2PBY A;  3DAV A;  1QME A;  3ZVT A;  2EFU A;  4KG6 A;  4NXB A;  1G5U A;  1LI0 A;  5EOO A;  3NOP C;  2XR0 A;  1DP8 A;  3H9W A;  3T4O A;  4S2I A;  3S7Q A;  5DTS A;  1MBL A;  3GDI A;  2Q0O A;  1XJ6 A;  1V9Z A;  4KZ6 A;  2W1R A;  4DE1 A;  3S7N A;  2XF3 A;  2IWC A;  5CX7 A;  4F3L B;  2EWV A;  4S2N A;  4IHQ A;  4EU0 A;  3P01 A;  4E6W A;  3IWO A;  5L2F A;  3ULF A;  3QNC A;  3VP2 A;  5M18 A;  3B33 A;  1FSY A;  5EVI C;  4DJ3 A;  5FAT A;  2INW A;  4ARZ B;  1STZ A;  3Q7Z A;  3DTE A;  1IFQ A;  2PYP A;  3IWQ A;  1OTI A;  4LFU A;  4KQR A;  1I2S A;  2P04 A;  4I39 A;  4ZBE A;  3IX3 A;  2Y2H A;  4JPM A;  4GD8 A;  2HPB A;  2ZQA A;  1SHV A;  4OOL A;  5K5B A;  1LL5 A;  2O0Y A;  1F98 A;  3SZT A;  1U60 A;  4UQI M;  3MFX A;  4UEY A;  2Y2Q A;  4GKU A;  3FC7 A;  5KSH A;  2O99 A;  3PBN A;  1X0O A;  1P97 A;  4HNB A;  2JC7 A;  4GB7 A;  4ETZ A;  5I94 A;  1KVL A;  2FFF B;  1XP4 A;  5A91 A;  2P74 A;  1JTD A;  2V1A A;  1GSX A;  3T50 A;  1I5Q A;  4N1X A;  1K54 A;  2YKH A;  3D3O A;  3A3J A;  4LV1 A;  4ETX A;  2HP6 A;  4QWO A;  5AJG A;  5KSC A;  2H10 A;  3BLM A;  2XA7 S;  3MQQ A;  1BTL A;  5TR7 A;  4B9O A;  3ZQ5 A;  1ZG4 A;  1FR6 A;  4A5R A;  4MBH A;  3TSG A;  1YLY A;  2ZBB A;  2PRF A;  4JXV A;  3WRT A;  3D4F A;  5E2H A;  1OME A;  4KEN B;  5F6A A;  4M3K A;  1XFQ A;  5EE8 A;  4PKY G;  5EM1 A;  1FIK A;  1VQQ A;  5CXW A;  3T4J A;  4JGO A;  5HDS A;  1FCN A;  1KOU A;  2W3G A;  3ZNT A;  4E3O A;  4E3L A;  3VFH A;  5L10 A;  2K31 A;  1AWI A;  5DKL A;  3F1P B;  3DBA A;  3IS2 A;  3SH9 A;  4OPR A;  3VMA A;  2XD1 A;  4KZ9 A;  4N9K A;  2V8C A;  3KSH A;  4I5S A;  3VOY A;  4OLG A;  1UWP X;  1ACF A;  2VJW A;  1EWZ A;  5EFW A;  4R0Q A;  4CLC C;  2XQZ A;  4ZJ3 A;  3HUM A;  3MXR A;  5EVE A;  4G3W A;  4Y0U A;  3H7W B;  4RVA A;  4CLC D;  3KX0 X;  4LPZ A;  1VET B;  2JHE A;  3T4T A;  3ZG0 A;  1LSW A;  3WS1 A;  3HCY A;  1L2S A;  1T18 A;  3SS4 A;  3G2Y A;  1KE3 A;  3P09 A;  4LEN A;  1TDL A;  4GN2 A;  1LSV A;  3G35 A;  5F82 A;  4YWZ A;  3ZYT A;  2OV5 A;  4DDY A;  1P9W A;  4X55 A;  3W4Q A;  5HSQ A;  1O7E A;  1T1B A;  1K38 A;  3IWI A;  2XA7 M;  5TGF A;  3CAX A;  3S7O A;  2I72 A;  2OAP 1;  3PBT A;  3TW8 A;  2X71 A;  1PZO A;  5HAI A;  4EUZ A;  1G6O A;  3VSL A;  4LRZ E;  1T19 A;  4NET A;  1E25 A;  3G32 A;  2HDS A;  4IBX A;  1YPR A;  3A3D A;  2A3U A;  5EVI D;  2C5W B;  2PHY A;  3GVB A;  4S2J A;  4EW7 A;  1FIL A;  5EPH A;  5EEC A;  3LEQ A;  5HW3 A;  2WKP A;  1Z6F A;  4UQI S;  2EX8 A;  2UV0 E;  3S7P A;  4Q0H A;  2WAF A;  1XXM A;  1ALQ A;  4NKP A;  5HL6 A;  2V9A A;  3L9K A;  3NC8 A;  1E3U A;  2MJ6 A;  4ZTK A;  1MWR A;  4G3K A;  5J3W A;  3PBO A;  2W0N A;  5F1F A;  5GLC A;  3MKF A;  1NLY A;  2WGW B;  4Q0I A;  4KQQ A;  1LLB A;  1IYO A;  2XEP A;  1OTB A;  3H82 A;  3E98 A;  2DCF A;  3BM6 A;  3BQA A;  2VK3 A;  3LR4 A;  1MC0 A;  3IF6 A;  4LCL A;  2JN7 A;  1PI5 A;  5HDC A;  3AGE A;  1KDW A;  2Y2O A;  4Q8I A;  3OC2 A;  4ID4 A;  3IXG A;  1OTD A;  2VLG A;  3N8R A;  5DF9 A;  1TS6 A;  1KGF A;  2RCX A;  5TBM B;  5AVF A;  1ESI A;  2Y2P A;  3A3I A;  3Q81 A;  4GHI B;  3HJI A;  1CF0 A;  4B4Z A;  4S2M A;  1NZO A;  4K91 A;  3BW6 A;  3IF5 A;  2XD5 A;  3ZHH A;  2HDR A;  3S1Y A;  1XA1 A;  4JF5 A;  1Y54 A;  4OOM A;  1K57 A;  1LSX A;  4XT2 B;  1YMS A;  3CPT B;  1ESU A;  1LI9 A;  1D1J A;  4HIA A;  2XDM A;  4HBU A;  1S4R A;  3UDI A;  3V50 A;  3ZDJ A;  2X02 A;  1GCE A;  4I3A A;  3IF6 B;  3O5Y A;  3OZH A;  1W5D A;  2Y2I A;  4B93 A;  2IA2 A;  3LUQ A;  2OLU A;  1CJF A;  1LT0 A;  1H0M A;  4BBT A;  2NUT C;  4EEU A;  3IX8 A;  5TBM A;  3NOU C;  2B18 A;  5KZH A;  1IKG A;  1K57 C;  3N8L A;  4BWI A;  1G68 A;  4O0P A;  3N7W A;  3HUN A;  4KUO A;  5A92 A;  4FOF A;  3P98 A;  5I5L A;  3VP1 A;  4KG5 A;  4ZDX A;  3T1Q B;  3BLS A;  3BQ8 A;  5J8X A;  4JKT A;  1S66 L;  2HF6 A;  4XUZ A;  5FSR A;  2ZL1 A;  3C5A A;  4R6L A;  1K55 A;  1FCM A;  1Q2P A;  5KIZ A;  4QY6 A;  3OOV A;  4LRY C;  1BT5 A;  1GHM A;  5E2F A;  5CER A;  1XJ4 A;  2GNX A;  1CI8 A;  2KDK A;  3C2W A;  3T1S A;  3HJK A;  4PHT A;  3G6O A;  5F83 A;  5FQI A;  3DWK A;  3UNW A;  2Z6C A;  1S1Y A;  1YLJ A;  4R23 A;  4BBV A;  1CEF A;  1ONG A;  2ZC4 B;  4JGR A;  3S4X A;  4PKY A;  4X1M A;  3LIE A;  4EET B;  2QWS A;  3VP4 A;  5EOE A;  1XJ3 A;  2H0T A;  4O01 A;  1WYC A;  5DJT A;  5GLA A;  3VV4 A;  5IS1 A;  3WS2 A;  3BJN A;  1ZKJ A;  5GLD A;  2HGV A;  2GJ3 A;  2ZJ9 A;  1PNE A;  1M6K A;  4IUH A;  2XFS A;  1BLC A;  2O9B A;  3OPL A;  2KOI A;  1AXB A;  4GDN A;  3UE3 A;  4HOI A;  1OJG A;  3KYQ A;  4Y15 A;  5A93 A;  3AGF A;  3T4L A;  3PHY A;  1VET A;  3PBQ A;  5BOH A;  2W3D A;  4HP9 A;  3HL9 A;  4JGQ A;  4S2L A;  5L8M A;  4HH3 A;  1BUL A;  2WAE A;  4HJ3 A;  3WS5 A;  1PWG A;  3LEZ A;  2G2W A;  2WKR A;  4BJP A;  3JPU A;  4PMA A;  5DFX A;  4WYY A;  4NXE A;  5GHZ A;  2ZMA A;  3NOT C;  3L7H A;  1SKO A;  3DWZ A;  4X56 A;  4B88 A;  3UDF A;  4KZ7 A;  5CGX A;  2VGK A;  2HP9 A;  1T1A A;  4DKI A;  2D01 A;  3MXQ A;  5AVE A;  2Y91 A;  3ZG8 B;  4WEK A;  1DJB A;  1ES5 A;  3HLE A;  3RXW A;  3BRM A;  4PPR A;  4PM6 A;  4K0X A;  4BD0 A;  2JKR M;  2WGV A;  4HJ4 A;  5CHM A;  5CTN A;  3T1X A;  4YIN A;  3HLC A;  4HI4 A;  3ZGA B;  3RXX A;  3E0Y A;  1ES4 A;  3LIF A;  2PR5 A;  2PBD P;  5HAP A;  2M1C A;  3LY4 A;  5DVA A;  1N9O A;  2VX8 A;  4BQM A;  3ZFZ A;  1TF1 A;  4GS9 B;  3FG8 A;  5HX9 A;  3M6B A;  2A49 A;  1SKO B;  4R70 A;  2BG1 A;  4CLC B;  3HBR A;  4YFM A;  1ERQ A;  4CQH A;  4OOY A;  4EER A;  3ISG A;  4U3T A;  3HLD A;  3KSG A;  2HZ5 A;  3FPW A;  5G4Y A;  1HLU P;  2PU2 A;  1IYS A;  1NXY A;  1XJ2 A;  3FZC A;  1W63 M;  3UB9 A;  4HES A;  4WN5 A;  3DTI A;  1SCW A;  4KQD A;  1K55 C;  3MZF A;  3HRE A;  4MBK A;  4E04 A;  1W79 A;  3CUE C;  4S2O A;  2J9O A;  2Z2M B;  5C5K A;  2Y8H A;  5JYP A;  3ZG5 A;  3T4S A;  3OLO A;  2WZZ A;  1JWZ A;  1DJC A;  1MWU A;  3SS3 A;  2O9A A;  1L0F A;  1TS0 A;  3O86 A;  5IHV A;  3BEC A;  4OP5 A;  2OOL A;  2WYX A;  3CI6 A;  4FSF A;  2FZ0 A;  4DMZ A;  1MWT A;  1Y4O A;  3FYZ A;  1OT6 A;  3CPT A;  3OBF A;  4CJN A;  2VKS A;  4E3N A;  1JVJ A;  4Y7P A;  2A24 A;  1HVB A;  3NEC A;  4JF4 A;  3NBL A;  3B42 A;  2ACG A;  4U0X A;  3ZVW A;  4JBF A;  5FQQ A;  2WKE A;  5DF7 A;  3VE3 A;  1ES2 A;  5FAO A;  3PYP A;  2EA9 A;  2EWW A;  2JE5 A;  1SZV A;  4YOF A;  4B4X A;  3Q82 A;  2OAQ 1;  4R3A A;  2ZD8 A;  5FDH A;  1LL9 A;  1PW8 A;  4WL9 A;  1TS7 A;  3NI9 A;  3G34 A;  3GV9 A;  1WA9 A;  3NUL A;  4FD8 A;  3ICY A;  4ZRR A;  3NY4 A;  1TEM A;  3EWK A;  3V5M A;  5FI2 A;  1IEL A;  1HD8 A;  3TRC A;  3G30 A;  4DF6 A;  1YSP A;  4DXC A;  2ZM0 A;  4Y2F A;  3UMD A;  4AFI A;  1Q2Q A;  2J80 A;  4YNR A;  4OPY A;  4WEL A;  1XGJ A;  5FAP A;  1OJ5 A;  2ZL1 B;  1EI5 A;  2QHK A;  2Y79 A;  5L07 A;  3UME A;  3DTM A;  4LGW A;  3IX4 A;  1WE4 A;  1KE0 A;  1H8Y A;  3E4P A;  3C30 A;  4DE0 A;  1G6A A;  3K3D A;  4MMN A;  2FH5 A;  3IHA A;  3MZD A;  2X01 A;  4X69 A;  1VHM A;  1XKZ A;  2ZC6 B;  3R4K A;  4JLF A;  2G2U A;  5AQA A;  4HQA A;  4C75 A;  5EM0 A;  4UA6 A;  4MN6 A;  3C7U A;  4MCW A;  4DDS A;  4Y13 A;  4E3J A;  3QP6 A;  1TVF A;  3AGD A;  3F1O A;  1DRM A;  5HFO A;  1ES3 A;  3GEC A;  1C3B A;  1N9B A;  4FH2 A;  2VGJ A;  3IXB A;  2ZC5 B;  4KZ4 A;  1D7E A;  3LR3 A;  2VGL S;  1MXO A;  2ZOI A;  2W1T B;  4OQH A;  1K54 C;  5AQ9 A;  2P9V A;  3C38 A;  1N9L A;  3IH8 A;  4OON A;  4EBL A;  3VE4 A;  1JWP A;  1NZU A;  5FEG A;  3O88 A;  4WUJ A;  3CWF A;  3GR2 A;  3SH7 A;  2J3W A;  2BAS A;  3BYD A;  2OWH A;  3EGX C;  4JGP A;  5CHU A;  3MKE A;  2WUQ A;  4E6X A;  2Y59 A;  3IS2 B;  3LIB A;  3NHQ A;  3PBR A;  2OLV A;  2PDR A;  1GSV A;  3CJM A;  4Y0O A;  3IT9 A;  2ZQ8 A;  3T4K A;  1KE4 A;  3GSG A;  3MJQ A;  2JKF A;  1YQS A;  3PTE A;  3W4P A;  4R4R A;  2EX2 A;  2XGN A;  5MC7 A;  3GRJ A;  1L0E A;  4RQ9 A;  1K4F A;  3LY3 A;  1XX2 A;  3NCK A;  3BFG A;  1J3W A;  3EQV A;  4HHD A;  5CGS A;  3V3S A;  2EX9 A;  5CEB A;  5IT5 A;  3KSI A;  3QP4 A;  2FFY A;  1NRJ A;  3H7W A;  5A90 A;  5CTM A;  1RGY A;  3QP5 A;  3VOL A;  3MS6 A;  3BEB A;  3HVF A;  2L4R A;  3HLG A;  4OPZ A;  1BSG A;  3UPN A;  5G18 A;  5HDD A;  2B95 A;  3E4Q A;  1I2W A;  4QPR A;  3DTK A;  4HEF A;  3UE6 A;  1J9M A;  4RA7 A;  4WZ5 C;  3N6I A;  4HP4 A;  4KZ8 A;  1H8M A;  3LCE A;  4NG2 A;  3T12 B;  2QJ5 A;  4OH0 A;  3TOI A;  3F1N B;  3LFV A;  2IWB A;  3HUO A;  2HV1 A;  5FI7 A;  4FH4 A;  4FUW A;  5E43 A;  3BFE A;  4GLQ A;  1ZG6 A;  3I7J A;  3FV7 A;  4R38 A;  2Y2K A;  1K0K A;  2Y2G A;  2J7V A;  3LYX A;  1BYW A;  3Q7V A;  4GNU A;  1H8Z A;  1BZA A;  4NXG A;  4RX3 A;  3IQA A;  2Y2M A;  5L09 A;  5DTT A;  1W8Y A;  3KSF A;  3KO6 A;  4LV3 A;  4M4X A;  3LIA A;  2H28 A;  5FL3 A;  4MN7 A;  3LR5 A;  2VA0 A;  4S2N C;  4DRT A;  3E4O A;  4F3L A;  4KZ5 A;  4Q0J A;  4KZ3 A;  2J3T C;  2W3F A;  1ZC2 A;  1O07 A;  3UB8 A;  1RCJ A;  4EES A;  4KZB A;  1DP6 A;  2EXB A;  2ZQ9 A;  1IOU A;  4X6T A;  5J7E A;  1L0D A;  1YKD A;  3OCN A;  2JKG A;  3IBR A;  3HLW A;  2JKT M;  4QB8 A;  4GOG A;  1S4S A;  2E8J A;  4Y5F A;  5FA7 A;  1TDG A;  4BD1 A;  4RX2 A;  2J8Y A;  3NDE A;  2PYR A;  3TG9 A;  2Y4A A;  2W3H A;  2QMI A;  4LCM A;  3BY9 A;  4PM5 A;  4BL2 A;  3MF0 A;  1FCO A;  2I9V A;  3CHW P;  4GHI A;  3C4O A;  4LLO B;  4R3J A;  4PAU A;  4WZ5 A;  2EFX A;  2PT7 A;  3EQU A;  5FQ9 A;  4BLM A;  3UO9 A;  3RTY A;  3LO7 A;  2HJE A;  5LBR A;  4QY5 A;  4IED A;  4E3I A;  4K0W A;  4UA9 A;  2ZC3 B;  1NWZ A;  3V3R A;  4PM9 A;  4GW9 A;  4PM8 A;  3UB5 P;  4IVI A;  1YSQ A;  1SDN A;  3PBS A;  1XGI A;  3PXP A;  3A3E A;  4S2K A;  3S22 A;  1JWV A;  4HJ6 A;  3SS5 A;  2CMN A;  1JNU A;  5J4E A;  2V20 A;  3HLB A;  3SW1 A;  3D72 A;  2WK0 A;  1IYP A;  4G3V A;  3C4P A;  2DMW A;  4Y3I A;  4DE2 A;  3CIT A;  4QD4 A;  2Y2N A;  4X1L A;  3O3V A;  4R1G A;  2HDU A;  5KMW A;  1XFN A;  2VGL M;  3SOI A;  1PRQ A;  1G28 A;  3WS4 A;  4WMC D;  1VM1 A;  3F1P A;  5CHJ A;  1IYQ A;  2OSU A;  5HPI A;  3MR0 A;  2UWX A;  4P0M A;  2IWD A;  5DF8 A;  1VEU A;  4KQO A;  1SDE A;  1FSW A;  2DNS A;  2AVX A;  3B3X A;  4L0L A;  3VP3 A;  4QHC A;  4LRX C;  2V0W A;  3RH8 B;  3BY8 A;  5HAR A;  4MBF A;  2C6W B;  4LV0 A;  2QPN A;  4JF6 A;  3EOI A;  3K3C A;  1Z09 A;  3LI8 A;  4IVK A;  1K6R A;  4KZA A;  1P0Z A;  3MMH A;  4U0T A;  3MZE A;  1S67 L;  1MZU A;  3V67 A;  2R78 A;  4UA7 A;  3KYZ A;  2P9V B;  5EVL A;  4JXW A;  3A0S A;  3D9Y A;  2EXA A;  2M7V A;  1YM1 A;  3VP0 A;  3E2L A;  5HD5 A;  2K2N A;  2E8I A;  4K08 A;  4BBU A;  3M6H A;  3UN7 A;  2PAV P;  1T1C A;  5HL1 A;  3UPO A;  5FDS A;  1YLW A;  2BLS A;  1ZHH B;  5DJU A;  5EV0 A;  1TD5 A;  3G2Z A;  1W7F A;  3SH8 A;  2ZMV A;  4E3M A;  2LB5 A;  1OTA A;  3BWL A;  4N1H A;  1M40 A;  5GLB A;  4CLC E;  3OPP A;  2V8F A;  3UE0 A;  2RL3 A;  2H0Y A;  3QP2 A;  3BFC A;  3N4I A;  2B5R A;  3BFD A;  5EUA A;  2M7U A;  1ERO A;  2BTF P;  1BLH A;  2CC1 A;  1MY8 A;  3T4Q A;  4P6Z S;  2H5S A;  4FTX A;  3UDX A;  1SKF A;  1K25 A;  2VV7 A;  4HBT A;  2PD8 A;  1RGZ A;  3ITB A;  1KVM A;  4S2P A;  3A0V A;  4Y0T A;  5IU1 A;  1KGE A;  1GA0 A;  5A8B A;  5HPF A;  1K56 D;  3BFF A;  1S0W A;  4PM7 A;  5G4Z A;  3FKV A;  4IUK A;  2VV8 A;  2KLI A;  5F69 A;  4N9L A;  1MWS A;  1KGG A;  5CRF A;  2WGW A;  2HDQ A;  2JKT I;  1FQG A;  2QKP A;  1K4E A;  2ZM2 A;  3N8S A;  3QNB A;  1GSW A;  4NK3 A;  2VZW A;  5F68 A;  1VB6 A;  3LID A;  1K56 A;  2W27 A;  4EV4 A;  3NJA A;  1A0K A;  5F1G A;  5D3O A;  1BLP A;  4O7D A;  1YLT A;  4OVD A;  1UWN X;  4ME4 A;  4C3Q A;  1BLS A;  2XH9 A;  5AQB A;  3Q7V B;  4R3B A;  4X53 A;  4GCZ A;  4EQ1 A;  5GL9 A;  5E2E A;  2JCH A;  3CLO A;  1OT9 A;  1PFL A;  1IEM A;  4H8R A;  4GZB A;  3G31 A;  3UY6 A;  4E3K A;  1W63 Q;  2YKF A;  1L3L A;  3V39 A;  2Q9N A;  3B47 A;  4DN0 A;  1DJA A;  2WKH A;  1YT4 A;  3T1R A;  4P85 A;  5DKK A;  4L9E A;  4EBP A;  1NYY A;  1F5M A;  2O9C A;  3UPP A;  4OQ0 A;  4CLC A;  2R9X A;  2XLN A;  4QJG A;  2HJ9 C;  4OPQ A;  4EQI A;  3FPV A;  2A2L A;  4XXR A;  4BL3 A;  1H5X A;  4GS9 A;  4HY8 A;  4Y17 A;  4XT2 A;  2ZQ7 A;  1DY6 A;  4EUV A;  1F2K A;  3A3F A;  2HP5 A;  3LR0 A;  3CZD A;  2ZMF A;  4OQG A;  2V2F F;  3K2N A;  4X68 A;  3MSH A;  5F5Y A;  3EEA A;  1MKM A;  2OWJ A;  3WWX A;  4KG2 A;  1PW1 A;  2Y2J A;  4D60 A;  2PU4 A;  3P7N A;  1V9Y A;  2XRN A;  3MBZ A;  1NJ4 A;  3O87 A;  3MQ0 A;  5HD3 A;  4LV2 A;  3NDG A;  3VFF A;  4H6J B;  2K7S A;  5AQ7 A;  4OKP A;  4MLL A;  4I38 A;  1ZTU A;  3WS0 A;  3GQZ A;  2PD7 A;  1FR1 A;  3VSK A;  1P9R A;  3G4P A;  1PYY A;  1MPL A;  3OCL A;  5HWV A;  4ARZ A;  4R4S A;  1XA7 A;  3MFD A;  4HH2 A;  1E4D A;  4MNR A;  3IH9 A;  4ZAM A;  3NIA A;  1EW0 A;  4IBR A;  1GHP A;  1YLZ A;  3CG5 A;  5EVI A;  4JXG A;  3U2A A;  3ZNY A;  5FQM A;  1YAX A;  4P87 A;  5U47 A;  4OQI A;  2XSS A;  1CI9 A;  2J3T D;  4F94 A;  4RYE A;  4OLD A;  2W3E A;  1KDS A;  1S1Z A;  4BMW A;  2L0W A;  1S6R A;  3W4O A;  1VEU B;  4NXF A;  5TJJ A;  4H6J A;  1E3U D;  3RFB A;  2KX6 A;  3JVU A;  1OPX A;  3IF6 C;  1CK3 A;  4C6Y A;  3PR6 A;  2ZQC A;  2XRO A;  4GJ4 A;  1NYM A;  2D02 A;  5DTK A;  2ZC7 A;  3M2J A;  3LGO A;  3JYI A;  4MN5 A;  2XFT A;  4MEZ A;  2QZ6 A;  3VOZ A;  1LHY A;  4N92 A;  5DFY A;  1D06 A;  2GDN A;  4WM9 A;  3FWL A;  2QJ7 A;  2NUP C;  2ZOH A;  3UB6 A;  2Z2L B;  5EVI B;  2ZM8 A;  5CGW A;  3M2K A;  4WLA A;  1XPB A;  3IXH A;  4ZJ2 A;  4DJ2 A;  5FAQ A;  4EEP A;  3LI9 A;  1PIO A;  1L0G A;  1Y28 A;  1NRF A;  2ZQD A;  1N4O A;  1OTE A;  2P08 A;  2WAD A;  5HZH A;  5FQK A;  3QP8 A;  2XK1 A;  3R7W B;  4L9G A;  2WGI A;  4Z1W A;  3UE1 A;  3CUE A;  2L1M A;  3C7V A;  3LIC A;  2DRW A;  3F1O B;  2EX6 A;  2J9P A;  4GDB A;  3CMZ A;  2W1T A;  3UB7 A;  2LB9 A;  5M19 A;  3Q1F A;  2VV6 A;  2PR6 A;  3JVV A;  1HZO A;  5GHX A;  3ZG9 B;  4MDZ A;  4O8G A;  3GMW A;  4FCF A;  1PZP A;  2QYB A;  1GA9 A;  5FAS A;  2R9W A;  5CEC A;  3EEH A;  4I3J A;  1WYB A;  3FKW A;  3U4L P;  4ESP A;  1DP9 A;  1IKI A;  4WZ4 A;  3IXD A;  3W2Z A;  1QMF A;  3MQO A;  4P6B A;  1K6S A;  1HTZ A;  3Q07 A;  5CED A;  3MXS A;  2WZX A;  5GHY A;  3E2K A;  2V1B A;  1ONH A;  4BEN A;  4IJG A;  1ERM A;  4L9F A;  2WKQ A;  3ZG7 B;  4OP8 A;  3KYE A; 
#chains in the Genus database with same CATH homology
 3R7W A;  3OC2 A;  2M7V A;  1OTD A;  3ICY A;  5HD5 A;  4ZRR A;  2VLG A;  5DF9 A;  2K2N A;  1TS6 A;  4WF0 A;  3EWK A;  5TBM B;  5HWT A;  4K08 A;  5AVF A;  3TRC A;  4BBU A;  4II7 A;  1T1C A;  1YSP A;  2B02 A;  4GHI B;  4KUK A;  3HJI A;  4Y2F A;  3UMD A;  4AFI A;  2J80 A;  4YNR A;  1ZHH B;  4WEL A;  5DJU A;  1TD5 A;  1OJ5 A;  2QHK A;  2ZMV A;  2Y79 A;  3UME A;  2GX5 A;  1LL8 A;  3BW6 A;  2G7U A;  2LB5 A;  1TS8 A;  1OTA A;  1H3Q A;  3BWL A;  3E4P A;  3C30 A;  4CLC E;  4OOM A;  1LSX A;  3K3D A;  4XT2 B;  4MMN A;  2VEA A;  1UGU A;  2GZA A;  2FH5 A;  3TJZ C;  2M7U A;  1VHM A;  3R4K A;  4HIA A;  4HQA A;  3T4Q A;  4P6Z S;  4MN6 A;  3C8C A;  1S4R A;  4MCW A;  1N9N A;  3A0R A;  4WEJ A;  3F1O A;  4P6Z M;  4I3A A;  3O5Y A;  1DRM A;  3IBJ A;  4B93 A;  2VV7 A;  2IA2 A;  2PD8 A;  3GEC A;  1ODV A;  3LUQ A;  5HWW A;  1LT0 A;  3A0V A;  5IU1 A;  3F1N A;  4NEE D;  4BBT A;  3H82 B;  1F9I A;  5A8B A;  2A24 B;  1D7E A;  2NUT C;  3LR3 A;  5HPF A;  4EEU A;  2VGL S;  3TE8 A;  1NLZ A;  2ZOI A;  5TBM A;  3NOU C;  2B18 A;  3EGD C;  4EXO A;  2W1T B;  5G4Z A;  2Z6D A;  2V0U A;  4IUK A;  2VV8 A;  2KLI A;  5F69 A;  2P7J A;  2JKR I;  4BWI A;  4I3I A;  4O0P A;  4KUO A;  4FOF A;  3C38 A;  1N9L A;  2JKT I;  5I5L A;  2QKP A;  4NXB A;  1GSW A;  3VE4 A;  2VZW A;  5F68 A;  1VB6 A;  3LID A;  3NOP C;  4WUJ A;  1DP8 A;  3CWF A;  2W27 A;  2J3W A;  2BAS A;  3H9W A;  3BQ8 A;  3NJA A;  2OWH A;  3T4O A;  3EGX C;  3S7Q A;  4JGP A;  1S66 L;  2HF6 A;  3GDI A;  1XJ6 A;  1UWN X;  1V9Z A;  2W1R A;  3S7N A;  3IS2 B;  3LIB A;  3NHQ A;  4ME4 A;  4R6L A;  5CX7 A;  4F3L B;  2EWV A;  3PBR A;  4IHQ A;  2PDR A;  4EU0 A;  3P01 A;  1GSV A;  5KIZ A;  3OOV A;  4GCZ A;  4LRY C;  3ULF A;  4EQ1 A;  3CLO A;  3B33 A;  1XJ4 A;  2GNX A;  1OT9 A;  2KDK A;  3C2W A;  3T4K A;  3HJK A;  4PHT A;  3G6O A;  4DJ3 A;  2Z6C A;  1S1Y A;  1W63 Q;  2YKF A;  3MJQ A;  3B47 A;  2INW A;  4ARZ B;  4BBV A;  5MC7 A;  4DN0 A;  1STZ A;  1IFQ A;  4RQ9 A;  2PYP A;  5DKK A;  4JGR A;  4L9E A;  4PKY A;  1OTI A;  3EQV A;  4HHD A;  3LIE A;  4EET B;  2QWS A;  2P04 A;  1F5M A;  4I39 A;  5IT5 A;  1XJ3 A;  4O01 A;  2O9C A;  5DJT A;  3KSI A;  1NRJ A;  3H7W A;  4CLC A;  3VV4 A;  4OOL A;  3VOL A;  5IS1 A;  2L4R A;  5K5B A;  2HJ9 C;  3BJN A;  3FPV A;  2A2L A;  5HDD A;  2O0Y A;  3E4Q A;  1F98 A;  4GS9 A;  2HGV A;  4QPR A;  4HY8 A;  4UQI M;  3MFX A;  4UEY A;  2GJ3 A;  4XT2 A;  4IUH A;  4EUV A;  3FC7 A;  2O9B A;  3UE6 A;  5KSH A;  3PBN A;  2O99 A;  3LR0 A;  2KOI A;  4HP4 A;  1H8M A;  1X0O A;  2ZMF A;  2QJ5 A;  3UE3 A;  1P97 A;  4HOI A;  1OJG A;  3KYQ A;  4HNB A;  4ETZ A;  3K2N A;  3T4L A;  3PHY A;  3F1N B;  3LFV A;  3PBQ A;  2W3D A;  4HP9 A;  2V1A A;  5F5Y A;  2HV1 A;  1GSX A;  3EEA A;  3T50 A;  4JGQ A;  5L8M A;  2YKH A;  3D3O A;  1MKM A;  2OWJ A;  4ETX A;  4HH3 A;  4HJ3 A;  5AJG A;  4GLQ A;  2WKR A;  2XA7 S;  3P7N A;  1V9Y A;  2XRN A;  4R38 A;  4BJP A;  3MQQ A;  5DFX A;  4NXE A;  4B9O A;  3MQ0 A;  5HD3 A;  3LYX A;  3NOT C;  1BYW A;  3ZQ5 A;  4H6J B;  4NXG A;  2K7S A;  3KSF A;  2ZBB A;  3KO6 A;  4I38 A;  1ZTU A;  2PD7 A;  5F6A A;  4M4X A;  3LIA A;  2H28 A;  5FL3 A;  1XFQ A;  1P9R A;  4PKY G;  4MN7 A;  3OCL A;  5HWV A;  1T1A A;  3LR5 A;  4ARZ A;  2VA0 A;  3T4J A;  4JGO A;  5HDS A;  2D01 A;  3MXQ A;  1KOU A;  4HH2 A;  2W3G A;  3E4O A;  4F3L A;  5AVE A;  4Q0J A;  2K31 A;  2J3T C;  2W3F A;  1EW0 A;  4WEK A;  5DKL A;  3UB8 A;  3F1P B;  4EES A;  3DBA A;  1DP6 A;  3IS2 A;  3U2A A;  1IOU A;  2JKR M;  1YAX A;  5J7E A;  1YKD A;  3OCN A;  4HJ4 A;  3IBR A;  3KSH A;  4I5S A;  2JKT M;  4HI4 A;  1S4S A;  1UWP X;  4Y5F A;  2XSS A;  3E0Y A;  2J3T D;  2VJW A;  3LIF A;  5EFW A;  2PR5 A;  4CLC C;  2W3E A;  2PYR A;  2M1C A;  4G3W A;  3H7W B;  1S1Z A;  4BMW A;  2W3H A;  4CLC D;  3KX0 X;  4LPZ A;  2L0W A;  2JHE A;  3BY9 A;  1N9O A;  2VX8 A;  3T4T A;  1LSW A;  4NXF A;  5TJJ A;  1TF1 A;  4H6J A;  3HCY A;  3MF0 A;  4GS9 B;  3FG8 A;  3RFB A;  2KX6 A;  3JVU A;  1OPX A;  1T18 A;  2I9V A;  4GHI A;  4LLO B;  3PR6 A;  4PAU A;  4R70 A;  2PT7 A;  2XRO A;  4GJ4 A;  2D02 A;  4CLC B;  1LSV A;  4YWZ A;  3EQU A;  4CQH A;  4MN5 A;  3ZYT A;  4EER A;  1P9W A;  3RTY A;  5HSQ A;  1T1B A;  3KSG A;  5DFY A;  2XA7 M;  2HJE A;  5LBR A;  1D06 A;  3CAX A;  3S7O A;  3FPW A;  2QJ7 A;  2NUP C;  5G4Y A;  2OAP 1;  2ZOH A;  3UB6 A;  3PBT A;  1NWZ A;  3TW8 A;  4WLA A;  1XJ2 A;  4GW9 A;  1W63 M;  3UB9 A;  1YSQ A;  4WN5 A;  4DJ2 A;  4EEP A;  3LI9 A;  4KQD A;  1G6O A;  3PBS A;  4LRZ E;  1T19 A;  3PXP A;  1Y28 A;  4E04 A;  4HJ6 A;  3CUE C;  2CMN A;  5C5K A;  2Y8H A;  1OTE A;  2P08 A;  2PHY A;  4EW7 A;  5HZH A;  1JNU A;  5J4E A;  3T4S A;  3SW1 A;  3D72 A;  3OLO A;  3R7W B;  4L9G A;  4G3V A;  2DMW A;  2WKP A;  4Y3I A;  2O9A A;  4Z1W A;  3CIT A;  1TS0 A;  3CUE A;  2L1M A;  3LIC A;  4UQI S;  2OOL A;  3F1O B;  3CI6 A;  1XFN A;  4FSF A;  3S7P A;  2W1T A;  3UB7 A;  2LB9 A;  2VGL M;  2FZ0 A;  4DMZ A;  1G28 A;  2VV6 A;  4Q0H A;  1OT6 A;  2PR6 A;  3JVV A;  3OBF A;  3F1P A;  2VKS A;  5HPI A;  3MR0 A;  4NKP A;  5HL6 A;  2V9A A;  2A24 A;  4KQO A;  4MDZ A;  2MJ6 A;  4O8G A;  4G3K A;  3B42 A;  2QYB A;  5J3W A;  3VE3 A;  3PBO A;  2W0N A;  3EEH A;  4L0L A;  4I3J A;  4LRX C;  1NLY A;  3PYP A;  2EA9 A;  2EWW A;  2V0W A;  1DP9 A;  3RH8 B;  4YOF A;  4Q0I A;  3BY8 A;  3MQO A;  3W2Z A;  2OAQ 1;  4R3A A;  1OTB A;  3H82 A;  3E98 A;  3EOI A;  3K3C A;  3LI8 A;  2V1B A;  4WL9 A;  3BQA A;  1TS7 A;  3LR4 A;  1MC0 A;  4IJG A;  1P0Z A;  4L9F A;  3MMH A;  2WKQ A;  1S67 L;  1MZU A;  2JN7 A;  3V67 A;  2R78 A;  3KYZ A;  5HDC A;  1WA9 A;  3A0S A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...