1N9LA

Crystal structure of the phot-lov1 domain from chlamydomonas reinhardtii in the dark state.
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
109
structure length
109
Chain Sequence
GLRHTFVVADATLPDCPLVYASEGFYAMTGYGPDEVLGHNCRFLQGEGTDPKEVQKIRDAIKKGEACSVRLLNYRKDGTPFWNLLTVTPIKTPDGRVSKFVGVQVDVTS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords putative blue light receptor
publication title Crystal Structures and Molecular Mechanism of a Light-Induced Signaling Switch: The Phot-LOV1 Domain from Chlamydomonas reinhardtii
pubmed rcsb
source organism Chlamydomonas reinhardtii
molecule tags Electron transport
total genus 30
structure length 109
sequence length 109
ec nomenclature
pdb deposition date 2002-11-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13426 PAS_9 PAS domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 1n9lA00
2PYPA 3LI9A 2V0UA 4HJ4A 4HH2A 3LICA 4EEPA 4NXBA 5DKLA 1TS7A 4LRXC 5HWTA 5TBMB 1D7EA 3NOTC 2M1CA 2VV8A 3H9WA 5G4YA 2R78A 2D02A 1ODVA 3LUQA 3PHYA 1VB6A 2K7SA 5HZHA 2GJ3A 2V1AA 1LT0A 4L9FA 5G4ZA 5HWVA 3LIDA 4GS9B 3K3CA 3PYPA 1P97A 4F3LA 2L4RA 4EERA 1DRMA 1TS8A 2VV6A 4XT2B 3LIFA 3GDIA 1T1AA 5I5LA 3MJQA 5HDDA 1D06A 2V9AA 3H7WB 3ICYA 5KIZA 1OTEA 2VLGA 1OT6A 4MN6A 5F6AA 5HSQA 4I39A 1MZUA 2PD8A 1F98A 3MQOA 4EQ1A 5J7EA 1UWNX 3LI8A 5J3WA 5F68A 4HHDA 3P7NA 3IS2A 1OJ5A 2Z6DA 2B02A 4WF0A 2YKHA 4KUOA 2PR6A 4LRYC 3F1OA 2VV7A 2L0WA 2A24B 2CMNA 4I3IA 4PKYA 3A0RA 3E4QA 1KOUA 4GHIB 5IS1A 1XFQA 3D72A 1DP8A 3A0SA 2ZOIA 3MR0A 4M4XA 1XJ4A 5DJUA 2PHYA 1V9YA 2QKPA 5AVEA 1P0ZA 4EESA 4R38A 2EA9A 2D01A 2OOLA 1UGUA 3F1NB 1T1CA 4HOIA 3VE4A 4WL9A 5HDCA 1XJ2A 2VEAA 4XT2A 1LSVA 4WN5A 4I3JA 3BY9A 4NXGA 1N9LA 4I3AA 2J80A 2KDKA 5F5YA 4HQAA 4PKYG 5EFWA 3BWLA 4R6LA 2I9VA 3H7WA 3A0VA 3BY8A 5A8BA 1X0OA 1S4SA 1T19A 4I38A 2QJ7A 3CAXA 1Y28A 3E4PA 5IU1A 4HNBA 4JGQA 1DP9A 4MN5A 2JHEA 1OTBA 3GECA 4JGPA 1N9NA 2HV1A 2W27A 3FG8A 1GSWA 2WKPA 1S67L 3UB7A 4EXOA 4LRZE 2A24A 2QHKA 4K08A 4H6JB 1N9OA 4GHIA 3LIBA 3RH8B 4NXEA 5HDSA 4EW7A 5HD5A 1OTDA 1T1BA 4RQ9A 3UE6A 3UB9A 3H82B 5HD3A 3LIEA 1F9IA 4BBTA 1NWZA 1UWPX 2PR5A 3B33A 3ULFA 1EW0A 3F1NA 1S1ZA 4WUJA 2Z6CA 2PD7A 1S66L 2QJ5A 3LIAA 2OWHA 5TBMA 3ZQ5A 5HWWA 2INWA 5DJTA 2KX6A 1V9ZA 3C2WA 1T18A 4LPZA 1LSWA 2ZOHA 5AVFA 2PDRA 2BASA 4EEUA 4GS9A 3G6OA 3F1PB 2P7JA 4HJ3A 3CLOA 4HI4A 1JNUA 2L1MA 4DJ3A 2ZBBA 3OLOA 3EWKA 4JGRA 3IS2B 4L9EA 1GSXA 4GCZA 3T50A 4R3AA 1LL8A 2OWJA 3F1OB 1BYWA 3UMEA 1XJ6A 1OT9A 4KUKA 5F69A 3LYXA 3FC7A 3NOPC 4BBVA 5DKKA 1S1YA 2V1BA 4H6JA 1OTAA 4HH3A 4HP9A 2W0NA 3VE3A 3H82A 4E04A 2JN7A 1WA9A 3K3DA 4LLOB 2V0WA 3UB8A 3NJAA 1XFNA 1DP6A 2WKQA 2WKRA 3SW1A 1XJ3A 4HP4A 2YKFA 3HJKA 4L9GA 3CWFA 3F1PA 3UMDA 4HY8A 3IBRA 4KQDA 4EETB 4F3LB 3C8CA 1LSXA 3MFXA 4I5SA 4R70A 5J4EA 2H28A 4YWZA 1OTIA 3NOUC 4BBUA 4B9OA 1TS0A 3VOLA 4WLAA 4JGOA 1G28A 3E4OA 2QWSA 1OJGA 4HJ6A 3UB6A 3MXQA 1GSVA 1S4RA 1TS6A 3HJIA 3KX0X 4GW9A 4DJ2A 3RTYA 4NXFA 3NHQA 3EEHA 2PYRA 4HIAA 3MQQA
chains in the Genus database with same CATH superfamily
3LI9A 4GKUA 1WYBA 3LICA 3WS1A 3W2ZA 1GHIA 2JKRI 4DRTA 2VK3A 3T4JA 5TBMB 3T12B 4WEKA 1SDEA 3A3DA 4ETXA 3CUEA 4II7A 3TE8A 4CQHA 3VSKA 3LUQA 1VB6A 3VOZA 5FQMA 2ZC7A 3KYEA 2K7SA 1FCOA 2V1AA 4QD4A 4L9FA 2ZM0A 4IUHA 3R7WB 4OP5A 3PYPA 3MF0A 2H0TA 3V3SA 4MN7A 1RP5A 2VV6A 5GHZA 3Q7ZA 3T1XA 1XKZA 4WZ5A 4XT2B 3FPVA 3SZTA 4K91A 2IWDA 4MCWA 3P98A 1T1AA 4JXSA 5I5LA 1HLUP 3BFCA 1VEUA 3S1YA 3GQZA 3ICYA 3LCEA 1PNEA 5L09A 3Q7VB 5F6AA 1NXYA 5HSQA 2R9XA 4WZ4A 5DVAA 3TW8A 1SKFA 5J7EA 4CLCE 3ZVTA 5CEBA 3SH7A 4WMCD 2VGLM 5AJGA 4DMZA 4R3BA 3ZG5A 4OQGA 3O3VA 3PBOA 1W5DA 3C30A 3NDGA 1SKOA 2A24B 3BLSA 5HW3A 1U60A 4G3VA 3U2AA 3E4QA 3PAEA 1XFQA 2O99A 2DRWA 3O87A 4Y0TA 1LHYA 4PMAA 1K25A 4IVKA 2HJ9C 3N8SA 5AVEA 1P0ZA 4C75A 3MSHA 3V50A 2Y2IA 3OPPA 3DTMA 2XSSA 2J3TC 3VE4A 1RCJA 1NRFA 4DE1A 4R3JA 1LSVA 5A90A 4WN5A 4I3JA 5L8MA 1MKIA 2OSUA 1ZG4A 2B95A 3UO9A 4I3AA 2XH9A 2KDKA 4HQAA 3AGFA 3LR3A 5EFWA 1XGIA 4KZBA 4NG2A 3A0VA 3OPLA 3BY8A 5DF7A 4CLCB 1X0OA 3CZDA 3UPNA 1IFQA 3EOIA 4FCFA 3UB5P 2X71A 2XD5A 4JGQA 1JWZA 4MN5A 2H0YA 5U47A 1W8YA 1W63M 4UHUA 4FUWA 1WE4A 1N9NA 2A3UA 2HV1A 3MKEA 1XXMA 1PZOA 4Q0IA 2QYBA 2J7VA 5HAIA 4LRZE 2ZMFA 3C4PA 2HDRA 1H8MA 3V67A 4JBFA 4XUZA 4NEED 3HUOA 1ZHHB 1O07A 4H6JB 4GHIA 3CMZA 4GN2A 1KVMA 5DTKA 4KQQA 1H0MA 4WELA 1T1BA 2QPNA 4RQ9A 4JXGA 3B42A 1VETA 3H82B 3LY3A 3PR6A 3LIEA 5CECA 4B88A 4S2JA 3IX3A 4UA9A 1UWPX 1ALQA 2P9VA 3ULFA 3F1NA 5IT5A 4GD6A 5EECA 4WUJA 1PZPA 2PD7A 3ISGA 2NUPC 1D1JA 3IH8A 3QP8A 1ERQA 1YM1A 2J3TD 5DJTA 5EOOA 1KGGA 2E8JA 4XXRA 3IF6C 2P08A 4OQHA 1T18A 2Y2KA 2JC7A 3HLBA 2BASA 4EEUA 4GS9A 2ZLYA 3MKFA 4UQIS 1JNUA 1AWIA 1DJAA 3OCNA 4DJ3A 1MY8A 1BLCA 4N9KA 5CHJA 4ZAMA 4DE0A 3OLOA 1RGZA 4L9EA 3OZHA 3WRZA 2WUQA 5FQQA 3GR2A 3VP0A 3T50A 1CEGA 1G6AA 1NJ4A 1HD8A 3BLMA 3W4PA 2OWJA 1E25A 1L0GA 3NCKA 2DNSA 4IUKA 3NOPC 3T1QB 2O9CA 1OTAA 4FTXA 3VV4A 3AGEA 3SS3A 4GD8A 4NETA 5HPFA 3JVVA 4UEYA 1DJCA 1I2WA 3U4LP 3O86A 3UB8A 1GA9A 4PM9A 1XFNA 4QY6A 4QU3A 2C5WB 3EGXC 3S7QA 1P9WA 3HL9A 3UNWA 2ZJ9A 2Z2MB 1PW1A 3N8LA 3SW1A 5E2GA 4S2KA 4ZJ2A 1ES2A 3BFDA 4EV4A 3T4SA 4WM9A 1K57C 3IBRA 1EI5A 1YLTA 1LSXA 4IJGA 3N7WA 4BBUA 2PRFA 3FKWA 3CI6A 4Y3IA 2XR0A 1L0FA 1JTGA 3VOLA 4NK3A 2JKGA 4C3QA 2Y2QA 3E4OA 1YLZA 5HL6A 2HDQA 4HJ6A 1K55C 3MXQA 4PM7A 3T4TA 3MXRA 1TS6A 4S2PA 2ZMAA 5EVIC 1KE0A 1MBLA 2P9VB 4HIAA 4GZBA 4WEJA 3MQQA 1ACFA 3LR5A 2V0UA 2Y8HA 4HJ4A 1H8ZA 3CJMA 1O7EA 4NXBA 4N1HA 1TS7A 4DE2A 1I5QA 5HWTA 2Y91A 4YOFA 4KZ3A 3RXWA 2VGJA 4P6ZM 2R78A 3JVUA 3PHYA 4MEZA 1FSWA 4OPQA 4A5RA 4K0XA 1GHPA 5D3OA 1IYPA 5G4ZA 5HWVA 4X1LA 3CG5A 1YSPA 4GS9B 4IBRA 2ZL1A 5FL3A 4F3LA 1K54C 1TS8A 3L9KA 5FATA 2A49A 3HVFA 2WK0A 1TVFA 2V9AA 5CERA 3H7WB 1MC0A 1CJFA 4O0PA 1OT6A 1IYOA 3KSFA 3V3RA 4XUXA 5AQ9A 1IKIA 4YINA 2WGWB 1NLZA 4I39A 2PD8A 2HDSA 3MZFA 1LL9A 4EQ1A 4ZBEA 2WKIA 4OONA 5GLCA 4BL2A 3VFFA 2W1TB 1ES5A 4BQMA 4GOGA 4HEFA 5E2EA 3P7NA 3IS2A 4ZJ3A 2B02A 4BJPA 1KDSA 1FR1A 2PR6A 3MFDA 2J9PA 4YFMA 3RXXA 1ZC2A 3C7VA 2HP9A 4Y13A 5CGXA 1VQQA 4I3IA 4GLQA 2ZM2A 5EVID 4PKYA 2Y2HA 3A0RA 1YMSA 3KYQA 5FSRA 1PWGA 2ZC4B 5TFQA 1DP8A 3A0SA 2ZOIA 2XRNA 4M4XA 1BT5A 2XROA 5F82A 1XJ4A 5KMWA 4BD1A 2BTFP 1IYQA 4R38A 1BTLA 2EA9A 4BLMA 2D01A 5M1AA 1UGUA 5DF9A 4BENA 4ZJ1A 3IF6A 3I7JA 3N6IA 2VEAA 5JYPA 3OPHA 1I2SA 5FAOA 4MLLA 1JTDA 3GVBA 3LEZA 2VX8A 4MDZA 4GDBA 1YPRA 1FSYA 5HARA 1ZG6A 5A8BA 4Z1WA 1EROA 3HREA 2H10A 4N1XA 4R4SA 1ONGA 2PBDP 2QMIA 1S4SA 3MBZA 1OPXA 4S2LA 1JWVA 1XGJA 3CAXA 1Y28A 3E4PA 4G3KA 3T1RA 4HNBA 4E3KA 1OTBA 2Y4AA 4KZ8A 5GHXA 4D2OA 3A3IA 5GL9A 1AXBA 3IHBA 3CPTA 1S67L 4DKIA 2OLVA 2W3DA 1IYSA 3WS0A 4KZ9A 2DMWA 3TSGA 3W4OA 4LCMA 5MC7A 3TJZC 5HDSA 4EW7A 3LEQA 1YLPA 5KSCA 2WKHA 4PHTA 1ES4A 1XX2A 1FCNA 1YT4A 3SS4A 2GX5A 1EWZA 4IVIA 1PIOA 2O9BA 1TD5A 1DY6A 2PBYA 1BULA 2HP5A 4S2NC 4OPRA 2JKFA 4X68A 3O5YA 3ZHHA 2OWHA 1Y4OA 2OV5A 2M7VA 5HWWA 4JPMA 2ZC6B 1K57A 3HLDA 3JYIA 1KVLA 2XF3A 1N9BA 3TRCA 3GTCA 4DDSA 3QP2A 3C2WA 3ZDJA 1F5MA 5JYOA 1LSWA 2ZOHA 4MBHA 4JF6A 4M3KA 2PDRA 5E43A 3G6OA 3F1PB 2IA2A 3IT9A 4QHCA 1J3WA 2A2LA 3D4FA 3UE0A 3EWKA 3IS2B 5DFXA 3ZFZA 1GSXA 1MWSA 3DWKA 1K55A 1Q2QA 4FH2A 4E3OA 3UMEA 1XJ6A 2I72A 1W79A 5F69A 5A93A 1KGEA 3HUMA 1KE3A 4L0LA 3FC7A 5EVIA 1S1YA 1WYCA 4HP9A 1MWUA 3A3FA 3VE3A 1KDWA 3Q1FA 3T4LA 5FI2A 1L3LA 3B3XA 3VFHA 2EX6A 2O0YA 2NUTC 4OH0A 4FH4A 4P85A 4Y7PA 1WA9A 3K3DA 4KZ4A 3G32A 1L0EA 2DCFA 1ZTUA 2V20A 4JF5A 1HZOA 3UPOA 5FQIA 3BFGA 4LV0A 1M6KA 2WKQA 3BFFA 4KG6A 1K54A 2P74A 4OLDA 2Q0OA 1DJBA 1XJ3A 4OOYA 4HP4A 3VMAA 3LFVA 2ACGA 2YKFA 4L9GA 4N92A 2GDNA 4KQDA 5KZHA 3W8KA 1CF0A 4ME4A 2XK1A 3V39A 5I94A 5CHUA 1NZUA 4R70A 5J4EA 3WS5A 4OOLA 5KSHA 5HPIA 3UPPA 3C7UA 2W3GA 1VEUB 1IELA 4KG2A 3ZGAB 4JLFA 3C38A 5L2FA 1G28A 3G35A 4ZRRA 4HESA 4O01A 2G2WA 2EX8A 2QWSA 2VZWA 4ZDXA 1TDGA 4P6ZS 1RGYA 3V5MA 1YLJA 5CGWA 2W3HA 4R23A 1S4RA 3HJIA 3KX0X 4GW9A 3UY6A 1ESUA 4NXFA 4P87A 2W1RA 2XA7S 3PBRA 3W4QA 2JE5A 5EV0A 4FD8A 1XPBA 2ZQ7A 3QP4A 1VHMA 3T4QA 4HBTA 5EM0A 3M2KA 1SKOB 1YLWA 2OAP1 4LRXC 2RCXA 1NZOA 5AQAA 5DTSA 4R1GA 4RYEA 1D7EA 2JBFA 3NOTC 4GNUA 4EU0A 5M18A 1K56D 2X02A 2M1CA 3H9WA 2D02A 1ODVA 4BL3A 3RJUA 4LV2A 3QP1A 3IWOA 5E2FA 5HZHA 1H5XA 4RA7A 3D3OA 2GJ3A 3IXBA 1LT0A 2Y79A 4LV1A 4EBNA 3WS4A 3ZCZA 3EGDC 2J8YA 4MBKA 3K3CA 2VKSA 5FA7A 2L4RA 3BEBA 3OC2A 3IXDA 3ZYTA 1LL5A 3LIFA 3MJQA 5HDDA 2PAVP 1L0DA 5A92A 4WBGA 3S7NA 4KZ5A 4OQIA 1TEMA 1CQAA 5KIZA 2VLGA 2KLIA 2PU4A 2EFUA 1CK3A 2W3FA 2IWCA 1SZVA 3NIAA 5CX7A 2G2UA 1MZUA 4OP8A 2WADA 2XQZA 3L7HA 3MQOA 4X53A 3VP4A 2IWBA 1FQGA 2EWWA 5K5BA 4HHDA 2FZ0A 5FDHA 1OJ5A 1S0WA 3KO6A 3SOIA 4PM5A 4HBUA 4KUOA 4FSFA 3F1OA 3UN7A 2BG1A 4OPZA 3E2KA 3NC8A 2L0WA 2OAQ1 1E3UD 3PAGA 1BZAA 5CTMA 2Y2LA 3IX4A 4E6WA 4GHIB 5IS1A 3D72A 4N9LA 1KGFA 1NY0A 4S2NA 4DE3A 2PHYA 1TDLA 1VETB 2QKPA 5AQ7A 3IF5A 2Y2PA 3G31A 4EESA 4KZ6A 2OOLA 3O88A 2ZMVA 4S2OA 3F1NB 3LY4A 4B93A 2O9AA 5GLAA 3K2NA 2EFXA 2K2NA 4WL9A 1NLYA 1M40A 1GCEA 1K6RA 5HDCA 1XJ2A 4XT2A 1PYYA 3CITA 1JVJA 4KENB 5FAPA 5CGSA 3EQVA 2J80A 3G4PA 1H3QA 4R6LA 2I9VA 4DDYA 3QNCA 2FFFB 4EWFA 2WZXA 1PWCA 5F1FA 2QJ7A 4GJ4A 5IU1A 3DTIA 2VGLS 4UQIM 2WKEA 5TGFA 1ESIA 3VP3A 2JHEA 2EX2A 3GECA 4JGPA 4H8RA 4S2IA 4C6YA 1NYYA 1MWTA 2ZQAA 1N4OA 3FG8A 1GSWA 1W63Q 3IWIA 2WKPA 1J9MA 4UAAA 1K4FA 1SCWA 4X55A 4EXOA 2A24A 1E4DA 2QHKA 4K08A 2EXBA 1H8YA 5FQ9A 1XA1A 5HAQA 2PT7A 4O8GA 4ID4A 2V1ZA 1N9OA 4YNRA 3RH8B 4NXEA 1K56A 2Q9MA 5HD5A 3NY4A 3R4KA 1OTDA 3UE6A 3KSIA 2Y59A 2CC1A 3HLGA 4KG5A 4G3WA 1F9IA 3FYZA 4PPRA 1MWRA 1NRJA 2K31A 1NWZA 3B33A 2ZQ9A 2ZQ8A 2Z6CA 5A91A 3DTKA 4BD0A 1CI8A 3LO7A 3ZQ5A 1YAXA 4EBPA 2KX6A 2Y2MA 3T4OA 4KQOA 3S4XA 1PFLA 1STZA 1V9ZA 3BYDA 2UWXA 3IQAA 4LPZA 5EOEA 2XLNA 3D9YA 5BOHA 5AVFA 4EBLA 3PXPA 4QWOA 4MBFA 3HLCA 3S22A 3CLOA 2W3EA 4HI4A 2L1MA 4Q8IA 4Y2FA 3LR4A 2Y2GA 1K38A 5GHYA 2KOIA 4U3TA 2V2FF 2FFYA 1LL8A 3F1OB 1BYWA 4S2MA 4D60A 4UA7A 5L10A 1OT9A 1E3UA 1XP4A 2M7UA 2V1BA 1K0KA 4H6JA 2WAEA 1FIKA 4OOMA 4HH3A 5LBRA 5TR7A 5F1GA 3H82A 3MZEA 3S7OA 4Y5FA 3WRTA 4IBXA 3ZG9B 5EVEA 4LLOB 2V0WA 4F94A 2HZ5A 5EM1A 2V8FA 5FQJA 4QPRA 1YLYA 1MKMA 3Q07A 3DWZA 4LENA 3ITBA 1LI0A 2HPBA 1PI5A 4GB7A 1ERMA 2XFSA 3OBFA 4RX3A 1LI9A 2HP6A 2BLSA 3HUNA 4OQ0A 2LB9A 2JKRM 1W7FA 3CWFA 2ZL1B 1YKDA 4F3LB 4U0TA 1A0KA 3P09A 3MQ0A 4IEDA 5FDSA 2ZM8A 3FZCA 4P0MA 2H28A 4OLGA 1BSGA 1OTIA 2HF6A 4OKPA 2UV0E 4GDNA 3PBNA 3GSGA 3UE3A 3LR0A 2WZZA 4U0XA 2JCHA 5IHVA 3C5AA 4JGOA 4EUVA 2Y2JA 1ES3A 5GLBA 1OMEA 5CTNA 3C4OA 1Z6FA 4R0QA 1Y54A 4DXBA 3UDFA 2C6WB 3KSHA 1GA0A 4DJ2A 3NBLA 1NYMA 3DTEA 4LCLA 3RTYA 3NHQA 3T1SA 5DF8A 2ZC5B 2Z2LB 1FR6A 3EEHA 4BWIA 1CEFA 2PYRA 4B4ZA 4K0WA 3VOYA 1CI9A 4Y15A 2PYPA 4P6BA 2FH5A 2XD1A 4HH2A 4JXVA 4X1MA 4EEPA 4E3MA 3Q82A 4DN0A 1L2SA 3PBSA 5DKLA 2GZAA 5FASA 2ZC3B 3BFEA 2H5SA 5EPHA 2VV8A 5G4YA 3IX8A 3LGOA 3OOVA 3A3JA 3IXHA 4NKPA 4O7DA 3E0YA 3MS6A 4JKTA 2B18A 3LIDA 4LFUA 4CPKA 3BECA 4OPYA 1P97A 5FAQA 4EERA 1DRMA 5FI7A 3S7PA 4EUZA 3IF6B 5EUAA 1W8QA 2V8CA 4KZ7A 3GDIA 3UE1A 1IOUA 1ZKJA 1D06A 4ETZA 4RX2A 4X6TA 3ITAA 2J9OA 3N4IA 3E98A 1OTEA 4E3LA 4X56A 1IEMA 1FILA 4MN6A 1VM1A 4E6XA 1GHMA 3WS2A 3SS5A 1Q2PA 1F98A 1QMFA 1UWNX 5HL1A 3LI8A 3CHWP 5J3WA 3SH9A 3B47A 5F68A 4CLCC 4KZAA 1XA7A 2Z6DA 3G2YA 3NECA 2ZQDA 4WF0A 2YKHA 3CPTB 1P9RA 5AQBA 4LRYC 2WGIA 2VV7A 3VSLA 3GRJA 1F2KA 4MNRA 2CMNA 2LB5A 4QY5A 4ARZA 1KOUA 3E2LA 3A3EA 3MR0A 2XDMA 3G30A 5DJUA 4BMWA 1V9YA 4AFIA 3KYZA 3QHYA 4Y17A 4LGWA 5CRFA 1T1CA 3JPUA 1YQSA 3CUEC 4HOIA 5J8XA 1PI4A 4WMCA 3Q81A 4UA6A 3BY9A 4NXGA 3WWXA 3HBRA 3TOIA 1N9LA 5F5YA 4PKYG 1S6RA 3BWLA 3H7WA 5CXWA 4PAUA 1YMXA 4WZ5C 5DFYA 3HLWA 2WGWA 2VA0A 1T19A 4I38A 3BJNA 4Y0UA 4JF4A 1PWDA 1FCMA 2W1TA 2E8IA 3EQUA 1DP9A 1HVBA 4X25A 1TF1A 2B5RA 2EX9A 1K4EA 3IH9A 3M6BA 5G18A 2W27A 3G34A 2WAFA 4CLCD 3UB7A 4MMNA 1FOFA 2XFTA 1G68A 3NDEA 3UDIA 2Y55A 1K6SA 5EVIB 5FI6A 4QB8A 3LIBA 3ZVWA 3ZNYA 1BLPA 3UB9A 4Z9QA 5L07A 2G7UA 5HD3A 5F83A 3PBTA 4JXWA 2MJ6A 2JKTI 4BBTA 1PW8A 2PR5A 4PM6A 5E2HA 3ZG7B 1EW0A 3RFBA 1S1ZA 4B4XA 1C3BA 2VGKA 1S66L 2QJ5A 3LIAA 5TBMA 4RVAA 3N8RA 1PRQA 5EE8A 3TG9A 3PTEA 2INWA 1ONHA 3QNBA 4PM8A 1QMEA 3HCYA 4FOFA 1G5UA 4ESPA 1JWPA 3GV9A 3R7WA 3VP2A 5M19A 2HJEA 2P7JA 4HJ3A 3QP6A 2WYXA 1LLBA 3MXSA 5CHMA 5TJJA 1BLHA 1MPLA 2HGVA 3SH8A 3FKVA 2ZBBA 5CEDA 4JGRA 4E3NA 1IKGA 5HX9A 3AGDA 2JKTM 4GCZA 3IXGA 4Q0HA 2HDUA 4R3AA 2EWVA 3HLFA 3BRMA 3DW0A 3IHAA 3IWQA 4CJNA 5HFOA 2X01A 4Y0OA 4DXCA 3MZDA 2OLUA 3T4KA 1BLSA 3ZG0A 1YSQA 3Q7VA 4KUKA 3BW6A 2XEPA 1Z09A 3LYXA 5EVLA 2ZQCA 4BBVA 5GLDA 5DKKA 4ZTKA 4ARZB 1HTZA 2GNXA 3G2ZA 2W0NA 1BUEA 3NI9A 4E04A 2VJWA 3FV7A 3MMHA 2JN7A 5FEFA 4EQIA 2AVXA 2XA7M 3GMWA 2Y2OA 3ZNTA 3NJAA 4IHQA 3BM6A 1DP6A 3EEAA 4OVDA 2WKRA 4X69A 5FEGA 2Q9NA 2XGNA 2R9WA 4LV3A 2WGVA 3HJKA 3F1PA 1SHVA 3M2JA 4HY8A 3UMDA 3VP1A 4QJGA 4EETB 3C8CA 1G6OA 3NULA 4KQRA 1MXOA 3OPRA 3OCLA 5DTTA 2P04A 3MFXA 3DAVA 4I5SA 3BQAA 3IBJA 4YWZA 2PU2A 5FQKA 3NOUC 5HAPA 3M6HA 2QZ6A 3FPWA 1TS0A 3FWLA 5C5KA 4B9OA 4WLAA 3PBQA 1SDNA 4CLCA 3ZG8B 3P01A 1OJGA 4Q0JA 2RL3A 1KE4A 3DBAA 3UB6A 4DF6A 3UDXA 4E3IA 2ZD8A 2Y2NA 1GSVA 2J3WA 4R4RA 3BQ8A 3HLEA 3KSGA 4WYYA 3QP5A 4E3JA 2EXAA
chains in the Genus database with same CATH topology
2PYPA 3LI9A 3LR5A 2V0UA 2Y8HA 2FH5A 4HJ4A 4HH2A 3LICA 1VHMA 3T4QA 4EEPA 4NXBA 4DN0A 2OAP1 3PBSA 5DKLA 1TS7A 3W2ZA 2GZAA 2JKRI 4LRXC 5HWTA 3T4JA 5TBMB 4WEKA 4YOFA 1D7EA 3NOTC 4EU0A 2M1CA 4ETXA 2VV8A 3CUEA 3H9WA 4II7A 4P6ZM 2R78A 5G4YA 3TE8A 4CQHA 2D02A 3OOVA 1ODVA 3JVUA 4NKPA 3LUQA 3PHYA 1VB6A 3E0YA 2K7SA 5HZHA 3D3OA 2GJ3A 2V1AA 1LT0A 2B18A 2Y79A 4L9FA 5G4ZA 5HWVA 3LIDA 4IUHA 1YSPA 4GS9B 3EGDC 3R7WB 3K3CA 5FL3A 3PYPA 1P97A 3MF0A 4F3LA 2VKSA 4MN7A 2L4RA 4EERA 1DRMA 1TS8A 3S7PA 2VV6A 3OC2A 3ZYTA 4XT2B 3FPVA 3LIFA 3GDIA 4MCWA 1T1AA 5I5LA 3MJQA 5HDDA 1IOUA 1D06A 4ETZA 2V9AA 3S7NA 3H7WB 1MC0A 3E98A 4O0PA 3ICYA 5KIZA 1OTEA 2VLGA 1OT6A 2KLIA 4MN6A 3KSFA 5F6AA 2W3FA 5CX7A 5HSQA 1NLZA 4I39A 1MZUA 2PD8A 1F98A 3MQOA 3TW8A 4EQ1A 5J7EA 1UWNX 3LI8A 4CLCE 5J3WA 3B47A 2EWWA 2W1TB 5F68A 5K5BA 4CLCC 2VGLM 4HHDA 2FZ0A 3P7NA 3IS2A 5AJGA 4DMZA 1OJ5A 2Z6DA 3KO6A 2B02A 4WF0A 2YKHA 4BJPA 1P9RA 4KUOA 3PBOA 2PR6A 4LRYC 3C30A 4FSFA 3F1OA 2VV7A 2L0WA 2A24B 2OAQ1 2CMNA 4GLQA 4I3IA 4PKYA 2LB5A 4G3VA 3U2AA 4ARZA 3A0RA 3KYQA 3E4QA 1KOUA 4GHIB 5IS1A 1XFQA 2O99A 4WEJA 3D72A 1DP8A 3A0SA 2ZOIA 3MR0A 2XRNA 4M4XA 2XROA 1XJ4A 5DJUA 2PHYA 4BMWA 1V9YA 2HJ9C 2QKPA 4AFIA 3KYZA 5AVEA 1P0ZA 4EESA 4R38A 2EA9A 2D01A 2OOLA 1UGUA 2ZMVA 3F1NB 5DF9A 2XSSA 1T1CA 2J3TC 4B93A 2O9AA 3CUEC 4HOIA 3K2NA 3VE4A 2K2NA 4WL9A 1NLYA 5HDCA 1XJ2A 2VEAA 4XT2A 1LSVA 3CITA 4WN5A 4I3JA 5L8MA 3BY9A 4NXGA 3EQVA 1N9LA 4I3AA 2J80A 2KDKA 5F5YA 4HQAA 4PKYG 3LR3A 2VX8A 4MDZA 1H3QA 5EFWA 3BWLA 4R6LA 2I9VA 3H7WA 3A0VA 4PAUA 3BY8A 5A8BA 4Z1WA 5DFYA 4CLCB 1X0OA 1S4SA 1T19A 2VA0A 1IFQA 3EOIA 4I38A 1OPXA 2QJ7A 4GJ4A 3CAXA 3BJNA 1Y28A 3E4PA 4G3KA 5IU1A 4HNBA 2VGLS 4UQIM 2W1TA 4JGQA 3EQUA 1DP9A 4MN5A 2JHEA 1OTBA 1TF1A 1W63M 3GECA 4JGPA 1N9NA 2HV1A 2W27A 3FG8A 1GSWA 1W63Q 2WKPA 1S67L 4Q0IA 4CLCD 2QYBA 3UB7A 4EXOA 4LRZE 2A24A 4MMNA 2QHKA 2ZMFA 4K08A 2W3DA 1H8MA 3V67A 2PT7A 2DMWA 4O8GA 4NEED 1ZHHB 4H6JB 1N9OA 4GHIA 5MC7A 3LIBA 3TJZC 4YNRA 3RH8B 4NXEA 5HDSA 4EW7A 4WELA 5HD5A 3R4KA 1OTDA 1T1BA 4RQ9A 3UE6A 3KSIA 4PHTA 3UB9A 2G7UA 3B42A 3H82B 5HD3A 3PR6A 3LIEA 2GX5A 3PBTA 4G3WA 1F9IA 2MJ6A 1NRJA 2JKTI 1NWZA 2K31A 4BBTA 2O9BA 1UWPX 2PR5A 1TD5A 3B33A 3ULFA 1EW0A 3RFBA 3F1NA 1S1ZA 5IT5A 4WUJA 2Z6CA 2PD7A 1S66L 2NUPC 2QJ5A 3O5YA 3LIAA 2OWHA 5TBMA 2M7VA 3ZQ5A 5HWWA 1YAXA 2J3TD 2INWA 5DJTA 2KX6A 3T4OA 4KQOA 3HCYA 1STZA 1V9ZA 3TRCA 4FOFA 2P08A 3C2WA 1F5MA 1T18A 4LPZA 1LSWA 2ZOHA 5AVFA 2PDRA 3PXPA 2BASA 4EEUA 4GS9A 3G6OA 3R7WA 2HJEA 3F1PB 2P7JA 4HJ3A 3CLOA 2W3EA 2IA2A 4HI4A 4UQIS 1JNUA 5TJJA 3OCNA 2L1MA 2HGVA 4DJ3A 2A2LA 2ZBBA 4Y2FA 3LR4A 3OLOA 3EWKA 4JGRA 3IS2B 4L9EA 5DFXA 1GSXA 2JKTM 4GCZA 2KOIA 4Q0HA 3T50A 4R3AA 2EWVA 1LL8A 2OWJA 3F1OB 1BYWA 3UMEA 1XJ6A 3T4KA 1YSQA 1OT9A 4KUKA 5F69A 3BW6A 4L0LA 3LYXA 3FC7A 4IUKA 3NOPC 4BBVA 2M7UA 1S1YA 5DKKA 2V1BA 4H6JA 4ARZB 2O9CA 1OTAA 4OOMA 4HH3A 4HP9A 2GNXA 2W0NA 5LBRA 3VV4A 3VE3A 3H82A 4E04A 2VJWA 3MMHA 3T4LA 2JN7A 2O0YA 2NUTC 5HPFA 3JVVA 4UEYA 3S7OA 1WA9A 4Y5FA 2XA7M 3K3DA 4LLOB 2V0WA 3UB8A 3NJAA 4IHQA 1ZTUA 1XFNA 4QPRA 1DP6A 1MKMA 3EGXC 2WKQA 3S7QA 1P9WA 3EEAA 2WKRA 3OBFA 3SW1A 1XJ3A 4HP4A 3T4SA 2LB9A 2JKRM 3LFVA 2YKFA 3HJKA 4L9GA 3CWFA 3F1PA 3UMDA 4HY8A 3IBRA 4KQDA 1YKDA 4EETB 4F3LB 3C8CA 4ME4A 1G6OA 1LSXA 3MQ0A 4IJGA 3OCLA 2P04A 3MFXA 4I5SA 4R70A 3BQAA 2H28A 5J4EA 3IBJA 4OOLA 4YWZA 5KSHA 1OTIA 3NOUC 5HPIA 2HF6A 4BBUA 2W3GA 3PBNA 3CI6A 3FPWA 1TS0A 5C5KA 4Y3IA 3UE3A 4B9OA 3LR0A 3VOLA 4WLAA 3PBQA 4CLCA 3C38A 4JGOA 1G28A 4ZRRA 4EUVA 4O01A 3E4OA 2QWSA 3P01A 1OJGA 2VZWA 5HL6A 4HJ6A 4Q0JA 3DBAA 3UB6A 4P6ZS 3MXQA 3T4TA 1GSVA 2W3HA 1S4RA 1TS6A 3HJIA 3KSHA 3KX0X 4GW9A 4DJ2A 2J3WA 3BQ8A 3RTYA 4NXFA 3NHQA 3KSGA 2W1RA 2XA7S 3EEHA 3PBRA 4BWIA 2PYRA 4HIAA 3MQQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2PYP A;  3LI9 A;  2V0U A;  4HJ4 A;  4HH2 A;  3LIC A;  4EEP A;  4NXB A;  5DKL A;  1TS7 A;  4LRX C;  5HWT A;  5TBM B;  1D7E A;  3NOT C;  2M1C A;  2VV8 A;  3H9W A;  5G4Y A;  2R78 A;  2D02 A;  1ODV A;  3LUQ A;  3PHY A;  1VB6 A;  2K7S A;  5HZH A;  2GJ3 A;  2V1A A;  1LT0 A;  4L9F A;  5G4Z A;  5HWV A;  3LID A;  4GS9 B;  3K3C A;  3PYP A;  1P97 A;  4F3L A;  2L4R A;  4EER A;  1DRM A;  1TS8 A;  2VV6 A;  4XT2 B;  3LIF A;  3GDI A;  1T1A A;  5I5L A;  3MJQ A;  5HDD A;  1D06 A;  2V9A A;  3H7W B;  3ICY A;  5KIZ A;  1OTE A;  2VLG A;  1OT6 A;  4MN6 A;  5F6A A;  5HSQ A;  4I39 A;  1MZU A;  2PD8 A;  1F98 A;  3MQO A;  4EQ1 A;  5J7E A;  1UWN X;  3LI8 A;  5J3W A;  5F68 A;  4HHD A;  3P7N A;  3IS2 A;  1OJ5 A;  2Z6D A;  2B02 A;  4WF0 A;  2YKH A;  4KUO A;  2PR6 A;  4LRY C;  3F1O A;  2VV7 A;  2L0W A;  2A24 B;  2CMN A;  4I3I A;  4PKY A;  3A0R A;  3E4Q A;  1KOU A;  4GHI B;  5IS1 A;  1XFQ A;  3D72 A;  1DP8 A;  3A0S A;  2ZOI A;  3MR0 A;  4M4X A;  1XJ4 A;  5DJU A;  2PHY A;  1V9Y A;  2QKP A;  5AVE A;  1P0Z A;  4EES A;  4R38 A;  2EA9 A;  2D01 A;  2OOL A;  1UGU A;  3F1N B;  1T1C A;  4HOI A;  3VE4 A;  4WL9 A;  5HDC A;  1XJ2 A;  2VEA A;  4XT2 A;  1LSV A;  4WN5 A;  4I3J A;  3BY9 A;  4NXG A;  1N9L A;  4I3A A;  2J80 A;  2KDK A;  5F5Y A;  4HQA A;  4PKY G;  5EFW A;  3BWL A;  4R6L A;  2I9V A;  3H7W A;  3A0V A;  3BY8 A;  5A8B A;  1X0O A;  1S4S A;  1T19 A;  4I38 A;  2QJ7 A;  3CAX A;  1Y28 A;  3E4P A;  5IU1 A;  4HNB A;  4JGQ A;  1DP9 A;  4MN5 A;  2JHE A;  1OTB A;  3GEC A;  4JGP A;  1N9N A;  2HV1 A;  2W27 A;  3FG8 A;  1GSW A;  2WKP A;  1S67 L;  3UB7 A;  4EXO A;  4LRZ E;  2A24 A;  2QHK A;  4K08 A;  4H6J B;  1N9O A;  4GHI A;  3LIB A;  3RH8 B;  4NXE A;  5HDS A;  4EW7 A;  5HD5 A;  1OTD A;  1T1B A;  4RQ9 A;  3UE6 A;  3UB9 A;  3H82 B;  5HD3 A;  3LIE A;  1F9I A;  4BBT A;  1NWZ A;  1UWP X;  2PR5 A;  3B33 A;  3ULF A;  1EW0 A;  3F1N A;  1S1Z A;  4WUJ A;  2Z6C A;  2PD7 A;  1S66 L;  2QJ5 A;  3LIA A;  2OWH A;  5TBM A;  3ZQ5 A;  5HWW A;  2INW A;  5DJT A;  2KX6 A;  1V9Z A;  3C2W A;  1T18 A;  4LPZ A;  1LSW A;  2ZOH A;  5AVF A;  2PDR A;  2BAS A;  4EEU A;  4GS9 A;  3G6O A;  3F1P B;  2P7J A;  4HJ3 A;  3CLO A;  4HI4 A;  1JNU A;  2L1M A;  4DJ3 A;  2ZBB A;  3OLO A;  3EWK A;  4JGR A;  3IS2 B;  4L9E A;  1GSX A;  4GCZ A;  3T50 A;  4R3A A;  1LL8 A;  2OWJ A;  3F1O B;  1BYW A;  3UME A;  1XJ6 A;  1OT9 A;  4KUK A;  5F69 A;  3LYX A;  3FC7 A;  3NOP C;  4BBV A;  5DKK A;  1S1Y A;  2V1B A;  4H6J A;  1OTA A;  4HH3 A;  4HP9 A;  2W0N A;  3VE3 A;  3H82 A;  4E04 A;  2JN7 A;  1WA9 A;  3K3D A;  4LLO B;  2V0W A;  3UB8 A;  3NJA A;  1XFN A;  1DP6 A;  2WKQ A;  2WKR A;  3SW1 A;  1XJ3 A;  4HP4 A;  2YKF A;  3HJK A;  4L9G A;  3CWF A;  3F1P A;  3UMD A;  4HY8 A;  3IBR A;  4KQD A;  4EET B;  4F3L B;  3C8C A;  1LSX A;  3MFX A;  4I5S A;  4R70 A;  5J4E A;  2H28 A;  4YWZ A;  1OTI A;  3NOU C;  4BBU A;  4B9O A;  1TS0 A;  3VOL A;  4WLA A;  4JGO A;  1G28 A;  3E4O A;  2QWS A;  1OJG A;  4HJ6 A;  3UB6 A;  3MXQ A;  1GSV A;  1S4R A;  1TS6 A;  3HJI A;  3KX0 X;  4GW9 A;  4DJ2 A;  3RTY A;  4NXF A;  3NHQ A;  3EEH A;  2PYR A;  4HIA A;  3MQQ A; 
#chains in the Genus database with same CATH topology
 3LI9 A;  4GKU A;  1WYB A;  3LIC A;  3WS1 A;  3W2Z A;  1GHI A;  2JKR I;  4DRT A;  2VK3 A;  3T4J A;  5TBM B;  3T12 B;  4WEK A;  1SDE A;  3A3D A;  4ETX A;  3CUE A;  4II7 A;  3TE8 A;  4CQH A;  3VSK A;  3LUQ A;  1VB6 A;  3VOZ A;  5FQM A;  2ZC7 A;  3KYE A;  2K7S A;  1FCO A;  2V1A A;  4QD4 A;  4L9F A;  2ZM0 A;  4IUH A;  3R7W B;  4OP5 A;  3PYP A;  3MF0 A;  2H0T A;  3V3S A;  4MN7 A;  1RP5 A;  2VV6 A;  5GHZ A;  3Q7Z A;  3T1X A;  1XKZ A;  4WZ5 A;  4XT2 B;  3FPV A;  3SZT A;  4K91 A;  2IWD A;  4MCW A;  3P98 A;  1T1A A;  4JXS A;  5I5L A;  1HLU P;  3BFC A;  1VEU A;  3S1Y A;  3GQZ A;  3ICY A;  3LCE A;  1PNE A;  5L09 A;  3Q7V B;  5F6A A;  1NXY A;  5HSQ A;  2R9X A;  4WZ4 A;  5DVA A;  3TW8 A;  1SKF A;  5J7E A;  4CLC E;  3ZVT A;  5CEB A;  3SH7 A;  4WMC D;  2VGL M;  5AJG A;  4DMZ A;  4R3B A;  3ZG5 A;  4OQG A;  3O3V A;  3PBO A;  1W5D A;  3C30 A;  3NDG A;  1SKO A;  2A24 B;  3BLS A;  5HW3 A;  1U60 A;  4G3V A;  3U2A A;  3E4Q A;  3PAE A;  1XFQ A;  2O99 A;  2DRW A;  3O87 A;  4Y0T A;  1LHY A;  4PMA A;  1K25 A;  4IVK A;  2HJ9 C;  3N8S A;  5AVE A;  1P0Z A;  4C75 A;  3MSH A;  3V50 A;  2Y2I A;  3OPP A;  3DTM A;  2XSS A;  2J3T C;  3VE4 A;  1RCJ A;  1NRF A;  4DE1 A;  4R3J A;  1LSV A;  5A90 A;  4WN5 A;  4I3J A;  5L8M A;  1MKI A;  2OSU A;  1ZG4 A;  2B95 A;  3UO9 A;  4I3A A;  2XH9 A;  2KDK A;  4HQA A;  3AGF A;  3LR3 A;  5EFW A;  1XGI A;  4KZB A;  4NG2 A;  3A0V A;  3OPL A;  3BY8 A;  5DF7 A;  4CLC B;  1X0O A;  3CZD A;  3UPN A;  1IFQ A;  3EOI A;  4FCF A;  3UB5 P;  2X71 A;  2XD5 A;  4JGQ A;  1JWZ A;  4MN5 A;  2H0Y A;  5U47 A;  1W8Y A;  1W63 M;  4UHU A;  4FUW A;  1WE4 A;  1N9N A;  2A3U A;  2HV1 A;  3MKE A;  1XXM A;  1PZO A;  4Q0I A;  2QYB A;  2J7V A;  5HAI A;  4LRZ E;  2ZMF A;  3C4P A;  2HDR A;  1H8M A;  3V67 A;  4JBF A;  4XUZ A;  4NEE D;  3HUO A;  1ZHH B;  1O07 A;  4H6J B;  4GHI A;  3CMZ A;  4GN2 A;  1KVM A;  5DTK A;  4KQQ A;  1H0M A;  4WEL A;  1T1B A;  2QPN A;  4RQ9 A;  4JXG A;  3B42 A;  1VET A;  3H82 B;  3LY3 A;  3PR6 A;  3LIE A;  5CEC A;  4B88 A;  4S2J A;  3IX3 A;  4UA9 A;  1UWP X;  1ALQ A;  2P9V A;  3ULF A;  3F1N A;  5IT5 A;  4GD6 A;  5EEC A;  4WUJ A;  1PZP A;  2PD7 A;  3ISG A;  2NUP C;  1D1J A;  3IH8 A;  3QP8 A;  1ERQ A;  1YM1 A;  2J3T D;  5DJT A;  5EOO A;  1KGG A;  2E8J A;  4XXR A;  3IF6 C;  2P08 A;  4OQH A;  1T18 A;  2Y2K A;  2JC7 A;  3HLB A;  2BAS A;  4EEU A;  4GS9 A;  2ZLY A;  3MKF A;  4UQI S;  1JNU A;  1AWI A;  1DJA A;  3OCN A;  4DJ3 A;  1MY8 A;  1BLC A;  4N9K A;  5CHJ A;  4ZAM A;  4DE0 A;  3OLO A;  1RGZ A;  4L9E A;  3OZH A;  3WRZ A;  2WUQ A;  5FQQ A;  3GR2 A;  3VP0 A;  3T50 A;  1CEG A;  1G6A A;  1NJ4 A;  1HD8 A;  3BLM A;  3W4P A;  2OWJ A;  1E25 A;  1L0G A;  3NCK A;  2DNS A;  4IUK A;  3NOP C;  3T1Q B;  2O9C A;  1OTA A;  4FTX A;  3VV4 A;  3AGE A;  3SS3 A;  4GD8 A;  4NET A;  5HPF A;  3JVV A;  4UEY A;  1DJC A;  1I2W A;  3U4L P;  3O86 A;  3UB8 A;  1GA9 A;  4PM9 A;  1XFN A;  4QY6 A;  4QU3 A;  2C5W B;  3EGX C;  3S7Q A;  1P9W A;  3HL9 A;  3UNW A;  2ZJ9 A;  2Z2M B;  1PW1 A;  3N8L A;  3SW1 A;  5E2G A;  4S2K A;  4ZJ2 A;  1ES2 A;  3BFD A;  4EV4 A;  3T4S A;  4WM9 A;  1K57 C;  3IBR A;  1EI5 A;  1YLT A;  1LSX A;  4IJG A;  3N7W A;  4BBU A;  2PRF A;  3FKW A;  3CI6 A;  4Y3I A;  2XR0 A;  1L0F A;  1JTG A;  3VOL A;  4NK3 A;  2JKG A;  4C3Q A;  2Y2Q A;  3E4O A;  1YLZ A;  5HL6 A;  2HDQ A;  4HJ6 A;  1K55 C;  3MXQ A;  4PM7 A;  3T4T A;  3MXR A;  1TS6 A;  4S2P A;  2ZMA A;  5EVI C;  1KE0 A;  1MBL A;  2P9V B;  4HIA A;  4GZB A;  4WEJ A;  3MQQ A;  1ACF A;  3LR5 A;  2V0U A;  2Y8H A;  4HJ4 A;  1H8Z A;  3CJM A;  1O7E A;  4NXB A;  4N1H A;  1TS7 A;  4DE2 A;  1I5Q A;  5HWT A;  2Y91 A;  4YOF A;  4KZ3 A;  3RXW A;  2VGJ A;  4P6Z M;  2R78 A;  3JVU A;  3PHY A;  4MEZ A;  1FSW A;  4OPQ A;  4A5R A;  4K0X A;  1GHP A;  5D3O A;  1IYP A;  5G4Z A;  5HWV A;  4X1L A;  3CG5 A;  1YSP A;  4GS9 B;  4IBR A;  2ZL1 A;  5FL3 A;  4F3L A;  1K54 C;  1TS8 A;  3L9K A;  5FAT A;  2A49 A;  3HVF A;  2WK0 A;  1TVF A;  2V9A A;  5CER A;  3H7W B;  1MC0 A;  1CJF A;  4O0P A;  1OT6 A;  1IYO A;  3KSF A;  3V3R A;  4XUX A;  5AQ9 A;  1IKI A;  4YIN A;  2WGW B;  1NLZ A;  4I39 A;  2PD8 A;  2HDS A;  3MZF A;  1LL9 A;  4EQ1 A;  4ZBE A;  2WKI A;  4OON A;  5GLC A;  4BL2 A;  3VFF A;  2W1T B;  1ES5 A;  4BQM A;  4GOG A;  4HEF A;  5E2E A;  3P7N A;  3IS2 A;  4ZJ3 A;  2B02 A;  4BJP A;  1KDS A;  1FR1 A;  2PR6 A;  3MFD A;  2J9P A;  4YFM A;  3RXX A;  1ZC2 A;  3C7V A;  2HP9 A;  4Y13 A;  5CGX A;  1VQQ A;  4I3I A;  4GLQ A;  2ZM2 A;  5EVI D;  4PKY A;  2Y2H A;  3A0R A;  1YMS A;  3KYQ A;  5FSR A;  1PWG A;  2ZC4 B;  5TFQ A;  1DP8 A;  3A0S A;  2ZOI A;  2XRN A;  4M4X A;  1BT5 A;  2XRO A;  5F82 A;  1XJ4 A;  5KMW A;  4BD1 A;  2BTF P;  1IYQ A;  4R38 A;  1BTL A;  2EA9 A;  4BLM A;  2D01 A;  5M1A A;  1UGU A;  5DF9 A;  4BEN A;  4ZJ1 A;  3IF6 A;  3I7J A;  3N6I A;  2VEA A;  5JYP A;  3OPH A;  1I2S A;  5FAO A;  4MLL A;  1JTD A;  3GVB A;  3LEZ A;  2VX8 A;  4MDZ A;  4GDB A;  1YPR A;  1FSY A;  5HAR A;  1ZG6 A;  5A8B A;  4Z1W A;  1ERO A;  3HRE A;  2H10 A;  4N1X A;  4R4S A;  1ONG A;  2PBD P;  2QMI A;  1S4S A;  3MBZ A;  1OPX A;  4S2L A;  1JWV A;  1XGJ A;  3CAX A;  1Y28 A;  3E4P A;  4G3K A;  3T1R A;  4HNB A;  4E3K A;  1OTB A;  2Y4A A;  4KZ8 A;  5GHX A;  4D2O A;  3A3I A;  5GL9 A;  1AXB A;  3IHB A;  3CPT A;  1S67 L;  4DKI A;  2OLV A;  2W3D A;  1IYS A;  3WS0 A;  4KZ9 A;  2DMW A;  3TSG A;  3W4O A;  4LCM A;  5MC7 A;  3TJZ C;  5HDS A;  4EW7 A;  3LEQ A;  1YLP A;  5KSC A;  2WKH A;  4PHT A;  1ES4 A;  1XX2 A;  1FCN A;  1YT4 A;  3SS4 A;  2GX5 A;  1EWZ A;  4IVI A;  1PIO A;  2O9B A;  1TD5 A;  1DY6 A;  2PBY A;  1BUL A;  2HP5 A;  4S2N C;  4OPR A;  2JKF A;  4X68 A;  3O5Y A;  3ZHH A;  2OWH A;  1Y4O A;  2OV5 A;  2M7V A;  5HWW A;  4JPM A;  2ZC6 B;  1K57 A;  3HLD A;  3JYI A;  1KVL A;  2XF3 A;  1N9B A;  3TRC A;  3GTC A;  4DDS A;  3QP2 A;  3C2W A;  3ZDJ A;  1F5M A;  5JYO A;  1LSW A;  2ZOH A;  4MBH A;  4JF6 A;  4M3K A;  2PDR A;  5E43 A;  3G6O A;  3F1P B;  2IA2 A;  3IT9 A;  4QHC A;  1J3W A;  2A2L A;  3D4F A;  3UE0 A;  3EWK A;  3IS2 B;  5DFX A;  3ZFZ A;  1GSX A;  1MWS A;  3DWK A;  1K55 A;  1Q2Q A;  4FH2 A;  4E3O A;  3UME A;  1XJ6 A;  2I72 A;  1W79 A;  5F69 A;  5A93 A;  1KGE A;  3HUM A;  1KE3 A;  4L0L A;  3FC7 A;  5EVI A;  1S1Y A;  1WYC A;  4HP9 A;  1MWU A;  3A3F A;  3VE3 A;  1KDW A;  3Q1F A;  3T4L A;  5FI2 A;  1L3L A;  3B3X A;  3VFH A;  2EX6 A;  2O0Y A;  2NUT C;  4OH0 A;  4FH4 A;  4P85 A;  4Y7P A;  1WA9 A;  3K3D A;  4KZ4 A;  3G32 A;  1L0E A;  2DCF A;  1ZTU A;  2V20 A;  4JF5 A;  1HZO A;  3UPO A;  5FQI A;  3BFG A;  4LV0 A;  1M6K A;  2WKQ A;  3BFF A;  4KG6 A;  1K54 A;  2P74 A;  4OLD A;  2Q0O A;  1DJB A;  1XJ3 A;  4OOY A;  4HP4 A;  3VMA A;  3LFV A;  2ACG A;  2YKF A;  4L9G A;  4N92 A;  2GDN A;  4KQD A;  5KZH A;  3W8K A;  1CF0 A;  4ME4 A;  2XK1 A;  3V39 A;  5I94 A;  5CHU A;  1NZU A;  4R70 A;  5J4E A;  3WS5 A;  4OOL A;  5KSH A;  5HPI A;  3UPP A;  3C7U A;  2W3G A;  1VEU B;  1IEL A;  4KG2 A;  3ZGA B;  4JLF A;  3C38 A;  5L2F A;  1G28 A;  3G35 A;  4ZRR A;  4HES A;  4O01 A;  2G2W A;  2EX8 A;  2QWS A;  2VZW A;  4ZDX A;  1TDG A;  4P6Z S;  1RGY A;  3V5M A;  1YLJ A;  5CGW A;  2W3H A;  4R23 A;  1S4R A;  3HJI A;  3KX0 X;  4GW9 A;  3UY6 A;  1ESU A;  4NXF A;  4P87 A;  2W1R A;  2XA7 S;  3PBR A;  3W4Q A;  2JE5 A;  5EV0 A;  4FD8 A;  1XPB A;  2ZQ7 A;  3QP4 A;  1VHM A;  3T4Q A;  4HBT A;  5EM0 A;  3M2K A;  1SKO B;  1YLW A;  2OAP 1;  4LRX C;  2RCX A;  1NZO A;  5AQA A;  5DTS A;  4R1G A;  4RYE A;  1D7E A;  2JBF A;  3NOT C;  4GNU A;  4EU0 A;  5M18 A;  1K56 D;  2X02 A;  2M1C A;  3H9W A;  2D02 A;  1ODV A;  4BL3 A;  3RJU A;  4LV2 A;  3QP1 A;  3IWO A;  5E2F A;  5HZH A;  1H5X A;  4RA7 A;  3D3O A;  2GJ3 A;  3IXB A;  1LT0 A;  2Y79 A;  4LV1 A;  4EBN A;  3WS4 A;  3ZCZ A;  3EGD C;  2J8Y A;  4MBK A;  3K3C A;  2VKS A;  5FA7 A;  2L4R A;  3BEB A;  3OC2 A;  3IXD A;  3ZYT A;  1LL5 A;  3LIF A;  3MJQ A;  5HDD A;  2PAV P;  1L0D A;  5A92 A;  4WBG A;  3S7N A;  4KZ5 A;  4OQI A;  1TEM A;  1CQA A;  5KIZ A;  2VLG A;  2KLI A;  2PU4 A;  2EFU A;  1CK3 A;  2W3F A;  2IWC A;  1SZV A;  3NIA A;  5CX7 A;  2G2U A;  1MZU A;  4OP8 A;  2WAD A;  2XQZ A;  3L7H A;  3MQO A;  4X53 A;  3VP4 A;  2IWB A;  1FQG A;  2EWW A;  5K5B A;  4HHD A;  2FZ0 A;  5FDH A;  1OJ5 A;  1S0W A;  3KO6 A;  3SOI A;  4PM5 A;  4HBU A;  4KUO A;  4FSF A;  3F1O A;  3UN7 A;  2BG1 A;  4OPZ A;  3E2K A;  3NC8 A;  2L0W A;  2OAQ 1;  1E3U D;  3PAG A;  1BZA A;  5CTM A;  2Y2L A;  3IX4 A;  4E6W A;  4GHI B;  5IS1 A;  3D72 A;  4N9L A;  1KGF A;  1NY0 A;  4S2N A;  4DE3 A;  2PHY A;  1TDL A;  1VET B;  2QKP A;  5AQ7 A;  3IF5 A;  2Y2P A;  3G31 A;  4EES A;  4KZ6 A;  2OOL A;  3O88 A;  2ZMV A;  4S2O A;  3F1N B;  3LY4 A;  4B93 A;  2O9A A;  5GLA A;  3K2N A;  2EFX A;  2K2N A;  4WL9 A;  1NLY A;  1M40 A;  1GCE A;  1K6R A;  5HDC A;  1XJ2 A;  4XT2 A;  1PYY A;  3CIT A;  1JVJ A;  4KEN B;  5FAP A;  5CGS A;  3EQV A;  2J80 A;  3G4P A;  1H3Q A;  4R6L A;  2I9V A;  4DDY A;  3QNC A;  2FFF B;  4EWF A;  2WZX A;  1PWC A;  5F1F A;  2QJ7 A;  4GJ4 A;  5IU1 A;  3DTI A;  2VGL S;  4UQI M;  2WKE A;  5TGF A;  1ESI A;  3VP3 A;  2JHE A;  2EX2 A;  3GEC A;  4JGP A;  4H8R A;  4S2I A;  4C6Y A;  1NYY A;  1MWT A;  2ZQA A;  1N4O A;  3FG8 A;  1GSW A;  1W63 Q;  3IWI A;  2WKP A;  1J9M A;  4UAA A;  1K4F A;  1SCW A;  4X55 A;  4EXO A;  2A24 A;  1E4D A;  2QHK A;  4K08 A;  2EXB A;  1H8Y A;  5FQ9 A;  1XA1 A;  5HAQ A;  2PT7 A;  4O8G A;  4ID4 A;  2V1Z A;  1N9O A;  4YNR A;  3RH8 B;  4NXE A;  1K56 A;  2Q9M A;  5HD5 A;  3NY4 A;  3R4K A;  1OTD A;  3UE6 A;  3KSI A;  2Y59 A;  2CC1 A;  3HLG A;  4KG5 A;  4G3W A;  1F9I A;  3FYZ A;  4PPR A;  1MWR A;  1NRJ A;  2K31 A;  1NWZ A;  3B33 A;  2ZQ9 A;  2ZQ8 A;  2Z6C A;  5A91 A;  3DTK A;  4BD0 A;  1CI8 A;  3LO7 A;  3ZQ5 A;  1YAX A;  4EBP A;  2KX6 A;  2Y2M A;  3T4O A;  4KQO A;  3S4X A;  1PFL A;  1STZ A;  1V9Z A;  3BYD A;  2UWX A;  3IQA A;  4LPZ A;  5EOE A;  2XLN A;  3D9Y A;  5BOH A;  5AVF A;  4EBL A;  3PXP A;  4QWO A;  4MBF A;  3HLC A;  3S22 A;  3CLO A;  2W3E A;  4HI4 A;  2L1M A;  4Q8I A;  4Y2F A;  3LR4 A;  2Y2G A;  1K38 A;  5GHY A;  2KOI A;  4U3T A;  2V2F F;  2FFY A;  1LL8 A;  3F1O B;  1BYW A;  4S2M A;  4D60 A;  4UA7 A;  5L10 A;  1OT9 A;  1E3U A;  1XP4 A;  2M7U A;  2V1B A;  1K0K A;  4H6J A;  2WAE A;  1FIK A;  4OOM A;  4HH3 A;  5LBR A;  5TR7 A;  5F1G A;  3H82 A;  3MZE A;  3S7O A;  4Y5F A;  3WRT A;  4IBX A;  3ZG9 B;  5EVE A;  4LLO B;  2V0W A;  4F94 A;  2HZ5 A;  5EM1 A;  2V8F A;  5FQJ A;  4QPR A;  1YLY A;  1MKM A;  3Q07 A;  3DWZ A;  4LEN A;  3ITB A;  1LI0 A;  2HPB A;  1PI5 A;  4GB7 A;  1ERM A;  2XFS A;  3OBF A;  4RX3 A;  1LI9 A;  2HP6 A;  2BLS A;  3HUN A;  4OQ0 A;  2LB9 A;  2JKR M;  1W7F A;  3CWF A;  2ZL1 B;  1YKD A;  4F3L B;  4U0T A;  1A0K A;  3P09 A;  3MQ0 A;  4IED A;  5FDS A;  2ZM8 A;  3FZC A;  4P0M A;  2H28 A;  4OLG A;  1BSG A;  1OTI A;  2HF6 A;  4OKP A;  2UV0 E;  4GDN A;  3PBN A;  3GSG A;  3UE3 A;  3LR0 A;  2WZZ A;  4U0X A;  2JCH A;  5IHV A;  3C5A A;  4JGO A;  4EUV A;  2Y2J A;  1ES3 A;  5GLB A;  1OME A;  5CTN A;  3C4O A;  1Z6F A;  4R0Q A;  1Y54 A;  4DXB A;  3UDF A;  2C6W B;  3KSH A;  1GA0 A;  4DJ2 A;  3NBL A;  1NYM A;  3DTE A;  4LCL A;  3RTY A;  3NHQ A;  3T1S A;  5DF8 A;  2ZC5 B;  2Z2L B;  1FR6 A;  3EEH A;  4BWI A;  1CEF A;  2PYR A;  4B4Z A;  4K0W A;  3VOY A;  1CI9 A;  4Y15 A;  2PYP A;  4P6B A;  2FH5 A;  2XD1 A;  4HH2 A;  4JXV A;  4X1M A;  4EEP A;  4E3M A;  3Q82 A;  4DN0 A;  1L2S A;  3PBS A;  5DKL A;  2GZA A;  5FAS A;  2ZC3 B;  3BFE A;  2H5S A;  5EPH A;  2VV8 A;  5G4Y A;  3IX8 A;  3LGO A;  3OOV A;  3A3J A;  3IXH A;  4NKP A;  4O7D A;  3E0Y A;  3MS6 A;  4JKT A;  2B18 A;  3LID A;  4LFU A;  4CPK A;  3BEC A;  4OPY A;  1P97 A;  5FAQ A;  4EER A;  1DRM A;  5FI7 A;  3S7P A;  4EUZ A;  3IF6 B;  5EUA A;  1W8Q A;  2V8C A;  4KZ7 A;  3GDI A;  3UE1 A;  1IOU A;  1ZKJ A;  1D06 A;  4ETZ A;  4RX2 A;  4X6T A;  3ITA A;  2J9O A;  3N4I A;  3E98 A;  1OTE A;  4E3L A;  4X56 A;  1IEM A;  1FIL A;  4MN6 A;  1VM1 A;  4E6X A;  1GHM A;  3WS2 A;  3SS5 A;  1Q2P A;  1F98 A;  1QMF A;  1UWN X;  5HL1 A;  3LI8 A;  3CHW P;  5J3W A;  3SH9 A;  3B47 A;  5F68 A;  4CLC C;  4KZA A;  1XA7 A;  2Z6D A;  3G2Y A;  3NEC A;  2ZQD A;  4WF0 A;  2YKH A;  3CPT B;  1P9R A;  5AQB A;  4LRY C;  2WGI A;  2VV7 A;  3VSL A;  3GRJ A;  1F2K A;  4MNR A;  2CMN A;  2LB5 A;  4QY5 A;  4ARZ A;  1KOU A;  3E2L A;  3A3E A;  3MR0 A;  2XDM A;  3G30 A;  5DJU A;  4BMW A;  1V9Y A;  4AFI A;  3KYZ A;  3QHY A;  4Y17 A;  4LGW A;  5CRF A;  1T1C A;  3JPU A;  1YQS A;  3CUE C;  4HOI A;  5J8X A;  1PI4 A;  4WMC A;  3Q81 A;  4UA6 A;  3BY9 A;  4NXG A;  3WWX A;  3HBR A;  3TOI A;  1N9L A;  5F5Y A;  4PKY G;  1S6R A;  3BWL A;  3H7W A;  5CXW A;  4PAU A;  1YMX A;  4WZ5 C;  5DFY A;  3HLW A;  2WGW A;  2VA0 A;  1T19 A;  4I38 A;  3BJN A;  4Y0U A;  4JF4 A;  1PWD A;  1FCM A;  2W1T A;  2E8I A;  3EQU A;  1DP9 A;  1HVB A;  4X25 A;  1TF1 A;  2B5R A;  2EX9 A;  1K4E A;  3IH9 A;  3M6B A;  5G18 A;  2W27 A;  3G34 A;  2WAF A;  4CLC D;  3UB7 A;  4MMN A;  1FOF A;  2XFT A;  1G68 A;  3NDE A;  3UDI A;  2Y55 A;  1K6S A;  5EVI B;  5FI6 A;  4QB8 A;  3LIB A;  3ZVW A;  3ZNY A;  1BLP A;  3UB9 A;  4Z9Q A;  5L07 A;  2G7U A;  5HD3 A;  5F83 A;  3PBT A;  4JXW A;  2MJ6 A;  2JKT I;  4BBT A;  1PW8 A;  2PR5 A;  4PM6 A;  5E2H A;  3ZG7 B;  1EW0 A;  3RFB A;  1S1Z A;  4B4X A;  1C3B A;  2VGK A;  1S66 L;  2QJ5 A;  3LIA A;  5TBM A;  4RVA A;  3N8R A;  1PRQ A;  5EE8 A;  3TG9 A;  3PTE A;  2INW A;  1ONH A;  3QNB A;  4PM8 A;  1QME A;  3HCY A;  4FOF A;  1G5U A;  4ESP A;  1JWP A;  3GV9 A;  3R7W A;  3VP2 A;  5M19 A;  2HJE A;  2P7J A;  4HJ3 A;  3QP6 A;  2WYX A;  1LLB A;  3MXS A;  5CHM A;  5TJJ A;  1BLH A;  1MPL A;  2HGV A;  3SH8 A;  3FKV A;  2ZBB A;  5CED A;  4JGR A;  4E3N A;  1IKG A;  5HX9 A;  3AGD A;  2JKT M;  4GCZ A;  3IXG A;  4Q0H A;  2HDU A;  4R3A A;  2EWV A;  3HLF A;  3BRM A;  3DW0 A;  3IHA A;  3IWQ A;  4CJN A;  5HFO A;  2X01 A;  4Y0O A;  4DXC A;  3MZD A;  2OLU A;  3T4K A;  1BLS A;  3ZG0 A;  1YSQ A;  3Q7V A;  4KUK A;  3BW6 A;  2XEP A;  1Z09 A;  3LYX A;  5EVL A;  2ZQC A;  4BBV A;  5GLD A;  5DKK A;  4ZTK A;  4ARZ B;  1HTZ A;  2GNX A;  3G2Z A;  2W0N A;  1BUE A;  3NI9 A;  4E04 A;  2VJW A;  3FV7 A;  3MMH A;  2JN7 A;  5FEF A;  4EQI A;  2AVX A;  2XA7 M;  3GMW A;  2Y2O A;  3ZNT A;  3NJA A;  4IHQ A;  3BM6 A;  1DP6 A;  3EEA A;  4OVD A;  2WKR A;  4X69 A;  5FEG A;  2Q9N A;  2XGN A;  2R9W A;  4LV3 A;  2WGV A;  3HJK A;  3F1P A;  1SHV A;  3M2J A;  4HY8 A;  3UMD A;  3VP1 A;  4QJG A;  4EET B;  3C8C A;  1G6O A;  3NUL A;  4KQR A;  1MXO A;  3OPR A;  3OCL A;  5DTT A;  2P04 A;  3MFX A;  3DAV A;  4I5S A;  3BQA A;  3IBJ A;  4YWZ A;  2PU2 A;  5FQK A;  3NOU C;  5HAP A;  3M6H A;  2QZ6 A;  3FPW A;  1TS0 A;  3FWL A;  5C5K A;  4B9O A;  4WLA A;  3PBQ A;  1SDN A;  4CLC A;  3ZG8 B;  3P01 A;  1OJG A;  4Q0J A;  2RL3 A;  1KE4 A;  3DBA A;  3UB6 A;  4DF6 A;  3UDX A;  4E3I A;  2ZD8 A;  2Y2N A;  1GSV A;  2J3W A;  4R4R A;  3BQ8 A;  3HLE A;  3KSG A;  4WYY A;  3QP5 A;  4E3J A;  2EXA A; 
#chains in the Genus database with same CATH homology
 2PYP A;  3LI9 A;  3LR5 A;  2V0U A;  2Y8H A;  2FH5 A;  4HJ4 A;  4HH2 A;  3LIC A;  1VHM A;  3T4Q A;  4EEP A;  4NXB A;  4DN0 A;  2OAP 1;  3PBS A;  5DKL A;  1TS7 A;  3W2Z A;  2GZA A;  2JKR I;  4LRX C;  5HWT A;  3T4J A;  5TBM B;  4WEK A;  4YOF A;  1D7E A;  3NOT C;  4EU0 A;  2M1C A;  4ETX A;  2VV8 A;  3CUE A;  3H9W A;  4II7 A;  4P6Z M;  2R78 A;  5G4Y A;  3TE8 A;  4CQH A;  2D02 A;  3OOV A;  1ODV A;  3JVU A;  4NKP A;  3LUQ A;  3PHY A;  1VB6 A;  3E0Y A;  2K7S A;  5HZH A;  3D3O A;  2GJ3 A;  2V1A A;  1LT0 A;  2B18 A;  2Y79 A;  4L9F A;  5G4Z A;  5HWV A;  3LID A;  4IUH A;  1YSP A;  4GS9 B;  3EGD C;  3R7W B;  3K3C A;  5FL3 A;  3PYP A;  1P97 A;  3MF0 A;  4F3L A;  2VKS A;  4MN7 A;  2L4R A;  4EER A;  1DRM A;  1TS8 A;  3S7P A;  2VV6 A;  3OC2 A;  3ZYT A;  4XT2 B;  3FPV A;  3LIF A;  3GDI A;  4MCW A;  1T1A A;  5I5L A;  3MJQ A;  5HDD A;  1IOU A;  1D06 A;  4ETZ A;  2V9A A;  3S7N A;  3H7W B;  1MC0 A;  3E98 A;  4O0P A;  3ICY A;  5KIZ A;  1OTE A;  2VLG A;  1OT6 A;  2KLI A;  4MN6 A;  3KSF A;  5F6A A;  2W3F A;  5CX7 A;  5HSQ A;  1NLZ A;  4I39 A;  1MZU A;  2PD8 A;  1F98 A;  3MQO A;  3TW8 A;  4EQ1 A;  5J7E A;  1UWN X;  3LI8 A;  4CLC E;  5J3W A;  3B47 A;  2EWW A;  2W1T B;  5F68 A;  5K5B A;  4CLC C;  2VGL M;  4HHD A;  2FZ0 A;  3P7N A;  3IS2 A;  5AJG A;  4DMZ A;  1OJ5 A;  2Z6D A;  3KO6 A;  2B02 A;  4WF0 A;  2YKH A;  4BJP A;  1P9R A;  4KUO A;  3PBO A;  2PR6 A;  4LRY C;  3C30 A;  4FSF A;  3F1O A;  2VV7 A;  2L0W A;  2A24 B;  2OAQ 1;  2CMN A;  4GLQ A;  4I3I A;  4PKY A;  2LB5 A;  4G3V A;  3U2A A;  4ARZ A;  3A0R A;  3KYQ A;  3E4Q A;  1KOU A;  4GHI B;  5IS1 A;  1XFQ A;  2O99 A;  4WEJ A;  3D72 A;  1DP8 A;  3A0S A;  2ZOI A;  3MR0 A;  2XRN A;  4M4X A;  2XRO A;  1XJ4 A;  5DJU A;  2PHY A;  4BMW A;  1V9Y A;  2HJ9 C;  2QKP A;  4AFI A;  3KYZ A;  5AVE A;  1P0Z A;  4EES A;  4R38 A;  2EA9 A;  2D01 A;  2OOL A;  1UGU A;  2ZMV A;  3F1N B;  5DF9 A;  2XSS A;  1T1C A;  2J3T C;  4B93 A;  2O9A A;  3CUE C;  4HOI A;  3K2N A;  3VE4 A;  2K2N A;  4WL9 A;  1NLY A;  5HDC A;  1XJ2 A;  2VEA A;  4XT2 A;  1LSV A;  3CIT A;  4WN5 A;  4I3J A;  5L8M A;  3BY9 A;  4NXG A;  3EQV A;  1N9L A;  4I3A A;  2J80 A;  2KDK A;  5F5Y A;  4HQA A;  4PKY G;  3LR3 A;  2VX8 A;  4MDZ A;  1H3Q A;  5EFW A;  3BWL A;  4R6L A;  2I9V A;  3H7W A;  3A0V A;  4PAU A;  3BY8 A;  5A8B A;  4Z1W A;  5DFY A;  4CLC B;  1X0O A;  1S4S A;  1T19 A;  2VA0 A;  1IFQ A;  3EOI A;  4I38 A;  1OPX A;  2QJ7 A;  4GJ4 A;  3CAX A;  3BJN A;  1Y28 A;  3E4P A;  4G3K A;  5IU1 A;  4HNB A;  2VGL S;  4UQI M;  2W1T A;  4JGQ A;  3EQU A;  1DP9 A;  4MN5 A;  2JHE A;  1OTB A;  1TF1 A;  1W63 M;  3GEC A;  4JGP A;  1N9N A;  2HV1 A;  2W27 A;  3FG8 A;  1GSW A;  1W63 Q;  2WKP A;  1S67 L;  4Q0I A;  4CLC D;  2QYB A;  3UB7 A;  4EXO A;  4LRZ E;  2A24 A;  4MMN A;  2QHK A;  2ZMF A;  4K08 A;  2W3D A;  1H8M A;  3V67 A;  2PT7 A;  2DMW A;  4O8G A;  4NEE D;  1ZHH B;  4H6J B;  1N9O A;  4GHI A;  5MC7 A;  3LIB A;  3TJZ C;  4YNR A;  3RH8 B;  4NXE A;  5HDS A;  4EW7 A;  4WEL A;  5HD5 A;  3R4K A;  1OTD A;  1T1B A;  4RQ9 A;  3UE6 A;  3KSI A;  4PHT A;  3UB9 A;  2G7U A;  3B42 A;  3H82 B;  5HD3 A;  3PR6 A;  3LIE A;  2GX5 A;  3PBT A;  4G3W A;  1F9I A;  2MJ6 A;  1NRJ A;  2JKT I;  1NWZ A;  2K31 A;  4BBT A;  2O9B A;  1UWP X;  2PR5 A;  1TD5 A;  3B33 A;  3ULF A;  1EW0 A;  3RFB A;  3F1N A;  1S1Z A;  5IT5 A;  4WUJ A;  2Z6C A;  2PD7 A;  1S66 L;  2NUP C;  2QJ5 A;  3O5Y A;  3LIA A;  2OWH A;  5TBM A;  2M7V A;  3ZQ5 A;  5HWW A;  1YAX A;  2J3T D;  2INW A;  5DJT A;  2KX6 A;  3T4O A;  4KQO A;  3HCY A;  1STZ A;  1V9Z A;  3TRC A;  4FOF A;  2P08 A;  3C2W A;  1F5M A;  1T18 A;  4LPZ A;  1LSW A;  2ZOH A;  5AVF A;  2PDR A;  3PXP A;  2BAS A;  4EEU A;  4GS9 A;  3G6O A;  3R7W A;  2HJE A;  3F1P B;  2P7J A;  4HJ3 A;  3CLO A;  2W3E A;  2IA2 A;  4HI4 A;  4UQI S;  1JNU A;  5TJJ A;  3OCN A;  2L1M A;  2HGV A;  4DJ3 A;  2A2L A;  2ZBB A;  4Y2F A;  3LR4 A;  3OLO A;  3EWK A;  4JGR A;  3IS2 B;  4L9E A;  5DFX A;  1GSX A;  2JKT M;  4GCZ A;  2KOI A;  4Q0H A;  3T50 A;  4R3A A;  2EWV A;  1LL8 A;  2OWJ A;  3F1O B;  1BYW A;  3UME A;  1XJ6 A;  3T4K A;  1YSQ A;  1OT9 A;  4KUK A;  5F69 A;  3BW6 A;  4L0L A;  3LYX A;  3FC7 A;  4IUK A;  3NOP C;  4BBV A;  2M7U A;  1S1Y A;  5DKK A;  2V1B A;  4H6J A;  4ARZ B;  2O9C A;  1OTA A;  4OOM A;  4HH3 A;  4HP9 A;  2GNX A;  2W0N A;  5LBR A;  3VV4 A;  3VE3 A;  3H82 A;  4E04 A;  2VJW A;  3MMH A;  3T4L A;  2JN7 A;  2O0Y A;  2NUT C;  5HPF A;  3JVV A;  4UEY A;  3S7O A;  1WA9 A;  4Y5F A;  2XA7 M;  3K3D A;  4LLO B;  2V0W A;  3UB8 A;  3NJA A;  4IHQ A;  1ZTU A;  1XFN A;  4QPR A;  1DP6 A;  1MKM A;  3EGX C;  2WKQ A;  3S7Q A;  1P9W A;  3EEA A;  2WKR A;  3OBF A;  3SW1 A;  1XJ3 A;  4HP4 A;  3T4S A;  2LB9 A;  2JKR M;  3LFV A;  2YKF A;  3HJK A;  4L9G A;  3CWF A;  3F1P A;  3UMD A;  4HY8 A;  3IBR A;  4KQD A;  1YKD A;  4EET B;  4F3L B;  3C8C A;  4ME4 A;  1G6O A;  1LSX A;  3MQ0 A;  4IJG A;  3OCL A;  2P04 A;  3MFX A;  4I5S A;  4R70 A;  3BQA A;  2H28 A;  5J4E A;  3IBJ A;  4OOL A;  4YWZ A;  5KSH A;  1OTI A;  3NOU C;  5HPI A;  2HF6 A;  4BBU A;  2W3G A;  3PBN A;  3CI6 A;  3FPW A;  1TS0 A;  5C5K A;  4Y3I A;  3UE3 A;  4B9O A;  3LR0 A;  3VOL A;  4WLA A;  3PBQ A;  4CLC A;  3C38 A;  4JGO A;  1G28 A;  4ZRR A;  4EUV A;  4O01 A;  3E4O A;  2QWS A;  3P01 A;  1OJG A;  2VZW A;  5HL6 A;  4HJ6 A;  4Q0J A;  3DBA A;  3UB6 A;  4P6Z S;  3MXQ A;  3T4T A;  1GSV A;  2W3H A;  1S4R A;  1TS6 A;  3HJI A;  3KSH A;  3KX0 X;  4GW9 A;  4DJ2 A;  2J3W A;  3BQ8 A;  3RTY A;  4NXF A;  3NHQ A;  3KSG A;  2W1R A;  2XA7 S;  3EEH A;  3PBR A;  4BWI A;  2PYR A;  4HIA A;  3MQQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...