1N9NA

Crystal structure of the phot-lov1 domain from chlamydomonas reinhardtii in illuminated state. data set of a single crystal.
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
108
structure length
108
Chain Sequence
b'LRHTFVVADATLPDCPLVYASEGFYAMTGYGPDEVLGHNCRFLQGEGTDPKEVQKIRDAIKKGEACSVRLLNYRKDGTPFWNLLTVTPIKTPDGRVSKFVGVQVDVTS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords putative blue light receptor
publication title Crystal Structures and Molecular Mechanism of a Light-Induced Signaling Switch: The Phot-LOV1 Domain from Chlamydomonas reinhardtii
pubmed rcsb
source organism Chlamydomonas reinhardtii
molecule tags Electron transport
total genus 29
structure length 108
sequence length 108
ec nomenclature
pdb deposition date 2002-11-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13426 PAS_9 PAS domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 1n9nA00
3VOLA 1LSWA 3H82B 2V0WA 2V9AA 2QKPA 4F3LA 4GS9A 5HDCA 3LIFA 2P7JA 2PD7A 3H82A 1OTBA 3C8CA 3VE4A 3A0RA 1D06A 5DJUA 2V1AA 1T1AA 2V0UA 5G4YA 2QJ5A 5IU1A 4HNBA 4NXBA 4BBVA 1XFNA 1OJGA 3MJQA 5G4ZA 1T18A 1GSVA 3RH8B 3K3DA 3G6OA 2PR6A 5HWVA 3C2WA 5HDDA 1G28A 4PKYG 3UB8A 4BBTA 1T1CA 1N9NA 3MXQA 3GDIA 2PYPA 4GHIB 2VV6A 5J3WA 3F1OA 1LL8A 2VV8A 1X0OA 1UWNX 3VE3A 3H7WB 2L1MA 3UE6A 3MR0A 3NHQA 4HIAA 3A0VA 1TS6A 3K3CA 4EESA 2VLGA 1LT0A 5A8BA 3H7WA 1XJ3A 3BWLA 2H28A 1S1ZA 4HOIA 2M1CA 4HHDA 2PD8A 4I39A 4EEUA 3KX0X 4WF0A 3FG8A 1T1BA 5F5YA 4EETB 3HJIA 3ULFA 4WL9A 1DP9A 5HD5A 4KUKA 5HD3A 3F1NB 3MQOA 3F1PB 1DRMA 4HJ3A 4WLAA 1D7EA 1V9YA 5DKKA 2WKQA 4LRZE 3F1NA 4JGOA 4NXFA 3F1PA 3E4PA 2ZBBA 2VV7A 2JN7A 3IS2B 1GSWA 3CWFA 3LI8A 3LYXA 4H6JA 4EQ1A 4NXGA 1N9LA 4K08A 3MQQA 2J80A 3UB6A 3EEHA 3E4OA 2EA9A 2Z6DA 1TS0A 1XJ2A 5EFWA 1OTAA 3OLOA 5TBMB 1DP6A 3NOUC 3PYPA 1JNUA 4HJ6A 2L0WA 1OTDA 4BBUA 3NOTC 1XFQA 4M4XA 1LSVA 3GECA 4MN6A 1ODVA 5TBMA 4GCZA 1OT9A 1LSXA 3D72A 2OOLA 5HWWA 2R78A 3LIAA 1KOUA 4GHIA 4EW7A 4HP4A 1S4SA 1S66L 3BY9A 1OTEA 2ZOIA 5DKLA 3LI9A 2W27A 2INWA 4HH2A 4L9EA 4E04A 1NWZA 3ZQ5A 3LIBA 3LIDA 4HP9A 2YKFA 4I5SA 4EERA 4R3AA 1VB6A 5J4EA 3NJAA 1S4RA 3B33A 5IS1A 2KX6A 4DJ2A 2GJ3A 4I3JA 4KQDA 3UB9A 2OWJA 5F68A 4XT2B 1OT6A 4I38A 2B02A 5HWTA 1XJ4A 2PHYA 2ZOHA 4LRXC 1TS7A 1F98A 3HJKA 2A24B 5F69A 4JGQA 4XT2A 4EXOA 1XJ6A 2V1BA 4WUJA 3ICYA 2K7SA 3NOPC 4I3AA 5AVFA 4WN5A 1S1YA 3UMDA 1P97A 2A24A 4PKYA 2JHEA 2PDRA 2YKHA 1F9IA 3IS2A 1WA9A 1OJ5A 1OTIA 1N9OA 1T19A 1Y28A 3H9WA 4HY8A 4DJ3A 2L4RA 4EEPA 2PR5A 3E4QA 4I3IA 4LRYC 2I9VA 2HV1A 4B9OA 5KIZA 4NXEA 3LIEA 4HI4A 3F1OB 5J7EA 4HJ4A 3CLOA 2QJ7A 2VEAA 3FC7A 4R70A 2D01A 4R6LA 4GW9A 2QWSA 2OWHA 4HQAA 1P0ZA 4MN5A 5HZHA 3CAXA 4R38A 1UWPX 1DP8A 3EWKA 1MZUA 3A0SA 3T50A 5HDSA 1EW0A 1UGUA 2PYRA 5I5LA 1GSXA 4LLOB 3UB7A 3P7NA 5AVEA 2Z6CA 3BY8A 2WKRA 1TS8A 3LUQA 3MFXA 4KUOA 1BYWA 2KDKA 4L9GA 1S67L 3PHYA 1V9ZA 4LPZA 2BASA 3RTYA 4JGPA 4JGRA 3IBRA 3UMEA 4YWZA 4L9FA 5DJTA 2W0NA 2QHKA 5F6AA 3SW1A 2CMNA 3LICA 5HSQA 4RQ9A 2WKPA 4F3LB 4GS9B 4H6JB 2D02A 4HH3A
chains in the Genus database with same CATH superfamily
2ZC3B 4K0WA 2WZXA 2V9AA 2QKPA 1KVLA 3A3EA 1K57A 3P09A 3UY6A 1I5QA 1HTZA 5CEDA 1KDSA 4IUHA 5CRFA 1JVJA 4OP8A 1OTBA 1EROA 3BW6A 1BLCA 4WBGA 3DW0A 4P85A 4S2NC 1K25A 2PBYA 3A0RA 2B95A 3S7NA 1D06A 1T1AA 3G32A 2V0UA 3MFDA 4MBFA 2QJ5A 5CXWA 3CUEA 3IT9A 4NXBA 4CLCD 4Q0IA 1XFNA 4KG5A 3EQVA 2ZQ9A 3MJQA 1SHVA 1K56A 4U0XA 4WELA 3HLBA 4Q0JA 3HBRA 3K3DA 2PR6A 2OAP1 3C38A 5CHMA 1G28A 2JKTM 3DTMA 4BBTA 1ZTUA 5HAPA 4BD0A 3VFFA 3AGFA 4BL2A 3F1OA 2OSUA 4JBFA 2FFFB 3M6HA 3KYQA 2VV8A 5L2FA 1Y54A 4KQRA 3BLMA 3MS6A 4Y7PA 1JTDA 3H7WB 1ERMA 2L1MA 2B5RA 1NJ4A 4S2KA 1C3BA 1NYYA 1L0DA 3NULA 3ZDJA 1W8QA 4BJPA 2PBDP 3VSKA 4MCWA 3A0VA 3K3CA 3ZYTA 1DJBA 1N9BA 1PIOA 3A3FA 4WZ5C 2OV5A 5A8BA 5GHZA 1XJ3A 2W3DA 4WEJA 4HOIA 2M1CA 2WGIA 4K91A 3HLCA 5FDHA 4A5RA 2ZQ7A 5G18A 4HHDA 3FYZA 3FZCA 4EEUA 3KX0X 1LL9A 3TOIA 3HLDA 1YLTA 5KMWA 3ULFA 4U3TA 1DP9A 3JYIA 1DRMA 4ZJ1A 4HJ3A 4WLAA 1XPBA 2WKQA 3VP4A 3TSGA 4LRZE 4S2OA 3MQ0A 2Y2QA 2GNXA 4R4SA 3S7QA 3IF6B 4GD8A 1MXOA 3LI8A 4KZ6A 4GJ4A 3NC8A 3V50A 3QNCA 4S2LA 4EU0A 4O7DA 2ACGA 2J80A 3OPHA 3TRCA 1P9RA 5IHVA 4EBLA 4DE0A 2V20A 1K55A 2MJ6A 4YNRA 2A3UA 5E2GA 3G31A 5A90A 3IH9A 1OTAA 3OLOA 4KG2A 5TBMB 5K5BA 1DP6A 3NOUC 3ZG0A 2JKFA 4OPZA 1S6RA 4IVIA 3PAGA 3NOTC 4DN0A 3UPPA 3GECA 4JXWA 4MN7A 1ODVA 1PW1A 3T4TA 1YKDA 3E0YA 4ZDXA 2Y2OA 3QP6A 4E3OA 4EUZA 5GHYA 4FTXA 3G30A 3UDXA 5HWWA 4JXGA 3ZG7B 1KOUA 4MBKA 3LO7A 1ZG4A 5CHJA 1SZVA 1ESIA 3BY9A 1OTEA 4IHQA 5FSRA 3VOYA 4GKUA 3UNWA 1SDEA 4ZBEA 4CLCC 2W27A 2INWA 2W1TB 4E04A 3ZQ5A 4HP9A 1ZHHB 2Y2LA 2YKFA 4I5SA 2P9VB 1VEUB 3P01A 5GHXA 2JKRM 5IS1A 1K38A 2KX6A 1JWVA 4I3JA 2OWJA 2ZJ9A 2GZAA 4B93A 3KO6A 5HWTA 4HESA 1GHPA 2JE5A 4GN2A 1F98A 2XDMA 3UN7A 2A49A 4JGQA 2XD1A 4P6ZM 3BQ8A 4EXOA 1H5XA 1K6RA 1H8ZA 2V1BA 3KSFA 4GD6A 2Y2MA 3NOPC 2Z2MB 1RGYA 4FD8A 2UV0E 3VP0A 4CQHA 5AVFA 3IF5A 5GL9A 3IX8A 3VMAA 1P97A 3T4LA 4FCFA 3U4LP 4E3NA 2WADA 3IF6A 4K0XA 1CJFA 1L3LA 3IWIA 4M3KA 1WA9A 1XKZA 2KOIA 4Z9QA 1T19A 3GQZA 4LV2A 4HY8A 1RCJA 4B9OA 4Y0UA 2VZWA 5HX9A 3R7WA 3D9YA 4NXEA 1ES5A 2VJWA 3HCYA 4BENA 1NZOA 3QHYA 3AGEA 4R70A 5I94A 3B42A 4R6LA 2IA2A 4WEKA 4E3IA 4GNUA 3BJNA 5GLBA 2J3TC 1P0ZA 3EQUA 4MN5A 3A0SA 1EW0A 4LV3A 1HVBA 5EVIB 2E8IA 2O9AA 3BFCA 4PM5A 1PFLA 5I5LA 1GSXA 4DXCA 3UB7A 5JYOA 3QP8A 3HLEA 5A93A 2Z6CA 2WKRA 2Y2PA 1GCEA 1ZC2A 2I72A 3UPOA 3ZVWA 2H10A 3SOIA 2KDKA 4PM8A 3MZFA 4LFUA 4OVDA 3PBRA 5FL3A 5AQ9A 1M40A 3RTYA 3N7WA 1YM1A 3L7HA 4JGRA 2AVXA 3FPVA 5D3OA 5GLDA 2PU2A 3VP1A 4NKPA 4L9FA 4XXRA 2P9VA 4CLCE 2JC7A 1J3WA 5E2FA 2P08A 4RYEA 4Y3IA 1MKMA 1N4OA 3LICA 4G3VA 1RP5A 3Q81A 3SH7A 3IQAA 3T4KA 5GLAA 1W7FA 2EXBA 2D02A 2XQZA 1LSWA 2Y2KA 2XRNA 1NRJA 1RGZA 5DTSA 3MF0A 2DRWA 3O3VA 2IWBA 4LCMA 5HDCA 4ZJ2A 4ETXA 5FDSA 5TFQA 1VETA 1BLPA 3H82A 2DMWA 3C8CA 3VP3A 4RX3A 4D60A 2V1AA 2J7VA 4R0QA 4OPQA 5G4YA 5IU1A 1NXYA 4BBVA 1YLYA 3VP2A 1T18A 2ZQDA 1GSVA 1Z09A 5EECA 4NETA 3G6OA 3C2WA 3UB8A 5CTMA 4R3JA 2LB5A 1N9NA 3MXQA 4N1XA 1EI5A 4DMZA 2J9PA 2WKHA 5A91A 1X0OA 4KZ4A 5L07A 1UWNX 3RXWA 2HPBA 2LB9A 5FATA 3MMHA 2ZM2A 3L9KA 4HIAA 5FQJA 3T4JA 4EESA 2VLGA 5DFXA 1W79A 3WS2A 4OQ0A 4OQIA 2JKGA 2IWCA 5EVEA 3ZG8B 2X71A 2WK0A 2PD8A 4I39A 1QMFA 2H0YA 2X02A 1XA7A 2WGVA 4PAUA 2W3FA 1PWCA 3WS0A 2J3WA 3CPTA 2XA7S 4XUXA 3Q7VA 3RJUA 1D7EA 1SDNA 2Z2LB 4O8GA 3E98A 4F94A 4MLLA 1ACFA 5EM1A 1EWZA 3F1NA 3F1PA 1CK3A 3LR3A 3GV9A 3ITBA 2VV7A 4Y17A 1BULA 2ZLYA 3CWFA 1FSYA 2HZ5A 1CF0A 4NXGA 5DTKA 2G7UA 3MQQA 1W5DA 2Y55A 1K54A 3SS3A 3E4OA 2PRFA 1SKOB 4IVKA 2BLSA 3GR2A 2PAVP 2Z6DA 1TS0A 1XX2A 1AWIA 4X1LA 2HDSA 5U47A 1ZG6A 4KZ5A 3UE1A 4HBUA 2DCFA 4ARZA 1JNUA 4BLMA 1OTDA 4LV1A 4PM7A 3OPLA 5E2EA 4WMCD 4M4XA 4G3WA 3KSGA 2CC1A 5A92A 5KSHA 1LSXA 1H0MA 4II7A 5FQQA 2OOLA 1AXBA 4Y13A 2J9OA 1YSQA 2ZMFA 1BSGA 4S2NA 1IEMA 3GMWA 2XSSA 1S66L 3W4OA 1BT5A 1TEMA 1KE3A 2ZD8A 2ZOIA 4YOFA 2V8FA 3ZFZA 3N8RA 4ESPA 1K0KA 3S22A 1OMEA 1FR6A 4HH2A 2ZL1A 3JPUA 4EERA 1VB6A 4O0PA 3NJAA 4QU3A 3IXBA 4Z1WA 3B33A 4DJ2A 4Q0HA 2B02A 5L8MA 1ALQA 1BLHA 1XJ4A 2JKTI 1IKIA 2PHYA 3S1YA 3HLGA 2P04A 3MXRA 3HJKA 3NY4A 5J8XA 5F69A 1SCWA 4IUKA 3VFHA 3DTEA 4WUJA 4WZ5A 2ZQCA 1VQQA 3ICYA 3Q7ZA 2OLVA 4JPMA 3EEAA 4WN5A 1GHIA 2WUQA 2JHEA 5KSCA 1L0GA 3WRTA 2J3TD 1STZA 3G2ZA 4JF6A 4O01A 2VGKA 1OJ5A 3GRJA 4KZBA 3R7WB 1Y28A 3H9WA 1W63Q 1TDGA 3WS4A 2K31A 1SKOA 1YQSA 4ME4A 4Y15A 5L10A 3E4QA 2JBFA 2WAEA 3HUNA 4I3IA 4CPKA 3QP5A 2I9VA 3G34A 4YFMA 1WYCA 2HV1A 1FQGA 3DWKA 3PBOA 5KIZA 1L2SA 3LIEA 2FH5A 3T4SA 5J7EA 4HJ4A 3NDEA 4Y0OA 1K4EA 2VEAA 3FC7A 1E3UA 1KE4A 1FCNA 2D01A 3R4KA 2Q0OA 1PZOA 4S2IA 2QWSA 4WZ4A 4HBTA 4QB8A 1WE4A 5EUAA 1UWPX 3EWKA 4DE1A 2ZC7A 5CERA 1LI0A 5HDSA 1GA9A 2GX5A 2W3HA 3FWLA 2XLNA 5EOOA 2PYRA 4OQGA 2C5WB 3MBZA 3IX4A 3EGXC 3P7NA 4E3KA 4OQHA 3LUQA 3MFXA 4KUOA 2V2FF 4L9GA 1S67L 3V3SA 3Q1FA 2BASA 3LR0A 3UE3A 3O87A 4KZ9A 3ISGA 5MC7A 3BFEA 3DTIA 4BD1A 3BECA 2PT7A 3QP2A 3UMEA 4EBNA 1D1JA 3IF6C 2QHKA 4P6ZS 4OOYA 4L0LA 4X68A 2E8JA 3KYZA 4R3BA 3LR4A 1PW8A 4JKTA 4CLCA 3OBFA 4KQOA 4RQ9A 2WKPA 1PRQA 3W8KA 5HW3A 4ID4A 3IXDA 3GVBA 3OCLA 5EVID 4HH3A 3N6IA 3VOLA 4B4ZA 1GA0A 1VETB 1Z6FA 3CI6A 3H82B 5DF8A 2DNSA 2ZC6B 3LY4A 5F82A 3BQAA 4GS9A 2VGLM 2P7JA 3UDIA 1F5MA 3T12B 3C30A 4E6XA 3VE4A 1JTGA 5CECA 5HPIA 5FEFA 1JWZA 4HNBA 4BMWA 2JKRI 4P87A 4IJGA 3A3IA 3V5MA 1OJGA 4MBHA 5G4ZA 4FSFA 3BRMA 2EWWA 5CTNA 3RH8B 5M18A 2XROA 4S2PA 4G3KA 5AQ7A 4FUWA 4KQQA 5HDDA 3C5AA 3MZDA 4X56A 2WKIA 1T1CA 3GDIA 2W3EA 2VV6A 4NK3A 5J3WA 2EFXA 1FILA 4OP5A 3JVUA 3WRZA 1YAXA 3N4IA 3ZG9B 3SH8A 3EOIA 1XA1A 4E3MA 4JXSA 3VE3A 3UE6A 3UPNA 2FFYA 3RFBA 4BWIA 4LGWA 1CI8A 1K56D 1TS6A 1G6OA 3O5YA 3V39A 3BWLA 4ZRRA 2H28A 5FEGA 1S1ZA 4JLFA 2V1ZA 4JXVA 3TG9A 2XD5A 1LL5A 4RX2A 2KLIA 3CPTB 4WF0A 2OAQ1 5F5YA 1W63M 3Q7VB 1CI9A 5IT5A 4EETB 1SKFA 4OLGA 3O86A 4WL9A 5HD5A 5HFOA 2O9BA 5HD3A 3F1NB 3F1PB 5BOHA 3M2KA 1MBLA 3OCNA 1V9YA 4RA7A 1IKGA 1PZPA 3JVVA 3HL9A 1P9WA 4EWFA 4ZTKA 2G2WA 4D2OA 3LEZA 4MEZA 3MSHA 3MXSA 4BQMA 4KZ3A 4UQIS 2JN7A 4Y2FA 1GSWA 1IELA 4UQIM 2Y2GA 3C4OA 4CJNA 4B4XA 4FH2A 4K08A 3CMZA 3UB6A 3EEHA 4OLDA 2C6WB 2EA9A 4X55A 1GHMA 3WS1A 4ARZB 3W2ZA 2QZ6A 5EFWA 3AGDA 4KZAA 5FAOA 3ZNYA 4R23A 3KYEA 5M1AA 5CGSA 5HAIA 3ZHHA 1MY8A 4KZ7A 3PYPA 1XGIA 3D4FA 3K2NA 5FQMA 4HJ6A 5EVIC 4BBUA 1XFQA 1LSVA 4DF6A 5DF7A 5LBRA 4GCZA 3ZNTA 3HREA 2VX8A 3UO9A 5FI6A 2WAFA 3LIAA 4N1HA 3T1SA 3OZHA 2QPNA 4HP4A 3DAVA 1S4SA 3OPRA 4R1GA 1YT4A 1FR1A 2ZL1B 3QP1A 4QD4A 4UA6A 5FAQA 5DKLA 2BTFP 3LEQA 3LIBA 3NCKA 2WGWA 2Y8HA 4UA7A 1IYPA 3NI9A 5FI7A 1ONGA 4EV4A 4X1MA 1LI9A 4N9LA 5J4EA 1K57C 1FIKA 1S4RA 4RVAA 3BM6A 4X53A 4EUVA 4KQDA 5DVAA 4I38A 5DTTA 1G6AA 3NBLA 1YSPA 4H8RA 2ZOHA 1L0EA 4LRXC 4PM9A 1TS7A 3CUEC 4GB7A 4XT2A 2ZC5B 1J9MA 5F1FA 5CX7A 2K7SA 4DKIA 4DDYA 3QNBA 1S1YA 3UMDA 4MMNA 2A24A 4NEED 3S7OA 3BFGA 2YKHA 1BUEA 3IWQA 5FAPA 2A2LA 1K4FA 4OONA 3MKEA 1XGJA 3C7VA 3N8SA 3TE8A 1QMEA 3TW8A 1PNEA 2W3GA 1VHMA 4IEDA 1OTIA 1N9OA 3IWOA 1TD5A 2ZQ8A 4GZBA 1BLSA 3NDGA 4GDNA 4QPRA 3OC2A 2L4RA 2V8CA 4EEPA 1KVMA 2R9XA 2M7VA 4LRYC 1YLPA 4JF4A 3U2AA 4EQIA 3PXPA 4HI4A 1LLBA 3HUMA 4PHTA 1MPLA 3P98A 3VSLA 2QJ7A 1E25A 2J8YA 4DDSA 3T1XA 1FOFA 1YMXA 1TF1A 4GW9A 2Y2HA 2X01A 3LCEA 1H8YA 3TJZC 5HZHA 3CAXA 1BZAA 4S2MA 3Q82A 3DBAA 3T50A 3HUOA 5FASA 1UGUA 5DF9A 2VK3A 4LCLA 2WZZA 4LLOB 1G68A 3BY8A 3PR6A 1BYWA 4UEYA 2VA0A 1V9ZA 2WKEA 2XH9A 4LPZA 1MKIA 2O99A 1WYBA 2ZMAA 5FQKA 3W4PA 5HL6A 3C4PA 4CLCB 3SZTA 2ZM0A 2W0NA 1K55C 4UAAA 5F6AA 2ZM8A 3SW1A 4B88A 1CEFA 2CMNA 3S7PA 2FZ0A 2IWDA 3S4XA 3EGDC 3N8LA 2HJ9C 4GS9B 2Y4AA 4H6JB 1DY6A 3PTEA 1JWPA 3V67A 4DXBA 5CEBA 3T1QB 4AFIA 2EXAA 4C6YA 1PYYA 2B18A 2V0WA 5AQBA 2EX6A 4KG6A 3VV4A 4QHCA 4F3LA 2G2UA 1NLZA 5HAQA 3LIFA 4OPYA 1M6KA 2PD7A 3I7JA 2QYBA 3A3DA 3G35A 4ZJ3A 2XGNA 3HVFA 1CQAA 5DJUA 3IH8A 1NZUA 4HEFA 2Y2NA 3PBTA 1OPXA 4UA9A 2ZMVA 3GTCA 3NECA 4E6WA 2Y2IA 4FOFA 1TVFA 2Y79A 5E43A 1NLYA 5HWVA 1ZKJA 2HJEA 5HL1A 4PKYG 1MWSA 3MZEA 3ZVTA 4GHIB 2PYPA 5C5KA 5JYPA 2Q9NA 3SH9A 1FCMA 1MWTA 5FQIA 1LL8A 1U60A 4MDZA 3C7UA 1PWDA 3DTKA 4KENB 1O07A 3PBSA 3MR0A 3NHQA 3FPWA 2XEPA 2HP5A 4YINA 3ZG5A 3UDFA 1W8YA 2OLUA 3B47A 1LT0A 1ONHA 1H3QA 3H7WA 2VGJA 4QJGA 2HGVA 3HLWA 4NG2A 3D3OA 2O0YA 4XUZA 4N9KA 5TR7A 3LGOA 1Y4OA 3OOVA 4OOMA 1LHYA 3FG8A 1T1BA 3FKVA 3HJIA 4X25A 3UE0A 2PU4A 4UHUA 4EBPA 5TJJA 4KUKA 4P0MA 3MQOA 1YPRA 4JF5A 4OOLA 1VM1A 2H0TA 1YMSA 5AQAA 3UB5P 4U0TA 4R4RA 1ESUA 3ITAA 5EOEA 4DE3A 3BYDA 1L0FA 5DKKA 1NRFA 4JGOA 4BL3A 4NXFA 4OKPA 2M7UA 5EE8A 3E4PA 2ZBBA 4ZAMA 2VGLS 4WMCA 3IS2B 2BG1A 3LYXA 4H6JA 4EQ1A 5M19A 3KSHA 1N9LA 5FQ9A 2RL3A 3CZDA 1ERQA 4IBRA 1HZOA 1XXMA 4PPRA 4X69A 1BTLA 1I2SA 4WYYA 3IHBA 3PAEA 1XJ2A 5AJGA 5GLCA 1A0KA 4E3JA 1KGEA 2HP6A 3BFFA 1O7EA 2Y2JA 2NUTC 5CGXA 4IBXA 1I2WA 3QP4A 2L0WA 4PM6A 2JCHA 5F83A 1YLZA 4GDBA 1K6SA 4MN6A 3E2KA 5TBMA 4N92A 3BFDA 1OT9A 1HLUP 3FV7A 3D72A 1KDWA 1ES3A 5FA7A 2R78A 3E2LA 1F2KA 4GHIA 2HF6A 4EW7A 2P74A 1MWUA 3IHAA 1IOUA 1KE0A 2HDRA 3IBJA 4DRTA 1ES4A 1YLWA 2WGWB 4QY5A 5EPHA 3ZGAB 2R9WA 2HP9A 4FH4A 1E4DA 5DFYA 3LI9A 2EX9A 4E3LA 1TDLA 4L9EA 1NWZA 3FKWA 3LIDA 3OPPA 1CEGA 1PI5A 2XR0A 1Q2QA 3M6BA 4R3AA 3G4PA 2WYXA 4OPRA 3O88A 2W1TA 3RXXA 2GJ3A 3UB9A 4S2JA 5F68A 4XT2B 3V3RA 1OT6A 3LY3A 2VKSA 5E2HA 2EFUA 3IX3A 2GDNA 2RCXA 5F1GA 1VEUA 4PMAA 2W1RA 5CHUA 4C3QA 3PBNA 3IXGA 4QY6A 2A24B 4GLQA 3CHWP 1DJCA 1XJ6A 1NYMA 3VOZA 4Y5FA 3WWXA 1HD8A 2HDUA 2K2NA 5KZHA 3A3JA 3SS4A 2Y91A 4I3AA 3BLSA 4PKYA 1IYOA 2PDRA 2XK1A 4LV0A 1IYQA 1ES2A 5TGFA 1MC0A 1F9IA 4QWOA 3IS2A 4X6TA 2ZQAA 5FI2A 3T1RA 1G5UA 3W4QA 3DWZA 4Q8IA 3T4OA 4OH0A 3M2JA 4GOGA 3NIAA 4DJ3A 3KSIA 3CJMA 5HARA 5CGWA 4MNRA 4KZ8A 3PBQA 2PR5A 3LFVA 1KGGA 2EWVA 3G2YA 2O9CA 2H5SA 1NY0A 3F1OB 3CLOA 3BEBA 3ZCZA 2XFSA 4ETZA 5EM0A 3Q07A 2OWHA 5EVLA 4HQAA 1Q2PA 3CITA 4R38A 1DP8A 1MZUA 1YLJA 3LR5A 3GSGA 2Q9MA 2UWXA 2Y59A 3WS5A 5HPFA 1H8MA 4C75A 1IFQA 5AVEA 1MWRA 2ZC4B 2EX2A 1KGFA 1TS8A 1FCOA 3HLFA 5EVIA 5L09A 2XFTA 3PHYA 1XP4A 2NUPC 4DE2A 2HDQA 2XF3A 1FSWA 1E3UD 1IYSA 4JGPA 3IBRA 3SS5A 4YWZA 4Y0TA 1PI4A 2QMIA 5DJTA 1K54C 3MKFA 3B3XA 4LENA 2EX8A 1PWGA 3IXHA 4P6BA 3T4QA 1S0WA 5EV0A 5HSQA 3CG5A 4WM9A 4F3LB 1DJAA 2XA7M
chains in the Genus database with same CATH topology
3VOLA 1LSWA 3CI6A 3H82B 4AFIA 2B18A 2V0WA 2XRNA 2V9AA 1NRJA 2QKPA 3VV4A 3MF0A 4F3LA 3BQAA 4GS9A 1NLZA 4IUHA 5HDCA 2VGLM 3LIFA 4ETXA 2P7JA 2PD7A 3H82A 1F5MA 1OTBA 2DMWA 3BW6A 3C8CA 2QYBA 3C30A 3VE4A 3S7NA 3A0RA 1D06A 5DJUA 2V1AA 5HPIA 1T1AA 2V0UA 3PBTA 5G4YA 2QJ5A 5IU1A 4HNBA 3CUEA 4BMWA 1OPXA 2JKRI 4IJGA 4NXBA 4BBVA 4CLCD 4Q0IA 2ZMVA 1XFNA 3EQVA 1OJGA 3MJQA 4WELA 5G4ZA 4FSFA 1T18A 1GSVA 2EWWA 4Q0JA 4FOFA 3RH8B 3K3DA 2XROA 3G6OA 2Y79A 4G3KA 2PR6A 1NLYA 2OAP1 3C38A 5HWVA 2HJEA 3C2WA 5HDDA 1G28A 2JKTM 4PKYG 3UB8A 4BBTA 1ZTUA 2LB5A 1T1CA 1N9NA 3MXQA 3GDIA 2PYPA 4GHIB 2W3EA 2VV6A 5C5KA 5J3WA 3F1OA 4DMZA 3JVUA 1LL8A 1YAXA 3KYQA 2VV8A 4MDZA 1X0OA 3EOIA 1UWNX 3VE3A 3PBSA 3H7WB 2L1MA 3UE6A 2LB9A 3MR0A 3MMHA 3NHQA 3FPWA 3RFBA 4BWIA 4HIAA 4BJPA 3T4JA 4MCWA 3A0VA 1TS6A 1G6OA 3K3CA 4EESA 3ZYTA 2VLGA 3O5YA 3B47A 1LT0A 5DFXA 1H3QA 3H7WA 5A8BA 1XJ3A 3BWLA 2W3DA 4ZRRA 4WEJA 2HGVA 2H28A 1S1ZA 3D3OA 2O0YA 4HOIA 2M1CA 2KLIA 4HHDA 2PD8A 4I39A 3OOVA 4EEUA 4OOMA 3KX0X 4WF0A 3FG8A 1T1BA 2OAQ1 5F5YA 1W63M 5IT5A 4EETB 3HJIA 3ULFA 4PAUA 4WL9A 2W3FA 1DP9A 5HD5A 5TJJA 2O9BA 4KUKA 5HD3A 3F1NB 3MQOA 4OOLA 3F1PB 1DRMA 2J3WA 4HJ3A 2XA7S 4WLAA 3OCNA 1D7EA 1V9YA 4O8GA 3E98A 3JVVA 1P9WA 5DKKA 2WKQA 4LRZE 3F1NA 4JGOA 3MQ0A 4NXFA 3F1PA 2GNXA 2M7UA 3LR3A 3E4PA 2ZBBA 4UQIS 3S7QA 2VV7A 2JN7A 2VGLS 4Y2FA 3IS2B 1GSWA 3CWFA 3LI8A 3LYXA 4UQIM 4H6JA 4EQ1A 4GJ4A 4NXGA 3KSHA 1N9LA 4EU0A 4K08A 2G7UA 3MQQA 2J80A 3TRCA 3UB6A 3EEHA 1P9RA 3E4OA 2EA9A 2MJ6A 4ARZB 3W2ZA 4YNRA 2Z6DA 1TS0A 1XJ2A 5AJGA 5EFWA 1OTAA 3OLOA 5TBMB 5K5BA 1DP6A 2NUTC 3NOUC 4ARZA 3PYPA 1JNUA 3K2NA 4HJ6A 2L0WA 1OTDA 4BBUA 3NOTC 4DN0A 1XFQA 4M4XA 4G3WA 1LSVA 3GECA 3KSGA 4MN6A 4MN7A 1ODVA 5TBMA 3T4TA 5LBRA 4GCZA 1OT9A 1YKDA 3E0YA 1LSXA 5KSHA 4II7A 2VX8A 3D72A 2OOLA 5HWWA 2R78A 1YSQA 3LIAA 1KOUA 4GHIA 2HF6A 2ZMFA 4EW7A 4HP4A 1S4SA 1IOUA 2XSSA 1S66L 3BY9A 1OTEA 3IBJA 4IHQA 2ZOIA 4YOFA 4CLCC 5DKLA 5DFYA 3LI9A 2W27A 2INWA 2W1TB 4HH2A 4L9EA 4E04A 1NWZA 3ZQ5A 3LIBA 3LIDA 2Y8HA 1ZHHB 4HP9A 2YKFA 4I5SA 4EERA 4R3AA 1VB6A 4O0PA 5J4EA 3NJAA 1S4RA 3V67A 4Z1WA 3P01A 2W1TA 4EUVA 2JKRM 3B33A 5IS1A 2KX6A 4DJ2A 2GJ3A 4I3JA 4KQDA 3UB9A 2OWJA 5F68A 2GZAA 4XT2B 4B93A 1OT6A 4I38A 4Q0HA 2B02A 3KO6A 2VKSA 5HWTA 5L8MA 1XJ4A 1YSPA 2JKTI 2PHYA 2ZOHA 4LRXC 2W1RA 1TS7A 2P04A 3PBNA 3CUEC 1F98A 3HJKA 2A24B 5F69A 4GLQA 4JGQA 4XT2A 4P6ZM 4EXOA 3BQ8A 1XJ6A 4IUKA 4Y5FA 2V1BA 4WUJA 3KSFA 3ICYA 5CX7A 2K2NA 2K7SA 3NOPC 4I3AA 3EEAA 4CQHA 5AVFA 4WN5A 1S1YA 3UMDA 4MMNA 1P97A 2A24A 4NEED 3S7OA 3T4LA 4PKYA 2JHEA 2PDRA 2J3TD 2YKHA 1MC0A 1STZA 1F9IA 3IS2A 2A2LA 4O01A 1WA9A 3T4OA 3TE8A 2KOIA 3TW8A 2W3GA 1VHMA 1OJ5A 1OTIA 1N9OA 1TD5A 1T19A 3R7WB 1Y28A 3H9WA 4QPRA 1W63Q 3OC2A 4HY8A 4DJ3A 3KSIA 2L4RA 2K31A 4ME4A 3PBQA 4EEPA 2PR5A 3E4QA 2M7VA 4I3IA 4LRYC 2I9VA 3LFVA 2EWVA 2HV1A 4B9OA 2O9CA 2VZWA 3R7WA 3U2AA 3PBOA 3PXPA 4NXEA 5KIZA 2VJWA 3HCYA 3LIEA 4HI4A 2FH5A 3F1OB 3T4SA 4HJ4A 5J7EA 4PHTA 3CLOA 2QJ7A 2VEAA 3FC7A 4R70A 3B42A 2D01A 4R6LA 4ETZA 2IA2A 3R4KA 1TF1A 4GW9A 2QWSA 4WEKA 2OWHA 3BJNA 4HQAA 2J3TC 1P0ZA 3EQUA 4MN5A 3TJZC 3CITA 5HZHA 3CAXA 4R38A 1UWPX 1DP8A 3EWKA 1MZUA 3A0SA 3DBAA 3T50A 5HDSA 2GX5A 1EW0A 2W3HA 1UGUA 5DF9A 3LR5A 2O9AA 2PYRA 5I5LA 1GSXA 4LLOB 3UB7A 3EGXC 5HPFA 1H8MA 3P7NA 1IFQA 5AVEA 2Z6CA 3BY8A 2WKRA 1TS8A 3LUQA 3MFXA 3PR6A 4KUOA 1BYWA 2KDKA 4L9GA 1S67L 3PHYA 4UEYA 2VA0A 2NUPC 3PBRA 5FL3A 1V9ZA 4LPZA 2BASA 3RTYA 3LR0A 3UE3A 4JGPA 4JGRA 2O99A 3IBRA 3FPVA 5MC7A 2PT7A 3UMEA 4YWZA 4NKPA 5HL6A 4L9FA 5DJTA 4CLCB 4CLCE 2W0NA 2QHKA 2P08A 4P6ZS 4Y3IA 4L0LA 5F6AA 3KYZA 3SW1A 3T4QA 3LR4A 1MKMA 2CMNA 3S7PA 2FZ0A 3LICA 5HSQA 4CLCA 3EGDC 4G3VA 3OBFA 4KQOA 4RQ9A 2WKPA 4F3LB 3T4KA 2HJ9C 4GS9B 2XA7M 4H6JB 3OCLA 2D02A 4HH3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3VOL A;  1LSW A;  3H82 B;  2V0W A;  2V9A A;  2QKP A;  4F3L A;  4GS9 A;  5HDC A;  3LIF A;  2P7J A;  2PD7 A;  3H82 A;  1OTB A;  3C8C A;  3VE4 A;  3A0R A;  1D06 A;  5DJU A;  2V1A A;  1T1A A;  2V0U A;  5G4Y A;  2QJ5 A;  5IU1 A;  4HNB A;  4NXB A;  4BBV A;  1XFN A;  1OJG A;  3MJQ A;  5G4Z A;  1T18 A;  1GSV A;  3RH8 B;  3K3D A;  3G6O A;  2PR6 A;  5HWV A;  3C2W A;  5HDD A;  1G28 A;  4PKY G;  3UB8 A;  4BBT A;  1T1C A;  1N9N A;  3MXQ A;  3GDI A;  2PYP A;  4GHI B;  2VV6 A;  5J3W A;  3F1O A;  1LL8 A;  2VV8 A;  1X0O A;  1UWN X;  3VE3 A;  3H7W B;  2L1M A;  3UE6 A;  3MR0 A;  3NHQ A;  4HIA A;  3A0V A;  1TS6 A;  3K3C A;  4EES A;  2VLG A;  1LT0 A;  5A8B A;  3H7W A;  1XJ3 A;  3BWL A;  2H28 A;  1S1Z A;  4HOI A;  2M1C A;  4HHD A;  2PD8 A;  4I39 A;  4EEU A;  3KX0 X;  4WF0 A;  3FG8 A;  1T1B A;  5F5Y A;  4EET B;  3HJI A;  3ULF A;  4WL9 A;  1DP9 A;  5HD5 A;  4KUK A;  5HD3 A;  3F1N B;  3MQO A;  3F1P B;  1DRM A;  4HJ3 A;  4WLA A;  1D7E A;  1V9Y A;  5DKK A;  2WKQ A;  4LRZ E;  3F1N A;  4JGO A;  4NXF A;  3F1P A;  3E4P A;  2ZBB A;  2VV7 A;  2JN7 A;  3IS2 B;  1GSW A;  3CWF A;  3LI8 A;  3LYX A;  4H6J A;  4EQ1 A;  4NXG A;  1N9L A;  4K08 A;  3MQQ A;  2J80 A;  3UB6 A;  3EEH A;  3E4O A;  2EA9 A;  2Z6D A;  1TS0 A;  1XJ2 A;  5EFW A;  1OTA A;  3OLO A;  5TBM B;  1DP6 A;  3NOU C;  3PYP A;  1JNU A;  4HJ6 A;  2L0W A;  1OTD A;  4BBU A;  3NOT C;  1XFQ A;  4M4X A;  1LSV A;  3GEC A;  4MN6 A;  1ODV A;  5TBM A;  4GCZ A;  1OT9 A;  1LSX A;  3D72 A;  2OOL A;  5HWW A;  2R78 A;  3LIA A;  1KOU A;  4GHI A;  4EW7 A;  4HP4 A;  1S4S A;  1S66 L;  3BY9 A;  1OTE A;  2ZOI A;  5DKL A;  3LI9 A;  2W27 A;  2INW A;  4HH2 A;  4L9E A;  4E04 A;  1NWZ A;  3ZQ5 A;  3LIB A;  3LID A;  4HP9 A;  2YKF A;  4I5S A;  4EER A;  4R3A A;  1VB6 A;  5J4E A;  3NJA A;  1S4R A;  3B33 A;  5IS1 A;  2KX6 A;  4DJ2 A;  2GJ3 A;  4I3J A;  4KQD A;  3UB9 A;  2OWJ A;  5F68 A;  4XT2 B;  1OT6 A;  4I38 A;  2B02 A;  5HWT A;  1XJ4 A;  2PHY A;  2ZOH A;  4LRX C;  1TS7 A;  1F98 A;  3HJK A;  2A24 B;  5F69 A;  4JGQ A;  4XT2 A;  4EXO A;  1XJ6 A;  2V1B A;  4WUJ A;  3ICY A;  2K7S A;  3NOP C;  4I3A A;  5AVF A;  4WN5 A;  1S1Y A;  3UMD A;  1P97 A;  2A24 A;  4PKY A;  2JHE A;  2PDR A;  2YKH A;  1F9I A;  3IS2 A;  1WA9 A;  1OJ5 A;  1OTI A;  1N9O A;  1T19 A;  1Y28 A;  3H9W A;  4HY8 A;  4DJ3 A;  2L4R A;  4EEP A;  2PR5 A;  3E4Q A;  4I3I A;  4LRY C;  2I9V A;  2HV1 A;  4B9O A;  5KIZ A;  4NXE A;  3LIE A;  4HI4 A;  3F1O B;  5J7E A;  4HJ4 A;  3CLO A;  2QJ7 A;  2VEA A;  3FC7 A;  4R70 A;  2D01 A;  4R6L A;  4GW9 A;  2QWS A;  2OWH A;  4HQA A;  1P0Z A;  4MN5 A;  5HZH A;  3CAX A;  4R38 A;  1UWP X;  1DP8 A;  3EWK A;  1MZU A;  3A0S A;  3T50 A;  5HDS A;  1EW0 A;  1UGU A;  2PYR A;  5I5L A;  1GSX A;  4LLO B;  3UB7 A;  3P7N A;  5AVE A;  2Z6C A;  3BY8 A;  2WKR A;  1TS8 A;  3LUQ A;  3MFX A;  4KUO A;  1BYW A;  2KDK A;  4L9G A;  1S67 L;  3PHY A;  1V9Z A;  4LPZ A;  2BAS A;  3RTY A;  4JGP A;  4JGR A;  3IBR A;  3UME A;  4YWZ A;  4L9F A;  5DJT A;  2W0N A;  2QHK A;  5F6A A;  3SW1 A;  2CMN A;  3LIC A;  5HSQ A;  4RQ9 A;  2WKP A;  4F3L B;  4GS9 B;  4H6J B;  2D02 A;  4HH3 A; 
#chains in the Genus database with same CATH topology
 2ZC3 B;  4K0W A;  2WZX A;  2V9A A;  2QKP A;  1KVL A;  3A3E A;  1K57 A;  3P09 A;  3UY6 A;  1I5Q A;  1HTZ A;  5CED A;  1KDS A;  4IUH A;  5CRF A;  1JVJ A;  4OP8 A;  1OTB A;  1ERO A;  3BW6 A;  1BLC A;  4WBG A;  3DW0 A;  4P85 A;  4S2N C;  1K25 A;  2PBY A;  3A0R A;  2B95 A;  3S7N A;  1D06 A;  1T1A A;  3G32 A;  2V0U A;  3MFD A;  4MBF A;  2QJ5 A;  5CXW A;  3CUE A;  3IT9 A;  4NXB A;  4CLC D;  4Q0I A;  1XFN A;  4KG5 A;  3EQV A;  2ZQ9 A;  3MJQ A;  1SHV A;  1K56 A;  4U0X A;  4WEL A;  3HLB A;  4Q0J A;  3HBR A;  3K3D A;  2PR6 A;  2OAP 1;  3C38 A;  5CHM A;  1G28 A;  2JKT M;  3DTM A;  4BBT A;  1ZTU A;  5HAP A;  4BD0 A;  3VFF A;  3AGF A;  4BL2 A;  3F1O A;  2OSU A;  4JBF A;  2FFF B;  3M6H A;  3KYQ A;  2VV8 A;  5L2F A;  1Y54 A;  4KQR A;  3BLM A;  3MS6 A;  4Y7P A;  1JTD A;  3H7W B;  1ERM A;  2L1M A;  2B5R A;  1NJ4 A;  4S2K A;  1C3B A;  1NYY A;  1L0D A;  3NUL A;  3ZDJ A;  1W8Q A;  4BJP A;  2PBD P;  3VSK A;  4MCW A;  3A0V A;  3K3C A;  3ZYT A;  1DJB A;  1N9B A;  1PIO A;  3A3F A;  4WZ5 C;  2OV5 A;  5A8B A;  5GHZ A;  1XJ3 A;  2W3D A;  4WEJ A;  4HOI A;  2M1C A;  2WGI A;  4K91 A;  3HLC A;  5FDH A;  4A5R A;  2ZQ7 A;  5G18 A;  4HHD A;  3FYZ A;  3FZC A;  4EEU A;  3KX0 X;  1LL9 A;  3TOI A;  3HLD A;  1YLT A;  5KMW A;  3ULF A;  4U3T A;  1DP9 A;  3JYI A;  1DRM A;  4ZJ1 A;  4HJ3 A;  4WLA A;  1XPB A;  2WKQ A;  3VP4 A;  3TSG A;  4LRZ E;  4S2O A;  3MQ0 A;  2Y2Q A;  2GNX A;  4R4S A;  3S7Q A;  3IF6 B;  4GD8 A;  1MXO A;  3LI8 A;  4KZ6 A;  4GJ4 A;  3NC8 A;  3V50 A;  3QNC A;  4S2L A;  4EU0 A;  4O7D A;  2ACG A;  2J80 A;  3OPH A;  3TRC A;  1P9R A;  5IHV A;  4EBL A;  4DE0 A;  2V20 A;  1K55 A;  2MJ6 A;  4YNR A;  2A3U A;  5E2G A;  3G31 A;  5A90 A;  3IH9 A;  1OTA A;  3OLO A;  4KG2 A;  5TBM B;  5K5B A;  1DP6 A;  3NOU C;  3ZG0 A;  2JKF A;  4OPZ A;  1S6R A;  4IVI A;  3PAG A;  3NOT C;  4DN0 A;  3UPP A;  3GEC A;  4JXW A;  4MN7 A;  1ODV A;  1PW1 A;  3T4T A;  1YKD A;  3E0Y A;  4ZDX A;  2Y2O A;  3QP6 A;  4E3O A;  4EUZ A;  5GHY A;  4FTX A;  3G30 A;  3UDX A;  5HWW A;  4JXG A;  3ZG7 B;  1KOU A;  4MBK A;  3LO7 A;  1ZG4 A;  5CHJ A;  1SZV A;  1ESI A;  3BY9 A;  1OTE A;  4IHQ A;  5FSR A;  3VOY A;  4GKU A;  3UNW A;  1SDE A;  4ZBE A;  4CLC C;  2W27 A;  2INW A;  2W1T B;  4E04 A;  3ZQ5 A;  4HP9 A;  1ZHH B;  2Y2L A;  2YKF A;  4I5S A;  2P9V B;  1VEU B;  3P01 A;  5GHX A;  2JKR M;  5IS1 A;  1K38 A;  2KX6 A;  1JWV A;  4I3J A;  2OWJ A;  2ZJ9 A;  2GZA A;  4B93 A;  3KO6 A;  5HWT A;  4HES A;  1GHP A;  2JE5 A;  4GN2 A;  1F98 A;  2XDM A;  3UN7 A;  2A49 A;  4JGQ A;  2XD1 A;  4P6Z M;  3BQ8 A;  4EXO A;  1H5X A;  1K6R A;  1H8Z A;  2V1B A;  3KSF A;  4GD6 A;  2Y2M A;  3NOP C;  2Z2M B;  1RGY A;  4FD8 A;  2UV0 E;  3VP0 A;  4CQH A;  5AVF A;  3IF5 A;  5GL9 A;  3IX8 A;  3VMA A;  1P97 A;  3T4L A;  4FCF A;  3U4L P;  4E3N A;  2WAD A;  3IF6 A;  4K0X A;  1CJF A;  1L3L A;  3IWI A;  4M3K A;  1WA9 A;  1XKZ A;  2KOI A;  4Z9Q A;  1T19 A;  3GQZ A;  4LV2 A;  4HY8 A;  1RCJ A;  4B9O A;  4Y0U A;  2VZW A;  5HX9 A;  3R7W A;  3D9Y A;  4NXE A;  1ES5 A;  2VJW A;  3HCY A;  4BEN A;  1NZO A;  3QHY A;  3AGE A;  4R70 A;  5I94 A;  3B42 A;  4R6L A;  2IA2 A;  4WEK A;  4E3I A;  4GNU A;  3BJN A;  5GLB A;  2J3T C;  1P0Z A;  3EQU A;  4MN5 A;  3A0S A;  1EW0 A;  4LV3 A;  1HVB A;  5EVI B;  2E8I A;  2O9A A;  3BFC A;  4PM5 A;  1PFL A;  5I5L A;  1GSX A;  4DXC A;  3UB7 A;  5JYO A;  3QP8 A;  3HLE A;  5A93 A;  2Z6C A;  2WKR A;  2Y2P A;  1GCE A;  1ZC2 A;  2I72 A;  3UPO A;  3ZVW A;  2H10 A;  3SOI A;  2KDK A;  4PM8 A;  3MZF A;  4LFU A;  4OVD A;  3PBR A;  5FL3 A;  5AQ9 A;  1M40 A;  3RTY A;  3N7W A;  1YM1 A;  3L7H A;  4JGR A;  2AVX A;  3FPV A;  5D3O A;  5GLD A;  2PU2 A;  3VP1 A;  4NKP A;  4L9F A;  4XXR A;  2P9V A;  4CLC E;  2JC7 A;  1J3W A;  5E2F A;  2P08 A;  4RYE A;  4Y3I A;  1MKM A;  1N4O A;  3LIC A;  4G3V A;  1RP5 A;  3Q81 A;  3SH7 A;  3IQA A;  3T4K A;  5GLA A;  1W7F A;  2EXB A;  2D02 A;  2XQZ A;  1LSW A;  2Y2K A;  2XRN A;  1NRJ A;  1RGZ A;  5DTS A;  3MF0 A;  2DRW A;  3O3V A;  2IWB A;  4LCM A;  5HDC A;  4ZJ2 A;  4ETX A;  5FDS A;  5TFQ A;  1VET A;  1BLP A;  3H82 A;  2DMW A;  3C8C A;  3VP3 A;  4RX3 A;  4D60 A;  2V1A A;  2J7V A;  4R0Q A;  4OPQ A;  5G4Y A;  5IU1 A;  1NXY A;  4BBV A;  1YLY A;  3VP2 A;  1T18 A;  2ZQD A;  1GSV A;  1Z09 A;  5EEC A;  4NET A;  3G6O A;  3C2W A;  3UB8 A;  5CTM A;  4R3J A;  2LB5 A;  1N9N A;  3MXQ A;  4N1X A;  1EI5 A;  4DMZ A;  2J9P A;  2WKH A;  5A91 A;  1X0O A;  4KZ4 A;  5L07 A;  1UWN X;  3RXW A;  2HPB A;  2LB9 A;  5FAT A;  3MMH A;  2ZM2 A;  3L9K A;  4HIA A;  5FQJ A;  3T4J A;  4EES A;  2VLG A;  5DFX A;  1W79 A;  3WS2 A;  4OQ0 A;  4OQI A;  2JKG A;  2IWC A;  5EVE A;  3ZG8 B;  2X71 A;  2WK0 A;  2PD8 A;  4I39 A;  1QMF A;  2H0Y A;  2X02 A;  1XA7 A;  2WGV A;  4PAU A;  2W3F A;  1PWC A;  3WS0 A;  2J3W A;  3CPT A;  2XA7 S;  4XUX A;  3Q7V A;  3RJU A;  1D7E A;  1SDN A;  2Z2L B;  4O8G A;  3E98 A;  4F94 A;  4MLL A;  1ACF A;  5EM1 A;  1EWZ A;  3F1N A;  3F1P A;  1CK3 A;  3LR3 A;  3GV9 A;  3ITB A;  2VV7 A;  4Y17 A;  1BUL A;  2ZLY A;  3CWF A;  1FSY A;  2HZ5 A;  1CF0 A;  4NXG A;  5DTK A;  2G7U A;  3MQQ A;  1W5D A;  2Y55 A;  1K54 A;  3SS3 A;  3E4O A;  2PRF A;  1SKO B;  4IVK A;  2BLS A;  3GR2 A;  2PAV P;  2Z6D A;  1TS0 A;  1XX2 A;  1AWI A;  4X1L A;  2HDS A;  5U47 A;  1ZG6 A;  4KZ5 A;  3UE1 A;  4HBU A;  2DCF A;  4ARZ A;  1JNU A;  4BLM A;  1OTD A;  4LV1 A;  4PM7 A;  3OPL A;  5E2E A;  4WMC D;  4M4X A;  4G3W A;  3KSG A;  2CC1 A;  5A92 A;  5KSH A;  1LSX A;  1H0M A;  4II7 A;  5FQQ A;  2OOL A;  1AXB A;  4Y13 A;  2J9O A;  1YSQ A;  2ZMF A;  1BSG A;  4S2N A;  1IEM A;  3GMW A;  2XSS A;  1S66 L;  3W4O A;  1BT5 A;  1TEM A;  1KE3 A;  2ZD8 A;  2ZOI A;  4YOF A;  2V8F A;  3ZFZ A;  3N8R A;  4ESP A;  1K0K A;  3S22 A;  1OME A;  1FR6 A;  4HH2 A;  2ZL1 A;  3JPU A;  4EER A;  1VB6 A;  4O0P A;  3NJA A;  4QU3 A;  3IXB A;  4Z1W A;  3B33 A;  4DJ2 A;  4Q0H A;  2B02 A;  5L8M A;  1ALQ A;  1BLH A;  1XJ4 A;  2JKT I;  1IKI A;  2PHY A;  3S1Y A;  3HLG A;  2P04 A;  3MXR A;  3HJK A;  3NY4 A;  5J8X A;  5F69 A;  1SCW A;  4IUK A;  3VFH A;  3DTE A;  4WUJ A;  4WZ5 A;  2ZQC A;  1VQQ A;  3ICY A;  3Q7Z A;  2OLV A;  4JPM A;  3EEA A;  4WN5 A;  1GHI A;  2WUQ A;  2JHE A;  5KSC A;  1L0G A;  3WRT A;  2J3T D;  1STZ A;  3G2Z A;  4JF6 A;  4O01 A;  2VGK A;  1OJ5 A;  3GRJ A;  4KZB A;  3R7W B;  1Y28 A;  3H9W A;  1W63 Q;  1TDG A;  3WS4 A;  2K31 A;  1SKO A;  1YQS A;  4ME4 A;  4Y15 A;  5L10 A;  3E4Q A;  2JBF A;  2WAE A;  3HUN A;  4I3I A;  4CPK A;  3QP5 A;  2I9V A;  3G34 A;  4YFM A;  1WYC A;  2HV1 A;  1FQG A;  3DWK A;  3PBO A;  5KIZ A;  1L2S A;  3LIE A;  2FH5 A;  3T4S A;  5J7E A;  4HJ4 A;  3NDE A;  4Y0O A;  1K4E A;  2VEA A;  3FC7 A;  1E3U A;  1KE4 A;  1FCN A;  2D01 A;  3R4K A;  2Q0O A;  1PZO A;  4S2I A;  2QWS A;  4WZ4 A;  4HBT A;  4QB8 A;  1WE4 A;  5EUA A;  1UWP X;  3EWK A;  4DE1 A;  2ZC7 A;  5CER A;  1LI0 A;  5HDS A;  1GA9 A;  2GX5 A;  2W3H A;  3FWL A;  2XLN A;  5EOO A;  2PYR A;  4OQG A;  2C5W B;  3MBZ A;  3IX4 A;  3EGX C;  3P7N A;  4E3K A;  4OQH A;  3LUQ A;  3MFX A;  4KUO A;  2V2F F;  4L9G A;  1S67 L;  3V3S A;  3Q1F A;  2BAS A;  3LR0 A;  3UE3 A;  3O87 A;  4KZ9 A;  3ISG A;  5MC7 A;  3BFE A;  3DTI A;  4BD1 A;  3BEC A;  2PT7 A;  3QP2 A;  3UME A;  4EBN A;  1D1J A;  3IF6 C;  2QHK A;  4P6Z S;  4OOY A;  4L0L A;  4X68 A;  2E8J A;  3KYZ A;  4R3B A;  3LR4 A;  1PW8 A;  4JKT A;  4CLC A;  3OBF A;  4KQO A;  4RQ9 A;  2WKP A;  1PRQ A;  3W8K A;  5HW3 A;  4ID4 A;  3IXD A;  3GVB A;  3OCL A;  5EVI D;  4HH3 A;  3N6I A;  3VOL A;  4B4Z A;  1GA0 A;  1VET B;  1Z6F A;  3CI6 A;  3H82 B;  5DF8 A;  2DNS A;  2ZC6 B;  3LY4 A;  5F82 A;  3BQA A;  4GS9 A;  2VGL M;  2P7J A;  3UDI A;  1F5M A;  3T12 B;  3C30 A;  4E6X A;  3VE4 A;  1JTG A;  5CEC A;  5HPI A;  5FEF A;  1JWZ A;  4HNB A;  4BMW A;  2JKR I;  4P87 A;  4IJG A;  3A3I A;  3V5M A;  1OJG A;  4MBH A;  5G4Z A;  4FSF A;  3BRM A;  2EWW A;  5CTN A;  3RH8 B;  5M18 A;  2XRO A;  4S2P A;  4G3K A;  5AQ7 A;  4FUW A;  4KQQ A;  5HDD A;  3C5A A;  3MZD A;  4X56 A;  2WKI A;  1T1C A;  3GDI A;  2W3E A;  2VV6 A;  4NK3 A;  5J3W A;  2EFX A;  1FIL A;  4OP5 A;  3JVU A;  3WRZ A;  1YAX A;  3N4I A;  3ZG9 B;  3SH8 A;  3EOI A;  1XA1 A;  4E3M A;  4JXS A;  3VE3 A;  3UE6 A;  3UPN A;  2FFY A;  3RFB A;  4BWI A;  4LGW A;  1CI8 A;  1K56 D;  1TS6 A;  1G6O A;  3O5Y A;  3V39 A;  3BWL A;  4ZRR A;  2H28 A;  5FEG A;  1S1Z A;  4JLF A;  2V1Z A;  4JXV A;  3TG9 A;  2XD5 A;  1LL5 A;  4RX2 A;  2KLI A;  3CPT B;  4WF0 A;  2OAQ 1;  5F5Y A;  1W63 M;  3Q7V B;  1CI9 A;  5IT5 A;  4EET B;  1SKF A;  4OLG A;  3O86 A;  4WL9 A;  5HD5 A;  5HFO A;  2O9B A;  5HD3 A;  3F1N B;  3F1P B;  5BOH A;  3M2K A;  1MBL A;  3OCN A;  1V9Y A;  4RA7 A;  1IKG A;  1PZP A;  3JVV A;  3HL9 A;  1P9W A;  4EWF A;  4ZTK A;  2G2W A;  4D2O A;  3LEZ A;  4MEZ A;  3MSH A;  3MXS A;  4BQM A;  4KZ3 A;  4UQI S;  2JN7 A;  4Y2F A;  1GSW A;  1IEL A;  4UQI M;  2Y2G A;  3C4O A;  4CJN A;  4B4X A;  4FH2 A;  4K08 A;  3CMZ A;  3UB6 A;  3EEH A;  4OLD A;  2C6W B;  2EA9 A;  4X55 A;  1GHM A;  3WS1 A;  4ARZ B;  3W2Z A;  2QZ6 A;  5EFW A;  3AGD A;  4KZA A;  5FAO A;  3ZNY A;  4R23 A;  3KYE A;  5M1A A;  5CGS A;  5HAI A;  3ZHH A;  1MY8 A;  4KZ7 A;  3PYP A;  1XGI A;  3D4F A;  3K2N A;  5FQM A;  4HJ6 A;  5EVI C;  4BBU A;  1XFQ A;  1LSV A;  4DF6 A;  5DF7 A;  5LBR A;  4GCZ A;  3ZNT A;  3HRE A;  2VX8 A;  3UO9 A;  5FI6 A;  2WAF A;  3LIA A;  4N1H A;  3T1S A;  3OZH A;  2QPN A;  4HP4 A;  3DAV A;  1S4S A;  3OPR A;  4R1G A;  1YT4 A;  1FR1 A;  2ZL1 B;  3QP1 A;  4QD4 A;  4UA6 A;  5FAQ A;  5DKL A;  2BTF P;  3LEQ A;  3LIB A;  3NCK A;  2WGW A;  2Y8H A;  4UA7 A;  1IYP A;  3NI9 A;  5FI7 A;  1ONG A;  4EV4 A;  4X1M A;  1LI9 A;  4N9L A;  5J4E A;  1K57 C;  1FIK A;  1S4R A;  4RVA A;  3BM6 A;  4X53 A;  4EUV A;  4KQD A;  5DVA A;  4I38 A;  5DTT A;  1G6A A;  3NBL A;  1YSP A;  4H8R A;  2ZOH A;  1L0E A;  4LRX C;  4PM9 A;  1TS7 A;  3CUE C;  4GB7 A;  4XT2 A;  2ZC5 B;  1J9M A;  5F1F A;  5CX7 A;  2K7S A;  4DKI A;  4DDY A;  3QNB A;  1S1Y A;  3UMD A;  4MMN A;  2A24 A;  4NEE D;  3S7O A;  3BFG A;  2YKH A;  1BUE A;  3IWQ A;  5FAP A;  2A2L A;  1K4F A;  4OON A;  3MKE A;  1XGJ A;  3C7V A;  3N8S A;  3TE8 A;  1QME A;  3TW8 A;  1PNE A;  2W3G A;  1VHM A;  4IED A;  1OTI A;  1N9O A;  3IWO A;  1TD5 A;  2ZQ8 A;  4GZB A;  1BLS A;  3NDG A;  4GDN A;  4QPR A;  3OC2 A;  2L4R A;  2V8C A;  4EEP A;  1KVM A;  2R9X A;  2M7V A;  4LRY C;  1YLP A;  4JF4 A;  3U2A A;  4EQI A;  3PXP A;  4HI4 A;  1LLB A;  3HUM A;  4PHT A;  1MPL A;  3P98 A;  3VSL A;  2QJ7 A;  1E25 A;  2J8Y A;  4DDS A;  3T1X A;  1FOF A;  1YMX A;  1TF1 A;  4GW9 A;  2Y2H A;  2X01 A;  3LCE A;  1H8Y A;  3TJZ C;  5HZH A;  3CAX A;  1BZA A;  4S2M A;  3Q82 A;  3DBA A;  3T50 A;  3HUO A;  5FAS A;  1UGU A;  5DF9 A;  2VK3 A;  4LCL A;  2WZZ A;  4LLO B;  1G68 A;  3BY8 A;  3PR6 A;  1BYW A;  4UEY A;  2VA0 A;  1V9Z A;  2WKE A;  2XH9 A;  4LPZ A;  1MKI A;  2O99 A;  1WYB A;  2ZMA A;  5FQK A;  3W4P A;  5HL6 A;  3C4P A;  4CLC B;  3SZT A;  2ZM0 A;  2W0N A;  1K55 C;  4UAA A;  5F6A A;  2ZM8 A;  3SW1 A;  4B88 A;  1CEF A;  2CMN A;  3S7P A;  2FZ0 A;  2IWD A;  3S4X A;  3EGD C;  3N8L A;  2HJ9 C;  4GS9 B;  2Y4A A;  4H6J B;  1DY6 A;  3PTE A;  1JWP A;  3V67 A;  4DXB A;  5CEB A;  3T1Q B;  4AFI A;  2EXA A;  4C6Y A;  1PYY A;  2B18 A;  2V0W A;  5AQB A;  2EX6 A;  4KG6 A;  3VV4 A;  4QHC A;  4F3L A;  2G2U A;  1NLZ A;  5HAQ A;  3LIF A;  4OPY A;  1M6K A;  2PD7 A;  3I7J A;  2QYB A;  3A3D A;  3G35 A;  4ZJ3 A;  2XGN A;  3HVF A;  1CQA A;  5DJU A;  3IH8 A;  1NZU A;  4HEF A;  2Y2N A;  3PBT A;  1OPX A;  4UA9 A;  2ZMV A;  3GTC A;  3NEC A;  4E6W A;  2Y2I A;  4FOF A;  1TVF A;  2Y79 A;  5E43 A;  1NLY A;  5HWV A;  1ZKJ A;  2HJE A;  5HL1 A;  4PKY G;  1MWS A;  3MZE A;  3ZVT A;  4GHI B;  2PYP A;  5C5K A;  5JYP A;  2Q9N A;  3SH9 A;  1FCM A;  1MWT A;  5FQI A;  1LL8 A;  1U60 A;  4MDZ A;  3C7U A;  1PWD A;  3DTK A;  4KEN B;  1O07 A;  3PBS A;  3MR0 A;  3NHQ A;  3FPW A;  2XEP A;  2HP5 A;  4YIN A;  3ZG5 A;  3UDF A;  1W8Y A;  2OLU A;  3B47 A;  1LT0 A;  1ONH A;  1H3Q A;  3H7W A;  2VGJ A;  4QJG A;  2HGV A;  3HLW A;  4NG2 A;  3D3O A;  2O0Y A;  4XUZ A;  4N9K A;  5TR7 A;  3LGO A;  1Y4O A;  3OOV A;  4OOM A;  1LHY A;  3FG8 A;  1T1B A;  3FKV A;  3HJI A;  4X25 A;  3UE0 A;  2PU4 A;  4UHU A;  4EBP A;  5TJJ A;  4KUK A;  4P0M A;  3MQO A;  1YPR A;  4JF5 A;  4OOL A;  1VM1 A;  2H0T A;  1YMS A;  5AQA A;  3UB5 P;  4U0T A;  4R4R A;  1ESU A;  3ITA A;  5EOE A;  4DE3 A;  3BYD A;  1L0F A;  5DKK A;  1NRF A;  4JGO A;  4BL3 A;  4NXF A;  4OKP A;  2M7U A;  5EE8 A;  3E4P A;  2ZBB A;  4ZAM A;  2VGL S;  4WMC A;  3IS2 B;  2BG1 A;  3LYX A;  4H6J A;  4EQ1 A;  5M19 A;  3KSH A;  1N9L A;  5FQ9 A;  2RL3 A;  3CZD A;  1ERQ A;  4IBR A;  1HZO A;  1XXM A;  4PPR A;  4X69 A;  1BTL A;  1I2S A;  4WYY A;  3IHB A;  3PAE A;  1XJ2 A;  5AJG A;  5GLC A;  1A0K A;  4E3J A;  1KGE A;  2HP6 A;  3BFF A;  1O7E A;  2Y2J A;  2NUT C;  5CGX A;  4IBX A;  1I2W A;  3QP4 A;  2L0W A;  4PM6 A;  2JCH A;  5F83 A;  1YLZ A;  4GDB A;  1K6S A;  4MN6 A;  3E2K A;  5TBM A;  4N92 A;  3BFD A;  1OT9 A;  1HLU P;  3FV7 A;  3D72 A;  1KDW A;  1ES3 A;  5FA7 A;  2R78 A;  3E2L A;  1F2K A;  4GHI A;  2HF6 A;  4EW7 A;  2P74 A;  1MWU A;  3IHA A;  1IOU A;  1KE0 A;  2HDR A;  3IBJ A;  4DRT A;  1ES4 A;  1YLW A;  2WGW B;  4QY5 A;  5EPH A;  3ZGA B;  2R9W A;  2HP9 A;  4FH4 A;  1E4D A;  5DFY A;  3LI9 A;  2EX9 A;  4E3L A;  1TDL A;  4L9E A;  1NWZ A;  3FKW A;  3LID A;  3OPP A;  1CEG A;  1PI5 A;  2XR0 A;  1Q2Q A;  3M6B A;  4R3A A;  3G4P A;  2WYX A;  4OPR A;  3O88 A;  2W1T A;  3RXX A;  2GJ3 A;  3UB9 A;  4S2J A;  5F68 A;  4XT2 B;  3V3R A;  1OT6 A;  3LY3 A;  2VKS A;  5E2H A;  2EFU A;  3IX3 A;  2GDN A;  2RCX A;  5F1G A;  1VEU A;  4PMA A;  2W1R A;  5CHU A;  4C3Q A;  3PBN A;  3IXG A;  4QY6 A;  2A24 B;  4GLQ A;  3CHW P;  1DJC A;  1XJ6 A;  1NYM A;  3VOZ A;  4Y5F A;  3WWX A;  1HD8 A;  2HDU A;  2K2N A;  5KZH A;  3A3J A;  3SS4 A;  2Y91 A;  4I3A A;  3BLS A;  4PKY A;  1IYO A;  2PDR A;  2XK1 A;  4LV0 A;  1IYQ A;  1ES2 A;  5TGF A;  1MC0 A;  1F9I A;  4QWO A;  3IS2 A;  4X6T A;  2ZQA A;  5FI2 A;  3T1R A;  1G5U A;  3W4Q A;  3DWZ A;  4Q8I A;  3T4O A;  4OH0 A;  3M2J A;  4GOG A;  3NIA A;  4DJ3 A;  3KSI A;  3CJM A;  5HAR A;  5CGW A;  4MNR A;  4KZ8 A;  3PBQ A;  2PR5 A;  3LFV A;  1KGG A;  2EWV A;  3G2Y A;  2O9C A;  2H5S A;  1NY0 A;  3F1O B;  3CLO A;  3BEB A;  3ZCZ A;  2XFS A;  4ETZ A;  5EM0 A;  3Q07 A;  2OWH A;  5EVL A;  4HQA A;  1Q2P A;  3CIT A;  4R38 A;  1DP8 A;  1MZU A;  1YLJ A;  3LR5 A;  3GSG A;  2Q9M A;  2UWX A;  2Y59 A;  3WS5 A;  5HPF A;  1H8M A;  4C75 A;  1IFQ A;  5AVE A;  1MWR A;  2ZC4 B;  2EX2 A;  1KGF A;  1TS8 A;  1FCO A;  3HLF A;  5EVI A;  5L09 A;  2XFT A;  3PHY A;  1XP4 A;  2NUP C;  4DE2 A;  2HDQ A;  2XF3 A;  1FSW A;  1E3U D;  1IYS A;  4JGP A;  3IBR A;  3SS5 A;  4YWZ A;  4Y0T A;  1PI4 A;  2QMI A;  5DJT A;  1K54 C;  3MKF A;  3B3X A;  4LEN A;  2EX8 A;  1PWG A;  3IXH A;  4P6B A;  3T4Q A;  1S0W A;  5EV0 A;  5HSQ A;  3CG5 A;  4WM9 A;  4F3L B;  1DJA A;  2XA7 M; 
#chains in the Genus database with same CATH homology
 3VOL A;  1LSW A;  3CI6 A;  3H82 B;  4AFI A;  2B18 A;  2V0W A;  2XRN A;  2V9A A;  1NRJ A;  2QKP A;  3VV4 A;  3MF0 A;  4F3L A;  3BQA A;  4GS9 A;  1NLZ A;  4IUH A;  5HDC A;  2VGL M;  3LIF A;  4ETX A;  2P7J A;  2PD7 A;  3H82 A;  1F5M A;  1OTB A;  2DMW A;  3BW6 A;  3C8C A;  2QYB A;  3C30 A;  3VE4 A;  3S7N A;  3A0R A;  1D06 A;  5DJU A;  2V1A A;  5HPI A;  1T1A A;  2V0U A;  3PBT A;  5G4Y A;  2QJ5 A;  5IU1 A;  4HNB A;  3CUE A;  4BMW A;  1OPX A;  2JKR I;  4IJG A;  4NXB A;  4BBV A;  4CLC D;  4Q0I A;  2ZMV A;  1XFN A;  3EQV A;  1OJG A;  3MJQ A;  4WEL A;  5G4Z A;  4FSF A;  1T18 A;  1GSV A;  2EWW A;  4Q0J A;  4FOF A;  3RH8 B;  3K3D A;  2XRO A;  3G6O A;  2Y79 A;  4G3K A;  2PR6 A;  1NLY A;  2OAP 1;  3C38 A;  5HWV A;  2HJE A;  3C2W A;  5HDD A;  1G28 A;  2JKT M;  4PKY G;  3UB8 A;  4BBT A;  1ZTU A;  2LB5 A;  1T1C A;  1N9N A;  3MXQ A;  3GDI A;  2PYP A;  4GHI B;  2W3E A;  2VV6 A;  5C5K A;  5J3W A;  3F1O A;  4DMZ A;  3JVU A;  1LL8 A;  1YAX A;  3KYQ A;  2VV8 A;  4MDZ A;  1X0O A;  3EOI A;  1UWN X;  3VE3 A;  3PBS A;  3H7W B;  2L1M A;  3UE6 A;  2LB9 A;  3MR0 A;  3MMH A;  3NHQ A;  3FPW A;  3RFB A;  4BWI A;  4HIA A;  4BJP A;  3T4J A;  4MCW A;  3A0V A;  1TS6 A;  1G6O A;  3K3C A;  4EES A;  3ZYT A;  2VLG A;  3O5Y A;  3B47 A;  1LT0 A;  5DFX A;  1H3Q A;  3H7W A;  5A8B A;  1XJ3 A;  3BWL A;  2W3D A;  4ZRR A;  4WEJ A;  2HGV A;  2H28 A;  1S1Z A;  3D3O A;  2O0Y A;  4HOI A;  2M1C A;  2KLI A;  4HHD A;  2PD8 A;  4I39 A;  3OOV A;  4EEU A;  4OOM A;  3KX0 X;  4WF0 A;  3FG8 A;  1T1B A;  2OAQ 1;  5F5Y A;  1W63 M;  5IT5 A;  4EET B;  3HJI A;  3ULF A;  4PAU A;  4WL9 A;  2W3F A;  1DP9 A;  5HD5 A;  5TJJ A;  2O9B A;  4KUK A;  5HD3 A;  3F1N B;  3MQO A;  4OOL A;  3F1P B;  1DRM A;  2J3W A;  4HJ3 A;  2XA7 S;  4WLA A;  3OCN A;  1D7E A;  1V9Y A;  4O8G A;  3E98 A;  3JVV A;  1P9W A;  5DKK A;  2WKQ A;  4LRZ E;  3F1N A;  4JGO A;  3MQ0 A;  4NXF A;  3F1P A;  2GNX A;  2M7U A;  3LR3 A;  3E4P A;  2ZBB A;  4UQI S;  3S7Q A;  2VV7 A;  2JN7 A;  2VGL S;  4Y2F A;  3IS2 B;  1GSW A;  3CWF A;  3LI8 A;  3LYX A;  4UQI M;  4H6J A;  4EQ1 A;  4GJ4 A;  4NXG A;  3KSH A;  1N9L A;  4EU0 A;  4K08 A;  2G7U A;  3MQQ A;  2J80 A;  3TRC A;  3UB6 A;  3EEH A;  1P9R A;  3E4O A;  2EA9 A;  2MJ6 A;  4ARZ B;  3W2Z A;  4YNR A;  2Z6D A;  1TS0 A;  1XJ2 A;  5AJG A;  5EFW A;  1OTA A;  3OLO A;  5TBM B;  5K5B A;  1DP6 A;  2NUT C;  3NOU C;  4ARZ A;  3PYP A;  1JNU A;  3K2N A;  4HJ6 A;  2L0W A;  1OTD A;  4BBU A;  3NOT C;  4DN0 A;  1XFQ A;  4M4X A;  4G3W A;  1LSV A;  3GEC A;  3KSG A;  4MN6 A;  4MN7 A;  1ODV A;  5TBM A;  3T4T A;  5LBR A;  4GCZ A;  1OT9 A;  1YKD A;  3E0Y A;  1LSX A;  5KSH A;  4II7 A;  2VX8 A;  3D72 A;  2OOL A;  5HWW A;  2R78 A;  1YSQ A;  3LIA A;  1KOU A;  4GHI A;  2HF6 A;  2ZMF A;  4EW7 A;  4HP4 A;  1S4S A;  1IOU A;  2XSS A;  1S66 L;  3BY9 A;  1OTE A;  3IBJ A;  4IHQ A;  2ZOI A;  4YOF A;  4CLC C;  5DKL A;  5DFY A;  3LI9 A;  2W27 A;  2INW A;  2W1T B;  4HH2 A;  4L9E A;  4E04 A;  1NWZ A;  3ZQ5 A;  3LIB A;  3LID A;  2Y8H A;  1ZHH B;  4HP9 A;  2YKF A;  4I5S A;  4EER A;  4R3A A;  1VB6 A;  4O0P A;  5J4E A;  3NJA A;  1S4R A;  3V67 A;  4Z1W A;  3P01 A;  2W1T A;  4EUV A;  2JKR M;  3B33 A;  5IS1 A;  2KX6 A;  4DJ2 A;  2GJ3 A;  4I3J A;  4KQD A;  3UB9 A;  2OWJ A;  5F68 A;  2GZA A;  4XT2 B;  4B93 A;  1OT6 A;  4I38 A;  4Q0H A;  2B02 A;  3KO6 A;  2VKS A;  5HWT A;  5L8M A;  1XJ4 A;  1YSP A;  2JKT I;  2PHY A;  2ZOH A;  4LRX C;  2W1R A;  1TS7 A;  2P04 A;  3PBN A;  3CUE C;  1F98 A;  3HJK A;  2A24 B;  5F69 A;  4GLQ A;  4JGQ A;  4XT2 A;  4P6Z M;  4EXO A;  3BQ8 A;  1XJ6 A;  4IUK A;  4Y5F A;  2V1B A;  4WUJ A;  3KSF A;  3ICY A;  5CX7 A;  2K2N A;  2K7S A;  3NOP C;  4I3A A;  3EEA A;  4CQH A;  5AVF A;  4WN5 A;  1S1Y A;  3UMD A;  4MMN A;  1P97 A;  2A24 A;  4NEE D;  3S7O A;  3T4L A;  4PKY A;  2JHE A;  2PDR A;  2J3T D;  2YKH A;  1MC0 A;  1STZ A;  1F9I A;  3IS2 A;  2A2L A;  4O01 A;  1WA9 A;  3T4O A;  3TE8 A;  2KOI A;  3TW8 A;  2W3G A;  1VHM A;  1OJ5 A;  1OTI A;  1N9O A;  1TD5 A;  1T19 A;  3R7W B;  1Y28 A;  3H9W A;  4QPR A;  1W63 Q;  3OC2 A;  4HY8 A;  4DJ3 A;  3KSI A;  2L4R A;  2K31 A;  4ME4 A;  3PBQ A;  4EEP A;  2PR5 A;  3E4Q A;  2M7V A;  4I3I A;  4LRY C;  2I9V A;  3LFV A;  2EWV A;  2HV1 A;  4B9O A;  2O9C A;  2VZW A;  3R7W A;  3U2A A;  3PBO A;  3PXP A;  4NXE A;  5KIZ A;  2VJW A;  3HCY A;  3LIE A;  4HI4 A;  2FH5 A;  3F1O B;  3T4S A;  4HJ4 A;  5J7E A;  4PHT A;  3CLO A;  2QJ7 A;  2VEA A;  3FC7 A;  4R70 A;  3B42 A;  2D01 A;  4R6L A;  4ETZ A;  2IA2 A;  3R4K A;  1TF1 A;  4GW9 A;  2QWS A;  4WEK A;  2OWH A;  3BJN A;  4HQA A;  2J3T C;  1P0Z A;  3EQU A;  4MN5 A;  3TJZ C;  3CIT A;  5HZH A;  3CAX A;  4R38 A;  1UWP X;  1DP8 A;  3EWK A;  1MZU A;  3A0S A;  3DBA A;  3T50 A;  5HDS A;  2GX5 A;  1EW0 A;  2W3H A;  1UGU A;  5DF9 A;  3LR5 A;  2O9A A;  2PYR A;  5I5L A;  1GSX A;  4LLO B;  3UB7 A;  3EGX C;  5HPF A;  1H8M A;  3P7N A;  1IFQ A;  5AVE A;  2Z6C A;  3BY8 A;  2WKR A;  1TS8 A;  3LUQ A;  3MFX A;  3PR6 A;  4KUO A;  1BYW A;  2KDK A;  4L9G A;  1S67 L;  3PHY A;  4UEY A;  2VA0 A;  2NUP C;  3PBR A;  5FL3 A;  1V9Z A;  4LPZ A;  2BAS A;  3RTY A;  3LR0 A;  3UE3 A;  4JGP A;  4JGR A;  2O99 A;  3IBR A;  3FPV A;  5MC7 A;  2PT7 A;  3UME A;  4YWZ A;  4NKP A;  5HL6 A;  4L9F A;  5DJT A;  4CLC B;  4CLC E;  2W0N A;  2QHK A;  2P08 A;  4P6Z S;  4Y3I A;  4L0L A;  5F6A A;  3KYZ A;  3SW1 A;  3T4Q A;  3LR4 A;  1MKM A;  2CMN A;  3S7P A;  2FZ0 A;  3LIC A;  5HSQ A;  4CLC A;  3EGD C;  4G3V A;  3OBF A;  4KQO A;  4RQ9 A;  2WKP A;  4F3L B;  3T4K A;  2HJ9 C;  4GS9 B;  2XA7 M;  4H6J B;  3OCL A;  2D02 A;  4HH3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...