1N9LA

Crystal structure of the phot-lov1 domain from chlamydomonas reinhardtii in the dark state.
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
109
structure length
109
Chain Sequence
GLRHTFVVADATLPDCPLVYASEGFYAMTGYGPDEVLGHNCRFLQGEGTDPKEVQKIRDAIKKGEACSVRLLNYRKDGTPFWNLLTVTPIKTPDGRVSKFVGVQVDVTS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structures and Molecular Mechanism of a Light-Induced Signaling Switch: The Phot-LOV1 Domain from Chlamydomonas reinhardtii
pubmed rcsb
source organism Chlamydomonas reinhardtii
molecule tags Electron transport
molecule keywords putative blue light receptor
total genus 30
structure length 109
sequence length 109
ec nomenclature
pdb deposition date 2002-11-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13426 PAS_9 PAS domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 1n9lA00
3CWFA 3LICA 3P7NA 2VEAA 4HP9A 4YWZA 2Z6CA 1N9NA 3EEHA 3F1PA 5F6AA 5IU1A 1S4SA 2QWSA 4EXOA 3HJIA 2QJ7A 4KUOA 1S4RA 3MQQA 4RQ9A 5AVEA 4R3AA 4LLOB 3PYPA 2B02A 3MR0A 3RH8B 3LIEA 1OTBA 4LRXC 1Y28A 4PKYG 3T50A 2QHKA 3ULFA 1S67L 1OJGA 3K3DA 2WKQA 3KX0X 5HWVA 2PD7A 3MQOA 4I39A 1MZUA 3H82A 4JGOA 2D01A 1XJ3A 3BY8A 3GDIA 4L9FA 1DRMA 4MN6A 4JGQA 5J7EA 1S1ZA 2D02A 3CAXA 3LIDA 4H6JB 1OT9A 1V9YA 2YKHA 4HNBA 4XT2A 4HHDA 4EEUA 4DJ3A 2KX6A 2VV6A 4F3LB 2A24B 3MFXA 2L4RA 4HJ3A 3MXQA 4HJ4A 4LPZA 3E4PA 4NXBA 5HSQA 1S1YA 2QKPA 1ODVA 1LT0A 1OTAA 3A0SA 4HP4A 1EW0A 2V0UA 4E04A 4EW7A 2EA9A 4GHIA 1OJ5A 5J4EA 1VB6A 4JGRA 3CLOA 1WA9A 4EEPA 2KDKA 1UWNX 1T1CA 4HY8A 5EFWA 4EQ1A 2VV8A 3F1NA 2L0WA 2V9AA 4KQDA 2ZOIA 5KIZA 3SW1A 1S66L 1D06A 3VE4A 4R6LA 4BBVA 1DP6A 2OOLA 5HDSA 5HWWA 4HH3A 1GSVA 2QJ5A 4HJ6A 5F68A 1LSXA 3F1NB 4EETB 1DP8A 3LYXA 2ZBBA 4HIAA 3HJKA 5DKLA 5HWTA 4EESA 3MJQA 5IS1A 2PYRA 3ICYA 3H82B 3VE3A 4I3JA 5J3WA 4GS9B 3E4OA 4WL9A 3NJAA 2OWJA 3EWKA 2INWA 5DJUA 4L9GA 2P7JA 3UB7A 2VLGA 3LI8A 3F1OB 4R38A 1BYWA 1P0ZA 2V1AA 3LIFA 3UE6A 2HV1A 1JNUA 5F5YA 4LRYC 3UB8A 4KUKA 2A24A 2W27A 3FC7A 2J80A 2PYPA 4BBUA 2CMNA 2K7SA 2V0WA 1T18A 3A0RA 4H6JA 5DJTA 3F1PB 4NXFA 1TS7A 1UWPX 1XFNA 5DKKA 1LSVA 1OTDA 3B33A 2I9VA 3H7WA 3PHYA 4I38A 4R70A 1UGUA 1XJ4A 2V1BA 3GECA 1F9IA 1D7EA 1XJ2A 2L1MA 1TS0A 4HH2A 5G4YA 2JHEA 3C8CA 3LI9A 3NOPC 4NXGA 5HDCA 1XJ6A 3FG8A 4WLAA 2PD8A 3BWLA 1TS8A 1TS6A 4HQAA 3IS2B 3LIBA 3K3CA 1DP9A 4GHIB 5HD5A 2PDRA 5TBMA 4WF0A 3NHQA 3IS2A 4LRZE 5F69A 2PR5A 4GCZA 2VV7A 3UB9A 1X0OA 1OTIA 1N9LA 3IBRA 3NOTC 4BBTA 2M1CA 4K08A 4MN5A 4I3IA 3OLOA 5HDDA 2PHYA 4WUJA 1F98A 1T1BA 1OTEA 1T19A 3H7WB 4F3LA 4HI4A 2W0NA 3A0VA 4PKYA 1LSWA 1KOUA 1GSXA 2BASA 4WN5A 1V9ZA 4XT2B 2PR6A 5HZHA 1OT6A 2H28A 1NWZA 3E4QA 5I5LA 3UMDA 4B9OA 5A8BA 4M4XA 2YKFA 3NOUC 5G4ZA 4I5SA 2Z6DA 1T1AA 4JGPA 5AVFA 2GJ3A 3C2WA 1P97A 2WKRA 1G28A 3BY9A 3D72A 3F1OA 4NXEA 1LL8A 1N9OA 4HOIA 5HD3A 2WKPA 2R78A 4GS9A 3H9WA 5TBMB 4EERA 1XFQA 3UMEA 3LUQA 4DJ2A 3RTYA 4L9EA 2JN7A 3UB6A 2ZOHA 1GSWA 3G6OA 3VOLA 3ZQ5A 3LIAA 2OWHA 4GW9A 4I3AA
chains in the Genus database with same CATH superfamily
3CWFA 5IU1A 1P9RA 2OAQ1 3EGXC 2J8YA 2ZC4B 5AVEA 1K56A 2PAVP 4ZJ3A 3SS5A 4R3BA 3PYPA 1PI4A 4Y0UA 1K6RA 2XD1A 3IHBA 2ZMVA 4PPRA 3ZNYA 3BY8A 2A3UA 2O9CA 2Y55A 4XT2A 1MWUA 3KYEA 3HUNA 2VGKA 2Y2IA 3MFXA 1YLPA 3MXQA 5CTMA 3FKWA 3NY4A 4OLGA 2ZQ9A 4GLQA 2P9VB 4UAAA 1TDGA 5A91A 4EQ1A 1PNEA 4IVKA 4EU0A 1K55C 5HDSA 1DP8A 4A5RA 5E2HA 1M40A 4WL9A 3EWKA 4MEZA 1BYWA 1P0ZA 3LIFA 4DE2A 2JKGA 2VK3A 1YSPA 4B93A 2XF3A 2K7SA 3LR0A 3EGDC 3LO7A 1CI9A 3NOPC 1H8ZA 1PWCA 4KQRA 5E2EA 1CEFA 1DP9A 2FZ0A 4GCZA 1HZOA 1ONHA 2JKRI 3BFGA 1FR1A 1LSWA 1KOUA 5HZHA 2JCHA 4GD8A 1LL9A 4U0XA 3BY9A 5M1AA 2FFYA 3KYQA 5FEGA 4HOIA 5TJJA 1XFQA 4GKUA 2GDNA 2P74A 3FPVA 3MSHA 4LCLA 5FQMA 1FIKA 4C6YA 5FATA 3UB5P 1XKZA 2W1TB 4X25A 5CEBA 1N9NA 2Y2MA 5EVIA 4HBUA 3Q1FA 4PKYG 1K54C 1W8YA 3T4JA 4Y13A 3BJNA 5HW3A 1YM1A 4CJNA 2JKFA 4KZ6A 5EVLA 1NRFA 5EVEA 3IF5A 3V5MA 1NZUA 4CLCB 2LB5A 3TW8A 4E04A 3TG9A 4Q0JA 4NK3A 3HUOA 1WA9A 4EBLA 3BEBA 3ZNTA 3SW1A 4FSFA 5L10A 4U0TA 2ZL1A 1ESUA 1ZG4A 2OOLA 1KDSA 1GSVA 1KGGA 2KLIA 1MBLA 2WGWB 2K2NA 1L0DA 4RA7A 2HDSA 2P7JA 2ZJ9A 4DE3A 5DF7A 3S7QA 3P09A 3MMHA 1NXYA 2J80A 4BBUA 2O9AA 2I72A 3NECA 3UN7A 3HL9A 5DTTA 3T4LA 4NXGA 3LI9A 3VSKA 2BTFP 4BD1A 3GTCA 1L0FA 3N8LA 3OPRA 4MDZA 4OVDA 3NULA 4MCWA 2QYBA 3DW0A 1H5XA 1K56D 4BBTA 3PR6A 4OPRA 1O07A 3E4QA 3B3XA 4Y2FA 1G28A 2UWXA 5GHXA 1N9BA 4K0XA 3A3EA 3ZVWA 4OPQA 5EECA 1O7EA 2W1TA 1GA9A 4PM6A 4S2NC 3W2ZA 1SCWA 3T50A 2WKQA 2FFFB 1GHPA 3T1RA 4JGQA 4UA6A 1IYOA 1SKFA 2K31A 3ISGA 2VV6A 3VFHA 5GLBA 1OTAA 3TE8A 3HLBA 5HAQA 2WUQA 1ERQA 4KZAA 2B5RA 3QP4A 2DRWA 3O3VA 1MC0A 4C3QA 3VP0A 4ARZB 2NUTC 2XGNA 4QY5A 1D06A 4Q8IA 1YLYA 4HJ6A 4LCMA 4QPRA 3UDIA 3BQAA 1RP5A 2H10A 4E3IA 3MKEA 3BLSA 4QD4A 1JNUA 3UB8A 4FOFA 3OC2A 2Q0OA 2Z2MB 2P08A 4HH2A 2V1BA 4AFIA 3FG8A 2PD8A 2ZM8A 3LIBA 5EM1A 4JLFA 3IS2A 3SH8A 4MBKA 2JBFA 3DWKA 3VOZA 1YSQA 1ESIA 3NBLA 1E3UA 4EBNA 3Q7ZA 3VV4A 4D2OA 4M4XA 1NLYA 5CTNA 4QB8A 2B18A 2X71A 1P97A 2VGJA 4M3KA 5AQBA 5HD3A 2R78A 4GS9A 4E6WA 1MY8A 3ZQ5A 4JF6A 4G3KA 4BMWA 2A2LA 3F1PA 3QP2A 1FILA 3MQQA 3MBZA 1OMEA 1HTZA 2Y79A 3DTEA 1GHMA 1V9YA 4EEUA 4FTXA 4N9LA 3R7WB 1PWDA 4DDYA 2HP9A 1HD8A 1MKIA 3T4OA 1ES4A 3F1NA 3QNCA 4Y5FA 3OPPA 3V3RA 4UEYA 3VE4A 2DCFA 2J3WA 1YAXA 4I3JA 3M6HA 3E4OA 5MC7A 1Z09A 3F1OB 2V1AA 5F5YA 1PI5A 4OQHA 3T4QA 4X53A 2HJEA 2V0WA 1NRJA 2WAFA 4Z1WA 3B33A 4GNUA 4WEKA 1H0MA 3PHYA 1TDLA 2XEPA 4OQIA 4WZ4A 4DMZA 3KSGA 2J3TD 4N1XA 5E2FA 1NLZA 4MMNA 3HCYA 2LB9A 2PHYA 1GHIA 1PIOA 4S2PA 1T19A 3RFBA 2OLUA 3NDEA 3JVUA 2Y2PA 1BZAA 4E3NA 4WM9A 1LL8A 5GLAA 4OH0A 3N8RA 3UMEA 3VOLA 5EUAA 1JVJA 4GW9A 4R4RA 4YWZA 3HJIA 3D9YA 4LV2A 3S7OA 2J3TC 1K4FA 3MS6A 3RH8B 2WAEA 4Y15A 4DDSA 4LENA 2PD7A 4I39A 2O0YA 3GDIA 3T1QB 1BLPA 1L0EA 4IBXA 5HL6A 1MXOA 4G3WA 4P6ZS 3PBNA 1EW0A 1NJ4A 4JXGA 4LV3A 2QPNA 4EEPA 1FCMA 2V20A 2L0WA 3EOIA 3IXHA 1HLUP 5F68A 2EFXA 2ZBBA 3VFFA 1JWVA 2JE5A 4EESA 5DFYA 5J3WA 4PM7A 5FI6A 3FZCA 3IWQA 4UHUA 4LRYC 4OLDA 1K54A 3C4OA 2QMIA 4H6JA 2ZMFA 1LSVA 4S2KA 2I9VA 3RXXA 5G4YA 1XA1A 5CHJA 5GHYA 4BL3A 3PBRA 1XPBA 3B42A 4WMCD 4S2MA 2R9XA 1JTGA 2M1CA 4K08A 2IWDA 5E2GA 4OPYA 2ZC5B 4HBTA 3BYDA 4DN0A 4Y0OA 3H7WB 2XROA 4IVIA 2BASA 1GSXA 3K2NA 1XGJA 4EV4A 2HP5A 4JGPA 2ZM0A 5GLDA 4JBFA 2AVXA 3ITBA 4U3TA 3UPNA 3ZG8B 3CI6A 4I3AA 2WADA 3DAVA 3TSGA 1YMXA 4P6ZM 1NYMA 1QMEA 1OJGA 3CG5A 3MF0A 3TOIA 3PBSA 3HLGA 3T4TA 4H6JB 4HNBA 2Y91A 5GLCA 2A24B 4GB7A 4LPZA 1YLWA 3BFCA 4YFMA 2XD5A 2EA9A 3T4SA 4PMAA 1G68A 2Y2LA 4N1HA 4JGRA 5FDHA 1SDEA 3VP3A 4B4XA 2VV8A 4K91A 4ZJ1A 1VEUB 1RCJA 3RXWA 1G6OA 3IF6B 2XA7S 5HX9A 3HREA 1J9MA 3NJAA 1K0KA 2VLGA 3UE6A 4X1MA 4WEJA 4OQGA 2H0YA 3CUEA 3FC7A 2PYPA 4Y3IA 4NXFA 1OTDA 2ZL1B 1ZKJA 3IH8A 2G2WA 4X56A 3LR3A 1SKOB 2WKIA 2VGLM 5DF8A 1TS6A 2XK1A 1FCNA 4HESA 1W63M 4WF0A 5EOOA 1ERMA 4DXCA 1T1BA 3FWLA 2O99A 4F3LA 2WK0A 3BFDA 4FCFA 2PR6A 4Q0HA 3OBFA 1W63Q 5F82A 2YKFA 1LI9A 1F2KA 3OPLA 3UNWA 4WZ5A 3LUQA 3M2JA 5FQKA 4NG2A 1Q2PA 3Q7VA 4KZ7A 4O7DA 1FCOA 4YNRA 3LICA 1SHVA 1W79A 2PRFA 1KE0A 5CGXA 2NUPC 3BM6A 3WS1A 1OTBA 2QHKA 3FYZA 3EEAA 4JGOA 1ES3A 4PM8A 3MXSA 2D02A 3T4KA 4F94A 4JF5A 1OT9A 2ZQAA 3DWZA 2EX6A 3PBTA 2EX8A 2W1RA 1EI5A 2PBYA 3BRMA 3UY6A 4HH3A 3VMAA 4X69A 4K0WA 4II7A 2VGLS 3IXBA 4S2LA 3KSHA 3N4IA 4CLCD 2V2FF 3BW6A 5DJTA 1MPLA 1IYQA 1F9IA 1F5MA 1ES5A 4Y17A 5CGSA 5J8XA 1NYYA 5F69A 5FQIA 2VV7A 1I2WA 2Y2NA 3IBRA 1N9LA 3OLOA 1ONGA 3PAGA 1CEGA 5HPIA 2OLVA 1D1JA 3NDGA 4XT2B 4EQIA 2ZC3B 2XLNA 4KZBA 4X6TA 5GHZA 4QY6A 3D72A 3SZTA 4PM5A 1N4OA 5LBRA 1CJFA 3UO9A 5TGFA 3N8SA 4L9EA 4ZTKA 4X55A 4FD8A 3UB6A 3G6OA 3ZFZA 2OWHA 4DE1A 3QP1A 1KE3A 2Z6CA 3EEHA 2QWSA 4WBGA 4KUOA 1EWZA 1YLZA 3ULFA 4WYYA 1KVMA 5BOHA 3KX0X 2Y2HA 3U2AA 2W3EA 1LHYA 2YKHA 3R4KA 4HJ4A 3E4PA 2Y2QA 3WRZA 4UQIS 1K57C 2V0UA 5J4EA 2V9AA 5JYOA 4E3JA 1LI0A 3HBRA 1DJCA 3CITA 1K55A 3G32A 3W4OA 2BG1A 3P01A 5CHMA 4L9GA 3PAEA 5I94A 1YT4A 2ZQ8A 2VKSA 4Q0IA 2W27A 2CMNA 1QMFA 4DE0A 1S0WA 5IHVA 4B88A 1XJ2A 4ESPA 2JHEA 1DY6A 5HDCA 4R23A 4WLAA 1L3LA 2WKEA 1TS8A 2MJ6A 4LGWA 3NOTC 4IBRA 1RGZA 1W7FA 2H0TA 3Q7VB 4MBFA 4PKYA 1ZTUA 2WYXA 2GNXA 5AVFA 4IUHA 3GV9A 2RL3A 5FA7A 2VEAA 1JTDA 1WYBA 4KG2A 4DKIA 5KZHA 1FQGA 2PT7A 4LRXC 4BD0A 2M7VA 3D3OA 3HLWA 2ZMAA 3MZDA 3K3DA 3MQOA 3OOVA 1AWIA 2XRNA 3VOYA 3LEZA 3LR5A 2KX6A 4RVAA 3SS3A 1VETA 2FH5A 3VP4A 2HGVA 2W3GA 3DTMA 1BTLA 4OOLA 1VB6A 1FOFA 3WS4A 3IF6A 1T1CA 4HY8A 4E3KA 3QNBA 1IELA 1L0GA 2ZOIA 4E6XA 2ZC6B 3I7JA 3LYXA 1ACFA 2PYRA 3P98A 4FH2A 1E3UD 4CLCA 2Y2OA 2A24A 3N7WA 1NZOA 3F1PB 4R70A 2XFTA 2JKRM 2DNSA 3L7HA 3PBQA 3Q82A 1WYCA 4R0QA 4GHIB 3FKVA 5CRFA 3UB9A 1SKOA 3UE0A 4CLCC 4UA9A 3A0VA 1E25A 4ZDXA 2H28A 5A8BA 1PZPA 4LV1A 4I5SA 2XA7M 5IT5A 2VZWA 4OP8A 5TBMB 3IWOA 4DJ2A 3PBOA 2J9OA 4ETZA 1KGEA 4P87A 4S2JA 4HEFA 1VEUA 1H3QA 4GZBA 2HZ5A 4PAUA 4S2NA 3BFEA 3LIEA 1ZHHB 3IT9A 4NEED 4DRTA 1IKIA 5CGWA 4OP5A 1K25A 1KVLA 5K5BA 3S1YA 1PZOA 3FPWA 5HAIA 3A3FA 3GMWA 4ARZA 1CI8A 5HSQA 2O9BA 4WZ5C 5HARA 3CLOA 4Y7PA 1MWTA 2VA0A 3CUEC 1S66L 4R6LA 3EQVA 1LSXA 3Q81A 3LY4A 5HWTA 5FAOA 1MWRA 3BFFA 2INWA 5TFQA 4BLMA 2HV1A 3S7PA 1HVBA 4N92A 3DTKA 4I38A 5FASA 4H8RA 1LL5A 2ZM2A 3NHQA 4KZ3A 3SS4A 3O5YA 1XX2A 2HDRA 3IBJA 2ZQCA 4LFUA 3OPHA 5DF9A 1XXMA 4KZ5A 3IX3A 5E43A 3UMDA 3PXPA 1VQQA 1T1AA 2XQZA 3MFDA 5FQQA 1TVFA 4IEDA 3IXGA 3QP6A 1PYYA 3IX8A 3BECA 1Y54A 2V8CA 2HP6A 4QHCA 3P7NA 1BLSA 5EVIC 1S4SA 4EXOA 3GRJA 3MR0A 1ZG6A 2RCXA 3WS5A 5GL9A 4ZJ2A 1MKMA 1STZA 4MNRA 1DJAA 5FI7A 1Q2QA 4MN6A 1CQAA 3TJZC 2Y4AA 2EWVA 4IUKA 4HHDA 3EQUA 3KYZA 3NIAA 4GHIA 3C7UA 5JYPA 1A0KA 5EFWA 5FQ9A 5KIZA 1G5UA 4UA7A 2G2UA 3M6BA 3F1NB 5KSHA 3ZG5A 1Z6FA 3HJKA 2E8JA 4P85A 4RYEA 3LGOA 4YINA 5EVIB 1BT5A 3O88A 1T18A 3G30A 3A3DA 4MBHA 4PHTA 2GX5A 4RX2A 4HQAA 3K3CA 1K57A 4KQQA 1IYPA 1VETB 4R3JA 5L8MA 1AXBA 5L07A 1F98A 5M19A 4Z9QA 3F1OA 3UDFA 3T1XA 4EERA 5CECA 4O0PA 3RTYA 2IA2A 3UDXA 1I5QA 2ZOHA 3LR4A 3M2KA 4EUZA 4HP9A 2HF6A 1EROA 4KG6A 2XDMA 4BQMA 1E4DA 4D60A 3GQZA 1Y28A 1IFQA 1PFLA 4R1GA 4IJGA 2W3DA 4EUVA 1S1ZA 4NETA 4XUXA 3HLFA 2HJ9C 4PM9A 3O86A 1KDWA 2EX2A 5EOEA 3E2KA 4NXBA 1S1YA 3VP1A 1ODVA 2V8FA 2EWWA 2P9VA 4RX3A 2A49A 2UV0E 5HPFA 3ZDJA 4KQDA 2G7UA 2H5SA 3IX4A 1YKDA 3GR2A 1SZVA 5FI2A 4L0LA 1GCEA 4EBPA 4HIAA 2JC7A 5DKLA 3V3SA 5IS1A 2OSUA 4X1LA 3SOIA 1TF1A 4GD6A 3C4PA 4CLCE 5D3OA 1BUEA 1RGYA 2ZQDA 3V50A 1YLJA 4OPZA 5A90A 5KMWA 1PW1A 5DKKA 4XXRA 4X68A 2WGVA 1DJBA 2QZ6A 1OPXA 1XGIA 1SDNA 4CPKA 3BWLA 3UPPA 3IS2B 4NKPA 3V39A 1WE4A 4QU3A 3W8KA 3KO6A 3ITAA 1ZC2A 3JPUA 4GDNA 1NWZA 5I5LA 3DBAA 5EVID 4P6BA 5EE8A 2PU2A 3B47A 5FAQA 3ZG0A 3SH7A 2C6WB 3LFVA 3NC8A 4JF4A 2Q9NA 1M6KA 3E0YA 4KENB 1C3BA 1YPRA 5CERA 5HFOA 3CZDA 5EV0A 3A3JA 4JXVA 1K6SA 3W4PA 3SH9A 3MQ0A 2D01A 5TR7A 5J7EA 3LIDA 3HLDA 2ZD8A 5EPHA 3N6IA 3WWXA 2QKPA 1LT0A 3OZHA 3OCNA 1OJ5A 5DTKA 3U4LP 2R9WA 2WGWA 4KZ8A 1BULA 4EETB 5A93A 1Y4OA 3QP8A 3W4QA 3H82B 5CHUA 3FV7A 1KE4A 1FR6A 2XFSA 1P9WA 1TS7A 5FAPA 3GECA 2W3FA 3RJUA 2L1MA 1TS0A 1KGFA 1XJ6A 4DXBA 4EWFA 4G3VA 4WMCA 3BLMA 1NY0A 2PDRA 3GSGA 3GVBA 5KSCA 2X01A 4GN2A 5DTSA 3S7NA 3C30A 1H8MA 3QHYA 4WN5A 2PBDP 1V9ZA 4Y0TA 1OT6A 3HLCA 1S6RA 4S2OA 1YQSA 3NOUC 3JVVA 1IOUA 1L2SA 2GJ3A 4NXEA 5M18A 2Y2GA 4FH4A 2EFUA 2M7UA 2PU4A 1S4RA 4R3AA 3T1SA 2Y59A 4N9KA 4LLOB 4UQIM 4ZBEA 5C5KA 1S67L 4GOGA 2Y8HA 1XA7A 3MZFA 1K38A 2W3HA 1DRMA 3S4XA 1ALQA 2JKTM 4CQHA 4DJ3A 4F3LB 4LV0A 3V67A 3NI9A 1YLTA 2XR0A 1VM1A 4JKTA 4XUZA 3MZEA 4EW7A 2WGIA 1MWSA 3CHWP 1TEMA 2J7VA 3Q07A 2V1ZA 5HWWA 2J9PA 4BWIA 2QJ5A 2HDUA 3S22A 2VJWA 4E3MA 2Q9MA 5A92A 3ICYA 4WELA 3A3IA 2OWJA 3UB7A 2IWBA 4R38A 3ZGAB 4BL2A 1PW8A 3HVFA 3LEQA 2ACGA 1PWGA 3H7WA 5L09A 1U60A 4MN7A 2DMWA 3HLEA 5HD5A 5FEFA 1BSGA 2PR5A 1CF0A 4R4SA 4KZ4A 2EX9A 2XSSA 3AGDA 1K4EA 4O01A 2Z6DA 4JXSA 4OONA 3C2WA 2WZZA 3C5AA 4OKPA 2JN7A 4KZ9A 1GSWA 3LIAA 3IQAA 1IKGA 2OAP1 3ZG9B 3AGFA 3UPOA 4RQ9A 1VHMA 1BLHA 4QWOA 4E3LA 2C5WB 2B02A 3ZCZA 1LLBA 4JXWA 4QJGA 1YMSA 1BLCA 1MZUA 1XJ3A 1PRQA 2Y2KA 3WS2A 2L4RA 3CJMA 3A0SA 3UE1A 3KSIA 5F1FA 5HAPA 2KDKA 3LCEA 1TD5A 4E3OA 2X02A 3C7VA 1GA0A 5F83A 1W5DA 4ID4A 3O87A 3VP2A 3QP5A 3MJQA 4S2IA 3VE3A 3BQ8A 5FDSA 5FSRA 3TRCA 4KG5A 3IHAA 5DJUA 4OOMA 3DTIA 4KUKA 1UWPX 1XFNA 2WKHA 1JWZA 2KOIA 5F1GA 1UGUA 1XJ4A 4OQ0A 3C8CA 3IWIA 2GZAA 3CMZA 5TBMA 2ZC7A 5AQ9A 5AJGA 3ZVTA 3WS0A 1X0OA 1OTIA 4MN5A 4I3IA 5HDDA 4WUJA 4FUWA 5U47A 3VSLA 4HI4A 1FSYA 2JKTI 5CXWA 4ZAMA 5G18A 5CX7A 4B9OA 1IEMA 5G4ZA 2EXAA 4BJPA 2Y2JA 3G34A 4ME4A 4ETXA 5EM0A 3E98A 1IYSA 1N9OA 2WKPA 2ZLYA 4P0MA 1JWPA 3CPTA 4GDBA 3T12B 1J3WA 5F6AA 5CEDA 2QJ7A 2ZQ7A 2B95A 3ZG7B 3G2YA 5DVAA 5HL1A 5HWVA 3H82A 4L9FA 4O8GA 2EXBA 5FL3A 3CAXA 3LY3A 5DFXA 4HJ3A 4HP4A 2HPBA 2VX8A 4MLLA 3G4PA 1UWNX 4B4ZA 3IF6C 3NCKA 5FQJA 2IWCA 2OV5A 4BBVA 1DP6A 3CPTB 3ZHHA 1I2SA 3MXRA 2HDQA 3KSFA 4GS9B 4GJ4A 1CK3A 4JPMA 3IH9A 5AQAA 3LI8A 4YOFA 2CC1A 2XH9A 1H8YA 2E8IA 3AGEA 3A0RA 1W8QA 4C75A 5AQ7A 3WRTA 1D7EA 4IHQA 2WZXA 4LRZE 3G2ZA 4ZRRA 3R7WA 3PTEA 4BENA 3D4FA 1OTEA 3IXDA 2Z2LB 2W0NA 1XP4A 3OCLA 3G35A 4OOYA 3E2LA 2WKRA 2BLSA 1ES2A 4KQOA 3JYIA 3MKFA 3H9WA 2P04A 4DF6A 3L9KA 3ZYTA 5L2FA 3HUMA 3C38A 1G6AA 1FSWA 3UE3A 3G31A
chains in the Genus database with same CATH topology
3CWFA 2VEAA 4YWZA 5IU1A 1P9RA 2OAQ1 3E0YA 3EGXC 3HJIA 5AVEA 3S7OA 2J3TC 3PYPA 3RH8B 2PT7A 4LRXC 2M7VA 3D3OA 3K3DA 2PD7A 3MQOA 2ZMVA 4I39A 3MQ0A 2O0YA 2D01A 3BY8A 3GDIA 3OOVA 2O9CA 2XRNA 5J7EA 4XT2A 3LIDA 3LR5A 2KX6A 3MFXA 5HL6A 3MXQA 4G3WA 2FH5A 4P6ZS 2QKPA 1LT0A 2HGVA 3PBNA 2W3GA 1EW0A 3OCNA 4GLQA 1OJ5A 4OOLA 1VB6A 4EEPA 1T1CA 4HY8A 4EQ1A 2L0WA 2ZOIA 4EU0A 3EOIA 5HDSA 5F68A 4EETB 1DP8A 3LYXA 2ZBBA 4EESA 2PYRA 3H82B 5DFYA 5J3WA 4WL9A 3EWKA 1BYWA 1P0ZA 3LIFA 4CLCA 4LRYC 2A24A 1YSPA 4B93A 1P9WA 2K7SA 4H6JA 3F1PB 3LR0A 1TS7A 2ZMFA 3EGDC 1LSVA 2I9VA 4R70A 3GECA 2W3FA 5G4YA 2L1MA 1TS0A 3NOPC 1XJ6A 2JKRM 3PBQA 4G3VA 1DP9A 3PBRA 4GHIB 2FZ0A 2PDRA 3B42A 4GCZA 3UB9A 4CLCC 2M1CA 4K08A 2JKRI 4DN0A 3S7NA 3H7WB 3C30A 2XROA 1H8MA 3A0VA 1LSWA 1KOUA 1GSXA 2BASA 3K2NA 4WN5A 1V9ZA 5HZHA 1OT6A 2H28A 5A8BA 3NOUC 3JVVA 1IOUA 4I5SA 4JGPA 2GJ3A 2XA7M 5IT5A 3BY9A 3KYQA 4NXEA 4HOIA 2VZWA 5TJJA 5TBMB 1XFQA 3FPVA 4DJ2A 3PBOA 2M7UA 4ETZA 3CI6A 4I3AA 2W1TB 1H3QA 1N9NA 4PAUA 1S4RA 4R3AA 4P6ZM 4LLOB 4UQIM 3LIEA 1ZHHB 5C5KA 4PKYG 4NEED 1S67L 1OJGA 2Y8HA 3MF0A 3T4JA 3BJNA 3PBSA 2W3HA 1DRMA 5K5BA 2JKTM 3T4TA 4H6JB 4CQHA 4HNBA 3FPWA 4DJ3A 4F3LB 3V67A 2A24B 4LPZA 4CLCB 4ARZA 5HSQA 2O9BA 2LB5A 3TW8A 4E04A 4EW7A 2EA9A 3T4SA 4Q0JA 4JGRA 3CLOA 1WA9A 2VV8A 3SW1A 4FSFA 2VA0A 3CUEC 1S66L 4R6LA 2OOLA 5HWWA 3EQVA 1GSVA 2QJ5A 4BWIA 1LSXA 2KLIA 2VJWA 1G6OA 2XA7S 2K2NA 5HWTA 3ICYA 4WELA 3NJAA 2OWJA 3UB7A 2INWA 2P7JA 2VLGA 3UE6A 4R38A 4WEJA 2HV1A 3S7QA 3CUEA 3MMHA 3FC7A 2J80A 2PYPA 4BBUA 4Y3IA 3S7PA 2O9AA 4NXFA 1OTDA 3H7WA 4I38A 3T4LA 4MN7A 3LI9A 4NXGA 3LR3A 2VGLM 2DMWA 1TS6A 4MDZA 1W63M 4MCWA 5HD5A 2QYBA 4WF0A 3NHQA 2PR5A 3O5YA 4BBTA 3IBJA 3PR6A 1T1BA 5DF9A 2O99A 4F3LA 2XSSA 2PR6A 4Q0HA 3OBFA 3E4QA 1W63Q 3UMDA 4O01A 3PXPA 2YKFA 4Y2FA 2Z6DA 1T1AA 3C2WA 1G28A 3LUQA 2JN7A 1GSWA 3LIAA 2W1TA 3P7NA 3LICA 2OAP1 4YNRA 1S4SA 4EXOA 4RQ9A 1VHMA 2NUPC 2B02A 3MR0A 3W2ZA 1OTBA 3T50A 2QHKA 3EEAA 2WKQA 4JGOA 1MZUA 1XJ3A 1MKMA 1STZA 4MN6A 3TJZC 4JGQA 2D02A 3T4KA 1OT9A 2K31A 2EWVA 4IUKA 4HHDA 2VV6A 3EQUA 3KYZA 3PBTA 2L4RA 1OTAA 3TE8A 2W1RA 3A0SA 3KSIA 4GHIA 2KDKA 1MC0A 4ARZB 1TD5A 5EFWA 2NUTC 5KIZA 1D06A 4HH3A 4HJ6A 3F1NB 5KSHA 4QPRA 4II7A 3HJKA 3BQAA 3MJQA 2VGLS 3VE3A 3BQ8A 3TRCA 5DJUA 3KSHA 4OOMA 1JNUA 3UB8A 4FOFA 4KUKA 3OC2A 4CLCD 3BW6A 1T18A 5DJTA 1UWPX 1XFNA 2P08A 2KOIA 1UGUA 1XJ4A 2V1BA 4HH2A 1F9IA 1F5MA 4PHTA 2GX5A 3C8CA 4AFIA 3FG8A 2PD8A 4HQAA 2GZAA 3LIBA 3K3CA 5TBMA 5AJGA 3IS2A 5F69A 2VV7A 1X0OA 1OTIA 1N9LA 3IBRA 4MN5A 4I3IA 3OLOA 5HDDA 5L8MA 4WUJA 1F98A 1YSQA 4HI4A 2JKTI 5HPIA 4XT2B 5CX7A 4B9OA 3VV4A 4M4XA 1NLYA 5G4ZA 4BJPA 4ETXA 4ME4A 2B18A 1P97A 3F1OA 3D72A 3E98A 5HD3A 1N9OA 5LBRA 2WKPA 2R78A 4GS9A 4EERA 4O0PA 3RTYA 2IA2A 4L9EA 3UB6A 2ZOHA 3LR4A 3G6OA 3ZQ5A 2OWHA 4G3KA 4BMWA 4HP9A 2HF6A 2Z6CA 5F6AA 3EEHA 2A2LA 3F1PA 2QWSA 4KUOA 2QJ7A 3MQQA 3ULFA 1Y28A 1IFQA 4IJGA 3KX0X 5HWVA 3H82A 4L9FA 2W3DA 3U2AA 4O8GA 4EUVA 2W3EA 2Y79A 5FL3A 1S1ZA 3CAXA 1V9YA 2YKHA 3R4KA 2HJ9C 5DFXA 4EEUA 3R7WB 4HJ3A 4HJ4A 3E4PA 4NXBA 1S1YA 4HP4A 1ODVA 4UQIS 2EWWA 2V0UA 2VX8A 5J4EA 5HPFA 1UWNX 3T4OA 3F1NA 2V9AA 4KQDA 4Y5FA 2G7UA 4UEYA 3VE4A 1YKDA 4BBVA 1DP6A 3CITA 4L0LA 2J3WA 4HIAA 5DKLA 5IS1A 1YAXA 3KSFA 4I3JA 4GS9B 3E4OA 4GJ4A 3P01A 1TF1A 4L9GA 5MC7A 3LI8A 3F1OB 2V1AA 4YOFA 4CLCE 5F5YA 2VKSA 4Q0IA 2W27A 3T4QA 2CMNA 2HJEA 2V0WA 1NRJA 3A0RA 5DKKA 4Z1WA 3B33A 4WEKA 3PHYA 1D7EA 1XJ2A 2JHEA 1OPXA 5HDCA 4WLAA 4IHQA 4DMZA 3BWLA 1TS8A 3KSGA 3IS2B 4NKPA 2J3TD 2MJ6A 4LRZE 4ZRRA 1NLZA 3NOTC 4MMNA 3KO6A 3HCYA 3R7WA 2LB9A 2PHYA 1OTEA 3RFBA 1T19A 2W0NA 4PKYA 1ZTUA 1NWZA 3JVUA 5I5LA 3DBAA 3OCLA 2GNXA 5AVFA 2WKRA 4IUHA 1LL8A 3B47A 4KQOA 3H9WA 2P04A 3UMEA 3ZYTA 3LFVA 3VOLA 3C38A 4GW9A 3UE3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CWF A;  3LIC A;  3P7N A;  2VEA A;  4HP9 A;  4YWZ A;  2Z6C A;  1N9N A;  3EEH A;  3F1P A;  5F6A A;  5IU1 A;  1S4S A;  2QWS A;  4EXO A;  3HJI A;  2QJ7 A;  4KUO A;  1S4R A;  3MQQ A;  4RQ9 A;  5AVE A;  4R3A A;  4LLO B;  3PYP A;  2B02 A;  3MR0 A;  3RH8 B;  3LIE A;  1OTB A;  4LRX C;  1Y28 A;  4PKY G;  3T50 A;  2QHK A;  3ULF A;  1S67 L;  1OJG A;  3K3D A;  2WKQ A;  3KX0 X;  5HWV A;  2PD7 A;  3MQO A;  4I39 A;  1MZU A;  3H82 A;  4JGO A;  2D01 A;  1XJ3 A;  3BY8 A;  3GDI A;  4L9F A;  1DRM A;  4MN6 A;  4JGQ A;  5J7E A;  1S1Z A;  2D02 A;  3CAX A;  3LID A;  4H6J B;  1OT9 A;  1V9Y A;  2YKH A;  4HNB A;  4XT2 A;  4HHD A;  4EEU A;  4DJ3 A;  2KX6 A;  2VV6 A;  4F3L B;  2A24 B;  3MFX A;  2L4R A;  4HJ3 A;  3MXQ A;  4HJ4 A;  4LPZ A;  3E4P A;  4NXB A;  5HSQ A;  1S1Y A;  2QKP A;  1ODV A;  1LT0 A;  1OTA A;  3A0S A;  4HP4 A;  1EW0 A;  2V0U A;  4E04 A;  4EW7 A;  2EA9 A;  4GHI A;  1OJ5 A;  5J4E A;  1VB6 A;  4JGR A;  3CLO A;  1WA9 A;  4EEP A;  2KDK A;  1UWN X;  1T1C A;  4HY8 A;  5EFW A;  4EQ1 A;  2VV8 A;  3F1N A;  2L0W A;  2V9A A;  4KQD A;  2ZOI A;  5KIZ A;  3SW1 A;  1S66 L;  1D06 A;  3VE4 A;  4R6L A;  4BBV A;  1DP6 A;  2OOL A;  5HDS A;  5HWW A;  4HH3 A;  1GSV A;  2QJ5 A;  4HJ6 A;  5F68 A;  1LSX A;  3F1N B;  4EET B;  1DP8 A;  3LYX A;  2ZBB A;  4HIA A;  3HJK A;  5DKL A;  5HWT A;  4EES A;  3MJQ A;  5IS1 A;  2PYR A;  3ICY A;  3H82 B;  3VE3 A;  4I3J A;  5J3W A;  4GS9 B;  3E4O A;  4WL9 A;  3NJA A;  2OWJ A;  3EWK A;  2INW A;  5DJU A;  4L9G A;  2P7J A;  3UB7 A;  2VLG A;  3LI8 A;  3F1O B;  4R38 A;  1BYW A;  1P0Z A;  2V1A A;  3LIF A;  3UE6 A;  2HV1 A;  1JNU A;  5F5Y A;  4LRY C;  3UB8 A;  4KUK A;  2A24 A;  2W27 A;  3FC7 A;  2J80 A;  2PYP A;  4BBU A;  2CMN A;  2K7S A;  2V0W A;  1T18 A;  3A0R A;  4H6J A;  5DJT A;  3F1P B;  4NXF A;  1TS7 A;  1UWP X;  1XFN A;  5DKK A;  1LSV A;  1OTD A;  3B33 A;  2I9V A;  3H7W A;  3PHY A;  4I38 A;  4R70 A;  1UGU A;  1XJ4 A;  2V1B A;  3GEC A;  1F9I A;  1D7E A;  1XJ2 A;  2L1M A;  1TS0 A;  4HH2 A;  5G4Y A;  2JHE A;  3C8C A;  3LI9 A;  3NOP C;  4NXG A;  5HDC A;  1XJ6 A;  3FG8 A;  4WLA A;  2PD8 A;  3BWL A;  1TS8 A;  1TS6 A;  4HQA A;  3IS2 B;  3LIB A;  3K3C A;  1DP9 A;  4GHI B;  5HD5 A;  2PDR A;  5TBM A;  4WF0 A;  3NHQ A;  3IS2 A;  4LRZ E;  5F69 A;  2PR5 A;  4GCZ A;  2VV7 A;  3UB9 A;  1X0O A;  1OTI A;  1N9L A;  3IBR A;  3NOT C;  4BBT A;  2M1C A;  4K08 A;  4MN5 A;  4I3I A;  3OLO A;  5HDD A;  2PHY A;  4WUJ A;  1F98 A;  1T1B A;  1OTE A;  1T19 A;  3H7W B;  4F3L A;  4HI4 A;  2W0N A;  3A0V A;  4PKY A;  1LSW A;  1KOU A;  1GSX A;  2BAS A;  4WN5 A;  1V9Z A;  4XT2 B;  2PR6 A;  5HZH A;  1OT6 A;  2H28 A;  1NWZ A;  3E4Q A;  5I5L A;  3UMD A;  4B9O A;  5A8B A;  4M4X A;  2YKF A;  3NOU C;  5G4Z A;  4I5S A;  2Z6D A;  1T1A A;  4JGP A;  5AVF A;  2GJ3 A;  3C2W A;  1P97 A;  2WKR A;  1G28 A;  3BY9 A;  3D72 A;  3F1O A;  4NXE A;  1LL8 A;  1N9O A;  4HOI A;  5HD3 A;  2WKP A;  2R78 A;  4GS9 A;  3H9W A;  5TBM B;  4EER A;  1XFQ A;  3UME A;  3LUQ A;  4DJ2 A;  3RTY A;  4L9E A;  2JN7 A;  3UB6 A;  2ZOH A;  1GSW A;  3G6O A;  3VOL A;  3ZQ5 A;  3LIA A;  2OWH A;  4GW9 A;  4I3A A; 
#chains in the Genus database with same CATH topology
 3CWF A;  5IU1 A;  1P9R A;  2OAQ 1;  3EGX C;  2J8Y A;  2ZC4 B;  5AVE A;  1K56 A;  2PAV P;  4ZJ3 A;  3SS5 A;  4R3B A;  3PYP A;  1PI4 A;  4Y0U A;  1K6R A;  2XD1 A;  3IHB A;  2ZMV A;  4PPR A;  3ZNY A;  3BY8 A;  2A3U A;  2O9C A;  2Y55 A;  4XT2 A;  1MWU A;  3KYE A;  3HUN A;  2VGK A;  2Y2I A;  3MFX A;  1YLP A;  3MXQ A;  5CTM A;  3FKW A;  3NY4 A;  4OLG A;  2ZQ9 A;  4GLQ A;  2P9V B;  4UAA A;  1TDG A;  5A91 A;  4EQ1 A;  1PNE A;  4IVK A;  4EU0 A;  1K55 C;  5HDS A;  1DP8 A;  4A5R A;  5E2H A;  1M40 A;  4WL9 A;  3EWK A;  4MEZ A;  1BYW A;  1P0Z A;  3LIF A;  4DE2 A;  2JKG A;  2VK3 A;  1YSP A;  4B93 A;  2XF3 A;  2K7S A;  3LR0 A;  3EGD C;  3LO7 A;  1CI9 A;  3NOP C;  1H8Z A;  1PWC A;  4KQR A;  5E2E A;  1CEF A;  1DP9 A;  2FZ0 A;  4GCZ A;  1HZO A;  1ONH A;  2JKR I;  3BFG A;  1FR1 A;  1LSW A;  1KOU A;  5HZH A;  2JCH A;  4GD8 A;  1LL9 A;  4U0X A;  3BY9 A;  5M1A A;  2FFY A;  3KYQ A;  5FEG A;  4HOI A;  5TJJ A;  1XFQ A;  4GKU A;  2GDN A;  2P74 A;  3FPV A;  3MSH A;  4LCL A;  5FQM A;  1FIK A;  4C6Y A;  5FAT A;  3UB5 P;  1XKZ A;  2W1T B;  4X25 A;  5CEB A;  1N9N A;  2Y2M A;  5EVI A;  4HBU A;  3Q1F A;  4PKY G;  1K54 C;  1W8Y A;  3T4J A;  4Y13 A;  3BJN A;  5HW3 A;  1YM1 A;  4CJN A;  2JKF A;  4KZ6 A;  5EVL A;  1NRF A;  5EVE A;  3IF5 A;  3V5M A;  1NZU A;  4CLC B;  2LB5 A;  3TW8 A;  4E04 A;  3TG9 A;  4Q0J A;  4NK3 A;  3HUO A;  1WA9 A;  4EBL A;  3BEB A;  3ZNT A;  3SW1 A;  4FSF A;  5L10 A;  4U0T A;  2ZL1 A;  1ESU A;  1ZG4 A;  2OOL A;  1KDS A;  1GSV A;  1KGG A;  2KLI A;  1MBL A;  2WGW B;  2K2N A;  1L0D A;  4RA7 A;  2HDS A;  2P7J A;  2ZJ9 A;  4DE3 A;  5DF7 A;  3S7Q A;  3P09 A;  3MMH A;  1NXY A;  2J80 A;  4BBU A;  2O9A A;  2I72 A;  3NEC A;  3UN7 A;  3HL9 A;  5DTT A;  3T4L A;  4NXG A;  3LI9 A;  3VSK A;  2BTF P;  4BD1 A;  3GTC A;  1L0F A;  3N8L A;  3OPR A;  4MDZ A;  4OVD A;  3NUL A;  4MCW A;  2QYB A;  3DW0 A;  1H5X A;  1K56 D;  4BBT A;  3PR6 A;  4OPR A;  1O07 A;  3E4Q A;  3B3X A;  4Y2F A;  1G28 A;  2UWX A;  5GHX A;  1N9B A;  4K0X A;  3A3E A;  3ZVW A;  4OPQ A;  5EEC A;  1O7E A;  2W1T A;  1GA9 A;  4PM6 A;  4S2N C;  3W2Z A;  1SCW A;  3T50 A;  2WKQ A;  2FFF B;  1GHP A;  3T1R A;  4JGQ A;  4UA6 A;  1IYO A;  1SKF A;  2K31 A;  3ISG A;  2VV6 A;  3VFH A;  5GLB A;  1OTA A;  3TE8 A;  3HLB A;  5HAQ A;  2WUQ A;  1ERQ A;  4KZA A;  2B5R A;  3QP4 A;  2DRW A;  3O3V A;  1MC0 A;  4C3Q A;  3VP0 A;  4ARZ B;  2NUT C;  2XGN A;  4QY5 A;  1D06 A;  4Q8I A;  1YLY A;  4HJ6 A;  4LCM A;  4QPR A;  3UDI A;  3BQA A;  1RP5 A;  2H10 A;  4E3I A;  3MKE A;  3BLS A;  4QD4 A;  1JNU A;  3UB8 A;  4FOF A;  3OC2 A;  2Q0O A;  2Z2M B;  2P08 A;  4HH2 A;  2V1B A;  4AFI A;  3FG8 A;  2PD8 A;  2ZM8 A;  3LIB A;  5EM1 A;  4JLF A;  3IS2 A;  3SH8 A;  4MBK A;  2JBF A;  3DWK A;  3VOZ A;  1YSQ A;  1ESI A;  3NBL A;  1E3U A;  4EBN A;  3Q7Z A;  3VV4 A;  4D2O A;  4M4X A;  1NLY A;  5CTN A;  4QB8 A;  2B18 A;  2X71 A;  1P97 A;  2VGJ A;  4M3K A;  5AQB A;  5HD3 A;  2R78 A;  4GS9 A;  4E6W A;  1MY8 A;  3ZQ5 A;  4JF6 A;  4G3K A;  4BMW A;  2A2L A;  3F1P A;  3QP2 A;  1FIL A;  3MQQ A;  3MBZ A;  1OME A;  1HTZ A;  2Y79 A;  3DTE A;  1GHM A;  1V9Y A;  4EEU A;  4FTX A;  4N9L A;  3R7W B;  1PWD A;  4DDY A;  2HP9 A;  1HD8 A;  1MKI A;  3T4O A;  1ES4 A;  3F1N A;  3QNC A;  4Y5F A;  3OPP A;  3V3R A;  4UEY A;  3VE4 A;  2DCF A;  2J3W A;  1YAX A;  4I3J A;  3M6H A;  3E4O A;  5MC7 A;  1Z09 A;  3F1O B;  2V1A A;  5F5Y A;  1PI5 A;  4OQH A;  3T4Q A;  4X53 A;  2HJE A;  2V0W A;  1NRJ A;  2WAF A;  4Z1W A;  3B33 A;  4GNU A;  4WEK A;  1H0M A;  3PHY A;  1TDL A;  2XEP A;  4OQI A;  4WZ4 A;  4DMZ A;  3KSG A;  2J3T D;  4N1X A;  5E2F A;  1NLZ A;  4MMN A;  3HCY A;  2LB9 A;  2PHY A;  1GHI A;  1PIO A;  4S2P A;  1T19 A;  3RFB A;  2OLU A;  3NDE A;  3JVU A;  2Y2P A;  1BZA A;  4E3N A;  4WM9 A;  1LL8 A;  5GLA A;  4OH0 A;  3N8R A;  3UME A;  3VOL A;  5EUA A;  1JVJ A;  4GW9 A;  4R4R A;  4YWZ A;  3HJI A;  3D9Y A;  4LV2 A;  3S7O A;  2J3T C;  1K4F A;  3MS6 A;  3RH8 B;  2WAE A;  4Y15 A;  4DDS A;  4LEN A;  2PD7 A;  4I39 A;  2O0Y A;  3GDI A;  3T1Q B;  1BLP A;  1L0E A;  4IBX A;  5HL6 A;  1MXO A;  4G3W A;  4P6Z S;  3PBN A;  1EW0 A;  1NJ4 A;  4JXG A;  4LV3 A;  2QPN A;  4EEP A;  1FCM A;  2V20 A;  2L0W A;  3EOI A;  3IXH A;  1HLU P;  5F68 A;  2EFX A;  2ZBB A;  3VFF A;  1JWV A;  2JE5 A;  4EES A;  5DFY A;  5J3W A;  4PM7 A;  5FI6 A;  3FZC A;  3IWQ A;  4UHU A;  4LRY C;  4OLD A;  1K54 A;  3C4O A;  2QMI A;  4H6J A;  2ZMF A;  1LSV A;  4S2K A;  2I9V A;  3RXX A;  5G4Y A;  1XA1 A;  5CHJ A;  5GHY A;  4BL3 A;  3PBR A;  1XPB A;  3B42 A;  4WMC D;  4S2M A;  2R9X A;  1JTG A;  2M1C A;  4K08 A;  2IWD A;  5E2G A;  4OPY A;  2ZC5 B;  4HBT A;  3BYD A;  4DN0 A;  4Y0O A;  3H7W B;  2XRO A;  4IVI A;  2BAS A;  1GSX A;  3K2N A;  1XGJ A;  4EV4 A;  2HP5 A;  4JGP A;  2ZM0 A;  5GLD A;  4JBF A;  2AVX A;  3ITB A;  4U3T A;  3UPN A;  3ZG8 B;  3CI6 A;  4I3A A;  2WAD A;  3DAV A;  3TSG A;  1YMX A;  4P6Z M;  1NYM A;  1QME A;  1OJG A;  3CG5 A;  3MF0 A;  3TOI A;  3PBS A;  3HLG A;  3T4T A;  4H6J B;  4HNB A;  2Y91 A;  5GLC A;  2A24 B;  4GB7 A;  4LPZ A;  1YLW A;  3BFC A;  4YFM A;  2XD5 A;  2EA9 A;  3T4S A;  4PMA A;  1G68 A;  2Y2L A;  4N1H A;  4JGR A;  5FDH A;  1SDE A;  3VP3 A;  4B4X A;  2VV8 A;  4K91 A;  4ZJ1 A;  1VEU B;  1RCJ A;  3RXW A;  1G6O A;  3IF6 B;  2XA7 S;  5HX9 A;  3HRE A;  1J9M A;  3NJA A;  1K0K A;  2VLG A;  3UE6 A;  4X1M A;  4WEJ A;  4OQG A;  2H0Y A;  3CUE A;  3FC7 A;  2PYP A;  4Y3I A;  4NXF A;  1OTD A;  2ZL1 B;  1ZKJ A;  3IH8 A;  2G2W A;  4X56 A;  3LR3 A;  1SKO B;  2WKI A;  2VGL M;  5DF8 A;  1TS6 A;  2XK1 A;  1FCN A;  4HES A;  1W63 M;  4WF0 A;  5EOO A;  1ERM A;  4DXC A;  1T1B A;  3FWL A;  2O99 A;  4F3L A;  2WK0 A;  3BFD A;  4FCF A;  2PR6 A;  4Q0H A;  3OBF A;  1W63 Q;  5F82 A;  2YKF A;  1LI9 A;  1F2K A;  3OPL A;  3UNW A;  4WZ5 A;  3LUQ A;  3M2J A;  5FQK A;  4NG2 A;  1Q2P A;  3Q7V A;  4KZ7 A;  4O7D A;  1FCO A;  4YNR A;  3LIC A;  1SHV A;  1W79 A;  2PRF A;  1KE0 A;  5CGX A;  2NUP C;  3BM6 A;  3WS1 A;  1OTB A;  2QHK A;  3FYZ A;  3EEA A;  4JGO A;  1ES3 A;  4PM8 A;  3MXS A;  2D02 A;  3T4K A;  4F94 A;  4JF5 A;  1OT9 A;  2ZQA A;  3DWZ A;  2EX6 A;  3PBT A;  2EX8 A;  2W1R A;  1EI5 A;  2PBY A;  3BRM A;  3UY6 A;  4HH3 A;  3VMA A;  4X69 A;  4K0W A;  4II7 A;  2VGL S;  3IXB A;  4S2L A;  3KSH A;  3N4I A;  4CLC D;  2V2F F;  3BW6 A;  5DJT A;  1MPL A;  1IYQ A;  1F9I A;  1F5M A;  1ES5 A;  4Y17 A;  5CGS A;  5J8X A;  1NYY A;  5F69 A;  5FQI A;  2VV7 A;  1I2W A;  2Y2N A;  3IBR A;  1N9L A;  3OLO A;  1ONG A;  3PAG A;  1CEG A;  5HPI A;  2OLV A;  1D1J A;  3NDG A;  4XT2 B;  4EQI A;  2ZC3 B;  2XLN A;  4KZB A;  4X6T A;  5GHZ A;  4QY6 A;  3D72 A;  3SZT A;  4PM5 A;  1N4O A;  5LBR A;  1CJF A;  3UO9 A;  5TGF A;  3N8S A;  4L9E A;  4ZTK A;  4X55 A;  4FD8 A;  3UB6 A;  3G6O A;  3ZFZ A;  2OWH A;  4DE1 A;  3QP1 A;  1KE3 A;  2Z6C A;  3EEH A;  2QWS A;  4WBG A;  4KUO A;  1EWZ A;  1YLZ A;  3ULF A;  4WYY A;  1KVM A;  5BOH A;  3KX0 X;  2Y2H A;  3U2A A;  2W3E A;  1LHY A;  2YKH A;  3R4K A;  4HJ4 A;  3E4P A;  2Y2Q A;  3WRZ A;  4UQI S;  1K57 C;  2V0U A;  5J4E A;  2V9A A;  5JYO A;  4E3J A;  1LI0 A;  3HBR A;  1DJC A;  3CIT A;  1K55 A;  3G32 A;  3W4O A;  2BG1 A;  3P01 A;  5CHM A;  4L9G A;  3PAE A;  5I94 A;  1YT4 A;  2ZQ8 A;  2VKS A;  4Q0I A;  2W27 A;  2CMN A;  1QMF A;  4DE0 A;  1S0W A;  5IHV A;  4B88 A;  1XJ2 A;  4ESP A;  2JHE A;  1DY6 A;  5HDC A;  4R23 A;  4WLA A;  1L3L A;  2WKE A;  1TS8 A;  2MJ6 A;  4LGW A;  3NOT C;  4IBR A;  1RGZ A;  1W7F A;  2H0T A;  3Q7V B;  4MBF A;  4PKY A;  1ZTU A;  2WYX A;  2GNX A;  5AVF A;  4IUH A;  3GV9 A;  2RL3 A;  5FA7 A;  2VEA A;  1JTD A;  1WYB A;  4KG2 A;  4DKI A;  5KZH A;  1FQG A;  2PT7 A;  4LRX C;  4BD0 A;  2M7V A;  3D3O A;  3HLW A;  2ZMA A;  3MZD A;  3K3D A;  3MQO A;  3OOV A;  1AWI A;  2XRN A;  3VOY A;  3LEZ A;  3LR5 A;  2KX6 A;  4RVA A;  3SS3 A;  1VET A;  2FH5 A;  3VP4 A;  2HGV A;  2W3G A;  3DTM A;  1BTL A;  4OOL A;  1VB6 A;  1FOF A;  3WS4 A;  3IF6 A;  1T1C A;  4HY8 A;  4E3K A;  3QNB A;  1IEL A;  1L0G A;  2ZOI A;  4E6X A;  2ZC6 B;  3I7J A;  3LYX A;  1ACF A;  2PYR A;  3P98 A;  4FH2 A;  1E3U D;  4CLC A;  2Y2O A;  2A24 A;  3N7W A;  1NZO A;  3F1P B;  4R70 A;  2XFT A;  2JKR M;  2DNS A;  3L7H A;  3PBQ A;  3Q82 A;  1WYC A;  4R0Q A;  4GHI B;  3FKV A;  5CRF A;  3UB9 A;  1SKO A;  3UE0 A;  4CLC C;  4UA9 A;  3A0V A;  1E25 A;  4ZDX A;  2H28 A;  5A8B A;  1PZP A;  4LV1 A;  4I5S A;  2XA7 M;  5IT5 A;  2VZW A;  4OP8 A;  5TBM B;  3IWO A;  4DJ2 A;  3PBO A;  2J9O A;  4ETZ A;  1KGE A;  4P87 A;  4S2J A;  4HEF A;  1VEU A;  1H3Q A;  4GZB A;  2HZ5 A;  4PAU A;  4S2N A;  3BFE A;  3LIE A;  1ZHH B;  3IT9 A;  4NEE D;  4DRT A;  1IKI A;  5CGW A;  4OP5 A;  1K25 A;  1KVL A;  5K5B A;  3S1Y A;  1PZO A;  3FPW A;  5HAI A;  3A3F A;  3GMW A;  4ARZ A;  1CI8 A;  5HSQ A;  2O9B A;  4WZ5 C;  5HAR A;  3CLO A;  4Y7P A;  1MWT A;  2VA0 A;  3CUE C;  1S66 L;  4R6L A;  3EQV A;  1LSX A;  3Q81 A;  3LY4 A;  5HWT A;  5FAO A;  1MWR A;  3BFF A;  2INW A;  5TFQ A;  4BLM A;  2HV1 A;  3S7P A;  1HVB A;  4N92 A;  3DTK A;  4I38 A;  5FAS A;  4H8R A;  1LL5 A;  2ZM2 A;  3NHQ A;  4KZ3 A;  3SS4 A;  3O5Y A;  1XX2 A;  2HDR A;  3IBJ A;  2ZQC A;  4LFU A;  3OPH A;  5DF9 A;  1XXM A;  4KZ5 A;  3IX3 A;  5E43 A;  3UMD A;  3PXP A;  1VQQ A;  1T1A A;  2XQZ A;  3MFD A;  5FQQ A;  1TVF A;  4IED A;  3IXG A;  3QP6 A;  1PYY A;  3IX8 A;  3BEC A;  1Y54 A;  2V8C A;  2HP6 A;  4QHC A;  3P7N A;  1BLS A;  5EVI C;  1S4S A;  4EXO A;  3GRJ A;  3MR0 A;  1ZG6 A;  2RCX A;  3WS5 A;  5GL9 A;  4ZJ2 A;  1MKM A;  1STZ A;  4MNR A;  1DJA A;  5FI7 A;  1Q2Q A;  4MN6 A;  1CQA A;  3TJZ C;  2Y4A A;  2EWV A;  4IUK A;  4HHD A;  3EQU A;  3KYZ A;  3NIA A;  4GHI A;  3C7U A;  5JYP A;  1A0K A;  5EFW A;  5FQ9 A;  5KIZ A;  1G5U A;  4UA7 A;  2G2U A;  3M6B A;  3F1N B;  5KSH A;  3ZG5 A;  1Z6F A;  3HJK A;  2E8J A;  4P85 A;  4RYE A;  3LGO A;  4YIN A;  5EVI B;  1BT5 A;  3O88 A;  1T18 A;  3G30 A;  3A3D A;  4MBH A;  4PHT A;  2GX5 A;  4RX2 A;  4HQA A;  3K3C A;  1K57 A;  4KQQ A;  1IYP A;  1VET B;  4R3J A;  5L8M A;  1AXB A;  5L07 A;  1F98 A;  5M19 A;  4Z9Q A;  3F1O A;  3UDF A;  3T1X A;  4EER A;  5CEC A;  4O0P A;  3RTY A;  2IA2 A;  3UDX A;  1I5Q A;  2ZOH A;  3LR4 A;  3M2K A;  4EUZ A;  4HP9 A;  2HF6 A;  1ERO A;  4KG6 A;  2XDM A;  4BQM A;  1E4D A;  4D60 A;  3GQZ A;  1Y28 A;  1IFQ A;  1PFL A;  4R1G A;  4IJG A;  2W3D A;  4EUV A;  1S1Z A;  4NET A;  4XUX A;  3HLF A;  2HJ9 C;  4PM9 A;  3O86 A;  1KDW A;  2EX2 A;  5EOE A;  3E2K A;  4NXB A;  1S1Y A;  3VP1 A;  1ODV A;  2V8F A;  2EWW A;  2P9V A;  4RX3 A;  2A49 A;  2UV0 E;  5HPF A;  3ZDJ A;  4KQD A;  2G7U A;  2H5S A;  3IX4 A;  1YKD A;  3GR2 A;  1SZV A;  5FI2 A;  4L0L A;  1GCE A;  4EBP A;  4HIA A;  2JC7 A;  5DKL A;  3V3S A;  5IS1 A;  2OSU A;  4X1L A;  3SOI A;  1TF1 A;  4GD6 A;  3C4P A;  4CLC E;  5D3O A;  1BUE A;  1RGY A;  2ZQD A;  3V50 A;  1YLJ A;  4OPZ A;  5A90 A;  5KMW A;  1PW1 A;  5DKK A;  4XXR A;  4X68 A;  2WGV A;  1DJB A;  2QZ6 A;  1OPX A;  1XGI A;  1SDN A;  4CPK A;  3BWL A;  3UPP A;  3IS2 B;  4NKP A;  3V39 A;  1WE4 A;  4QU3 A;  3W8K A;  3KO6 A;  3ITA A;  1ZC2 A;  3JPU A;  4GDN A;  1NWZ A;  5I5L A;  3DBA A;  5EVI D;  4P6B A;  5EE8 A;  2PU2 A;  3B47 A;  5FAQ A;  3ZG0 A;  3SH7 A;  2C6W B;  3LFV A;  3NC8 A;  4JF4 A;  2Q9N A;  1M6K A;  3E0Y A;  4KEN B;  1C3B A;  1YPR A;  5CER A;  5HFO A;  3CZD A;  5EV0 A;  3A3J A;  4JXV A;  1K6S A;  3W4P A;  3SH9 A;  3MQ0 A;  2D01 A;  5TR7 A;  5J7E A;  3LID A;  3HLD A;  2ZD8 A;  5EPH A;  3N6I A;  3WWX A;  2QKP A;  1LT0 A;  3OZH A;  3OCN A;  1OJ5 A;  5DTK A;  3U4L P;  2R9W A;  2WGW A;  4KZ8 A;  1BUL A;  4EET B;  5A93 A;  1Y4O A;  3QP8 A;  3W4Q A;  3H82 B;  5CHU A;  3FV7 A;  1KE4 A;  1FR6 A;  2XFS A;  1P9W A;  1TS7 A;  5FAP A;  3GEC A;  2W3F A;  3RJU A;  2L1M A;  1TS0 A;  1KGF A;  1XJ6 A;  4DXB A;  4EWF A;  4G3V A;  4WMC A;  3BLM A;  1NY0 A;  2PDR A;  3GSG A;  3GVB A;  5KSC A;  2X01 A;  4GN2 A;  5DTS A;  3S7N A;  3C30 A;  1H8M A;  3QHY A;  4WN5 A;  2PBD P;  1V9Z A;  4Y0T A;  1OT6 A;  3HLC A;  1S6R A;  4S2O A;  1YQS A;  3NOU C;  3JVV A;  1IOU A;  1L2S A;  2GJ3 A;  4NXE A;  5M18 A;  2Y2G A;  4FH4 A;  2EFU A;  2M7U A;  2PU4 A;  1S4R A;  4R3A A;  3T1S A;  2Y59 A;  4N9K A;  4LLO B;  4UQI M;  4ZBE A;  5C5K A;  1S67 L;  4GOG A;  2Y8H A;  1XA7 A;  3MZF A;  1K38 A;  2W3H A;  1DRM A;  3S4X A;  1ALQ A;  2JKT M;  4CQH A;  4DJ3 A;  4F3L B;  4LV0 A;  3V67 A;  3NI9 A;  1YLT A;  2XR0 A;  1VM1 A;  4JKT A;  4XUZ A;  3MZE A;  4EW7 A;  2WGI A;  1MWS A;  3CHW P;  1TEM A;  2J7V A;  3Q07 A;  2V1Z A;  5HWW A;  2J9P A;  4BWI A;  2QJ5 A;  2HDU A;  3S22 A;  2VJW A;  4E3M A;  2Q9M A;  5A92 A;  3ICY A;  4WEL A;  3A3I A;  2OWJ A;  3UB7 A;  2IWB A;  4R38 A;  3ZGA B;  4BL2 A;  1PW8 A;  3HVF A;  3LEQ A;  2ACG A;  1PWG A;  3H7W A;  5L09 A;  1U60 A;  4MN7 A;  2DMW A;  3HLE A;  5HD5 A;  5FEF A;  1BSG A;  2PR5 A;  1CF0 A;  4R4S A;  4KZ4 A;  2EX9 A;  2XSS A;  3AGD A;  1K4E A;  4O01 A;  2Z6D A;  4JXS A;  4OON A;  3C2W A;  2WZZ A;  3C5A A;  4OKP A;  2JN7 A;  4KZ9 A;  1GSW A;  3LIA A;  3IQA A;  1IKG A;  2OAP 1;  3ZG9 B;  3AGF A;  3UPO A;  4RQ9 A;  1VHM A;  1BLH A;  4QWO A;  4E3L A;  2C5W B;  2B02 A;  3ZCZ A;  1LLB A;  4JXW A;  4QJG A;  1YMS A;  1BLC A;  1MZU A;  1XJ3 A;  1PRQ A;  2Y2K A;  3WS2 A;  2L4R A;  3CJM A;  3A0S A;  3UE1 A;  3KSI A;  5F1F A;  5HAP A;  2KDK A;  3LCE A;  1TD5 A;  4E3O A;  2X02 A;  3C7V A;  1GA0 A;  5F83 A;  1W5D A;  4ID4 A;  3O87 A;  3VP2 A;  3QP5 A;  3MJQ A;  4S2I A;  3VE3 A;  3BQ8 A;  5FDS A;  5FSR A;  3TRC A;  4KG5 A;  3IHA A;  5DJU A;  4OOM A;  3DTI A;  4KUK A;  1UWP X;  1XFN A;  2WKH A;  1JWZ A;  2KOI A;  5F1G A;  1UGU A;  1XJ4 A;  4OQ0 A;  3C8C A;  3IWI A;  2GZA A;  3CMZ A;  5TBM A;  2ZC7 A;  5AQ9 A;  5AJG A;  3ZVT A;  3WS0 A;  1X0O A;  1OTI A;  4MN5 A;  4I3I A;  5HDD A;  4WUJ A;  4FUW A;  5U47 A;  3VSL A;  4HI4 A;  1FSY A;  2JKT I;  5CXW A;  4ZAM A;  5G18 A;  5CX7 A;  4B9O A;  1IEM A;  5G4Z A;  2EXA A;  4BJP A;  2Y2J A;  3G34 A;  4ME4 A;  4ETX A;  5EM0 A;  3E98 A;  1IYS A;  1N9O A;  2WKP A;  2ZLY A;  4P0M A;  1JWP A;  3CPT A;  4GDB A;  3T12 B;  1J3W A;  5F6A A;  5CED A;  2QJ7 A;  2ZQ7 A;  2B95 A;  3ZG7 B;  3G2Y A;  5DVA A;  5HL1 A;  5HWV A;  3H82 A;  4L9F A;  4O8G A;  2EXB A;  5FL3 A;  3CAX A;  3LY3 A;  5DFX A;  4HJ3 A;  4HP4 A;  2HPB A;  2VX8 A;  4MLL A;  3G4P A;  1UWN X;  4B4Z A;  3IF6 C;  3NCK A;  5FQJ A;  2IWC A;  2OV5 A;  4BBV A;  1DP6 A;  3CPT B;  3ZHH A;  1I2S A;  3MXR A;  2HDQ A;  3KSF A;  4GS9 B;  4GJ4 A;  1CK3 A;  4JPM A;  3IH9 A;  5AQA A;  3LI8 A;  4YOF A;  2CC1 A;  2XH9 A;  1H8Y A;  2E8I A;  3AGE A;  3A0R A;  1W8Q A;  4C75 A;  5AQ7 A;  3WRT A;  1D7E A;  4IHQ A;  2WZX A;  4LRZ E;  3G2Z A;  4ZRR A;  3R7W A;  3PTE A;  4BEN A;  3D4F A;  1OTE A;  3IXD A;  2Z2L B;  2W0N A;  1XP4 A;  3OCL A;  3G35 A;  4OOY A;  3E2L A;  2WKR A;  2BLS A;  1ES2 A;  4KQO A;  3JYI A;  3MKF A;  3H9W A;  2P04 A;  4DF6 A;  3L9K A;  3ZYT A;  5L2F A;  3HUM A;  3C38 A;  1G6A A;  1FSW A;  3UE3 A;  3G31 A; 
#chains in the Genus database with same CATH homology
 3CWF A;  2VEA A;  4YWZ A;  5IU1 A;  1P9R A;  2OAQ 1;  3E0Y A;  3EGX C;  3HJI A;  5AVE A;  3S7O A;  2J3T C;  3PYP A;  3RH8 B;  2PT7 A;  4LRX C;  2M7V A;  3D3O A;  3K3D A;  2PD7 A;  3MQO A;  2ZMV A;  4I39 A;  3MQ0 A;  2O0Y A;  2D01 A;  3BY8 A;  3GDI A;  3OOV A;  2O9C A;  2XRN A;  5J7E A;  4XT2 A;  3LID A;  3LR5 A;  2KX6 A;  3MFX A;  5HL6 A;  3MXQ A;  4G3W A;  2FH5 A;  4P6Z S;  2QKP A;  1LT0 A;  2HGV A;  3PBN A;  2W3G A;  1EW0 A;  3OCN A;  4GLQ A;  1OJ5 A;  4OOL A;  1VB6 A;  4EEP A;  1T1C A;  4HY8 A;  4EQ1 A;  2L0W A;  2ZOI A;  4EU0 A;  3EOI A;  5HDS A;  5F68 A;  4EET B;  1DP8 A;  3LYX A;  2ZBB A;  4EES A;  2PYR A;  3H82 B;  5DFY A;  5J3W A;  4WL9 A;  3EWK A;  1BYW A;  1P0Z A;  3LIF A;  4CLC A;  4LRY C;  2A24 A;  1YSP A;  4B93 A;  1P9W A;  2K7S A;  4H6J A;  3F1P B;  3LR0 A;  1TS7 A;  2ZMF A;  3EGD C;  1LSV A;  2I9V A;  4R70 A;  3GEC A;  2W3F A;  5G4Y A;  2L1M A;  1TS0 A;  3NOP C;  1XJ6 A;  2JKR M;  3PBQ A;  4G3V A;  1DP9 A;  3PBR A;  4GHI B;  2FZ0 A;  2PDR A;  3B42 A;  4GCZ A;  3UB9 A;  4CLC C;  2M1C A;  4K08 A;  2JKR I;  4DN0 A;  3S7N A;  3H7W B;  3C30 A;  2XRO A;  1H8M A;  3A0V A;  1LSW A;  1KOU A;  1GSX A;  2BAS A;  3K2N A;  4WN5 A;  1V9Z A;  5HZH A;  1OT6 A;  2H28 A;  5A8B A;  3NOU C;  3JVV A;  1IOU A;  4I5S A;  4JGP A;  2GJ3 A;  2XA7 M;  5IT5 A;  3BY9 A;  3KYQ A;  4NXE A;  4HOI A;  2VZW A;  5TJJ A;  5TBM B;  1XFQ A;  3FPV A;  4DJ2 A;  3PBO A;  2M7U A;  4ETZ A;  3CI6 A;  4I3A A;  2W1T B;  1H3Q A;  1N9N A;  4PAU A;  1S4R A;  4R3A A;  4P6Z M;  4LLO B;  4UQI M;  3LIE A;  1ZHH B;  5C5K A;  4PKY G;  4NEE D;  1S67 L;  1OJG A;  2Y8H A;  3MF0 A;  3T4J A;  3BJN A;  3PBS A;  2W3H A;  1DRM A;  5K5B A;  2JKT M;  3T4T A;  4H6J B;  4CQH A;  4HNB A;  3FPW A;  4DJ3 A;  4F3L B;  3V67 A;  2A24 B;  4LPZ A;  4CLC B;  4ARZ A;  5HSQ A;  2O9B A;  2LB5 A;  3TW8 A;  4E04 A;  4EW7 A;  2EA9 A;  3T4S A;  4Q0J A;  4JGR A;  3CLO A;  1WA9 A;  2VV8 A;  3SW1 A;  4FSF A;  2VA0 A;  3CUE C;  1S66 L;  4R6L A;  2OOL A;  5HWW A;  3EQV A;  1GSV A;  2QJ5 A;  4BWI A;  1LSX A;  2KLI A;  2VJW A;  1G6O A;  2XA7 S;  2K2N A;  5HWT A;  3ICY A;  4WEL A;  3NJA A;  2OWJ A;  3UB7 A;  2INW A;  2P7J A;  2VLG A;  3UE6 A;  4R38 A;  4WEJ A;  2HV1 A;  3S7Q A;  3CUE A;  3MMH A;  3FC7 A;  2J80 A;  2PYP A;  4BBU A;  4Y3I A;  3S7P A;  2O9A A;  4NXF A;  1OTD A;  3H7W A;  4I38 A;  3T4L A;  4MN7 A;  3LI9 A;  4NXG A;  3LR3 A;  2VGL M;  2DMW A;  1TS6 A;  4MDZ A;  1W63 M;  4MCW A;  5HD5 A;  2QYB A;  4WF0 A;  3NHQ A;  2PR5 A;  3O5Y A;  4BBT A;  3IBJ A;  3PR6 A;  1T1B A;  5DF9 A;  2O99 A;  4F3L A;  2XSS A;  2PR6 A;  4Q0H A;  3OBF A;  3E4Q A;  1W63 Q;  3UMD A;  4O01 A;  3PXP A;  2YKF A;  4Y2F A;  2Z6D A;  1T1A A;  3C2W A;  1G28 A;  3LUQ A;  2JN7 A;  1GSW A;  3LIA A;  2W1T A;  3P7N A;  3LIC A;  2OAP 1;  4YNR A;  1S4S A;  4EXO A;  4RQ9 A;  1VHM A;  2NUP C;  2B02 A;  3MR0 A;  3W2Z A;  1OTB A;  3T50 A;  2QHK A;  3EEA A;  2WKQ A;  4JGO A;  1MZU A;  1XJ3 A;  1MKM A;  1STZ A;  4MN6 A;  3TJZ C;  4JGQ A;  2D02 A;  3T4K A;  1OT9 A;  2K31 A;  2EWV A;  4IUK A;  4HHD A;  2VV6 A;  3EQU A;  3KYZ A;  3PBT A;  2L4R A;  1OTA A;  3TE8 A;  2W1R A;  3A0S A;  3KSI A;  4GHI A;  2KDK A;  1MC0 A;  4ARZ B;  1TD5 A;  5EFW A;  2NUT C;  5KIZ A;  1D06 A;  4HH3 A;  4HJ6 A;  3F1N B;  5KSH A;  4QPR A;  4II7 A;  3HJK A;  3BQA A;  3MJQ A;  2VGL S;  3VE3 A;  3BQ8 A;  3TRC A;  5DJU A;  3KSH A;  4OOM A;  1JNU A;  3UB8 A;  4FOF A;  4KUK A;  3OC2 A;  4CLC D;  3BW6 A;  1T18 A;  5DJT A;  1UWP X;  1XFN A;  2P08 A;  2KOI A;  1UGU A;  1XJ4 A;  2V1B A;  4HH2 A;  1F9I A;  1F5M A;  4PHT A;  2GX5 A;  3C8C A;  4AFI A;  3FG8 A;  2PD8 A;  4HQA A;  2GZA A;  3LIB A;  3K3C A;  5TBM A;  5AJG A;  3IS2 A;  5F69 A;  2VV7 A;  1X0O A;  1OTI A;  1N9L A;  3IBR A;  4MN5 A;  4I3I A;  3OLO A;  5HDD A;  5L8M A;  4WUJ A;  1F98 A;  1YSQ A;  4HI4 A;  2JKT I;  5HPI A;  4XT2 B;  5CX7 A;  4B9O A;  3VV4 A;  4M4X A;  1NLY A;  5G4Z A;  4BJP A;  4ETX A;  4ME4 A;  2B18 A;  1P97 A;  3F1O A;  3D72 A;  3E98 A;  5HD3 A;  1N9O A;  5LBR A;  2WKP A;  2R78 A;  4GS9 A;  4EER A;  4O0P A;  3RTY A;  2IA2 A;  4L9E A;  3UB6 A;  2ZOH A;  3LR4 A;  3G6O A;  3ZQ5 A;  2OWH A;  4G3K A;  4BMW A;  4HP9 A;  2HF6 A;  2Z6C A;  5F6A A;  3EEH A;  2A2L A;  3F1P A;  2QWS A;  4KUO A;  2QJ7 A;  3MQQ A;  3ULF A;  1Y28 A;  1IFQ A;  4IJG A;  3KX0 X;  5HWV A;  3H82 A;  4L9F A;  2W3D A;  3U2A A;  4O8G A;  4EUV A;  2W3E A;  2Y79 A;  5FL3 A;  1S1Z A;  3CAX A;  1V9Y A;  2YKH A;  3R4K A;  2HJ9 C;  5DFX A;  4EEU A;  3R7W B;  4HJ3 A;  4HJ4 A;  3E4P A;  4NXB A;  1S1Y A;  4HP4 A;  1ODV A;  4UQI S;  2EWW A;  2V0U A;  2VX8 A;  5J4E A;  5HPF A;  1UWN X;  3T4O A;  3F1N A;  2V9A A;  4KQD A;  4Y5F A;  2G7U A;  4UEY A;  3VE4 A;  1YKD A;  4BBV A;  1DP6 A;  3CIT A;  4L0L A;  2J3W A;  4HIA A;  5DKL A;  5IS1 A;  1YAX A;  3KSF A;  4I3J A;  4GS9 B;  3E4O A;  4GJ4 A;  3P01 A;  1TF1 A;  4L9G A;  5MC7 A;  3LI8 A;  3F1O B;  2V1A A;  4YOF A;  4CLC E;  5F5Y A;  2VKS A;  4Q0I A;  2W27 A;  3T4Q A;  2CMN A;  2HJE A;  2V0W A;  1NRJ A;  3A0R A;  5DKK A;  4Z1W A;  3B33 A;  4WEK A;  3PHY A;  1D7E A;  1XJ2 A;  2JHE A;  1OPX A;  5HDC A;  4WLA A;  4IHQ A;  4DMZ A;  3BWL A;  1TS8 A;  3KSG A;  3IS2 B;  4NKP A;  2J3T D;  2MJ6 A;  4LRZ E;  4ZRR A;  1NLZ A;  3NOT C;  4MMN A;  3KO6 A;  3HCY A;  3R7W A;  2LB9 A;  2PHY A;  1OTE A;  3RFB A;  1T19 A;  2W0N A;  4PKY A;  1ZTU A;  1NWZ A;  3JVU A;  5I5L A;  3DBA A;  3OCL A;  2GNX A;  5AVF A;  2WKR A;  4IUH A;  1LL8 A;  3B47 A;  4KQO A;  3H9W A;  2P04 A;  3UME A;  3ZYT A;  3LFV A;  3VOL A;  3C38 A;  4GW9 A;  3UE3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...