1N9MA

Streptavidin mutant s27a with biotin at 1.6a resolution
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
121
structure length
121
Chain Sequence
b'EAGITGTWYNQLGATFIVTAGADGALTGTYESAVGNAESRYVLTGRYDSAPATDGSGTALGWTVAWKNNYRNAHSATTWSGQYVGGAEARINTQWLLTSGTTEANAWKSTLVGHDTFTKVK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Streptavidin
publication title Structural studies of hydrogen bonds in the high-affinity streptavidin-biotin complex: mutations of amino acids interacting with the ureido oxygen of biotin.
pubmed doi rcsb
source organism Streptomyces avidinii
molecule tags Biotin-binding protein
total genus 27
structure length 121
sequence length 121
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2002-11-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01382 Avidin Avidin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.128.30 Mainly Beta Beta Barrel Lipocalin Avidin-like 1n9mA00
1N9YA 1RAVA 1SRFA 1VWJB 4Z28A 1RXKA 1SREA 1N4JA 4JNJA 4U46A 3RE6A 1MM9A 4GGRA 3VGWA 1SRJA 2A5BA 2RTRB 1VWFB 1Y52X 1VWCB 4Y5DA 1NBXA 2MF6A 1VYOA 3VHHA 2OFBA 4Z2OA 2RTIB 2RTHB 1LCWA 2Y32A 3VHIA 1RXHA 2C4IA 5B5FA 2F01A 1SWKA 2IZBA 2RTNB 2CAMA 1AVDA 1VWNB 1MK5A 3RY2A 3T6LA 4GD9A 1VWBB 2FHNX 1VWDB 2ZSCA 1VWPB 4BBOA 4Z2VA 2IZIA 1SWBA 2IZGB 4BX6B 1SRGA 1NQNA 1NC9A 1SWLA 1VWRB 2BC3A 1SWRA 4CPIA 2G5LA 1SLEB 1SLFB 2RTGB 4CPHB 1SWDA 1SLDB 1HXZA 3MM0A 1N7YA 2WPUA 1LCZA 4JHQA 3RY1A 3X00A 3SZJA 2RTFB 4CPEA 1SWTA 2UZ2A 3RDMA 4GGTA 1Y53X 4BX5A 5F2BA 2RTKA 2AVIA 4BX7A 2IZJA 5IRUA 4GJSA 1IJ8A 1LUQA 1SWCA 1LELA 1SWGA 1NDJA 2RTOB 1VWKB 2A5CA 3SZIA 1LDOA 3WYPA 1SWEA 4CPFA 1DF8A 1SWUA 2IZFB 5JD2A 4JO6A 2IZKA 1LCVA 2RTEB 3MG5A 1WBIA 2UYWA 1HQQA 3WZNA 1VWIB 1MOYA 2Y3EA 4EKVA 1SRHA 1SWAA 2C1SA 2Y3FA 4IRWA 5K68A 3PK2A 1N9MA 5L3YA 1VWAB 2GH7A 3VHMA 1SLGB 3RDXA 4DNEA 1STRB 2RTAA 5IRAA 4CPHA 1VWMB 1SWPA 3WZOA 2RTPB 2RTCB 5CHKA 1I9HA 1MEPA 4OKAA 4GJVA 4YVBA 1LDQA 2RTDB 1VWGB 1KFFA 2OF8A 4GGZA 1VWQB 4I60A 1KL5A 3WZQA 2IZHB 1Y55X 1HY2A 3RDUA 1SRIA 4GDAA 1N43A 1SWOA 2A8GA 1PTSA 4Y59A 2RTMA 4BCSA 1VWOB 1HXLA 1RSUB 1SWFA 5K67A 1SWQA 3EW1A 4Z6JA 1VWHB 1SWSA 1KL3A 4BJ8A 4BX6A 2FHLA 1NQMA 1STPA 1SWHA 1SWNA 2RTBB 3EW2A 3WZPA 2OFAA 5IRWA 2IZDB 4BX5B 1STSB 4BX7B 2C1QA 2OF9A 4Z2PA 5CSEA 2QCBA 3SZHA 1RXJA 2IZAA 3T2WA 4Z27A 2IZCB 3WYQA 3RE5A 2RTLA 3RDOA 3RDQA 3T2XA 1RSTB 2IZLB 2RTQB 2RTJA 1SWJA 3RDSA 1AVEA 1KL4A 3FDCA 5B5GA 1VWEB 3T6FA 2JGSA 1VWLB 2IZEB
chains in the Genus database with same CATH superfamily
1N9YA 2HNXA 3WJBA 1GX9A 4Z28A 2ANSA 4ORXA 4EXZA 1TVQA 1GT1A 4NP1A 3P6DA 4ZFXA 1MM9A 4ZHGA 5F58A 3VGWA 1LIBA 1SXUA 3APXA 5H9AA 5CYBA 5EEDA 5EZ2A 1VWCB 3LV4A 4IMNA 4OS3A 5C0NA 4IB9A 1VYOA 1JYJA 2AT6X 2I5ZO 4Z2OA 1ZNEA 1GT4A 3TF6A 3WJDA 2JMBA 3EBWA 4N7CA 4CDEA 1BSYA 1KOIA 1LIDA 1T8VA 4IMOA 5LJDA 1ZNGA 2RTNB 4NNSA 1AVDA 1O1UA 1VWNB 2FT9A 1PBOA 3F6ZB 2ASNX 4TKHA 4GD9A 3SLJA 2CBSA 4CV7A 1MX8A 2IFBA 4GE1A 4O9SA 1UZ2X 1B0OA 2BLGA 2RCQA 2IZIA 3D9WA 3FR4A 4ODDA 3RZYA 1G7NA 4UU2A 4HPDA 4ZHHA 1SWRA 4CPIA 2G5LA 4AZNA 1JIWI 3KQ0A 2LB6A 3CQRA 4JHQA 1AQBA 1SXXA 3BRNA 4U9CA 4YCEA 3SZJA 5IXGA 2RTFB 1DZJA 4DQ4A 3PEDA 1SWTA 2VFBA 3NADA 5AJBA 2A2GA 1KT6A 2CZTA 5HBSA 5EPQA 1CJ5A 1QY2A 4XMFA 5F2BA 2RTKA 4ZH9A 1IFCA 4ORUA 4ORRA 5IO5A 1A2DA 1LUQA 3VG2A 1SWGA 1XKIA 3QKGA 1IKEA 1VWKB 2EU7X 4HPAA 4QGWA 1SWEA 3WYPA 3ZQ3A 3TGCA 1GGLA 2X32A 2X8SA 1SY1A 2R56A 1X71A 4JO6A 1DZKA 2IZKA 2RTEB 3KVNA 3MG5A 4BGFA 2WEXA 2UYWA 1NP4A 3FR2A 1U18A 3PQSA 4AZPA 4JGLA 3BLGA 1OBUA 1E02A 1SWAA 3TZSA 2WR6A 4GZVA 5D47A 5K68A 2AH7X 3ZW0A 3HWGA 2ZAGA 3WJFA 3HWEA 2VDFA 1Y9TA 3ZUOA 3C78X 1SY3A 3NR3A 4I95A 1BWYA 1HBPA 1VWMB 1SWPA 3NQ3A 3ELXA 4YFPA 1EIOA 2RTCB 1FENA 2R74A 4QYNA 4OEMA 4U8UO 1I9HA 4KC8A 5HTEA 3BS2A 4ON1A 2DJFA 1H91A 4GKCA 1D2UA 2RTDB 5AQ6A 5BYPA 3C77X 2OF8A 3JSQA 2QO6A 4I60A 2JU3A 3UEXA 1FJ1E 3L4RA 3P6CA 4O4OA 1B8EA 1N43A 3H3IA 2RD7C 1E06A 3E3CA 2A8GA 2X46A 3N91A 4QGXA 4Y59A 3S60A 5D45A 1UYOX 4FBRA 3GAQA 1SWFA 4INNA 4MVEA 3APWA 3D97A 2K23A 2AT0X 1HMRA 3DSZA 1QY1A 2DJGA 2AKQA 2L5PA 3WVMA 1KL3A 4BJ8A 3JS1A 1E5PA 4IAWA 4OMXA 1NQMA 2NNEA 3AEHA 4YH0A 4IAXA 3SAOA 3FA7A 2HZQA 1ZNDA 3B2HA 1K3BA 3P24A 3WZPA 1STSB 2OF9A 4D6AA 3BU1A 2Q39A 1GM6A 4CK4A 4COTA 1ERXA 2KT4B 3WJGA 5L8IA 1IFBA 1SY2A 2FS6A 5D4AA 1JBHA 4ML7B 3O2YA 5L8OA 3T6FA 1ZRYA 2LKKA 1LPJA 5FENA 2IZEB 2P8GA 2RTPB 2W2BA 4GU8A 2W2AA 4YGHA 2HMBA 4HPCA 3ZW1A 1SRFA 2QO4A 2RCTA 1BJ7A 1K24A 4NLIA 2O62A 4ALOA 4YDBA 1N4JA 4JNJA 4LZVA 3WJCA 4FGIB 4GGRA 4GETA 2GC9A 1KZXA 3KFIA 2G7BA 4Y5DA 1NBXA 1AELA 3HTYA 1X8NA 2OFBA 4ZR2A 1EPAA 4IB7A 3FA8A 5IO6A 1Y9LA 2BHVA 3HWDA 3IA8A 1FELA 4QZTA 1B4MA 3NPOA 1LF7A 2K62A 2CAMA 1HMSA 2CM4A 2OFMX 3U03A 5LJHA 4FBOA 3WOVA 5LJCA 1QY0A 1JMXA 2RN4A 2ZSCA 1VWPB 3CKFA 4GRJA 3WJEA 2MO5A 1XCAA 1SXWA 2IZGB 1S2PA 3FEKA 3VG3A 5D8JA 1NQNA 4I9SA 5KIDA 1BRPA 1YWAA 1A57A 2RTGB 2X55A 4CPHB 1SWDA 1EXSA 2Z4HA 3MM0A 4ZHDA 2WPUA 1LCZA 1LICA 4PJ2A 2PY1A 4U8UN 1PMPA 1TW4A 3PECA 2L9CA 3OE3A 2FR2A 4CPEA 2X4MA 3KFFA 2OVDA 3RDMA 4GGTA 1GT3A 4OELA 1KXOA 1OBQA 1S7DA 1ICNA 2AVIA 4BX7A 1S44A 2QM9A 3S26A 3FMZA 1VPRA 2QMIA 1LELA 1I06A 1NDJA 2GTLM 2A5CA 2POAA 1LDOA 2AF5A 2LBVA 2JN3A 4CPFA 1G5WA 4YKOA 4XMDA 1SWUA 1YP6A 2IZFB 3CR6A 5HA0A 4CDDA 2AT8X 3VPJE 1EIIA 1P6PA 1VWIB 2FR3A 2VFCA 3WZNA 5LJBA 4IBAA 4N7DA 5FFHA 2OL7A 1RLBE 2Y3FA 5LJKA 1OBPA 2MHDA 4B55A 1DZMA 1I04A 2YMSA 3AUMO 1QWDA 5IO7A 2GTFX 3U0DA 1OPBA 1VWAB 1HMTA 4QAEA 3VHMA 3HOEA 3KFGA 4OS8A 2L68A 3RDXA 4DNEA 2RTAA 5IRAA 2A0AA 2OVAA 1KQXA 3UEUA 4WHIA 4OKAA 1MEPA 3ZW2A 1LIFA 3B2LA 1OPAA 1VWGB 3PDFA 3UAQA 3BU9A 1KFFA 4O49A 1KZWA 1VWQB 2JU7A 1DFVA 1KL5A 3LTWA 1MX7A 1W5RA 5DG4A 3RDUA 3SLTA 5H8TA 3MBTA 2R73A 4GDAA 2ACOA 2FKGA 1SWOA 4QGVA 3CBCA 1PTSA 2WEWA 3CQNA 1RSUB 1YIVA 4YGZA 1CRBA 1SWQA 2OFRX 3EW1A 4ALBA 4Z6JA 5BVSA 4A1YA 1D3SA 1GKAA 1VYGA 2KTDA 2FRSA 1ZNHA 3STKA 3B2IA 4XMGA 4BX6A 5L8NA 3FIQA 3O22A 3P6EA 1AVGI 5HCEC 1STPA 1YUPA 4KC7A 2CZUA 2OFAA 4Y0RA 1E2TA 2DM5A 4BOEA 3FIDA 3SZHA 3WBGA 1EQDA 2IZAA 1X89A 2IZCB 4Z27A 4KH8A 1DZPA 2WUTA 1CBIA 2RTLA 5EEEA 3EBKA 3RDQA 3RDOA 3P6GA 3WYQA 3FR5A 5KICA 4FQBB 1B56A 3CWKA 3TGBA 4QYPA 3FDCA 1YWBA 3VU1A 3ZUIA 1KT7A 1W4TA 2JGSA 4KIIA 4YBUA 5AJCA 3O19A 4NV7A 5HCDC 1HBQA 2AT5X 2HYSA 2I5VO 3P6HA 4TJZA 1VWJB 3ZW0B 2A13A 1ZNLA 1RXKA 1SREA 2CM9A 4MVIA 4U46A 1QG5A 1O8VA 1U17A 5EDCA 3B2KA 4QRLA 3VE1A 1FDQA 2A5BA 2RTRB 3FLLA 1IIUA 1BRQA 1VWFB 1QQSA 4Y0SA 2XSTA 1ALBA 2RQ0A 2RTIB 3HK1A 3UEWA 4BQUA 2RTHB 2Y32A 3VHIA 1MDCA 1RXHA 3EMMA 4MISA 4LZUA 5B5FA 2BT9A 2F01A 1SWKA 3S5XA 4WFUA 1W6FA 3VE2A 3MVFA 1SMPI 1KT4A 3TGAA 2GTLO 5B3MO 5BVTA 3RY2A 3Q6LA 5AEOA 4CDCA 5HAEA 4MEEA 4BBOA 1CBRA 3C76X 1N0SA 3FELA 3KZAA 1E00A 1SRGA 2X45A 3RWXA 1NC9A 1VWRB 3D4RA 4I3BA 3T1DA 2BC3A 2HLVA 3QQ2A 4YGGA 2Q2MA 1SLDB 1HXZA 1EI5A 3OD9A 1N7YA 3NQ9A 2RA6A 2YG2A 4HWMA 4C5PA 1MVGA 4XMCA 2CBRA 4YMYA 4NYRA 1UREA 4ZGFA 5HCCC 1OEKA 3D95A 4O4UA 3LHNA 2JW1A 2QOMA 4BX5A 5B29A 2AMMX 4ZJ0A 2Q9SA 5DPQA 4OS0A 2ZAIA 4I9RA 2WWPA 1DF8A 3HPEA 3KFHA 3PH5A 3RBYA 3STMX 3ZW1B 1LCVA 3PQUA 4KT5A 4QNIA 4Y0PA 1WBIA 2W2FA 2OZQA 4GUZA 3ZZVA 1BBPA 3STNA 1QFVA 1MOYA 4CSBA 4I6SA 4ZH6A 2C1SA 3EYCA 4WBKA 3I17A 4TKJA 2OY1O 3PK2A 4IB8A 1GX3A 2BS6A 3I0AA 2QOSC 4EDEA 3ELZA 3OBLA 4MIRA 2NP1A 4YDAA 3APUA 2E4JA 1STRB 4CPHA 1OSPO 3FA9A 5CHKA 4GDZA 4I3DA 1KT5A 3UEVA 4AZMA 3FYFA 1KGLA 1CBQA 3PP6A 5HZ9A 4LKTA 1JZUA 3FENA 5FAZA 4I3CA 4WFVA 3NBXX 3NQKA 3VG4A 1PM1X 1JMZA 5F6ZA 1BEBA 4ZGUA 3BY0A 2WQ9A 2IZHB 2N93A 4KCAA 4PSQA 1SRIA 5EDBA 4ZCBA 3F8AA 2RTMA 1I05A 3NX1A 5F6BA 5HZQA 1HXLA 4O4XA 4QZUA 5K06A 5JR8A 4EQAC 5K67A 4YFQA 1GX8A 1TOUA 2BS5A 2ALLX 2X8FA 4GH7A 5HA1A 1KT3A 4TKBA 4ZHFA 4HPBA 1G74A 1JYDA 2KW1A 4MVLA 3RKGA 5HZ5A 2A2UA 4U3QA 3GE2A 4TQ2A 3Q34A 4M6SA 5LKEA 2Q4NA 4D6BA 2IZDB 3AKNA 4AW8A 4BX7B 1Y0GA 3AKMA 2C1QA 4K19A 5B10O 5CSEA 1JV4A 3FW4A 3VG5A 4Z2PA 3T2WA 5B27A 3HOLA 5B11O 3RE5A 1X8QA 3T2XA 1RSTB 2IZLB 2RTJA 1ZNKA 2GTLN 2WQAE 2X56A 3APVA 1IW2A 3RDSA 1AVEA 4IABA 1X8PA 2JU8A 4LQZA 3WXQA 1U0XA 4O3WA 5F1EA 5B5GA 1VWEB 4EEJA 1X8UA 1EW3A 1VWLB 4M7MA 1JJJA 1RAVA 1I78A 2AL0X 1O1VA 1YP7A 4Y0QA 2Z4IA 1HN2A 3RE6A 1Z24A 1MUPA 1SY0A 1NGLA 4GNWA 3P6FA 1SRJA 1BSQA 1OEJA 1QABE 4AZOA 1Y52X 3U9PC 2MF6A 2FTBA 2FLJA 3VHHA 4RUNA 2OY8A 4A1HA 4IB6A 2G78A 1LCWA 1CBSA 1RBPA 2BSZA 4O3XB 3VG7A 5CE4A 1A18A 5FQ7E 5HTDA 2C4IA 4XMEA 2LA7A 2X8TA 2AT3X 3DTQA 3FEPA 3RSWA 3V8UA 1T0VA 2IZBA 4ORSA 5D48A 3ZI8A 1R0UA 1ICMA 2QO5A 1QFTA 3NX2A 2OY7A 2OVEA 1MK5A 3T6LA 4GNYA 1VWBB 2FHNX 1EPBA 2FS7A 4TLJA 1VWDB 1YWCA 1AB0A 1GKAB 4OMWA 1NP1A 5F7GA 4EFGA 4Z2VA 4LKPA 1DV9A 1SWBA 1L6MA 4BX6B 1T68X 1YWDA 1EALA 3BSZE 1SWLA 1FE3A 2G79A 3CMPA 2JOZA 2FGSA 3FA6A 2PI3O 1SLEB 1SLFB 5B2AO 3NP1A 5HZ6A 4L3RA 3CBSA 1PEEA 3X00A 3RY1A 3ZWEA 2OL8O 2MWHA 1KQWA 5LJEA 3SOTA 1UYNX 5HWZA 2GJ5A 4R0BA 4MVKA 2UZ2A 4A8ZA 2KTSA 4DQ3A 1Y53X 2LFOA 3BX7A 4HFOA 3B2JA 2IZJA 1JQPA 5IRUA 4GJSA 1IJ8A 1LIEA 1SWCA 1TXLA 2RTOB 4O4SA 5LKFA 3SZIA 4QQ1A 1LNMA 1I4UA 2L67A 4ID2A 3BX8A 4ORYA 1GXAA 5JD2A 3F9DA 2NNDA 5H9KA 2HKDA 1HQQA 2Y3EA 1X8OA 4EKVA 1SRHA 5HZ8A 4AYHA 3P02A 4IRWA 5H9NA 4AZQA 2MM3A 2KD2A 1N9MA 5L3YA 3IFBA 1JJXA 2GH7A 1SLGB 3FW5A 4RUUA 3JQOA 2F09A 3G7XA 2A3FX 5FQ6E 3WZOA 4DCBA 2F73A 4ARHA 1FEMA 1BLRA 2HZRA 2NNQA 1WUBA 2G8CO 1ADLA 3EC5A 4GJVA 3PPTA 5H9LA 5BVQA 4YVBA 1LDQA 3EM0A 1PBYA 1VYFA 4YCHA 3K3LA 2M4LA 1DF3A 2OYBO 1JJUA 4GGZA 1BM5A 3WZQA 4ORWA 2FWVA 1Y55X 1HY2A 1G85A 1LKEA 1BSOA 4NW4A 4UU3A 4AZRA 4YFRA 5KHPA 4CDFA 3OJYC 4NV8A 4BCSA 1VWOB 4ES7A 2LBAA 3BDRA 2OL6O 3HWFA 1VWHB 3VG6A 2MJIA 4ZHCA 1SWSA 1ML7A 1TOWA 4A60A 4TNNA 2Q2PA 3MX7A 1SXYA 2FHLA 1GT5A 1SWHA 1SWNA 2OVSA 1HQPA 2RTBB 3EW2A 2FKJA 4NNTA 4XMHA 4BX5B 5IRWA 4FBVA 3D96A 4U8UM 1ERBA 2XKLA 5LJGA 2QCBA 1RXJA 4O3YA 1LFOA 3S5VA 2ACPX 1ACDA 1SA8A 4YKMA 2WSJA 3CKGA 1A3YA 1DC9A 4YBPA 2RTQB 1IKJA 4GK9A 4L1NA 1SWJA 1FTPA 4NYQA 4BVMA 2X34A 1EUOA 1KL4A 5FQ8E 4NLJA 2OY5O 3PH6A 4O3ZA 3SLOA 1OEEA
chains in the Genus database with same CATH topology
1N9YA 1RAVA 1SRFA 1VWJB 4Z28A 1RXKA 1SREA 1N4JA 4JNJA 4U46A 3RE6A 1MM9A 4GGRA 3VGWA 1SRJA 2A5BA 2RTRB 1VWFB 1Y52X 1VWCB 4Y5DA 1NBXA 2MF6A 1VYOA 3VHHA 2OFBA 4Z2OA 2RTIB 2RTHB 1LCWA 2Y32A 3VHIA 1RXHA 2C4IA 5B5FA 2F01A 1SWKA 2IZBA 2RTNB 2CAMA 1AVDA 1VWNB 1MK5A 3RY2A 3T6LA 4GD9A 1VWBB 2FHNX 1VWDB 2ZSCA 1VWPB 4BBOA 4Z2VA 2IZIA 1SWBA 2IZGB 4BX6B 1SRGA 1NQNA 1NC9A 1SWLA 1VWRB 2BC3A 1SWRA 4CPIA 2G5LA 1SLEB 1SLFB 2RTGB 4CPHB 1SWDA 1SLDB 1HXZA 3MM0A 1N7YA 2WPUA 1LCZA 4JHQA 3RY1A 3X00A 3SZJA 2RTFB 4CPEA 1SWTA 2UZ2A 3RDMA 4GGTA 1Y53X 4BX5A 5F2BA 2RTKA 2AVIA 4BX7A 2IZJA 5IRUA 4GJSA 1IJ8A 1LUQA 1SWCA 1LELA 1SWGA 1NDJA 2RTOB 1VWKB 2A5CA 3SZIA 1LDOA 3WYPA 1SWEA 4CPFA 1DF8A 1SWUA 2IZFB 5JD2A 4JO6A 2IZKA 1LCVA 2RTEB 3MG5A 1WBIA 2UYWA 1HQQA 3WZNA 1VWIB 1MOYA 2Y3EA 4EKVA 1SRHA 1SWAA 2C1SA 2Y3FA 4IRWA 5K68A 3PK2A 1N9MA 5L3YA 1VWAB 2GH7A 3VHMA 1SLGB 3RDXA 4DNEA 1STRB 2RTAA 5IRAA 4CPHA 1VWMB 1SWPA 3WZOA 2RTPB 2RTCB 5CHKA 1I9HA 1MEPA 4OKAA 4GJVA 4YVBA 1LDQA 2RTDB 1VWGB 1KFFA 2OF8A 4GGZA 1VWQB 4I60A 1KL5A 3WZQA 2IZHB 1Y55X 1HY2A 3RDUA 1SRIA 4GDAA 1N43A 1SWOA 2A8GA 1PTSA 4Y59A 2RTMA 4BCSA 1VWOB 1HXLA 1RSUB 1SWFA 5K67A 1SWQA 3EW1A 4Z6JA 1VWHB 1SWSA 1KL3A 4BJ8A 4BX6A 2FHLA 1NQMA 1STPA 1SWHA 1SWNA 2RTBB 3EW2A 3WZPA 2OFAA 5IRWA 2IZDB 4BX5B 1STSB 4BX7B 2C1QA 2OF9A 4Z2PA 5CSEA 2QCBA 3SZHA 1RXJA 2IZAA 3T2WA 4Z27A 2IZCB 3WYQA 3RE5A 2RTLA 3RDOA 3RDQA 3T2XA 1RSTB 2IZLB 2RTQB 2RTJA 1SWJA 3RDSA 1AVEA 1KL4A 3FDCA 5B5GA 1VWEB 3T6FA 2JGSA 1VWLB 2IZEB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1N9Y A;  1RAV A;  1SRF A;  1VWJ B;  4Z28 A;  1RXK A;  1SRE A;  1N4J A;  4JNJ A;  4U46 A;  3RE6 A;  1MM9 A;  4GGR A;  3VGW A;  1SRJ A;  2A5B A;  2RTR B;  1VWF B;  1Y52 X;  1VWC B;  4Y5D A;  1NBX A;  2MF6 A;  1VYO A;  3VHH A;  2OFB A;  4Z2O A;  2RTI B;  2RTH B;  1LCW A;  2Y32 A;  3VHI A;  1RXH A;  2C4I A;  5B5F A;  2F01 A;  1SWK A;  2IZB A;  2RTN B;  2CAM A;  1AVD A;  1VWN B;  1MK5 A;  3RY2 A;  3T6L A;  4GD9 A;  1VWB B;  2FHN X;  1VWD B;  2ZSC A;  1VWP B;  4BBO A;  4Z2V A;  2IZI A;  1SWB A;  2IZG B;  4BX6 B;  1SRG A;  1NQN A;  1NC9 A;  1SWL A;  1VWR B;  2BC3 A;  1SWR A;  4CPI A;  2G5L A;  1SLE B;  1SLF B;  2RTG B;  4CPH B;  1SWD A;  1SLD B;  1HXZ A;  3MM0 A;  1N7Y A;  2WPU A;  1LCZ A;  4JHQ A;  3RY1 A;  3X00 A;  3SZJ A;  2RTF B;  4CPE A;  1SWT A;  2UZ2 A;  3RDM A;  4GGT A;  1Y53 X;  4BX5 A;  5F2B A;  2RTK A;  2AVI A;  4BX7 A;  2IZJ A;  5IRU A;  4GJS A;  1IJ8 A;  1LUQ A;  1SWC A;  1LEL A;  1SWG A;  1NDJ A;  2RTO B;  1VWK B;  2A5C A;  3SZI A;  1LDO A;  3WYP A;  1SWE A;  4CPF A;  1DF8 A;  1SWU A;  2IZF B;  5JD2 A;  4JO6 A;  2IZK A;  1LCV A;  2RTE B;  3MG5 A;  1WBI A;  2UYW A;  1HQQ A;  3WZN A;  1VWI B;  1MOY A;  2Y3E A;  4EKV A;  1SRH A;  1SWA A;  2C1S A;  2Y3F A;  4IRW A;  5K68 A;  3PK2 A;  1N9M A;  5L3Y A;  1VWA B;  2GH7 A;  3VHM A;  1SLG B;  3RDX A;  4DNE A;  1STR B;  2RTA A;  5IRA A;  4CPH A;  1VWM B;  1SWP A;  3WZO A;  2RTP B;  2RTC B;  5CHK A;  1I9H A;  1MEP A;  4OKA A;  4GJV A;  4YVB A;  1LDQ A;  2RTD B;  1VWG B;  1KFF A;  2OF8 A;  4GGZ A;  1VWQ B;  4I60 A;  1KL5 A;  3WZQ A;  2IZH B;  1Y55 X;  1HY2 A;  3RDU A;  1SRI A;  4GDA A;  1N43 A;  1SWO A;  2A8G A;  1PTS A;  4Y59 A;  2RTM A;  4BCS A;  1VWO B;  1HXL A;  1RSU B;  1SWF A;  5K67 A;  1SWQ A;  3EW1 A;  4Z6J A;  1VWH B;  1SWS A;  1KL3 A;  4BJ8 A;  4BX6 A;  2FHL A;  1NQM A;  1STP A;  1SWH A;  1SWN A;  2RTB B;  3EW2 A;  3WZP A;  2OFA A;  5IRW A;  2IZD B;  4BX5 B;  1STS B;  4BX7 B;  2C1Q A;  2OF9 A;  4Z2P A;  5CSE A;  2QCB A;  3SZH A;  1RXJ A;  2IZA A;  3T2W A;  4Z27 A;  2IZC B;  3WYQ A;  3RE5 A;  2RTL A;  3RDO A;  3RDQ A;  3T2X A;  1RST B;  2IZL B;  2RTQ B;  2RTJ A;  1SWJ A;  3RDS A;  1AVE A;  1KL4 A;  3FDC A;  5B5G A;  1VWE B;  3T6F A;  2JGS A;  1VWL B;  2IZE B; 
#chains in the Genus database with same CATH topology
 1N9Y A;  2HNX A;  3WJB A;  1GX9 A;  4Z28 A;  2ANS A;  4ORX A;  4EXZ A;  1TVQ A;  1GT1 A;  4NP1 A;  3P6D A;  4ZFX A;  1MM9 A;  4ZHG A;  5F58 A;  3VGW A;  1LIB A;  1SXU A;  3APX A;  5H9A A;  5CYB A;  5EED A;  5EZ2 A;  1VWC B;  3LV4 A;  4IMN A;  4OS3 A;  5C0N A;  4IB9 A;  1VYO A;  1JYJ A;  2AT6 X;  2I5Z O;  4Z2O A;  1ZNE A;  1GT4 A;  3TF6 A;  3WJD A;  2JMB A;  3EBW A;  4N7C A;  4CDE A;  1BSY A;  1KOI A;  1LID A;  1T8V A;  4IMO A;  5LJD A;  1ZNG A;  2RTN B;  4NNS A;  1AVD A;  1O1U A;  1VWN B;  2FT9 A;  1PBO A;  3F6Z B;  2ASN X;  4TKH A;  4GD9 A;  3SLJ A;  2CBS A;  4CV7 A;  1MX8 A;  2IFB A;  4GE1 A;  4O9S A;  1UZ2 X;  1B0O A;  2BLG A;  2RCQ A;  2IZI A;  3D9W A;  3FR4 A;  4ODD A;  3RZY A;  1G7N A;  4UU2 A;  4HPD A;  4ZHH A;  1SWR A;  4CPI A;  2G5L A;  4AZN A;  1JIW I;  3KQ0 A;  2LB6 A;  3CQR A;  4JHQ A;  1AQB A;  1SXX A;  3BRN A;  4U9C A;  4YCE A;  3SZJ A;  5IXG A;  2RTF B;  1DZJ A;  4DQ4 A;  3PED A;  1SWT A;  2VFB A;  3NAD A;  5AJB A;  2A2G A;  1KT6 A;  2CZT A;  5HBS A;  5EPQ A;  1CJ5 A;  1QY2 A;  4XMF A;  5F2B A;  2RTK A;  4ZH9 A;  1IFC A;  4ORU A;  4ORR A;  5IO5 A;  1A2D A;  1LUQ A;  3VG2 A;  1SWG A;  1XKI A;  3QKG A;  1IKE A;  1VWK B;  2EU7 X;  4HPA A;  4QGW A;  1SWE A;  3WYP A;  3ZQ3 A;  3TGC A;  1GGL A;  2X32 A;  2X8S A;  1SY1 A;  2R56 A;  1X71 A;  4JO6 A;  1DZK A;  2IZK A;  2RTE B;  3KVN A;  3MG5 A;  4BGF A;  2WEX A;  2UYW A;  1NP4 A;  3FR2 A;  1U18 A;  3PQS A;  4AZP A;  4JGL A;  3BLG A;  1OBU A;  1E02 A;  1SWA A;  3TZS A;  2WR6 A;  4GZV A;  5D47 A;  5K68 A;  2AH7 X;  3ZW0 A;  3HWG A;  2ZAG A;  3WJF A;  3HWE A;  2VDF A;  1Y9T A;  3ZUO A;  3C78 X;  1SY3 A;  3NR3 A;  4I95 A;  1BWY A;  1HBP A;  1VWM B;  1SWP A;  3NQ3 A;  3ELX A;  4YFP A;  1EIO A;  2RTC B;  1FEN A;  2R74 A;  4QYN A;  4OEM A;  4U8U O;  1I9H A;  4KC8 A;  5HTE A;  3BS2 A;  4ON1 A;  2DJF A;  1H91 A;  4GKC A;  1D2U A;  2RTD B;  5AQ6 A;  5BYP A;  3C77 X;  2OF8 A;  3JSQ A;  2QO6 A;  4I60 A;  2JU3 A;  3UEX A;  1FJ1 E;  3L4R A;  3P6C A;  4O4O A;  1B8E A;  1N43 A;  3H3I A;  2RD7 C;  1E06 A;  3E3C A;  2A8G A;  2X46 A;  3N91 A;  4QGX A;  4Y59 A;  3S60 A;  5D45 A;  1UYO X;  4FBR A;  3GAQ A;  1SWF A;  4INN A;  4MVE A;  3APW A;  3D97 A;  2K23 A;  2AT0 X;  1HMR A;  3DSZ A;  1QY1 A;  2DJG A;  2AKQ A;  2L5P A;  3WVM A;  1KL3 A;  4BJ8 A;  3JS1 A;  1E5P A;  4IAW A;  4OMX A;  1NQM A;  2NNE A;  3AEH A;  4YH0 A;  4IAX A;  3SAO A;  3FA7 A;  2HZQ A;  1ZND A;  3B2H A;  1K3B A;  3P24 A;  3WZP A;  1STS B;  2OF9 A;  4D6A A;  3BU1 A;  2Q39 A;  1GM6 A;  4CK4 A;  4COT A;  1ERX A;  2KT4 B;  3WJG A;  5L8I A;  1IFB A;  1SY2 A;  2FS6 A;  5D4A A;  1JBH A;  4ML7 B;  3O2Y A;  5L8O A;  3T6F A;  1ZRY A;  2LKK A;  1LPJ A;  5FEN A;  2IZE B;  2P8G A;  2RTP B;  2W2B A;  4GU8 A;  2W2A A;  4YGH A;  2HMB A;  4HPC A;  3ZW1 A;  1SRF A;  2QO4 A;  2RCT A;  1BJ7 A;  1K24 A;  4NLI A;  2O62 A;  4ALO A;  4YDB A;  1N4J A;  4JNJ A;  4LZV A;  3WJC A;  4FGI B;  4GGR A;  4GET A;  2GC9 A;  1KZX A;  3KFI A;  2G7B A;  4Y5D A;  1NBX A;  1AEL A;  3HTY A;  1X8N A;  2OFB A;  4ZR2 A;  1EPA A;  4IB7 A;  3FA8 A;  5IO6 A;  1Y9L A;  2BHV A;  3HWD A;  3IA8 A;  1FEL A;  4QZT A;  1B4M A;  3NPO A;  1LF7 A;  2K62 A;  2CAM A;  1HMS A;  2CM4 A;  2OFM X;  3U03 A;  5LJH A;  4FBO A;  3WOV A;  5LJC A;  1QY0 A;  1JMX A;  2RN4 A;  2ZSC A;  1VWP B;  3CKF A;  4GRJ A;  3WJE A;  2MO5 A;  1XCA A;  1SXW A;  2IZG B;  1S2P A;  3FEK A;  3VG3 A;  5D8J A;  1NQN A;  4I9S A;  5KID A;  1BRP A;  1YWA A;  1A57 A;  2RTG B;  2X55 A;  4CPH B;  1SWD A;  1EXS A;  2Z4H A;  3MM0 A;  4ZHD A;  2WPU A;  1LCZ A;  1LIC A;  4PJ2 A;  2PY1 A;  4U8U N;  1PMP A;  1TW4 A;  3PEC A;  2L9C A;  3OE3 A;  2FR2 A;  4CPE A;  2X4M A;  3KFF A;  2OVD A;  3RDM A;  4GGT A;  1GT3 A;  4OEL A;  1KXO A;  1OBQ A;  1S7D A;  1ICN A;  2AVI A;  4BX7 A;  1S44 A;  2QM9 A;  3S26 A;  3FMZ A;  1VPR A;  2QMI A;  1LEL A;  1I06 A;  1NDJ A;  2GTL M;  2A5C A;  2POA A;  1LDO A;  2AF5 A;  2LBV A;  2JN3 A;  4CPF A;  1G5W A;  4YKO A;  4XMD A;  1SWU A;  1YP6 A;  2IZF B;  3CR6 A;  5HA0 A;  4CDD A;  2AT8 X;  3VPJ E;  1EII A;  1P6P A;  1VWI B;  2FR3 A;  2VFC A;  3WZN A;  5LJB A;  4IBA A;  4N7D A;  5FFH A;  2OL7 A;  1RLB E;  2Y3F A;  5LJK A;  1OBP A;  2MHD A;  4B55 A;  1DZM A;  1I04 A;  2YMS A;  3AUM O;  1QWD A;  5IO7 A;  2GTF X;  3U0D A;  1OPB A;  1VWA B;  1HMT A;  4QAE A;  3VHM A;  3HOE A;  3KFG A;  4OS8 A;  2L68 A;  3RDX A;  4DNE A;  2RTA A;  5IRA A;  2A0A A;  2OVA A;  1KQX A;  3UEU A;  4WHI A;  4OKA A;  1MEP A;  3ZW2 A;  1LIF A;  3B2L A;  1OPA A;  1VWG B;  3PDF A;  3UAQ A;  3BU9 A;  1KFF A;  4O49 A;  1KZW A;  1VWQ B;  2JU7 A;  1DFV A;  1KL5 A;  3LTW A;  1MX7 A;  1W5R A;  5DG4 A;  3RDU A;  3SLT A;  5H8T A;  3MBT A;  2R73 A;  4GDA A;  2ACO A;  2FKG A;  1SWO A;  4QGV A;  3CBC A;  1PTS A;  2WEW A;  3CQN A;  1RSU B;  1YIV A;  4YGZ A;  1CRB A;  1SWQ A;  2OFR X;  3EW1 A;  4ALB A;  4Z6J A;  5BVS A;  4A1Y A;  1D3S A;  1GKA A;  1VYG A;  2KTD A;  2FRS A;  1ZNH A;  3STK A;  3B2I A;  4XMG A;  4BX6 A;  5L8N A;  3FIQ A;  3O22 A;  3P6E A;  1AVG I;  5HCE C;  1STP A;  1YUP A;  4KC7 A;  2CZU A;  2OFA A;  4Y0R A;  1E2T A;  2DM5 A;  4BOE A;  3FID A;  3SZH A;  3WBG A;  1EQD A;  2IZA A;  1X89 A;  2IZC B;  4Z27 A;  4KH8 A;  1DZP A;  2WUT A;  1CBI A;  2RTL A;  5EEE A;  3EBK A;  3RDQ A;  3RDO A;  3P6G A;  3WYQ A;  3FR5 A;  5KIC A;  4FQB B;  1B56 A;  3CWK A;  3TGB A;  4QYP A;  3FDC A;  1YWB A;  3VU1 A;  3ZUI A;  1KT7 A;  1W4T A;  2JGS A;  4KII A;  4YBU A;  5AJC A;  3O19 A;  4NV7 A;  5HCD C;  1HBQ A;  2AT5 X;  2HYS A;  2I5V O;  3P6H A;  4TJZ A;  1VWJ B;  3ZW0 B;  2A13 A;  1ZNL A;  1RXK A;  1SRE A;  2CM9 A;  4MVI A;  4U46 A;  1QG5 A;  1O8V A;  1U17 A;  5EDC A;  3B2K A;  4QRL A;  3VE1 A;  1FDQ A;  2A5B A;  2RTR B;  3FLL A;  1IIU A;  1BRQ A;  1VWF B;  1QQS A;  4Y0S A;  2XST A;  1ALB A;  2RQ0 A;  2RTI B;  3HK1 A;  3UEW A;  4BQU A;  2RTH B;  2Y32 A;  3VHI A;  1MDC A;  1RXH A;  3EMM A;  4MIS A;  4LZU A;  5B5F A;  2BT9 A;  2F01 A;  1SWK A;  3S5X A;  4WFU A;  1W6F A;  3VE2 A;  3MVF A;  1SMP I;  1KT4 A;  3TGA A;  2GTL O;  5B3M O;  5BVT A;  3RY2 A;  3Q6L A;  5AEO A;  4CDC A;  5HAE A;  4MEE A;  4BBO A;  1CBR A;  3C76 X;  1N0S A;  3FEL A;  3KZA A;  1E00 A;  1SRG A;  2X45 A;  3RWX A;  1NC9 A;  1VWR B;  3D4R A;  4I3B A;  3T1D A;  2BC3 A;  2HLV A;  3QQ2 A;  4YGG A;  2Q2M A;  1SLD B;  1HXZ A;  1EI5 A;  3OD9 A;  1N7Y A;  3NQ9 A;  2RA6 A;  2YG2 A;  4HWM A;  4C5P A;  1MVG A;  4XMC A;  2CBR A;  4YMY A;  4NYR A;  1URE A;  4ZGF A;  5HCC C;  1OEK A;  3D95 A;  4O4U A;  3LHN A;  2JW1 A;  2QOM A;  4BX5 A;  5B29 A;  2AMM X;  4ZJ0 A;  2Q9S A;  5DPQ A;  4OS0 A;  2ZAI A;  4I9R A;  2WWP A;  1DF8 A;  3HPE A;  3KFH A;  3PH5 A;  3RBY A;  3STM X;  3ZW1 B;  1LCV A;  3PQU A;  4KT5 A;  4QNI A;  4Y0P A;  1WBI A;  2W2F A;  2OZQ A;  4GUZ A;  3ZZV A;  1BBP A;  3STN A;  1QFV A;  1MOY A;  4CSB A;  4I6S A;  4ZH6 A;  2C1S A;  3EYC A;  4WBK A;  3I17 A;  4TKJ A;  2OY1 O;  3PK2 A;  4IB8 A;  1GX3 A;  2BS6 A;  3I0A A;  2QOS C;  4EDE A;  3ELZ A;  3OBL A;  4MIR A;  2NP1 A;  4YDA A;  3APU A;  2E4J A;  1STR B;  4CPH A;  1OSP O;  3FA9 A;  5CHK A;  4GDZ A;  4I3D A;  1KT5 A;  3UEV A;  4AZM A;  3FYF A;  1KGL A;  1CBQ A;  3PP6 A;  5HZ9 A;  4LKT A;  1JZU A;  3FEN A;  5FAZ A;  4I3C A;  4WFV A;  3NBX X;  3NQK A;  3VG4 A;  1PM1 X;  1JMZ A;  5F6Z A;  1BEB A;  4ZGU A;  3BY0 A;  2WQ9 A;  2IZH B;  2N93 A;  4KCA A;  4PSQ A;  1SRI A;  5EDB A;  4ZCB A;  3F8A A;  2RTM A;  1I05 A;  3NX1 A;  5F6B A;  5HZQ A;  1HXL A;  4O4X A;  4QZU A;  5K06 A;  5JR8 A;  4EQA C;  5K67 A;  4YFQ A;  1GX8 A;  1TOU A;  2BS5 A;  2ALL X;  2X8F A;  4GH7 A;  5HA1 A;  1KT3 A;  4TKB A;  4ZHF A;  4HPB A;  1G74 A;  1JYD A;  2KW1 A;  4MVL A;  3RKG A;  5HZ5 A;  2A2U A;  4U3Q A;  3GE2 A;  4TQ2 A;  3Q34 A;  4M6S A;  5LKE A;  2Q4N A;  4D6B A;  2IZD B;  3AKN A;  4AW8 A;  4BX7 B;  1Y0G A;  3AKM A;  2C1Q A;  4K19 A;  5B10 O;  5CSE A;  1JV4 A;  3FW4 A;  3VG5 A;  4Z2P A;  3T2W A;  5B27 A;  3HOL A;  5B11 O;  3RE5 A;  1X8Q A;  3T2X A;  1RST B;  2IZL B;  2RTJ A;  1ZNK A;  2GTL N;  2WQA E;  2X56 A;  3APV A;  1IW2 A;  3RDS A;  1AVE A;  4IAB A;  1X8P A;  2JU8 A;  4LQZ A;  3WXQ A;  1U0X A;  4O3W A;  5F1E A;  5B5G A;  1VWE B;  4EEJ A;  1X8U A;  1EW3 A;  1VWL B;  4M7M A;  1JJJ A;  1RAV A;  1I78 A;  2AL0 X;  1O1V A;  1YP7 A;  4Y0Q A;  2Z4I A;  1HN2 A;  3RE6 A;  1Z24 A;  1MUP A;  1SY0 A;  1NGL A;  4GNW A;  3P6F A;  1SRJ A;  1BSQ A;  1OEJ A;  1QAB E;  4AZO A;  1Y52 X;  3U9P C;  2MF6 A;  2FTB A;  2FLJ A;  3VHH A;  4RUN A;  2OY8 A;  4A1H A;  4IB6 A;  2G78 A;  1LCW A;  1CBS A;  1RBP A;  2BSZ A;  4O3X B;  3VG7 A;  5CE4 A;  1A18 A;  5FQ7 E;  5HTD A;  2C4I A;  4XME A;  2LA7 A;  2X8T A;  2AT3 X;  3DTQ A;  3FEP A;  3RSW A;  3V8U A;  1T0V A;  2IZB A;  4ORS A;  5D48 A;  3ZI8 A;  1R0U A;  1ICM A;  2QO5 A;  1QFT A;  3NX2 A;  2OY7 A;  2OVE A;  1MK5 A;  3T6L A;  4GNY A;  1VWB B;  2FHN X;  1EPB A;  2FS7 A;  4TLJ A;  1VWD B;  1YWC A;  1AB0 A;  1GKA B;  4OMW A;  1NP1 A;  5F7G A;  4EFG A;  4Z2V A;  4LKP A;  1DV9 A;  1SWB A;  1L6M A;  4BX6 B;  1T68 X;  1YWD A;  1EAL A;  3BSZ E;  1SWL A;  1FE3 A;  2G79 A;  3CMP A;  2JOZ A;  2FGS A;  3FA6 A;  2PI3 O;  1SLE B;  1SLF B;  5B2A O;  3NP1 A;  5HZ6 A;  4L3R A;  3CBS A;  1PEE A;  3X00 A;  3RY1 A;  3ZWE A;  2OL8 O;  2MWH A;  1KQW A;  5LJE A;  3SOT A;  1UYN X;  5HWZ A;  2GJ5 A;  4R0B A;  4MVK A;  2UZ2 A;  4A8Z A;  2KTS A;  4DQ3 A;  1Y53 X;  2LFO A;  3BX7 A;  4HFO A;  3B2J A;  2IZJ A;  1JQP A;  5IRU A;  4GJS A;  1IJ8 A;  1LIE A;  1SWC A;  1TXL A;  2RTO B;  4O4S A;  5LKF A;  3SZI A;  4QQ1 A;  1LNM A;  1I4U A;  2L67 A;  4ID2 A;  3BX8 A;  4ORY A;  1GXA A;  5JD2 A;  3F9D A;  2NND A;  5H9K A;  2HKD A;  1HQQ A;  2Y3E A;  1X8O A;  4EKV A;  1SRH A;  5HZ8 A;  4AYH A;  3P02 A;  4IRW A;  5H9N A;  4AZQ A;  2MM3 A;  2KD2 A;  1N9M A;  5L3Y A;  3IFB A;  1JJX A;  2GH7 A;  1SLG B;  3FW5 A;  4RUU A;  3JQO A;  2F09 A;  3G7X A;  2A3F X;  5FQ6 E;  3WZO A;  4DCB A;  2F73 A;  4ARH A;  1FEM A;  1BLR A;  2HZR A;  2NNQ A;  1WUB A;  2G8C O;  1ADL A;  3EC5 A;  4GJV A;  3PPT A;  5H9L A;  5BVQ A;  4YVB A;  1LDQ A;  3EM0 A;  1PBY A;  1VYF A;  4YCH A;  3K3L A;  2M4L A;  1DF3 A;  2OYB O;  1JJU A;  4GGZ A;  1BM5 A;  3WZQ A;  4ORW A;  2FWV A;  1Y55 X;  1HY2 A;  1G85 A;  1LKE A;  1BSO A;  4NW4 A;  4UU3 A;  4AZR A;  4YFR A;  5KHP A;  4CDF A;  3OJY C;  4NV8 A;  4BCS A;  1VWO B;  4ES7 A;  2LBA A;  3BDR A;  2OL6 O;  3HWF A;  1VWH B;  3VG6 A;  2MJI A;  4ZHC A;  1SWS A;  1ML7 A;  1TOW A;  4A60 A;  4TNN A;  2Q2P A;  3MX7 A;  1SXY A;  2FHL A;  1GT5 A;  1SWH A;  1SWN A;  2OVS A;  1HQP A;  2RTB B;  3EW2 A;  2FKJ A;  4NNT A;  4XMH A;  4BX5 B;  5IRW A;  4FBV A;  3D96 A;  4U8U M;  1ERB A;  2XKL A;  5LJG A;  2QCB A;  1RXJ A;  4O3Y A;  1LFO A;  3S5V A;  2ACP X;  1ACD A;  1SA8 A;  4YKM A;  2WSJ A;  3CKG A;  1A3Y A;  1DC9 A;  4YBP A;  2RTQ B;  1IKJ A;  4GK9 A;  4L1N A;  1SWJ A;  1FTP A;  4NYQ A;  4BVM A;  2X34 A;  1EUO A;  1KL4 A;  5FQ8 E;  4NLJ A;  2OY5 O;  3PH6 A;  4O3Z A;  3SLO A;  1OEE A; 
#chains in the Genus database with same CATH homology
 1N9Y A;  1RAV A;  1SRF A;  1VWJ B;  4Z28 A;  1RXK A;  1SRE A;  1N4J A;  4JNJ A;  4U46 A;  3RE6 A;  1MM9 A;  4GGR A;  3VGW A;  1SRJ A;  2A5B A;  2RTR B;  1VWF B;  1Y52 X;  1VWC B;  4Y5D A;  1NBX A;  2MF6 A;  1VYO A;  3VHH A;  2OFB A;  4Z2O A;  2RTI B;  2RTH B;  1LCW A;  2Y32 A;  3VHI A;  1RXH A;  2C4I A;  5B5F A;  2F01 A;  1SWK A;  2IZB A;  2RTN B;  2CAM A;  1AVD A;  1VWN B;  1MK5 A;  3RY2 A;  3T6L A;  4GD9 A;  1VWB B;  2FHN X;  1VWD B;  2ZSC A;  1VWP B;  4BBO A;  4Z2V A;  2IZI A;  1SWB A;  2IZG B;  4BX6 B;  1SRG A;  1NQN A;  1NC9 A;  1SWL A;  1VWR B;  2BC3 A;  1SWR A;  4CPI A;  2G5L A;  1SLE B;  1SLF B;  2RTG B;  4CPH B;  1SWD A;  1SLD B;  1HXZ A;  3MM0 A;  1N7Y A;  2WPU A;  1LCZ A;  4JHQ A;  3RY1 A;  3X00 A;  3SZJ A;  2RTF B;  4CPE A;  1SWT A;  2UZ2 A;  3RDM A;  4GGT A;  1Y53 X;  4BX5 A;  5F2B A;  2RTK A;  2AVI A;  4BX7 A;  2IZJ A;  5IRU A;  4GJS A;  1IJ8 A;  1LUQ A;  1SWC A;  1LEL A;  1SWG A;  1NDJ A;  2RTO B;  1VWK B;  2A5C A;  3SZI A;  1LDO A;  3WYP A;  1SWE A;  4CPF A;  1DF8 A;  1SWU A;  2IZF B;  5JD2 A;  4JO6 A;  2IZK A;  1LCV A;  2RTE B;  3MG5 A;  1WBI A;  2UYW A;  1HQQ A;  3WZN A;  1VWI B;  1MOY A;  2Y3E A;  4EKV A;  1SRH A;  1SWA A;  2C1S A;  2Y3F A;  4IRW A;  5K68 A;  3PK2 A;  1N9M A;  5L3Y A;  1VWA B;  2GH7 A;  3VHM A;  1SLG B;  3RDX A;  4DNE A;  1STR B;  2RTA A;  5IRA A;  4CPH A;  1VWM B;  1SWP A;  3WZO A;  2RTP B;  2RTC B;  5CHK A;  1I9H A;  1MEP A;  4OKA A;  4GJV A;  4YVB A;  1LDQ A;  2RTD B;  1VWG B;  1KFF A;  2OF8 A;  4GGZ A;  1VWQ B;  4I60 A;  1KL5 A;  3WZQ A;  2IZH B;  1Y55 X;  1HY2 A;  3RDU A;  1SRI A;  4GDA A;  1N43 A;  1SWO A;  2A8G A;  1PTS A;  4Y59 A;  2RTM A;  4BCS A;  1VWO B;  1HXL A;  1RSU B;  1SWF A;  5K67 A;  1SWQ A;  3EW1 A;  4Z6J A;  1VWH B;  1SWS A;  1KL3 A;  4BJ8 A;  4BX6 A;  2FHL A;  1NQM A;  1STP A;  1SWH A;  1SWN A;  2RTB B;  3EW2 A;  3WZP A;  2OFA A;  5IRW A;  2IZD B;  4BX5 B;  1STS B;  4BX7 B;  2C1Q A;  2OF9 A;  4Z2P A;  5CSE A;  2QCB A;  3SZH A;  1RXJ A;  2IZA A;  3T2W A;  4Z27 A;  2IZC B;  3WYQ A;  3RE5 A;  2RTL A;  3RDO A;  3RDQ A;  3T2X A;  1RST B;  2IZL B;  2RTQ B;  2RTJ A;  1SWJ A;  3RDS A;  1AVE A;  1KL4 A;  3FDC A;  5B5G A;  1VWE B;  3T6F A;  2JGS A;  1VWL B;  2IZE B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...