1N9NA

Crystal structure of the phot-lov1 domain from chlamydomonas reinhardtii in illuminated state. data set of a single crystal.
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
108
structure length
108
Chain Sequence
b'LRHTFVVADATLPDCPLVYASEGFYAMTGYGPDEVLGHNCRFLQGEGTDPKEVQKIRDAIKKGEACSVRLLNYRKDGTPFWNLLTVTPIKTPDGRVSKFVGVQVDVTS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords putative blue light receptor
molecule tags Electron transport
source organism Chlamydomonas reinhardtii
publication title Crystal Structures and Molecular Mechanism of a Light-Induced Signaling Switch: The Phot-LOV1 Domain from Chlamydomonas reinhardtii
pubmed rcsb
total genus 29
structure length 108
sequence length 108
ec nomenclature
pdb deposition date 2002-11-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13426 PAS_9 PAS domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 1n9nA00
4M4XA 2W27A 3LUQA 1S67L 1S4RA 1OTBA 3MQOA 4HH3A 5HWTA 3ULFA 5G4ZA 2HV1A 4NXBA 2OWHA 3CWFA 3FC7A 3ICYA 3A0SA 1DP6A 4KUOA 1DP8A 1LT0A 1T1BA 4HIAA 4XT2B 4EERA 3F1PA 1G28A 1S1ZA 2QKPA 3BY9A 3F1OB 2QHKA 1TS8A 2EA9A 3EEHA 3E4PA 4GS9B 4HH2A 5G4YA 1S4SA 3PHYA 2WKRA 2D02A 3LIBA 4GHIA 5AVEA 4I38A 1VB6A 3NJAA 5TBMA 1DP9A 5DKLA 1V9YA 2V0UA 1XJ2A 5J4EA 2Z6DA 4HP9A 2WKQA 1WA9A 4R3AA 4H6JA 3F1NB 3BY8A 3LI8A 4HY8A 1UWPX 3IS2A 3LI9A 2R78A 4WN5A 4GW9A 4HP4A 4WL9A 4DJ2A 4F3LA 4L9GA 2GJ3A 4WUJA 2WKPA 5DJTA 2PHYA 4HNBA 1OJGA 2PR6A 3G6OA 3MQQA 3C8CA 1XJ3A 3LIDA 4NXFA 4LRZE 4MN5A 1F9IA 3K3DA 4LRYC 3MJQA 4EESA 3A0VA 4K08A 4JGOA 4L9EA 1F98A 2PYPA 4LRXC 2VV7A 2ZOHA 4BBVA 4EW7A 3KX0X 2V9AA 4KUKA 2OOLA 2VLGA 4RQ9A 4EQ1A 5A8BA 1XJ4A 2A24A 2QJ5A 4HJ4A 4NXEA 3IBRA 2V1AA 2PD7A 2B02A 1UGUA 4H6JB 3UB6A 3SW1A 3GECA 4HI4A 3UB8A 5HWVA 3MFXA 4LPZA 1XJ6A 2A24B 2J80A 1KOUA 5HD5A 2JHEA 1UWNX 3HJKA 1T18A 4GHIB 1X0OA 2PD8A 3C2WA 3NOTC 4R70A 1T1CA 4EETB 5DJUA 1P97A 1OTAA 2PDRA 3LICA 4GS9A 1ODVA 1XFNA 2YKFA 1D06A 1GSXA 4HJ6A 4PKYA 3MR0A 3F1OA 3UMDA 3E4OA 2VV8A 3F1PB 4I5SA 5HZHA 4XT2A 5IS1A 5F68A 4I3AA 4F3LB 3A0RA 3CAXA 3K3CA 4HJ3A 3B33A 2QJ7A 3IS2B 2W0NA 1OTIA 2KX6A 4I3JA 2H28A 3VE3A 3LIAA 2L1MA 3F1NA 5I5LA 1N9OA 3MXQA 4BBTA 4E04A 5J3WA 1EW0A 1NWZA 4R6LA 5F6AA 5HWWA 4WF0A 4WLAA 5F69A 5TBMB 3NHQA 4KQDA 3UB9A 3UB7A 2KDKA 4EXOA 3EWKA 2VV6A 1D7EA 2I9VA 1S1YA 3T50A 3OLOA 5DKKA 4BBUA 3ZQ5A 4MN6A 3H82B 4NXGA 1Y28A 3P7NA 1GSVA 5HDSA 1LSXA 4HHDA 3BWLA 3RH8B 2VEAA 2JN7A 2V0WA 3NOUC 2L4RA 1OTDA 2YKHA 4JGRA 1GSWA 5KIZA 1BYWA 2D01A 2L0WA 2V1BA 3CLOA 3PYPA 5EFWA 5HD3A 1OT9A 1N9LA 3H7WA 3UMEA 2INWA 4EEPA 3NOPC 3RTYA 2BASA 1S66L 2PYRA 4HOIA 2P7JA 5HDDA 3VOLA 3VE4A 4DJ3A 2M1CA 4JGPA 5HDCA 5IU1A 2OWJA 4GCZA 1V9ZA 3H7WB 3LYXA 3UE6A 3HJIA 3LIEA 1MZUA 1N9NA 1XFQA 2QWSA 1TS0A 2ZBBA 4PKYG 4R38A 1P0ZA 3D72A 1TS7A 3E4QA 4I39A 1LL8A 1T1AA 3H82A 3H9WA 4LLOB 1JNUA 4YWZA 3LIFA 4EEUA 4B9OA 2ZOIA 3GDIA 4HQAA 2CMNA 4I3IA 2PR5A 4JGQA 1LSVA 1OJ5A 1OT6A 1TS6A 5HSQA 5F5YA 5AVFA 2K7SA 2Z6CA 3FG8A 5J7EA 1OTEA 1DRMA 1LSWA 1T19A 4L9FA
chains in the Genus database with same CATH superfamily
5FAOA 1K25A 1S67L 3MQOA 4HH3A 5G4ZA 2HV1A 1ALQA 3BFFA 1K54A 2WGWA 1KDSA 3QP1A 2WGVA 3QNCA 1ACFA 2UWXA 4DN0A 3VSLA 4GHIA 1I2SA 4GD8A 3OOVA 5J4EA 2JKRM 3LEZA 1E25A 3V5MA 5FDHA 4OQGA 3LO7A 4EV4A 2PHYA 4ARZB 3BEBA 4X1MA 3N8RA 4RQ9A 1VM1A 4FTXA 2ZQ9A 4HBUA 3GECA 1K4FA 1XJ6A 2ZC3B 4FCFA 2J80A 1TEMA 2A3UA 3CI6A 1X0OA 3NOTC 1T1CA 1XKZA 2JKTI 2VZWA 4CQHA 3CMZA 3IS2B 2Y2QA 2O0YA 3F1NA 5I5LA 1N9OA 2ZLYA 5EECA 4P0MA 2KOIA 4PM5A 3MKEA 3MZDA 2I9VA 3IXGA 1IELA 2ZMAA 4NXGA 1ONHA 5HDSA 3NOUC 2L0WA 4FSFA 4EBPA 4LV2A 3JVUA 5TJJA 2W3DA 1IYQA 4KZ7A 3TE8A 3UE3A 4RX2A 4Y0OA 3B3XA 4PM9A 2H10A 4Y0TA 4QU3A 3GDIA 3CPTB 2Y2IA 1KGGA 1L2SA 5HSQA 3FG8A 1K38A 2Y2OA 3LUQA 1OTBA 4UA9A 5EUAA 1KDWA 1GCEA 4WYYA 2WK0A 3Q82A 2VKSA 4B4XA 2DNSA 3E4PA 2ACGA 2PBYA 3NJAA 4EUZA 2X02A 4UEYA 1NZUA 2NUPC 5F82A 5KZHA 4PM8A 2BLSA 3HREA 5CEDA 3LI9A 4WN5A 5L10A 1H5XA 4G3KA 5GHXA 3EGDC 4JKTA 2Y2PA 4LRXC 2XGNA 4WMCD 5A8BA 3WRTA 4NXEA 1XGIA 3U4LP 2ZC4B 4DE2A 2H5SA 4K0WA 4OPQA 5GLCA 1NRJA 3W4QA 2XEPA 4OQ0A 5HD5A 4KZ4A 4PAUA 3F1PB 4X6TA 1JWVA 5GLAA 2EFUA 1ONGA 1O07A 3OCNA 3PR6A 2GZAA 4NG2A 1MWSA 3UN7A 1LL5A 3ITBA 4KZ5A 3DTEA 3H82B 2VEAA 5M19A 2INWA 2PRFA 4DE1A 1SKOA 3ZG0A 3OPPA 2Y79A 3S7QA 1GA0A 5AQAA 2R9XA 3T4OA 1TS7A 3T4SA 4ETXA 4WEJA 4X55A 5C5KA 4ESPA 4Y7PA 1LSVA 2ZL1B 1TDGA 3ZFZA 2Z6CA 1QMEA 4N92A 3MFDA 4UAAA 3ICYA 5HFOA 1FQGA 3IX4A 5FEGA 2P74A 4WM9A 4R0QA 2RL3A 1S0WA 3RJUA 4KZ9A 3V3RA 2QPNA 2VGLM 3K3DA 4LRYC 4FUWA 4QY6A 3FPVA 3P98A 3HUMA 3PXPA 5EE8A 1RP5A 2Z2LB 4IJGA 4N1XA 3TG9A 5HAIA 5GLDA 1JWZA 4JXSA 5DJUA 1RCJA 3MR0A 2V8CA 3EQUA 3T1RA 4NEED 2EWVA 4S2IA 2ZQ8A 3FWLA 4BBTA 3IF6A 3A3DA 3R7WA 4KQDA 3S7OA 5M1AA 3C38A 4OQIA 3OLOA 4Q0IA 5J8XA 2JKGA 2LB9A 5DTKA 1DJAA 2QMIA 3VP2A 1OTDA 2D01A 1XGJA 1K4EA 3O88A 4G3VA 3EQVA 2VGJA 3G2YA 2PAVP 2EXAA 4ME4A 3KSIA 2XD5A 1N9NA 2EWWA 3TJZC 1S6RA 1CF0A 4BMWA 3IT9A 4Z1WA 2PR5A 5CECA 2K7SA 4EBLA 3ZG9B 4YINA 1YM1A 5DFXA 1VEUA 4FH4A 4IVIA 2EX8A 1GA9A 3PAGA 3QP8A 2O99A 4RA7A 5DKLA 3R7WB 3IF6B 2WKQA 1Q2PA 4L0LA 2B5RA 4OOMA 4NXFA 1PIOA 3SH8A 4EWFA 2J8YA 2FFFB 4OKPA 3E0YA 1ZKJA 2XLNA 4Y0UA 3JVVA 3HVFA 4BENA 3N8LA 2WGIA 4RVAA 1YLZA 4R70A 1P97A 1OTAA 1FCMA 1QMFA 1IFQA 2C5WB 5M18A 1K0KA 3OZHA 4U3TA 4ZJ1A 5EVIA 1BTLA 2QYBA 4II7A 4DE0A 2O9BA 5EVLA 3OPHA 3BFEA 2J3TD 4RYEA 2HF6A 4OP8A 1XP4A 4F94A 3PBNA 1MWUA 4H8RA 3UDFA 2XA7M 3RXWA 5HDDA 3TRCA 1MZUA 1YSPA 3LR3A 4OOLA 5HARA 4CLCE 4OLDA 2CMNA 3ZG7B 1OJ5A 1OT6A 3V3SA 3UDXA 4UA6A 5AVFA 3M6HA 1SKOB 3MXQA 4E04A 4L9FA 1S4RA 4N9LA 4NXBA 2VX8A 4PM7A 3FC7A 1DJCA 3VP4A 4UA7A 3P09A 1IKIA 1FR1A 2J3WA 5KMWA 3MXSA 2UV0E 4HH2A 3T4KA 4C6YA 2IWDA 2HP6A 5FSRA 5FQIA 3LCEA 2WADA 2P04A 3PTEA 5EOOA 1KE3A 1YAXA 2R78A 1SDNA 3OPLA 4QD4A 5L09A 2Y2GA 3MJQA 3D9YA 3S4XA 4GDNA 4KQQA 3BFGA 5TGFA 1ES3A 3UB8A 3HLBA 3NIAA 5GHZA 3A3EA 3HUOA 1ODVA 2JKRI 3EEAA 4E3LA 4XT2A 4E3JA 4IVKA 2FFYA 4CLCB 2HPBA 2PBDP 3OBFA 3VE3A 1TDLA 3AGDA 3GVBA 4Y15A 3NHQA 2KDKA 2W3EA 5FASA 3MXRA 1BSGA 4QHCA 3P7NA 5DF8A 3BWLA 3KSFA 5A92A 1F5MA 4C3QA 3H7WA 5CXWA 5JYPA 1MBLA 4QB8A 3V39A 4JGPA 2OWJA 4X53A 3BQ8A 2KLIA 1L0FA 4DDYA 2HP5A 3CPTA 1YT4A 2DRWA 4I39A 1T1AA 4EEUA 2ZQCA 3C30A 1XA7A 3QNBA 1LI9A 5A90A 5FI7A 3T4JA 2OWHA 1STZA 2HJEA 1PW8A 3PBRA 3WRZA 3GTCA 1G28A 4LV3A 2D02A 1VB6A 1D1JA 2WUQA 3HLCA 3F1NB 1NY0A 3IS2A 2ZC6B 4HP4A 2PR6A 3CUEC 3LIDA 4EU0A 3M2KA 2XA7S 1BLCA 4EESA 5AJGA 3MS6A 4K08A 1HLUP 5E2EA 5F83A 1NYMA 4GZBA 3SW1A 4E3IA 4NK3A 5L07A 1BUEA 4MEZA 5FQ9A 4PKYA 4ARZA 4GS9A 5G18A 4DMZA 3ZDJA 3V67A 3K3CA 3IXDA 3UDIA 1HZOA 2W0NA 3PBTA 3ZG5A 4B4ZA 1CEGA 5AQ9A 5F69A 1TF1A 1YLYA 1Z6FA 1YLPA 4BBUA 4MN6A 2WGWB 2JN7A 3BECA 3GSGA 3CLOA 3PYPA 2Y2LA 5HD3A 3BJNA 3ZYTA 3VOYA 1KVLA 4S2NC 3SS5A 5IU1A 5CGWA 4QWOA 1MXOA 4WZ5C 4LENA 4IBXA 3NC8A 4LLOB 1BLPA 1ES2A 2EXBA 3A0SA 1DP8A 4HIAA 3F1OB 1N4OA 1CQAA 4UQIS 1BLSA 4X68A 3GMWA 3HLEA 4FD8A 3KYZA 1PFLA 5K5BA 5TBMA 2HP9A 3IHAA 2P08A 4R3AA 1LI0A 4Y13A 3UE1A 1Y4OA 3P01A 1A0KA 4LRZE 1F9IA 2OAP1 4MN5A 1NRFA 3A0VA 2Q9MA 4Y17A 4KUKA 3KYEA 2ZQAA 5EVID 1Q2QA 3NY4A 2B02A 4H6JB 5FQMA 4GLQA 1ES5A 2VGKA 1FILA 4JLFA 1ERQA 4EETB 3HBRA 1VETB 2WAEA 3E98A 4I5SA 5HZHA 1L0DA 2B95A 5U47A 3SOIA 3A0RA 4OLGA 1W79A 4DF6A 1PRQA 3QP4A 4N9KA 3A3FA 1PWCA 1K55C 4GN2A 5F6AA 5HPFA 5FAQA 3VSKA 4PPRA 1VQQA 1H3QA 3IH8A 3W4PA 1G68A 1FR6A 4KZ6A 3ZHHA 1U60A 2A2LA 2HDSA 3DW0A 1BYWA 3G4PA 4LCMA 3FKWA 4EEPA 3DWZA 2V2FF 3N7WA 4GCZA 2XR0A 4R38A 4JPMA 2ZOIA 4GOGA 1K6RA 5LBRA 5L8MA 2VGLS 4QPRA 2Y91A 3SZTA 2RCXA 5EV0A 1YLTA 2G2WA 2I72A 4R1GA 3LR0A 4JXVA 1FIKA 1HTZA 5G4YA 1S4SA 1MC0A 3E2LA 1E4DA 1V9YA 4HP9A 1K57C 4Q0HA 3LR4A 4E3NA 4HY8A 5FEFA 5DJTA 2M7UA 3VFFA 1FCOA 3C8CA 1XJ3A 5EOEA 1G6AA 1MPLA 5AQ7A 1FSWA 2V1AA 1W63Q 1M6KA 2BG1A 3K2NA 1KVMA 4U0XA 3LICA 1LHYA 2X01A 3Q7VA 3EGXC 3GRJA 4R6LA 3ITAA 1SCWA 4EXOA 2GNXA 4JXGA 3T50A 3VFHA 3LFVA 4FOFA 5FQQA 4MBHA 4ID4A 4LV1A 2Y4AA 1GSVA 4KQRA 3ISGA 3RXXA 3T1XA 3NDGA 2WAFA 5CTMA 1ZG6A 2IA2A 4GKUA 3UPPA 1BZAA 4QY5A 3OCLA 3E4QA 4YWZA 2Y59A 4CLCD 2O9CA 1H8ZA 4JF4A 2X71A 2W27A 2G7UA 2Q9NA 3MZEA 1JWPA 1YPRA 3JYIA 4FH2A 4X25A 4KUOA 4S2MA 5FDSA 1ZHHB 3EEHA 5CEBA 4S2OA 4IUKA 3PHYA 2WKRA 3IH9A 1ES4A 3LIBA 1FSYA 1K56D 4QJGA 4LGWA 5E2FA 5TR7A 1UWPX 2WKPA 2ZQDA 3NBLA 3WS5A 1W7FA 4OQHA 4BD0A 4GB7A 4UQIM 3UE0A 3DTIA 1UGUA 5HWVA 4DDSA 4XUXA 5E2HA 4C75A 1YMXA 1GSXA 1PYYA 1IYPA 3CAXA 3DBAA 4OPZA 1OTIA 2WKIA 2XROA 4P85A 4LFUA 4P87A 5DF7A 2K2NA 3UB7A 1H8YA 4XXRA 3UMEA 2W1RA 2YKHA 4KENB 3CJMA 4U0TA 3W8KA 1MKIA 1O7EA 2PYRA 1IEMA 2P9VB 4ZTKA 1ERMA 3N6IA 4S2NA 1XFQA 2ZBBA 4MMNA 4PKYG 2WZXA 4HQAA 4LV0A 4OP5A 4K91A 5BOHA 2XD1A 1SHVA 4OVDA 4O0PA 3DTKA 3A3IA 5CRFA 4JF5A 4O7DA 4R4SA 3C7VA 4E3OA 5CHUA 2WKEA 4CPKA 3IX8A 1PWDA 4K0XA 2DMWA 1BT5A 3G34A 3IQAA 3SS4A 4H6JA 3HCYA 1TD5A 3Q07A 3R4KA 4DRTA 4E3KA 2W3FA 4G3WA 2J9OA 4E6WA 1OJGA 1WYCA 2VJWA 3MQQA 3IF6C 3LY4A 4L9EA 5D3OA 2PYPA 3T1QB 4A5RA 4EUVA 1ESIA 1L0EA 2J9PA 5DTSA 3C7UA 3T12B 1CI9A 3M6BA 5GHYA 4ETZA 1NLZA 3MFXA 2Y2JA 5GL9A 4P6ZM 5IT5A 1UWNX 1GHIA 1F2KA 3BW6A 3F1OA 3CHWP 2VV8A 1P9RA 4F3LB 3B33A 3U2AA 2IWBA 4I3JA 3LIAA 1IYOA 5EVIC 5KSHA 3Q81A 2LB5A 2EFXA 2A49A 4KZAA 3T4LA 2H0TA 1KE4A 2E8JA 2V1BA 5CHJA 3QP2A 2BASA 1S66L 1MY8A 5HDCA 3Q7ZA 3M2JA 2EX6A 5HAQA 4S2KA 1E3UD 1PZOA 1KE0A 3I7JA 1JNUA 3PBOA 3LIFA 1WYBA 4KG2A 5DFYA 3DAVA 4JGQA 1XPBA 1OTEA 2XRNA 3VP0A 3QHYA 2Z2MB 4ZJ3A 2W1TA 1MWTA 5JYOA 1FCNA 3BY9A 3G30A 4GS9B 4I38A 2OLUA 4Q0JA 4BL2A 2V0UA 3IWIA 5F1GA 3O87A 4AFIA 1K56A 3IWQA 1K57A 3DWKA 2O9AA 3LEQA 1K55A 4BD1A 3VP1A 5F1FA 3GQZA 3FPWA 4LCLA 2Y2MA 3FYZA 5IHVA 2A24B 2PDRA 2XH9A 3UMDA 3VV4A 4I3AA 3OC2A 3UPOA 2C6WB 5J3WA 1KGFA 4WF0A 4S2JA 3FV7A 3EWKA 4S2LA 3HLFA 4MBFA 3LR5A 3G31A 3PBQA 3UPNA 3WS0A 2ZD8A 2W3HA 3RH8B 5FAPA 2OAQ1 3MBZA 1ESUA 2XK1A 4KG6A 4MDZA 3NOPC 2P7JA 4DJ3A 3MSHA 1YLWA 1ZG4A 3H7WB 1MWRA 3LIEA 2PT7A 1P0ZA 4XUZA 2JCHA 2OV5A 3Q1FA 4PM6A 4NETA 3DTMA 4B9OA 4R23A 4MLLA 4WMCA 4HESA 4KZ3A 3TSGA 5GLBA 2XFSA 4CLCC 3HLGA 2ZJ9A 3MF0A 1DP6A 2ZQ7A 4DKIA 4CLCA 4XT2B 2QKPA 1ZC2A 4ZBEA 4KZ8A 3V50A 1NYYA 2VA0A 2GX5A 4Q8IA 2QZ6A 4P6ZS 2R9WA 3KYQA 1NLYA 3SH9A 3ZNTA 4EBNA 2JBFA 2V8FA 4WL9A 3AGFA 4DJ2A 2HZ5A 4BBVA 4MBKA 1F98A 1XA1A 2V1ZA 3E2KA 2VLGA 2A24A 3UB6A 4BJPA 1KOUA 2K31A 3HL9A 1FOFA 4GNUA 1XFNA 4EQIA 3IXHA 2VK3A 4JXWA 3N8SA 3ZNYA 3FKVA 1EW0A 5HWWA 2IWCA 4D2OA 3CG5A 2ZM0A 4DXCA 4OH0A 1L0GA 1I5QA 1RGZA 4KZBA 5KSCA 4B88A 5CHMA 2DCFA 2W1TB 2V0WA 4GDBA 5KIZA 2L4RA 3IWOA 2EX2A 2G2UA 1OT9A 3RTYA 1EROA 1Z09A 4IEDA 4OPRA 3VOZA 3HJIA 3ZCZA 2JC7A 3NECA 1ZTUA 2FH5A 4CJNA 5EPHA 1L3LA 1JTDA 5EVIB 1AXBA 1LT0A 5MC7A 4R4RA 3BLSA 3GV9A 1Y54A 1XJ2A 3HLDA 4D60A 4MNRA 1CJFA 4X56A 2MJ6A 1LLBA 1NXYA 3NULA 4F3LA 4IHQA 4RX3A 4WUJA 3WS4A 2Y55A 3ZVTA 1AWIA 3S7PA 1W8QA 2BTFP 1XJ4A 5I94A 2JE5A 4YNRA 1K6SA 1PW1A 5HAPA 2HDUA 4HI4A 3WS2A 5E43A 3BYDA 4PHTA 4Y5FA 3VP3A 4HJ6A 1D06A 4UHUA 1VEUB 3C5AA 3BM6A 2PU2A 5EM1A 3L9KA 4ZAMA 2H28A 1YSQA 1HVBA 5HL6A 3WS1A 1XXMA 3IBJA 4WLAA 2Y2HA 3UB9A 2VV6A 1D7EA 4DXBA 1DY6A 2XQZA 4HHDA 2XDMA 4KG5A 3BLMA 4X1LA 1K54C 3CITA 1H8MA 4WEKA 1YLJA 3JPUA 4HOIA 3VE4A 4YFMA 5FI2A 4IUHA 1V9ZA 1PNEA 5CX7A 1SZVA 1CEFA 1LL8A 2W3GA 1EWZA 3H9WA 1J3WA 3FZCA 4BLMA 1H0MA 3HLWA 2P9VA 1TS6A 5F5YA 3HUNA 5A91A 1T19A 3D72A 2HDQA 4IBRA 3ULFA 3ZG8B 3D3OA 1PI5A 3MMHA 5HX9A 1S1ZA 4ZJ2A 2ZM8A 2QHKA 2EA9A 2H0YA 1G6OA 3C4OA 4B93A 3G2ZA 4WZ5A 5AVEA 3S22A 2E8IA 1IKGA 1GHPA 2JKTM 5HL1A 2Z6DA 1WA9A 4BL3A 3LI8A 5FL3A 1XX2A 2Y8HA 2OLVA 2GJ3A 4BWIA 4HNBA 3G6OA 4Z9QA 2V9AA 2OOLA 3IBRA 2EX9A 1GHMA 4R3JA 3NCKA 3SS3A 3HJKA 3O5YA 2M7VA 3PAEA 3RFBA 3S7NA 2B18A 1W63M 4JF6A 1EI5A 5IS1A 1YMSA 4R3BA 3UY6A 1VHMA 2L1MA 1NWZA 4O01A 2Y2NA 5EM0A 2ZL1A 4DE3A 1S1YA 1WE4A 1G5UA 5CGXA 5A93A 1Y28A 1KGEA 3T4QA 5TFQA 1N9LA 3T4TA 4ZDXA 1RGYA 2M1CA 4S2PA 2V20A 3NI9A 3L7HA 4JBFA 2QWSA 3MZFA 2WKHA 1JVJA 3UO9A 3H82A 4Y2FA 2ZC7A 4X69A 3WWXA 1HD8A 5J7EA 1N9BA 3VMAA 3T1SA 4M4XA 3G35A 2XF3A 4GJ4A 3CWFA 3MKFA 1T1BA 4WELA 3F1PA 5FQJA 1NJ4A 1TS8A 1IOUA 1W5DA 2XFTA 1PZPA 4GD6A 1DP9A 3O3VA 3PBSA 3Q7VB 1I2WA 5E2GA 3BY8A 4WBGA 3W4OA 4GW9A 3B42A 2AVXA 4L9GA 3IXBA 5L2FA 4HEFA 4PMAA 4JGOA 3LY3A 3TOIA 4EQ1A 5DTTA 3AGEA 1PWGA 2ZM2A 3IHBA 3MQ0A 4E6XA 2WYXA 4EW7A 1LL9A 1MKMA 3TW8A 3OPRA 4O8GA 3IF5A 5DF9A 2QJ7A 4NKPA 2KX6A 5HPIA 2XSSA 5EVEA 4OPYA 1CI8A 5DKKA 5FI6A 3BFDA 1LSXA 5CTNA 1DJBA 4JGRA 1GSWA 1P9WA 3VOLA 4E3MA 2OSUA 1BULA 3UE6A 4YOFA 3W2ZA 5CGSA 1SDEA 3A3JA 4KQOA 2ZMVA 1OMEA 4I3IA 1M40A 3BFCA 3CUEA 1DRMA 3KO6A 1YQSA 2HGVA 2HJ9C 5HWTA 3LGOA 2CC1A 4MCWA 3S1YA 4EERA 2Y2KA 3O86A 4MN7A 1IYSA 2HDRA 3IX3A 4Y3IA 1E3UA 1J9MA 3ZVWA 5FATA 4N1HA 2Q0OA 4OOYA 3KSGA 2J3TC 1VETA 2WZZA 2ZMFA 3UNWA 2VV7A 2ZOHA 3KX0X 3NDEA 2QJ5A 3KSHA 3G32A 4HJ4A 4P6BA 5AQBA 2PD7A 3ZGAB 4BQMA 4LPZA 5DVAA 2JHEA 3ZQ5A 1T18A 4GHIB 2PD8A 3C2WA 2J7VA 3BQAA 4OONA 5HW3A 2YKFA 2ZC5B 3E4OA 4ZRRA 5F68A 1OPXA 5CERA 4HJ3A 2NUTC 5TBMB 1YKDA 3QP6A 3SH7A 1BLHA 3QP5A 3UB5P 1CK3A 5EFWA 3BRMA 3EOIA 2JKFA 1JTGA 1TVFA 4HBTA 4M3KA 2GDNA 3LYXA 3C4PA 3B47A 2FZ0A 3N4IA 4WZ4A 1C3BA 1TS0A 5FA7A 1PI4A 3GR2A 3CZDA 2PU4A 1W8YA 1SKFA 3D4FA 1NZOA 5FQKA 1LSWA
chains in the Genus database with same CATH topology
2W27A 1S67L 1S4RA 3MQOA 4HH3A 2G7UA 5G4ZA 2HV1A 2VX8A 4NXBA 3FC7A 4KUOA 1LT0A 5MC7A 1ZHHB 2J3WA 3EEHA 4DN0A 4HH2A 3T4KA 4IUKA 3PHYA 2WKRA 3LIBA 4GHIA 3OOVA 1XJ2A 5J4EA 2JKRM 2P04A 1UWPX 1YAXA 2MJ6A 2R78A 4F3LA 4IHQA 4WUJA 2WKPA 2PHYA 4ARZB 3MJQA 3S7PA 4RQ9A 1XJ4A 4UQIM 4YNRA 1UGUA 3GECA 4HI4A 3UB8A 5HWVA 1XJ6A 2J80A 3CI6A 1X0OA 3NOTC 4PHTA 1T1CA 4Y5FA 2JKTI 1ODVA 4HJ6A 1D06A 3EEAA 1GSXA 2JKRI 2VZWA 4XT2A 4CQHA 4CLCB 3CAXA 3OBFA 3DBAA 3IS2B 1OTIA 2O0YA 3VE3A 2H28A 1YSQA 3F1NA 5I5LA 5HL6A 1N9OA 2XROA 3IBJA 4WLAA 2K2NA 3NHQA 3UB9A 2KOIA 2KDKA 3UB7A 2VV6A 1D7EA 2I9VA 2W3EA 4NXGA 3UMEA 3P7NA 5HDSA 2W1RA 4HHDA 3BWLA 3NOUC 3KSFA 2YKHA 2L0WA 1F5MA 4FSFA 3H7WA 3CITA 3JVUA 1H8MA 4WEKA 5TJJA 2W3DA 2PYRA 4HOIA 3VE4A 4JGPA 2OWJA 3BQ8A 2KLIA 4IUHA 3TE8A 3UE3A 1V9ZA 1XFQA 2ZBBA 4MMNA 4PKYG 5CX7A 4I39A 1LL8A 1T1AA 2W3GA 3H9WA 4EEUA 4HQAA 3GDIA 3C30A 1TS6A 5HSQA 5F5YA 3FG8A 3D72A 1T19A 3LUQA 4O0PA 1OTBA 3ULFA 3T4JA 2OWHA 1STZA 3D3OA 2HJEA 3MMHA 3PBRA 1G28A 1S1ZA 2VKSA 2QHKA 2EA9A 3E4PA 1G6OA 4B93A 2D02A 5AVEA 1VB6A 2DMWA 3NJAA 2JKTM 4UEYA 2Z6DA 2NUPC 1WA9A 4H6JA 3F1NB 3HCYA 3LI8A 5FL3A 1TD5A 3IS2A 2Y8HA 3R4KA 3LI9A 4WN5A 4HP4A 2W3FA 2GJ3A 4G3WA 4BWIA 4HNBA 1OJGA 4G3KA 2PR6A 3G6OA 3MQQA 2VJWA 3CUEC 3EGDC 3LIDA 2XA7S 4EU0A 4EESA 5AJGA 4K08A 4L9EA 2PYPA 4LRXC 2V9AA 2OOLA 4EUVA 5A8BA 4NXEA 3IBRA 3SW1A 4ETZA 1NLZA 3MFXA 4P6ZM 5IT5A 1UWNX 3HJKA 3O5YA 2M7VA 1NRJA 1LSWA 4PKYA 3RFBA 4GS9A 5HD5A 4ARZA 3S7NA 2B18A 1W63M 3BW6A 3F1OA 4DMZA 4PAUA 2VV8A 3F1PB 5IS1A 1P9RA 3V67A 4F3LB 3K3CA 3B33A 3PBTA 2W0NA 1VHMA 3U2AA 4I3JA 3LIAA 2L1MA 3OCNA 3PR6A 1NWZA 4O01A 2GZAA 5F69A 1TF1A 5KSHA 1S1YA 2LB5A 4BBUA 4MN6A 3H82B 3T4LA 1Y28A 3T4QA 2VEAA 2JN7A 2V1BA 3CLOA 3PYPA 5HD3A 3ZYTA 3BJNA 1N9LA 2INWA 3T4TA 2BASA 1S66L 2M1CA 5HDCA 5IU1A 2Y79A 3S7QA 2QWSA 3T4OA 1TS7A 3T4SA 3H82A 4LLOB 1JNUA 3PBOA 3LIFA 4Y2FA 4ETXA 4WEJA 5DFYA 5C5KA 4JGQA 1LSVA 5J7EA 2Z6CA 1OTEA 2XRNA 4M4XA 4GJ4A 3CWFA 3ICYA 3A0SA 2W1TA 1DP8A 1T1BA 4HIAA 4WELA 3F1PA 3BY9A 3F1OB 1TS8A 1IOUA 4UQIS 4GS9B 3KYZA 5K5BA 4I38A 5TBMA 1DP9A 4Q0JA 2V0UA 3PBSA 2P08A 4R3AA 4AFIA 3BY8A 4GW9A 3B42A 4L9GA 3P01A 2O9AA 2VGLM 4LRZE 4MN5A 1F9IA 2OAP1 3K3DA 4LRYC 3A0VA 4JGOA 3FPVA 4KUKA 4EQ1A 3PXPA 3FPWA 4H6JB 4IJGA 2B02A 4GLQA 2A24B 3MQ0A 4EETB 5DJUA 2PDRA 4EW7A 1MKMA 3UMDA 3MR0A 3E98A 3VV4A 4I5SA 3TW8A 5HZHA 4O8GA 3EQUA 4I3AA 4NEED 3A0RA 5DF9A 2EWVA 2QJ7A 3OC2A 4NKPA 2KX6A 5HPIA 2XSSA 4BBTA 5J3WA 5F6AA 5HPFA 4WF0A 3R7WA 4KQDA 3S7OA 3EWKA 3C38A 3LR5A 3OLOA 3PBQA 4Q0IA 5DKKA 2LB9A 1H3QA 2W3HA 1LSXA 3RH8B 2OAQ1 2A2LA 1OTDA 4JGRA 1GSWA 1BYWA 2D01A 1P9WA 4MDZA 3NOPC 4EEPA 4G3VA 3EQVA 2P7JA 4DJ3A 3VOLA 4GCZA 4ME4A 3KSIA 3H7WB 3UE6A 3LIEA 4YOFA 3W2ZA 1N9NA 4R38A 2EWWA 1P0ZA 2PT7A 3TJZC 4KQOA 4BMWA 4B9OA 2ZOIA 4Z1WA 2ZMVA 4I3IA 2PR5A 5LBRA 5L8MA 3CUEA 2K7SA 1DRMA 2VGLS 4QPRA 3KO6A 4CLCC 2HGVA 2HJ9C 5HWTA 3MF0A 1DP6A 4MCWA 5DFXA 4CLCA 4EERA 4XT2B 3LR0A 2QKPA 5G4YA 1S4SA 4MN7A 1MC0A 2O99A 4Y3IA 5DKLA 1V9YA 3R7WB 2VA0A 4HP9A 2WKQA 4Q0HA 2GX5A 3LR4A 4HY8A 4P6ZS 3KYQA 1NLYA 4L0LA 3KSGA 2J3TC 5DJTA 4OOMA 2M7UA 4NXFA 4WL9A 4DJ2A 3C8CA 1XJ3A 2ZMFA 4BBVA 1F98A 2VV7A 2ZOHA 3KX0X 3E0YA 2VLGA 2A24A 2QJ5A 3KSHA 4HJ4A 3JVVA 2V1AA 2PD7A 1W63Q 3UB6A 4BJPA 4LPZA 1KOUA 2K31A 2JHEA 3K2NA 3ZQ5A 1T18A 4GHIB 2PD8A 3C2WA 4R70A 1P97A 1OTAA 3BQAA 3LICA 1XFNA 2YKFA 1IFQA 3E4OA 4ZRRA 5F68A 1OPXA 4HJ3A 2NUTC 2QYBA 3EGXC 1EW0A 4II7A 4R6LA 2O9BA 5HWWA 5TBMB 1YKDA 4EXOA 2GNXA 3T50A 3LFVA 4FOFA 2J3TD 2HF6A 1GSVA 2W1TB 2V0WA 5KIZA 2L4RA 3PBNA 5EFWA 1OT9A 3EOIA 3RTYA 2XA7M 2IA2A 5HDDA 3TRCA 3LYXA 3HJIA 1MZUA 2FZ0A 3B47A 1YSPA 1TS0A 3OCLA 3LR3A 4OOLA 3E4QA 4YWZA 4CLCE 2CMNA 4CLCD 2O9CA 1OJ5A 1ZTUA 2FH5A 1OT6A 5AVFA 3MXQA 4E04A 4L9FA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4M4X A;  2W27 A;  3LUQ A;  1S67 L;  1S4R A;  1OTB A;  3MQO A;  4HH3 A;  5HWT A;  3ULF A;  5G4Z A;  2HV1 A;  4NXB A;  2OWH A;  3CWF A;  3FC7 A;  3ICY A;  3A0S A;  1DP6 A;  4KUO A;  1DP8 A;  1LT0 A;  1T1B A;  4HIA A;  4XT2 B;  4EER A;  3F1P A;  1G28 A;  1S1Z A;  2QKP A;  3BY9 A;  3F1O B;  2QHK A;  1TS8 A;  2EA9 A;  3EEH A;  3E4P A;  4GS9 B;  4HH2 A;  5G4Y A;  1S4S A;  3PHY A;  2WKR A;  2D02 A;  3LIB A;  4GHI A;  5AVE A;  4I38 A;  1VB6 A;  3NJA A;  5TBM A;  1DP9 A;  5DKL A;  1V9Y A;  2V0U A;  1XJ2 A;  5J4E A;  2Z6D A;  4HP9 A;  2WKQ A;  1WA9 A;  4R3A A;  4H6J A;  3F1N B;  3BY8 A;  3LI8 A;  4HY8 A;  1UWP X;  3IS2 A;  3LI9 A;  2R78 A;  4WN5 A;  4GW9 A;  4HP4 A;  4WL9 A;  4DJ2 A;  4F3L A;  4L9G A;  2GJ3 A;  4WUJ A;  2WKP A;  5DJT A;  2PHY A;  4HNB A;  1OJG A;  2PR6 A;  3G6O A;  3MQQ A;  3C8C A;  1XJ3 A;  3LID A;  4NXF A;  4LRZ E;  4MN5 A;  1F9I A;  3K3D A;  4LRY C;  3MJQ A;  4EES A;  3A0V A;  4K08 A;  4JGO A;  4L9E A;  1F98 A;  2PYP A;  4LRX C;  2VV7 A;  2ZOH A;  4BBV A;  4EW7 A;  3KX0 X;  2V9A A;  4KUK A;  2OOL A;  2VLG A;  4RQ9 A;  4EQ1 A;  5A8B A;  1XJ4 A;  2A24 A;  2QJ5 A;  4HJ4 A;  4NXE A;  3IBR A;  2V1A A;  2PD7 A;  2B02 A;  1UGU A;  4H6J B;  3UB6 A;  3SW1 A;  3GEC A;  4HI4 A;  3UB8 A;  5HWV A;  3MFX A;  4LPZ A;  1XJ6 A;  2A24 B;  2J80 A;  1KOU A;  5HD5 A;  2JHE A;  1UWN X;  3HJK A;  1T18 A;  4GHI B;  1X0O A;  2PD8 A;  3C2W A;  3NOT C;  4R70 A;  1T1C A;  4EET B;  5DJU A;  1P97 A;  1OTA A;  2PDR A;  3LIC A;  4GS9 A;  1ODV A;  1XFN A;  2YKF A;  1D06 A;  1GSX A;  4HJ6 A;  4PKY A;  3MR0 A;  3F1O A;  3UMD A;  3E4O A;  2VV8 A;  3F1P B;  4I5S A;  5HZH A;  4XT2 A;  5IS1 A;  5F68 A;  4I3A A;  4F3L B;  3A0R A;  3CAX A;  3K3C A;  4HJ3 A;  3B33 A;  2QJ7 A;  3IS2 B;  2W0N A;  1OTI A;  2KX6 A;  4I3J A;  2H28 A;  3VE3 A;  3LIA A;  2L1M A;  3F1N A;  5I5L A;  1N9O A;  3MXQ A;  4BBT A;  4E04 A;  5J3W A;  1EW0 A;  1NWZ A;  4R6L A;  5F6A A;  5HWW A;  4WF0 A;  4WLA A;  5F69 A;  5TBM B;  3NHQ A;  4KQD A;  3UB9 A;  3UB7 A;  2KDK A;  4EXO A;  3EWK A;  2VV6 A;  1D7E A;  2I9V A;  1S1Y A;  3T50 A;  3OLO A;  5DKK A;  4BBU A;  3ZQ5 A;  4MN6 A;  3H82 B;  4NXG A;  1Y28 A;  3P7N A;  1GSV A;  5HDS A;  1LSX A;  4HHD A;  3BWL A;  3RH8 B;  2VEA A;  2JN7 A;  2V0W A;  3NOU C;  2L4R A;  1OTD A;  2YKH A;  4JGR A;  1GSW A;  5KIZ A;  1BYW A;  2D01 A;  2L0W A;  2V1B A;  3CLO A;  3PYP A;  5EFW A;  5HD3 A;  1OT9 A;  1N9L A;  3H7W A;  3UME A;  2INW A;  4EEP A;  3NOP C;  3RTY A;  2BAS A;  1S66 L;  2PYR A;  4HOI A;  2P7J A;  5HDD A;  3VOL A;  3VE4 A;  4DJ3 A;  2M1C A;  4JGP A;  5HDC A;  5IU1 A;  2OWJ A;  4GCZ A;  1V9Z A;  3H7W B;  3LYX A;  3UE6 A;  3HJI A;  3LIE A;  1MZU A;  1N9N A;  1XFQ A;  2QWS A;  1TS0 A;  2ZBB A;  4PKY G;  4R38 A;  1P0Z A;  3D72 A;  1TS7 A;  3E4Q A;  4I39 A;  1LL8 A;  1T1A A;  3H82 A;  3H9W A;  4LLO B;  1JNU A;  4YWZ A;  3LIF A;  4EEU A;  4B9O A;  2ZOI A;  3GDI A;  4HQA A;  2CMN A;  4I3I A;  2PR5 A;  4JGQ A;  1LSV A;  1OJ5 A;  1OT6 A;  1TS6 A;  5HSQ A;  5F5Y A;  5AVF A;  2K7S A;  2Z6C A;  3FG8 A;  5J7E A;  1OTE A;  1DRM A;  1LSW A;  1T19 A;  4L9F A; 
#chains in the Genus database with same CATH topology
 5FAO A;  1K25 A;  1S67 L;  3MQO A;  4HH3 A;  5G4Z A;  2HV1 A;  1ALQ A;  3BFF A;  1K54 A;  2WGW A;  1KDS A;  3QP1 A;  2WGV A;  3QNC A;  1ACF A;  2UWX A;  4DN0 A;  3VSL A;  4GHI A;  1I2S A;  4GD8 A;  3OOV A;  5J4E A;  2JKR M;  3LEZ A;  1E25 A;  3V5M A;  5FDH A;  4OQG A;  3LO7 A;  4EV4 A;  2PHY A;  4ARZ B;  3BEB A;  4X1M A;  3N8R A;  4RQ9 A;  1VM1 A;  4FTX A;  2ZQ9 A;  4HBU A;  3GEC A;  1K4F A;  1XJ6 A;  2ZC3 B;  4FCF A;  2J80 A;  1TEM A;  2A3U A;  3CI6 A;  1X0O A;  3NOT C;  1T1C A;  1XKZ A;  2JKT I;  2VZW A;  4CQH A;  3CMZ A;  3IS2 B;  2Y2Q A;  2O0Y A;  3F1N A;  5I5L A;  1N9O A;  2ZLY A;  5EEC A;  4P0M A;  2KOI A;  4PM5 A;  3MKE A;  3MZD A;  2I9V A;  3IXG A;  1IEL A;  2ZMA A;  4NXG A;  1ONH A;  5HDS A;  3NOU C;  2L0W A;  4FSF A;  4EBP A;  4LV2 A;  3JVU A;  5TJJ A;  2W3D A;  1IYQ A;  4KZ7 A;  3TE8 A;  3UE3 A;  4RX2 A;  4Y0O A;  3B3X A;  4PM9 A;  2H10 A;  4Y0T A;  4QU3 A;  3GDI A;  3CPT B;  2Y2I A;  1KGG A;  1L2S A;  5HSQ A;  3FG8 A;  1K38 A;  2Y2O A;  3LUQ A;  1OTB A;  4UA9 A;  5EUA A;  1KDW A;  1GCE A;  4WYY A;  2WK0 A;  3Q82 A;  2VKS A;  4B4X A;  2DNS A;  3E4P A;  2ACG A;  2PBY A;  3NJA A;  4EUZ A;  2X02 A;  4UEY A;  1NZU A;  2NUP C;  5F82 A;  5KZH A;  4PM8 A;  2BLS A;  3HRE A;  5CED A;  3LI9 A;  4WN5 A;  5L10 A;  1H5X A;  4G3K A;  5GHX A;  3EGD C;  4JKT A;  2Y2P A;  4LRX C;  2XGN A;  4WMC D;  5A8B A;  3WRT A;  4NXE A;  1XGI A;  3U4L P;  2ZC4 B;  4DE2 A;  2H5S A;  4K0W A;  4OPQ A;  5GLC A;  1NRJ A;  3W4Q A;  2XEP A;  4OQ0 A;  5HD5 A;  4KZ4 A;  4PAU A;  3F1P B;  4X6T A;  1JWV A;  5GLA A;  2EFU A;  1ONG A;  1O07 A;  3OCN A;  3PR6 A;  2GZA A;  4NG2 A;  1MWS A;  3UN7 A;  1LL5 A;  3ITB A;  4KZ5 A;  3DTE A;  3H82 B;  2VEA A;  5M19 A;  2INW A;  2PRF A;  4DE1 A;  1SKO A;  3ZG0 A;  3OPP A;  2Y79 A;  3S7Q A;  1GA0 A;  5AQA A;  2R9X A;  3T4O A;  1TS7 A;  3T4S A;  4ETX A;  4WEJ A;  4X55 A;  5C5K A;  4ESP A;  4Y7P A;  1LSV A;  2ZL1 B;  1TDG A;  3ZFZ A;  2Z6C A;  1QME A;  4N92 A;  3MFD A;  4UAA A;  3ICY A;  5HFO A;  1FQG A;  3IX4 A;  5FEG A;  2P74 A;  4WM9 A;  4R0Q A;  2RL3 A;  1S0W A;  3RJU A;  4KZ9 A;  3V3R A;  2QPN A;  2VGL M;  3K3D A;  4LRY C;  4FUW A;  4QY6 A;  3FPV A;  3P98 A;  3HUM A;  3PXP A;  5EE8 A;  1RP5 A;  2Z2L B;  4IJG A;  4N1X A;  3TG9 A;  5HAI A;  5GLD A;  1JWZ A;  4JXS A;  5DJU A;  1RCJ A;  3MR0 A;  2V8C A;  3EQU A;  3T1R A;  4NEE D;  2EWV A;  4S2I A;  2ZQ8 A;  3FWL A;  4BBT A;  3IF6 A;  3A3D A;  3R7W A;  4KQD A;  3S7O A;  5M1A A;  3C38 A;  4OQI A;  3OLO A;  4Q0I A;  5J8X A;  2JKG A;  2LB9 A;  5DTK A;  1DJA A;  2QMI A;  3VP2 A;  1OTD A;  2D01 A;  1XGJ A;  1K4E A;  3O88 A;  4G3V A;  3EQV A;  2VGJ A;  3G2Y A;  2PAV P;  2EXA A;  4ME4 A;  3KSI A;  2XD5 A;  1N9N A;  2EWW A;  3TJZ C;  1S6R A;  1CF0 A;  4BMW A;  3IT9 A;  4Z1W A;  2PR5 A;  5CEC A;  2K7S A;  4EBL A;  3ZG9 B;  4YIN A;  1YM1 A;  5DFX A;  1VEU A;  4FH4 A;  4IVI A;  2EX8 A;  1GA9 A;  3PAG A;  3QP8 A;  2O99 A;  4RA7 A;  5DKL A;  3R7W B;  3IF6 B;  2WKQ A;  1Q2P A;  4L0L A;  2B5R A;  4OOM A;  4NXF A;  1PIO A;  3SH8 A;  4EWF A;  2J8Y A;  2FFF B;  4OKP A;  3E0Y A;  1ZKJ A;  2XLN A;  4Y0U A;  3JVV A;  3HVF A;  4BEN A;  3N8L A;  2WGI A;  4RVA A;  1YLZ A;  4R70 A;  1P97 A;  1OTA A;  1FCM A;  1QMF A;  1IFQ A;  2C5W B;  5M18 A;  1K0K A;  3OZH A;  4U3T A;  4ZJ1 A;  5EVI A;  1BTL A;  2QYB A;  4II7 A;  4DE0 A;  2O9B A;  5EVL A;  3OPH A;  3BFE A;  2J3T D;  4RYE A;  2HF6 A;  4OP8 A;  1XP4 A;  4F94 A;  3PBN A;  1MWU A;  4H8R A;  3UDF A;  2XA7 M;  3RXW A;  5HDD A;  3TRC A;  1MZU A;  1YSP A;  3LR3 A;  4OOL A;  5HAR A;  4CLC E;  4OLD A;  2CMN A;  3ZG7 B;  1OJ5 A;  1OT6 A;  3V3S A;  3UDX A;  4UA6 A;  5AVF A;  3M6H A;  1SKO B;  3MXQ A;  4E04 A;  4L9F A;  1S4R A;  4N9L A;  4NXB A;  2VX8 A;  4PM7 A;  3FC7 A;  1DJC A;  3VP4 A;  4UA7 A;  3P09 A;  1IKI A;  1FR1 A;  2J3W A;  5KMW A;  3MXS A;  2UV0 E;  4HH2 A;  3T4K A;  4C6Y A;  2IWD A;  2HP6 A;  5FSR A;  5FQI A;  3LCE A;  2WAD A;  2P04 A;  3PTE A;  5EOO A;  1KE3 A;  1YAX A;  2R78 A;  1SDN A;  3OPL A;  4QD4 A;  5L09 A;  2Y2G A;  3MJQ A;  3D9Y A;  3S4X A;  4GDN A;  4KQQ A;  3BFG A;  5TGF A;  1ES3 A;  3UB8 A;  3HLB A;  3NIA A;  5GHZ A;  3A3E A;  3HUO A;  1ODV A;  2JKR I;  3EEA A;  4E3L A;  4XT2 A;  4E3J A;  4IVK A;  2FFY A;  4CLC B;  2HPB A;  2PBD P;  3OBF A;  3VE3 A;  1TDL A;  3AGD A;  3GVB A;  4Y15 A;  3NHQ A;  2KDK A;  2W3E A;  5FAS A;  3MXR A;  1BSG A;  4QHC A;  3P7N A;  5DF8 A;  3BWL A;  3KSF A;  5A92 A;  1F5M A;  4C3Q A;  3H7W A;  5CXW A;  5JYP A;  1MBL A;  4QB8 A;  3V39 A;  4JGP A;  2OWJ A;  4X53 A;  3BQ8 A;  2KLI A;  1L0F A;  4DDY A;  2HP5 A;  3CPT A;  1YT4 A;  2DRW A;  4I39 A;  1T1A A;  4EEU A;  2ZQC A;  3C30 A;  1XA7 A;  3QNB A;  1LI9 A;  5A90 A;  5FI7 A;  3T4J A;  2OWH A;  1STZ A;  2HJE A;  1PW8 A;  3PBR A;  3WRZ A;  3GTC A;  1G28 A;  4LV3 A;  2D02 A;  1VB6 A;  1D1J A;  2WUQ A;  3HLC A;  3F1N B;  1NY0 A;  3IS2 A;  2ZC6 B;  4HP4 A;  2PR6 A;  3CUE C;  3LID A;  4EU0 A;  3M2K A;  2XA7 S;  1BLC A;  4EES A;  5AJG A;  3MS6 A;  4K08 A;  1HLU P;  5E2E A;  5F83 A;  1NYM A;  4GZB A;  3SW1 A;  4E3I A;  4NK3 A;  5L07 A;  1BUE A;  4MEZ A;  5FQ9 A;  4PKY A;  4ARZ A;  4GS9 A;  5G18 A;  4DMZ A;  3ZDJ A;  3V67 A;  3K3C A;  3IXD A;  3UDI A;  1HZO A;  2W0N A;  3PBT A;  3ZG5 A;  4B4Z A;  1CEG A;  5AQ9 A;  5F69 A;  1TF1 A;  1YLY A;  1Z6F A;  1YLP A;  4BBU A;  4MN6 A;  2WGW B;  2JN7 A;  3BEC A;  3GSG A;  3CLO A;  3PYP A;  2Y2L A;  5HD3 A;  3BJN A;  3ZYT A;  3VOY A;  1KVL A;  4S2N C;  3SS5 A;  5IU1 A;  5CGW A;  4QWO A;  1MXO A;  4WZ5 C;  4LEN A;  4IBX A;  3NC8 A;  4LLO B;  1BLP A;  1ES2 A;  2EXB A;  3A0S A;  1DP8 A;  4HIA A;  3F1O B;  1N4O A;  1CQA A;  4UQI S;  1BLS A;  4X68 A;  3GMW A;  3HLE A;  4FD8 A;  3KYZ A;  1PFL A;  5K5B A;  5TBM A;  2HP9 A;  3IHA A;  2P08 A;  4R3A A;  1LI0 A;  4Y13 A;  3UE1 A;  1Y4O A;  3P01 A;  1A0K A;  4LRZ E;  1F9I A;  2OAP 1;  4MN5 A;  1NRF A;  3A0V A;  2Q9M A;  4Y17 A;  4KUK A;  3KYE A;  2ZQA A;  5EVI D;  1Q2Q A;  3NY4 A;  2B02 A;  4H6J B;  5FQM A;  4GLQ A;  1ES5 A;  2VGK A;  1FIL A;  4JLF A;  1ERQ A;  4EET B;  3HBR A;  1VET B;  2WAE A;  3E98 A;  4I5S A;  5HZH A;  1L0D A;  2B95 A;  5U47 A;  3SOI A;  3A0R A;  4OLG A;  1W79 A;  4DF6 A;  1PRQ A;  3QP4 A;  4N9K A;  3A3F A;  1PWC A;  1K55 C;  4GN2 A;  5F6A A;  5HPF A;  5FAQ A;  3VSK A;  4PPR A;  1VQQ A;  1H3Q A;  3IH8 A;  3W4P A;  1G68 A;  1FR6 A;  4KZ6 A;  3ZHH A;  1U60 A;  2A2L A;  2HDS A;  3DW0 A;  1BYW A;  3G4P A;  4LCM A;  3FKW A;  4EEP A;  3DWZ A;  2V2F F;  3N7W A;  4GCZ A;  2XR0 A;  4R38 A;  4JPM A;  2ZOI A;  4GOG A;  1K6R A;  5LBR A;  5L8M A;  2VGL S;  4QPR A;  2Y91 A;  3SZT A;  2RCX A;  5EV0 A;  1YLT A;  2G2W A;  2I72 A;  4R1G A;  3LR0 A;  4JXV A;  1FIK A;  1HTZ A;  5G4Y A;  1S4S A;  1MC0 A;  3E2L A;  1E4D A;  1V9Y A;  4HP9 A;  1K57 C;  4Q0H A;  3LR4 A;  4E3N A;  4HY8 A;  5FEF A;  5DJT A;  2M7U A;  3VFF A;  1FCO A;  3C8C A;  1XJ3 A;  5EOE A;  1G6A A;  1MPL A;  5AQ7 A;  1FSW A;  2V1A A;  1W63 Q;  1M6K A;  2BG1 A;  3K2N A;  1KVM A;  4U0X A;  3LIC A;  1LHY A;  2X01 A;  3Q7V A;  3EGX C;  3GRJ A;  4R6L A;  3ITA A;  1SCW A;  4EXO A;  2GNX A;  4JXG A;  3T50 A;  3VFH A;  3LFV A;  4FOF A;  5FQQ A;  4MBH A;  4ID4 A;  4LV1 A;  2Y4A A;  1GSV A;  4KQR A;  3ISG A;  3RXX A;  3T1X A;  3NDG A;  2WAF A;  5CTM A;  1ZG6 A;  2IA2 A;  4GKU A;  3UPP A;  1BZA A;  4QY5 A;  3OCL A;  3E4Q A;  4YWZ A;  2Y59 A;  4CLC D;  2O9C A;  1H8Z A;  4JF4 A;  2X71 A;  2W27 A;  2G7U A;  2Q9N A;  3MZE A;  1JWP A;  1YPR A;  3JYI A;  4FH2 A;  4X25 A;  4KUO A;  4S2M A;  5FDS A;  1ZHH B;  3EEH A;  5CEB A;  4S2O A;  4IUK A;  3PHY A;  2WKR A;  3IH9 A;  1ES4 A;  3LIB A;  1FSY A;  1K56 D;  4QJG A;  4LGW A;  5E2F A;  5TR7 A;  1UWP X;  2WKP A;  2ZQD A;  3NBL A;  3WS5 A;  1W7F A;  4OQH A;  4BD0 A;  4GB7 A;  4UQI M;  3UE0 A;  3DTI A;  1UGU A;  5HWV A;  4DDS A;  4XUX A;  5E2H A;  4C75 A;  1YMX A;  1GSX A;  1PYY A;  1IYP A;  3CAX A;  3DBA A;  4OPZ A;  1OTI A;  2WKI A;  2XRO A;  4P85 A;  4LFU A;  4P87 A;  5DF7 A;  2K2N A;  3UB7 A;  1H8Y A;  4XXR A;  3UME A;  2W1R A;  2YKH A;  4KEN B;  3CJM A;  4U0T A;  3W8K A;  1MKI A;  1O7E A;  2PYR A;  1IEM A;  2P9V B;  4ZTK A;  1ERM A;  3N6I A;  4S2N A;  1XFQ A;  2ZBB A;  4MMN A;  4PKY G;  2WZX A;  4HQA A;  4LV0 A;  4OP5 A;  4K91 A;  5BOH A;  2XD1 A;  1SHV A;  4OVD A;  4O0P A;  3DTK A;  3A3I A;  5CRF A;  4JF5 A;  4O7D A;  4R4S A;  3C7V A;  4E3O A;  5CHU A;  2WKE A;  4CPK A;  3IX8 A;  1PWD A;  4K0X A;  2DMW A;  1BT5 A;  3G34 A;  3IQA A;  3SS4 A;  4H6J A;  3HCY A;  1TD5 A;  3Q07 A;  3R4K A;  4DRT A;  4E3K A;  2W3F A;  4G3W A;  2J9O A;  4E6W A;  1OJG A;  1WYC A;  2VJW A;  3MQQ A;  3IF6 C;  3LY4 A;  4L9E A;  5D3O A;  2PYP A;  3T1Q B;  4A5R A;  4EUV A;  1ESI A;  1L0E A;  2J9P A;  5DTS A;  3C7U A;  3T12 B;  1CI9 A;  3M6B A;  5GHY A;  4ETZ A;  1NLZ A;  3MFX A;  2Y2J A;  5GL9 A;  4P6Z M;  5IT5 A;  1UWN X;  1GHI A;  1F2K A;  3BW6 A;  3F1O A;  3CHW P;  2VV8 A;  1P9R A;  4F3L B;  3B33 A;  3U2A A;  2IWB A;  4I3J A;  3LIA A;  1IYO A;  5EVI C;  5KSH A;  3Q81 A;  2LB5 A;  2EFX A;  2A49 A;  4KZA A;  3T4L A;  2H0T A;  1KE4 A;  2E8J A;  2V1B A;  5CHJ A;  3QP2 A;  2BAS A;  1S66 L;  1MY8 A;  5HDC A;  3Q7Z A;  3M2J A;  2EX6 A;  5HAQ A;  4S2K A;  1E3U D;  1PZO A;  1KE0 A;  3I7J A;  1JNU A;  3PBO A;  3LIF A;  1WYB A;  4KG2 A;  5DFY A;  3DAV A;  4JGQ A;  1XPB A;  1OTE A;  2XRN A;  3VP0 A;  3QHY A;  2Z2M B;  4ZJ3 A;  2W1T A;  1MWT A;  5JYO A;  1FCN A;  3BY9 A;  3G30 A;  4GS9 B;  4I38 A;  2OLU A;  4Q0J A;  4BL2 A;  2V0U A;  3IWI A;  5F1G A;  3O87 A;  4AFI A;  1K56 A;  3IWQ A;  1K57 A;  3DWK A;  2O9A A;  3LEQ A;  1K55 A;  4BD1 A;  3VP1 A;  5F1F A;  3GQZ A;  3FPW A;  4LCL A;  2Y2M A;  3FYZ A;  5IHV A;  2A24 B;  2PDR A;  2XH9 A;  3UMD A;  3VV4 A;  4I3A A;  3OC2 A;  3UPO A;  2C6W B;  5J3W A;  1KGF A;  4WF0 A;  4S2J A;  3FV7 A;  3EWK A;  4S2L A;  3HLF A;  4MBF A;  3LR5 A;  3G31 A;  3PBQ A;  3UPN A;  3WS0 A;  2ZD8 A;  2W3H A;  3RH8 B;  5FAP A;  2OAQ 1;  3MBZ A;  1ESU A;  2XK1 A;  4KG6 A;  4MDZ A;  3NOP C;  2P7J A;  4DJ3 A;  3MSH A;  1YLW A;  1ZG4 A;  3H7W B;  1MWR A;  3LIE A;  2PT7 A;  1P0Z A;  4XUZ A;  2JCH A;  2OV5 A;  3Q1F A;  4PM6 A;  4NET A;  3DTM A;  4B9O A;  4R23 A;  4MLL A;  4WMC A;  4HES A;  4KZ3 A;  3TSG A;  5GLB A;  2XFS A;  4CLC C;  3HLG A;  2ZJ9 A;  3MF0 A;  1DP6 A;  2ZQ7 A;  4DKI A;  4CLC A;  4XT2 B;  2QKP A;  1ZC2 A;  4ZBE A;  4KZ8 A;  3V50 A;  1NYY A;  2VA0 A;  2GX5 A;  4Q8I A;  2QZ6 A;  4P6Z S;  2R9W A;  3KYQ A;  1NLY A;  3SH9 A;  3ZNT A;  4EBN A;  2JBF A;  2V8F A;  4WL9 A;  3AGF A;  4DJ2 A;  2HZ5 A;  4BBV A;  4MBK A;  1F98 A;  1XA1 A;  2V1Z A;  3E2K A;  2VLG A;  2A24 A;  3UB6 A;  4BJP A;  1KOU A;  2K31 A;  3HL9 A;  1FOF A;  4GNU A;  1XFN A;  4EQI A;  3IXH A;  2VK3 A;  4JXW A;  3N8S A;  3ZNY A;  3FKV A;  1EW0 A;  5HWW A;  2IWC A;  4D2O A;  3CG5 A;  2ZM0 A;  4DXC A;  4OH0 A;  1L0G A;  1I5Q A;  1RGZ A;  4KZB A;  5KSC A;  4B88 A;  5CHM A;  2DCF A;  2W1T B;  2V0W A;  4GDB A;  5KIZ A;  2L4R A;  3IWO A;  2EX2 A;  2G2U A;  1OT9 A;  3RTY A;  1ERO A;  1Z09 A;  4IED A;  4OPR A;  3VOZ A;  3HJI A;  3ZCZ A;  2JC7 A;  3NEC A;  1ZTU A;  2FH5 A;  4CJN A;  5EPH A;  1L3L A;  1JTD A;  5EVI B;  1AXB A;  1LT0 A;  5MC7 A;  4R4R A;  3BLS A;  3GV9 A;  1Y54 A;  1XJ2 A;  3HLD A;  4D60 A;  4MNR A;  1CJF A;  4X56 A;  2MJ6 A;  1LLB A;  1NXY A;  3NUL A;  4F3L A;  4IHQ A;  4RX3 A;  4WUJ A;  3WS4 A;  2Y55 A;  3ZVT A;  1AWI A;  3S7P A;  1W8Q A;  2BTF P;  1XJ4 A;  5I94 A;  2JE5 A;  4YNR A;  1K6S A;  1PW1 A;  5HAP A;  2HDU A;  4HI4 A;  3WS2 A;  5E43 A;  3BYD A;  4PHT A;  4Y5F A;  3VP3 A;  4HJ6 A;  1D06 A;  4UHU A;  1VEU B;  3C5A A;  3BM6 A;  2PU2 A;  5EM1 A;  3L9K A;  4ZAM A;  2H28 A;  1YSQ A;  1HVB A;  5HL6 A;  3WS1 A;  1XXM A;  3IBJ A;  4WLA A;  2Y2H A;  3UB9 A;  2VV6 A;  1D7E A;  4DXB A;  1DY6 A;  2XQZ A;  4HHD A;  2XDM A;  4KG5 A;  3BLM A;  4X1L A;  1K54 C;  3CIT A;  1H8M A;  4WEK A;  1YLJ A;  3JPU A;  4HOI A;  3VE4 A;  4YFM A;  5FI2 A;  4IUH A;  1V9Z A;  1PNE A;  5CX7 A;  1SZV A;  1CEF A;  1LL8 A;  2W3G A;  1EWZ A;  3H9W A;  1J3W A;  3FZC A;  4BLM A;  1H0M A;  3HLW A;  2P9V A;  1TS6 A;  5F5Y A;  3HUN A;  5A91 A;  1T19 A;  3D72 A;  2HDQ A;  4IBR A;  3ULF A;  3ZG8 B;  3D3O A;  1PI5 A;  3MMH A;  5HX9 A;  1S1Z A;  4ZJ2 A;  2ZM8 A;  2QHK A;  2EA9 A;  2H0Y A;  1G6O A;  3C4O A;  4B93 A;  3G2Z A;  4WZ5 A;  5AVE A;  3S22 A;  2E8I A;  1IKG A;  1GHP A;  2JKT M;  5HL1 A;  2Z6D A;  1WA9 A;  4BL3 A;  3LI8 A;  5FL3 A;  1XX2 A;  2Y8H A;  2OLV A;  2GJ3 A;  4BWI A;  4HNB A;  3G6O A;  4Z9Q A;  2V9A A;  2OOL A;  3IBR A;  2EX9 A;  1GHM A;  4R3J A;  3NCK A;  3SS3 A;  3HJK A;  3O5Y A;  2M7V A;  3PAE A;  3RFB A;  3S7N A;  2B18 A;  1W63 M;  4JF6 A;  1EI5 A;  5IS1 A;  1YMS A;  4R3B A;  3UY6 A;  1VHM A;  2L1M A;  1NWZ A;  4O01 A;  2Y2N A;  5EM0 A;  2ZL1 A;  4DE3 A;  1S1Y A;  1WE4 A;  1G5U A;  5CGX A;  5A93 A;  1Y28 A;  1KGE A;  3T4Q A;  5TFQ A;  1N9L A;  3T4T A;  4ZDX A;  1RGY A;  2M1C A;  4S2P A;  2V20 A;  3NI9 A;  3L7H A;  4JBF A;  2QWS A;  3MZF A;  2WKH A;  1JVJ A;  3UO9 A;  3H82 A;  4Y2F A;  2ZC7 A;  4X69 A;  3WWX A;  1HD8 A;  5J7E A;  1N9B A;  3VMA A;  3T1S A;  4M4X A;  3G35 A;  2XF3 A;  4GJ4 A;  3CWF A;  3MKF A;  1T1B A;  4WEL A;  3F1P A;  5FQJ A;  1NJ4 A;  1TS8 A;  1IOU A;  1W5D A;  2XFT A;  1PZP A;  4GD6 A;  1DP9 A;  3O3V A;  3PBS A;  3Q7V B;  1I2W A;  5E2G A;  3BY8 A;  4WBG A;  3W4O A;  4GW9 A;  3B42 A;  2AVX A;  4L9G A;  3IXB A;  5L2F A;  4HEF A;  4PMA A;  4JGO A;  3LY3 A;  3TOI A;  4EQ1 A;  5DTT A;  3AGE A;  1PWG A;  2ZM2 A;  3IHB A;  3MQ0 A;  4E6X A;  2WYX A;  4EW7 A;  1LL9 A;  1MKM A;  3TW8 A;  3OPR A;  4O8G A;  3IF5 A;  5DF9 A;  2QJ7 A;  4NKP A;  2KX6 A;  5HPI A;  2XSS A;  5EVE A;  4OPY A;  1CI8 A;  5DKK A;  5FI6 A;  3BFD A;  1LSX A;  5CTN A;  1DJB A;  4JGR A;  1GSW A;  1P9W A;  3VOL A;  4E3M A;  2OSU A;  1BUL A;  3UE6 A;  4YOF A;  3W2Z A;  5CGS A;  1SDE A;  3A3J A;  4KQO A;  2ZMV A;  1OME A;  4I3I A;  1M40 A;  3BFC A;  3CUE A;  1DRM A;  3KO6 A;  1YQS A;  2HGV A;  2HJ9 C;  5HWT A;  3LGO A;  2CC1 A;  4MCW A;  3S1Y A;  4EER A;  2Y2K A;  3O86 A;  4MN7 A;  1IYS A;  2HDR A;  3IX3 A;  4Y3I A;  1E3U A;  1J9M A;  3ZVW A;  5FAT A;  4N1H A;  2Q0O A;  4OOY A;  3KSG A;  2J3T C;  1VET A;  2WZZ A;  2ZMF A;  3UNW A;  2VV7 A;  2ZOH A;  3KX0 X;  3NDE A;  2QJ5 A;  3KSH A;  3G32 A;  4HJ4 A;  4P6B A;  5AQB A;  2PD7 A;  3ZGA B;  4BQM A;  4LPZ A;  5DVA A;  2JHE A;  3ZQ5 A;  1T18 A;  4GHI B;  2PD8 A;  3C2W A;  2J7V A;  3BQA A;  4OON A;  5HW3 A;  2YKF A;  2ZC5 B;  3E4O A;  4ZRR A;  5F68 A;  1OPX A;  5CER A;  4HJ3 A;  2NUT C;  5TBM B;  1YKD A;  3QP6 A;  3SH7 A;  1BLH A;  3QP5 A;  3UB5 P;  1CK3 A;  5EFW A;  3BRM A;  3EOI A;  2JKF A;  1JTG A;  1TVF A;  4HBT A;  4M3K A;  2GDN A;  3LYX A;  3C4P A;  3B47 A;  2FZ0 A;  3N4I A;  4WZ4 A;  1C3B A;  1TS0 A;  5FA7 A;  1PI4 A;  3GR2 A;  3CZD A;  2PU4 A;  1W8Y A;  1SKF A;  3D4F A;  1NZO A;  5FQK A;  1LSW A; 
#chains in the Genus database with same CATH homology
 2W27 A;  1S67 L;  1S4R A;  3MQO A;  4HH3 A;  2G7U A;  5G4Z A;  2HV1 A;  2VX8 A;  4NXB A;  3FC7 A;  4KUO A;  1LT0 A;  5MC7 A;  1ZHH B;  2J3W A;  3EEH A;  4DN0 A;  4HH2 A;  3T4K A;  4IUK A;  3PHY A;  2WKR A;  3LIB A;  4GHI A;  3OOV A;  1XJ2 A;  5J4E A;  2JKR M;  2P04 A;  1UWP X;  1YAX A;  2MJ6 A;  2R78 A;  4F3L A;  4IHQ A;  4WUJ A;  2WKP A;  2PHY A;  4ARZ B;  3MJQ A;  3S7P A;  4RQ9 A;  1XJ4 A;  4UQI M;  4YNR A;  1UGU A;  3GEC A;  4HI4 A;  3UB8 A;  5HWV A;  1XJ6 A;  2J80 A;  3CI6 A;  1X0O A;  3NOT C;  4PHT A;  1T1C A;  4Y5F A;  2JKT I;  1ODV A;  4HJ6 A;  1D06 A;  3EEA A;  1GSX A;  2JKR I;  2VZW A;  4XT2 A;  4CQH A;  4CLC B;  3CAX A;  3OBF A;  3DBA A;  3IS2 B;  1OTI A;  2O0Y A;  3VE3 A;  2H28 A;  1YSQ A;  3F1N A;  5I5L A;  5HL6 A;  1N9O A;  2XRO A;  3IBJ A;  4WLA A;  2K2N A;  3NHQ A;  3UB9 A;  2KOI A;  2KDK A;  3UB7 A;  2VV6 A;  1D7E A;  2I9V A;  2W3E A;  4NXG A;  3UME A;  3P7N A;  5HDS A;  2W1R A;  4HHD A;  3BWL A;  3NOU C;  3KSF A;  2YKH A;  2L0W A;  1F5M A;  4FSF A;  3H7W A;  3CIT A;  3JVU A;  1H8M A;  4WEK A;  5TJJ A;  2W3D A;  2PYR A;  4HOI A;  3VE4 A;  4JGP A;  2OWJ A;  3BQ8 A;  2KLI A;  4IUH A;  3TE8 A;  3UE3 A;  1V9Z A;  1XFQ A;  2ZBB A;  4MMN A;  4PKY G;  5CX7 A;  4I39 A;  1LL8 A;  1T1A A;  2W3G A;  3H9W A;  4EEU A;  4HQA A;  3GDI A;  3C30 A;  1TS6 A;  5HSQ A;  5F5Y A;  3FG8 A;  3D72 A;  1T19 A;  3LUQ A;  4O0P A;  1OTB A;  3ULF A;  3T4J A;  2OWH A;  1STZ A;  3D3O A;  2HJE A;  3MMH A;  3PBR A;  1G28 A;  1S1Z A;  2VKS A;  2QHK A;  2EA9 A;  3E4P A;  1G6O A;  4B93 A;  2D02 A;  5AVE A;  1VB6 A;  2DMW A;  3NJA A;  2JKT M;  4UEY A;  2Z6D A;  2NUP C;  1WA9 A;  4H6J A;  3F1N B;  3HCY A;  3LI8 A;  5FL3 A;  1TD5 A;  3IS2 A;  2Y8H A;  3R4K A;  3LI9 A;  4WN5 A;  4HP4 A;  2W3F A;  2GJ3 A;  4G3W A;  4BWI A;  4HNB A;  1OJG A;  4G3K A;  2PR6 A;  3G6O A;  3MQQ A;  2VJW A;  3CUE C;  3EGD C;  3LID A;  2XA7 S;  4EU0 A;  4EES A;  5AJG A;  4K08 A;  4L9E A;  2PYP A;  4LRX C;  2V9A A;  2OOL A;  4EUV A;  5A8B A;  4NXE A;  3IBR A;  3SW1 A;  4ETZ A;  1NLZ A;  3MFX A;  4P6Z M;  5IT5 A;  1UWN X;  3HJK A;  3O5Y A;  2M7V A;  1NRJ A;  1LSW A;  4PKY A;  3RFB A;  4GS9 A;  5HD5 A;  4ARZ A;  3S7N A;  2B18 A;  1W63 M;  3BW6 A;  3F1O A;  4DMZ A;  4PAU A;  2VV8 A;  3F1P B;  5IS1 A;  1P9R A;  3V67 A;  4F3L B;  3K3C A;  3B33 A;  3PBT A;  2W0N A;  1VHM A;  3U2A A;  4I3J A;  3LIA A;  2L1M A;  3OCN A;  3PR6 A;  1NWZ A;  4O01 A;  2GZA A;  5F69 A;  1TF1 A;  5KSH A;  1S1Y A;  2LB5 A;  4BBU A;  4MN6 A;  3H82 B;  3T4L A;  1Y28 A;  3T4Q A;  2VEA A;  2JN7 A;  2V1B A;  3CLO A;  3PYP A;  5HD3 A;  3ZYT A;  3BJN A;  1N9L A;  2INW A;  3T4T A;  2BAS A;  1S66 L;  2M1C A;  5HDC A;  5IU1 A;  2Y79 A;  3S7Q A;  2QWS A;  3T4O A;  1TS7 A;  3T4S A;  3H82 A;  4LLO B;  1JNU A;  3PBO A;  3LIF A;  4Y2F A;  4ETX A;  4WEJ A;  5DFY A;  5C5K A;  4JGQ A;  1LSV A;  5J7E A;  2Z6C A;  1OTE A;  2XRN A;  4M4X A;  4GJ4 A;  3CWF A;  3ICY A;  3A0S A;  2W1T A;  1DP8 A;  1T1B A;  4HIA A;  4WEL A;  3F1P A;  3BY9 A;  3F1O B;  1TS8 A;  1IOU A;  4UQI S;  4GS9 B;  3KYZ A;  5K5B A;  4I38 A;  5TBM A;  1DP9 A;  4Q0J A;  2V0U A;  3PBS A;  2P08 A;  4R3A A;  4AFI A;  3BY8 A;  4GW9 A;  3B42 A;  4L9G A;  3P01 A;  2O9A A;  2VGL M;  4LRZ E;  4MN5 A;  1F9I A;  2OAP 1;  3K3D A;  4LRY C;  3A0V A;  4JGO A;  3FPV A;  4KUK A;  4EQ1 A;  3PXP A;  3FPW A;  4H6J B;  4IJG A;  2B02 A;  4GLQ A;  2A24 B;  3MQ0 A;  4EET B;  5DJU A;  2PDR A;  4EW7 A;  1MKM A;  3UMD A;  3MR0 A;  3E98 A;  3VV4 A;  4I5S A;  3TW8 A;  5HZH A;  4O8G A;  3EQU A;  4I3A A;  4NEE D;  3A0R A;  5DF9 A;  2EWV A;  2QJ7 A;  3OC2 A;  4NKP A;  2KX6 A;  5HPI A;  2XSS A;  4BBT A;  5J3W A;  5F6A A;  5HPF A;  4WF0 A;  3R7W A;  4KQD A;  3S7O A;  3EWK A;  3C38 A;  3LR5 A;  3OLO A;  3PBQ A;  4Q0I A;  5DKK A;  2LB9 A;  1H3Q A;  2W3H A;  1LSX A;  3RH8 B;  2OAQ 1;  2A2L A;  1OTD A;  4JGR A;  1GSW A;  1BYW A;  2D01 A;  1P9W A;  4MDZ A;  3NOP C;  4EEP A;  4G3V A;  3EQV A;  2P7J A;  4DJ3 A;  3VOL A;  4GCZ A;  4ME4 A;  3KSI A;  3H7W B;  3UE6 A;  3LIE A;  4YOF A;  3W2Z A;  1N9N A;  4R38 A;  2EWW A;  1P0Z A;  2PT7 A;  3TJZ C;  4KQO A;  4BMW A;  4B9O A;  2ZOI A;  4Z1W A;  2ZMV A;  4I3I A;  2PR5 A;  5LBR A;  5L8M A;  3CUE A;  2K7S A;  1DRM A;  2VGL S;  4QPR A;  3KO6 A;  4CLC C;  2HGV A;  2HJ9 C;  5HWT A;  3MF0 A;  1DP6 A;  4MCW A;  5DFX A;  4CLC A;  4EER A;  4XT2 B;  3LR0 A;  2QKP A;  5G4Y A;  1S4S A;  4MN7 A;  1MC0 A;  2O99 A;  4Y3I A;  5DKL A;  1V9Y A;  3R7W B;  2VA0 A;  4HP9 A;  2WKQ A;  4Q0H A;  2GX5 A;  3LR4 A;  4HY8 A;  4P6Z S;  3KYQ A;  1NLY A;  4L0L A;  3KSG A;  2J3T C;  5DJT A;  4OOM A;  2M7U A;  4NXF A;  4WL9 A;  4DJ2 A;  3C8C A;  1XJ3 A;  2ZMF A;  4BBV A;  1F98 A;  2VV7 A;  2ZOH A;  3KX0 X;  3E0Y A;  2VLG A;  2A24 A;  2QJ5 A;  3KSH A;  4HJ4 A;  3JVV A;  2V1A A;  2PD7 A;  1W63 Q;  3UB6 A;  4BJP A;  4LPZ A;  1KOU A;  2K31 A;  2JHE A;  3K2N A;  3ZQ5 A;  1T18 A;  4GHI B;  2PD8 A;  3C2W A;  4R70 A;  1P97 A;  1OTA A;  3BQA A;  3LIC A;  1XFN A;  2YKF A;  1IFQ A;  3E4O A;  4ZRR A;  5F68 A;  1OPX A;  4HJ3 A;  2NUT C;  2QYB A;  3EGX C;  1EW0 A;  4II7 A;  4R6L A;  2O9B A;  5HWW A;  5TBM B;  1YKD A;  4EXO A;  2GNX A;  3T50 A;  3LFV A;  4FOF A;  2J3T D;  2HF6 A;  1GSV A;  2W1T B;  2V0W A;  5KIZ A;  2L4R A;  3PBN A;  5EFW A;  1OT9 A;  3EOI A;  3RTY A;  2XA7 M;  2IA2 A;  5HDD A;  3TRC A;  3LYX A;  3HJI A;  1MZU A;  2FZ0 A;  3B47 A;  1YSP A;  1TS0 A;  3OCL A;  3LR3 A;  4OOL A;  3E4Q A;  4YWZ A;  4CLC E;  2CMN A;  4CLC D;  2O9C A;  1OJ5 A;  1ZTU A;  2FH5 A;  1OT6 A;  5AVF A;  3MXQ A;  4E04 A;  4L9F A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...