1N9NA

Crystal structure of the phot-lov1 domain from chlamydomonas reinhardtii in illuminated state. data set of a single crystal.
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
108
structure length
108
Chain Sequence
LRHTFVVADATLPDCPLVYASEGFYAMTGYGPDEVLGHNCRFLQGEGTDPKEVQKIRDAIKKGEACSVRLLNYRKDGTPFWNLLTVTPIKTPDGRVSKFVGVQVDVTS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords putative blue light receptor
publication title Crystal Structures and Molecular Mechanism of a Light-Induced Signaling Switch: The Phot-LOV1 Domain from Chlamydomonas reinhardtii
pubmed rcsb
source organism Chlamydomonas reinhardtii
molecule tags Electron transport
total genus 29
structure length 108
sequence length 108
ec nomenclature
pdb deposition date 2002-11-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13426 PAS_9 PAS domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 1n9nA00
2L1MA 4HP9A 3UB9A 1G28A 4HQAA 4K08A 3F1NA 5F6AA 3VE3A 2VV6A 5HWTA 3LIDA 1S1YA 4I3JA 1GSWA 1T18A 1XFQA 1ODVA 3P7NA 5J3WA 3IS2A 4PKYG 4XT2B 1VB6A 2QKPA 2PYRA 1XFNA 5HWVA 4EERA 2WKQA 3CLOA 4I3IA 2ZBBA 5F68A 4GHIA 4HH3A 2WKRA 4LLOB 1V9YA 2V9AA 5J7EA 2OOLA 4YWZA 3G6OA 3T50A 3H9WA 3F1OA 3MR0A 4L9GA 3UB6A 2PHYA 4E04A 3UMDA 3B33A 3HJKA 3OLOA 3LIAA 1LSWA 4I38A 1F98A 4JGOA 5DKLA 3RTYA 2QJ7A 3UB7A 2JN7A 2VEAA 3VE4A 1OTIA 2V1AA 3H82B 2Z6CA 4HIAA 5KIZA 4H6JA 1NWZA 2H28A 5HDCA 1TS8A 5G4ZA 3VOLA 1UWNX 1LSVA 5DKKA 3GDIA 5IS1A 3LIBA 5IU1A 2K7SA 1N9LA 3HJIA 4L9EA 4NXEA 5J4EA 3F1PA 4EQ1A 2V0WA 4NXBA 4EW7A 4R6LA 2PDRA 2A24A 2PR6A 1KOUA 1DP8A 1LL8A 3GECA 1TS7A 4M4XA 2VLGA 2VV7A 3H7WA 1N9OA 1DP6A 4B9OA 1TS0A 4F3LB 4HI4A 3A0VA 3PHYA 1XJ2A 4BBUA 4EEPA 5TBMB 3A0SA 4BBVA 2D02A 2L0WA 2QHKA 4HP4A 3BY9A 3LICA 1UGUA 4KQDA 1OJGA 3LIEA 5HSQA 4NXGA 3UMEA 1X0OA 5HD3A 2OWJA 5AVFA 1DRMA 5HDSA 1OTBA 3SW1A 4GS9A 3LUQA 2M1CA 4WL9A 3K3DA 5HZHA 4GW9A 5I5LA 1T1BA 4DJ3A 1F9IA 3E4QA 4JGRA 3NJAA 1S66L 4MN6A 3CAXA 4WF0A 4JGPA 1LSXA 4XT2A 4EESA 3LI8A 4HY8A 5A8BA 3RH8B 1XJ3A 3LIFA 5G4YA 1OJ5A 3F1NB 1V9ZA 2QJ5A 3NOTC 4NXFA 3E4PA 2KX6A 5F69A 3UB8A 2I9VA 3ZQ5A 2QWSA 2BASA 3IS2B 1TS6A 3MJQA 3NOPC 2ZOHA 4LRYC 1WA9A 1OT6A 3C8CA 3MXQA 1T1CA 4GHIB 3EWKA 2JHEA 3NOUC 1XJ6A 3H82A 3LYXA 1T19A 1T1AA 2HV1A 1XJ4A 3ICYA 1GSXA 4LPZA 1P97A 3IBRA 2VV8A 1DP9A 4HH2A 1N9NA 4R70A 5DJUA 3F1OB 5HD5A 2W27A 5HDDA 2L4RA 1S4SA 2V0UA 4EETB 1S1ZA 2D01A 4HJ6A 4HNBA 4GCZA 3EEHA 2P7JA 1EW0A 3MFXA 2B02A 1S4RA 2YKHA 4I5SA 3UE6A 2WKPA 2PD8A 5DJTA 4H6JB 2GJ3A 3NHQA 4KUOA 3BWLA 4HHDA 4PKYA 5AVEA 3C2WA 1UWPX 1OTAA 2PD7A 1GSVA 3A0RA 2ZOIA 2W0NA 5HWWA 4WUJA 4LRXC 2PR5A 4WLAA 2YKFA 3KX0X 4F3LA 2INWA 1OTDA 3PYPA 4WN5A 5TBMA 3CWFA 3K3CA 3D72A 2OWHA 1Y28A 1MZUA 3ULFA 1D7EA 3FG8A 2KDKA 3MQOA 4RQ9A 3F1PB 2EA9A 4EEUA 2A24B 1OTEA 2R78A 3FC7A 4HJ4A 2PYPA 2CMNA 2Z6DA 3H7WB 1OT9A 4HOIA 5F5YA 1BYWA 3MQQA 4EXOA 1D06A 4I3AA 4DJ2A 4R38A 2J80A 3E4OA 4MN5A 4KUKA 3LI9A 5EFWA 1JNUA 2V1BA 1S67L 4L9FA 4JGQA 1P0ZA 4BBTA 4R3AA 4LRZE 4HJ3A 3BY8A 4I39A 1LT0A 4GS9B
chains in the Genus database with same CATH superfamily
3UB9A 1FCOA 4HQAA 4K08A 1ACFA 3BFCA 1YSQA 1XKZA 4RA7A 3VE3A 2R9XA 2VV6A 5FI6A 3ZDJA 1NZOA 3WS0A 2H0YA 1RP5A 1SKOB 2BLSA 4NKPA 4GZBA 4NETA 5TFQA 1XFQA 3VFFA 3P7NA 5J3WA 3L7HA 4KQQA 1FOFA 3O86A 2QKPA 1W7FA 3WS2A 2PYRA 2EXAA 1U60A 4EERA 1PWDA 4I3IA 1K4FA 4WELA 3LY3A 2HDRA 4HH3A 4OP5A 1VM1A 1NRJA 4X53A 2XSSA 3HLFA 3LEQA 2V9AA 4HEFA 4R0QA 2XA7S 4EV4A 2OOLA 5HPFA 3T50A 3H9WA 3IX8A 2KLIA 2ZMAA 5FEGA 3T1QB 2ZM0A 5FAQA 4E04A 1DJBA 1JTDA 4X1MA 1K0KA 2O0YA 3LIAA 1LSWA 3S1YA 1IKGA 4I38A 1DJCA 2Y2IA 5DKLA 4EU0A 2JN7A 3HUNA 1E25A 4Y15A 1J9MA 1NWZA 3TRCA 4MLLA 1NYMA 2XK1A 5G4ZA 4U0XA 1UWNX 4OQGA 5MC7A 3MZFA 2WYXA 2R9WA 3LIBA 3C4OA 5EOEA 3PAGA 2K7SA 3AGFA 2JKRI 1L3LA 1ONGA 2OLVA 3ITAA 3LGOA 4N92A 4NXEA 4Y0OA 5DF8A 4UA6A 3NDEA 3EQVA 5G18A 2ZQ9A 3R4KA 2XFSA 3KSFA 2PDRA 4QHCA 1ZTUA 5AQ9A 4S2LA 2WUQA 1LL8A 4JF5A 1TS7A 3UE0A 3S7OA 1SZVA 2VV7A 4ID4A 1N9OA 2WADA 4B9OA 4Q0JA 2H5SA 4FD8A 3TW8A 4FH4A 2J8YA 5FQMA 4YOFA 1XJ2A 2DCFA 1VHMA 4BBVA 2RCXA 2L0WA 5CHUA 1O07A 3N8SA 3BY9A 1ERQA 3MSHA 4GKUA 4L0LA 2V8FA 1UGUA 4WYYA 2WGVA 3T4QA 3UDXA 3IF6A 5EM0A 2A2LA 4NXGA 3NULA 5E2HA 3G35A 3VFHA 4GNUA 3O3VA 3ZG5A 4LCLA 1MPLA 1L0GA 2FZ0A 3G34A 5AQ7A 1NLYA 4GW9A 2EX2A 3B42A 1NZUA 4DJ3A 2Y2QA 1YMXA 4PM8A 3GTCA 4FUWA 2JE5A 3D9YA 1W5DA 1SKOA 4X25A 1TF1A 3UPNA 3V5MA 4Y5FA 4JGPA 4UA9A 1XA7A 3UE1A 4YNRA 1ZHHB 1OPXA 1ZG6A 3LI8A 4HY8A 1XJ3A 3LIFA 2OV5A 3E2LA 3P01A 2ZMVA 4DDYA 4Q8IA 1YLPA 4WZ5A 1HVBA 5L10A 4PMAA 2QJ5A 5IHVA 3Q81A 3E4PA 2W3EA 4Y0TA 2WZZA 5F69A 2V1ZA 3BFGA 3S7QA 5F1GA 1G6AA 3LR0A 2WKIA 4KZ7A 3IHBA 3MJQA 2P9VB 3GRJA 1I2SA 1HLUP 1OT6A 2ZQ7A 3QP8A 3VOZA 3PBRA 3QP1A 3UE3A 4HBTA 1T1CA 3EWKA 2EX9A 1K56D 2HJ9C 4IBRA 3LYXA 2VGLM 4JXWA 2HV1A 1GSXA 2V20A 5EECA 1J3WA 2VV8A 3HUMA 4UA7A 3UN7A 3CPTB 3HLBA 5CHMA 5KSCA 1NXYA 2ZQDA 2L4RA 1K54A 2LB5A 1S4SA 3GQZA 5HX9A 1S1ZA 4CLCC 1PI5A 1YLJA 1EW0A 2Y79A 3MFXA 1YM1A 3GVBA 4GJ4A 4BJPA 2YKHA 4CJNA 3C4PA 4IHQA 4C3QA 4B88A 4EUZA 2PD7A 1GSVA 3A0RA 2ZD8A 2ZOIA 1XA1A 5DFXA 3C30A 5EVLA 2PR5A 4WLAA 2YKFA 4U3TA 4WEKA 3FZCA 3CWFA 4RX2A 4Y13A 1Y28A 1FSYA 1MZUA 5EUAA 5EVID 1VEUA 2A49A 4LENA 3SZTA 3DTMA 3F1PB 2VJWA 4EEUA 5J8XA 1D1JA 2JCHA 2A24B 3UO9A 1K57C 3FC7A 1ES4A 1KVLA 4HJ4A 1NY0A 2CMNA 3H7WB 3E0YA 1YLZA 1BLPA 5F5YA 4FH2A 1MBLA 4EXOA 5D3OA 4MBHA 3QP6A 4QWOA 4R38A 4E3IA 3BLSA 4OPQA 3IT9A 1G6OA 3NCKA 4KUKA 4B4ZA 1S67L 3ZHHA 2V2FF 4MBFA 3PR6A 1CF0A 2P04A 4WMCD 4P85A 4E3LA 2W1TB 4X1LA 4YINA 1SCWA 1H8YA 2JKTI 5HWTA 3QP4A 2GZAA 3FV7A 5EOOA 4ZDXA 1MWSA 2X71A 2WK0A 4I3JA 2J3WA 1T18A 2HP9A 1ODVA 4E6WA 1I2WA 4OQHA 1JVJA 1IYOA 2Z2MB 3TG9A 3ZGAB 2QZ6A 2Z2LB 4QPRA 4EBNA 2WKQA 3MZEA 3CLOA 5DF7A 3FKVA 4LV1A 5L09A 1JWZA 1P9WA 2HZ5A 3C7VA 3P98A 3C7UA 2XD5A 5DFYA 1O7EA 4YWZA 3G6OA 4FOFA 2DMWA 3ZG7B 5FEFA 3HUOA 3CPTA 4C75A 2Y2NA 4L9GA 2W3GA 4NEED 3KSGA 4ESPA 4UQIS 3UB6A 2XROA 4ARZB 2PHYA 3T1RA 4GDNA 1PYYA 3CUEA 3OLOA 4II7A 4KZ8A 4C6YA 5E2EA 3LR3A 1K57A 1PI4A 3LR5A 4MCWA 1PW1A 1F98A 4IUKA 1ESUA 4O7DA 4KZ4A 1KGGA 3IQAA 2WGIA 3CG5A 3O87A 4HIAA 5KIZA 1L0FA 4G3VA 2H28A 4G3WA 2B18A 5HDCA 4DKIA 4IVIA 3NY4A 3VOLA 1K38A 4KENB 5DKKA 4LGWA 5I94A 4S2PA 4S2OA 3SS4A 1LI0A 2K2NA 4DE2A 1N9LA 4IEDA 4L9EA 4OQ0A 2XEPA 1HZOA 2OLUA 3NDGA 4OONA 4Y7PA 3F1PA 5FATA 3V39A 4BQMA 4R6LA 2A24A 5A92A 5EVIB 1HTZA 3D3OA 1K6SA 3GECA 3BEBA 4M4XA 2VLGA 3H7WA 2BG1A 1PIOA 5CGXA 2O9BA 4OPYA 1W8YA 3TOIA 1TDGA 1MWUA 4ETXA 2G2UA 1DJAA 4HI4A 3B3XA 3A0VA 4Z9QA 1ONHA 4E3KA 5CTNA 3A0SA 3TJZC 1E3UD 4GB7A 2D02A 2QHKA 3BFEA 1G68A 4M3KA 4HP4A 4KZ5A 3HL9A 5GHXA 3WRTA 3LICA 3IX4A 2HP6A 3OPPA 3T4JA 3EOIA 4MDZA 4KQDA 3N7WA 3LIEA 4E3JA 4S2NA 3NC8A 1X0OA 5M18A 1LI9A 3IF6C 2W3FA 2Y55A 1Y54A 1OTBA 2WZXA 3O88A 1MC0A 3N8LA 5FQIA 1K6RA 4N9KA 1AXBA 5HZHA 1XP4A 2W1TA 1LL9A 3JVUA 2XA7M 2HJEA 5I5LA 1IFQA 3LFVA 3VOYA 4FSFA 5C5KA 4N1XA 1F9IA 4CLCD 4JGRA 3PAEA 4PPRA 1S66L 3I7JA 2PAVP 2XDMA 5CX7A 4DF6A 3BFDA 5CHJA 3CAXA 2UWXA 3ZYTA 1BT5A 2A3UA 3NIAA 1MY8A 1KDSA 3M2KA 5A8BA 3RH8B 4DXBA 1LHYA 3F1NB 1KE3A 4O0PA 4WZ5C 3CJMA 4KZ6A 1SDNA 3NOTC 4OPRA 4OKPA 1K56A 2J7VA 5DTKA 3RXXA 4DE0A 2GDNA 4LV2A 4ARZA 3IS2B 3LO7A 4PM9A 2LB9A 4ZRRA 2V8CA 3VP1A 1ES3A 3C8CA 4DE1A 4PM5A 5K5BA 1C3BA 3SS3A 4GN2A 1H8MA 5CEDA 2JHEA 4MN7A 1MXOA 3BRMA 5DTSA 3VP4A 4U0TA 3ICYA 3Q7ZA 1SKFA 2DRWA 3IBRA 3WS5A 1PW8A 4HH2A 3V67A 5HPIA 2X02A 3ZG0A 3BQ8A 2W27A 5GHZA 5HDDA 4LCMA 1FQGA 1K54C 2M7VA 3T12B 2IWCA 3MKFA 1M6KA 4P6ZM 2OAQ1 1BSGA 2Y59A 3L9KA 2E8IA 4PHTA 2WKPA 4YFMA 4H6JB 2GJ3A 5EVIA 3BWLA 3KYZA 4HHDA 4O01A 4RVAA 1OTAA 4IVKA 1MKMA 2G2WA 4WUJA 4LRXC 4JF6A 5F82A 2HPBA 1QMEA 2PT7A 1YKDA 3A3JA 3KX0X 2INWA 4WZ4A 3FPWA 3K3CA 1D7EA 4ZTKA 1YLWA 4PM7A 4RQ9A 4RYEA 3M2JA 1VETB 2Y8HA 3IBJA 3OOVA 4KZBA 3G30A 4FCFA 1NYYA 3VP2A 5AQAA 2OAP1 4NK3A 2Q0OA 1IYQA 4WEJA 1OT9A 2HDUA 3IX3A 3MQQA 3G2ZA 3PBNA 2VKSA 1D06A 1QMFA 3Q07A 3W4QA 4Z1WA 3UPPA 4DJ2A 3OPHA 1IOUA 3D4FA 3OBFA 1YSPA 3QP2A 4DE3A 4Y2FA 1YLYA 4MN5A 3G2YA 1ZG4A 5L8MA 2W1RA 5HAQA 1RGZA 4EBPA 3ZCZA 4BBTA 1YT4A 4HJ3A 1MWTA 3A3FA 3DTIA 3VMAA 1LT0A 4GS9B 4HP9A 1GHIA 4KQRA 4KG6A 1BUEA 4JLFA 3F1NA 2RL3A 3KYQA 2Q9NA 3A3EA 4QD4A 2HDQA 1S1YA 1P9RA 1KDWA 5L2FA 3GMWA 4WM9A 1Z6FA 4GLQA 1GSWA 2ZQ8A 2XGNA 2Y2HA 1K55A 2B95A 3IS2A 4PKYG 3IXHA 3CHWP 4H8RA 3V50A 3BJNA 4S2MA 4UHUA 5HWVA 2VGKA 1CQAA 1TD5A 2ZBBA 4PAUA 3MXRA 1WE4A 2WKRA 4P0MA 3CI6A 3HBRA 1AWIA 1ERMA 5J7EA 3DTEA 1L0DA 4MEZA 3G32A 5FSRA 3PBSA 5CRFA 1G5UA 3MR0A 1SHVA 4R3JA 4E3OA 3MKEA 3UMDA 2WAEA 3HJKA 3DWZA 3CUEC 3OC2A 3DBAA 4CLCE 4KQOA 3ZG9B 3RTYA 2QJ7A 3UB7A 2V1AA 3IWOA 5CGWA 2Z6CA 1FR6A 3BYDA 4H6JA 3O5YA 4R4SA 3LY4A 1NJ4A 4S2JA 3PBOA 1LSVA 3SOIA 2EWWA 3GDIA 3LEZA 3A3IA 2O9CA 5IU1A 4N1HA 3WS1A 5F83A 1K4EA 2QYBA 2PRFA 4IJGA 1PWGA 5E2GA 5M19A 4DXCA 2I72A 3RXWA 2GX5A 1EROA 4EQ1A 2VGJA 5IT5A 1E3UA 1Z09A 4NXBA 4EW7A 2OSUA 2PR6A 1LLBA 1DP8A 3BM6A 1YLTA 3DWKA 4P87A 1H5XA 4GDBA 3U4LP 1DP6A 3UDIA 3ISGA 2B5RA 1TS0A 5FA7A 3PHYA 4EEPA 5TBMB 2XRNA 2W3DA 3OCLA 3UNWA 3T4TA 2P9VA 2ZJ9A 3MZDA 3W4PA 2P08A 1IYPA 1JWVA 3PXPA 4DN0A 3NBLA 1FCNA 4GD6A 1H3QA 4QY6A 3OPLA 3UMEA 2O99A 2QMIA 2OWJA 2MJ6A 4S2NC 1S0WA 2NUPC 5EM1A 4XUXA 5HDSA 3ZVTA 5FQ9A 4S2KA 2JC7A 3B47A 5FDSA 3SW1A 4GS9A 3GR2A 3K3DA 3T4SA 3N8RA 1L2SA 3S7NA 2ZM8A 2Y4AA 5GLCA 3SH7A 3QHYA 4BWIA 2IA2A 3GSGA 5EVEA 1YAXA 3C5AA 3A3DA 1RGYA 4UEYA 4JKTA 4EESA 3HVFA 4R23A 5A93A 1TEMA 5HAIA 3DTKA 3FWLA 5G4YA 1OJ5A 1V9ZA 3RJUA 3UPOA 2ZQAA 3DAVA 3IXBA 2H10A 3BW6A 3FKWA 3UB8A 4PM6A 3ZQ5A 3Q7VB 4ZAMA 1I5QA 2BASA 5DTTA 3ZFZA 5GL9A 3TSGA 1TS6A 1A0KA 1W63M 3BECA 3ITBA 2C6WB 4O8GA 2ZC6B 5EE8A 5GLDA 1DY6A 2WGWB 3EGDC 1IYSA 2ZLYA 4GHIB 1CEGA 3NOUC 3N4IA 4GD8A 5GHYA 1XJ6A 4K0XA 3CITA 1KVMA 4JXVA 2J3TC 3AGEA 4LPZA 3Q82A 4JBFA 1P97A 2M7UA 4R70A 4P6BA 4RX3A 3F1OB 3OZHA 4EQIA 3HLGA 5A90A 4EBLA 5LBRA 2V0UA 1ZC2A 3M6BA 1XGIA 2JKRM 4HJ6A 3EEHA 4IUHA 5FASA 5CERA 2B02A 1S4RA 2ZC3B 2C5WB 4Y3IA 5DJTA 5JYOA 3NHQA 4KUOA 5FQJA 2O9AA 3ZNYA 3ZVWA 1CJFA 5EVIC 5GLBA 1UWPX 3OPRA 3MS6A 3VSLA 3WWXA 2W3HA 3JVVA 1CI9A 3DW0A 1GHPA 4X68A 5HARA 3PYPA 5TBMA 3E98A 5CECA 1M40A 1MKIA 3FG8A 3MQOA 1WYCA 5AJGA 2EX6A 2EX8A 3MF0A 3MQ0A 2XH9A 3EEAA 5L07A 3NECA 1ZKJA 3CMZA 3NI9A 4EWFA 2XR0A 2R78A 1BZAA 3CZDA 2Z6DA 4X6TA 4ZJ2A 3S22A 1VQQA 1BYWA 2J9OA 3GV9A 2X01A 5HW3A 3QNCA 4R4RA 1N9BA 4QJGA 1ALQA 5FI2A 4BMWA 4K0WA 4BLMA 4DDSA 1W8QA 5FQKA 2PBYA 4ME4A 1BULA 3T4OA 4ZBEA 2V1BA 2Y2KA 5FL3A 4L9FA 3FPVA 4LV3A 2XF3A 4JGQA 1FILA 1EI5A 2ZM2A 5FAOA 4JPMA 2J9PA 4E6XA 2ZL1B 3BY8A 3HLWA 4I39A 5BOHA 1ES5A 1GHMA 2L1MA 1EWZA 4KG2A 3S4XA 1G28A 1CK3A 4XXRA 4LV0A 4WBGA 4KZ3A 3UY6A 2QPNA 5F6AA 3V3RA 3T4LA 4X69A 3LIDA 4X55A 1GCEA 3FYZA 3E2KA 4D2OA 3G4PA 3Q7VA 2JKGA 2WKEA 5HL6A 5TR7A 3KO6A 1PWCA 2VX8A 4QB8A 3R7WB 1K55C 4HESA 4XT2B 1VB6A 1VEUB 4BENA 2WAFA 4CQHA 1XFNA 1BLSA 3PTEA 2WGWA 2PU4A 2Y2MA 2VK3A 5F68A 4GHIA 4P6ZS 3WS4A 3HCYA 4B4XA 1PNEA 1PZOA 1FIKA 2UV0E 3K2NA 1V9YA 2P74A 4LLOB 5TJJA 2Y2OA 3HREA 4FTXA 4OLDA 4BD1A 1GA9A 2WKHA 3W8KA 2H0TA 1GA0A 1H0MA 1FSWA 4OPZA 1RCJA 1S6RA 4JXGA 4BL2A 1IELA 3F1OA 1YQSA 4ETZA 3B33A 2XQZA 4ZJ3A 1XPBA 4G3KA 1ES2A 2VZWA 1IKIA 2GNXA 4CPKA 4JGOA 3MFDA 2IWBA 2VEAA 3VE4A 2Y2GA 5A91A 2Y2PA 2Y2LA 1OTIA 2HF6A 3HLEA 3HLDA 4OOLA 4Y17A 3H82B 4S2IA 2EFUA 2EWVA 3ZNTA 1CI8A 1KGFA 1YPRA 4WMCA 3LCEA 4E3NA 2ACGA 4X56A 3LR4A 1CEFA 1TS8A 1TDLA 1LL5A 3EQUA 3P09A 1FR1A 1KGEA 5IS1A 2EXBA 3HJIA 4CLCB 5HAPA 4BD0A 4OQIA 5FDHA 5HL1A 4OVDA 1N4OA 3VP0A 1MWRA 5J4EA 2V0WA 3PBTA 4OOYA 1JWPA 1YMSA 2ZQCA 2XFTA 1KOUA 3M6HA 4R3BA 5CXWA 2Y91A 5FQQA 5GLAA 2DNSA 4B93A 2VGLS 1BLHA 5U47A 2ZC5B 5DF9A 4F3LB 4K91A 3SS5A 4BBUA 2PU2A 3OCNA 4MMNA 3VSKA 2HP5A 5F1FA 4MNRA 4HBUA 2EFXA 3QNBA 4KG5A 2Y2JA 1OJGA 3T1XA 5HSQA 5HD3A 2J3TD 4N9LA 5AVFA 3VP3A 4D60A 2PBDP 1NRFA 1DRMA 3BLMA 5HFOA 2ZL1A 3LUQA 2FFYA 3KSIA 2M1CA 4WL9A 5EPHA 3U2AA 5JYPA 4UAAA 1XXMA 2E8JA 3IHAA 1T1BA 2JKTM 5DVAA 1W79A 4OOMA 4XUZA 3E4QA 1ESIA 2ZC7A 3IF5A 3JYIA 3V3SA 3NJAA 5EV0A 1Y4OA 4MN6A 1PZPA 1KE0A 4WF0A 2JBFA 1TVFA 2K31A 3PBQA 3R7WA 1LSXA 3IH9A 4XT2A 5AQBA 3IXGA 3EGXC 2BTFP 2VA0A 3BQAA 4KZAA 4LFUA 3KYEA 4OP8A 3T4KA 2HGVA 2FH5A 1PFLA 1STZA 5M1AA 4JF4A 1BLCA 4AFIA 4NXFA 4F94A 2KX6A 3UDFA 5E43A 4KZ9A 1BTLA 2I9VA 3WRZA 2QWSA 4EUVA 2JKFA 3VV4A 3UB5P 4DMZA 4QU3A 5KMWA 3MXSA 1VETA 3NOPC 3RFBA 2ZOHA 3QP5A 4LRYC 1WA9A 4E3MA 3HLCA 4IBXA 5CGSA 3MXQA 1F2KA 1H8ZA 3SH9A 3IWQA 4BL3A 3S7PA 3H82A 1Q2PA 1T19A 1T1AA 4Y0UA 3IH8A 1XJ4A 4OLGA 3BFFA 1DP9A 3C38A 1N9NA 5DJUA 5FAPA 3SH8A 5HD5A 2ZMFA 1IEMA 2HDSA 1F5MA 3G31A 4EETB 3W4OA 3JPUA 4CLCA 1L0EA 3KSHA 2D01A 4HNBA 4GCZA 2P7JA 3IXDA 2FFFB 4I5SA 3UE6A 2PD8A 4PKYA 5AVEA 3C2WA 2AVXA 1WYBA 5TGFA 2KOIA 2G7UA 3TE8A 4MBKA 2Q9MA 2W0NA 5HWWA 1Q2QA 4UQIM 1NLZA 4F3LA 1OTDA 4WN5A 3D72A 1HD8A 2OWHA 3ULFA 2KDKA 3W2ZA 5CTMA 3AGDA 2XLNA 5E2FA 2IWDA 1XX2A 1SDEA 2EA9A 3Q1FA 4DRTA 1FCMA 4Q0HA 1OMEA 3MBZA 4JXSA 1KE4A 1OTEA 1JTGA 2ZC4B 4A5RA 1E4DA 1W63Q 2PYPA 2NUTC 4QY5A 5CEBA 4R1GA 4HOIA 3N6IA 3ZG8B 1PRQA 5KZHA 2XD1A 4Q0IA 4OH0A 4I3AA 3T1SA 5FI7A 2J80A 5KSHA 4ZJ1A 3E4OA 3LI9A 5EFWA 3IF6B 1JNUA 1XGJA 2CC1A 1P0ZA 3MMHA 1K25A 4R3AA 4LRZE 4GOGA 3IWIA 4NG2A
chains in the Genus database with same CATH topology
2L1MA 4HP9A 3UB9A 1G28A 2W1TB 4HQAA 4K08A 3F1NA 1YSQA 5F6AA 2JKTI 3KYQA 3T4LA 3VE3A 2VV6A 5HWTA 3LIDA 2GZAA 1S1YA 1P9RA 4GLQA 4I3JA 2J3WA 1GSWA 4NKPA 1T18A 1XFQA 1ODVA 5HL6A 3P7NA 3KO6A 5J3WA 2VX8A 3IS2A 4PKYG 3R7WB 3BJNA 4XT2B 1VB6A 2QKPA 2PYRA 4CQHA 1XFNA 4QPRA 5HWVA 4EERA 2WKQA 3CLOA 4I3IA 1TD5A 4WELA 2ZBBA 4PAUA 5F68A 4GHIA 4P6ZS 4HH3A 2WKRA 3HCYA 3CI6A 1NRJA 2XSSA 1P9WA 3K2NA 1V9YA 4LLOB 2V9AA 5TJJA 5J7EA 5DFYA 2XA7S 2OOLA 4YWZA 5HPFA 3G6OA 4FOFA 3T50A 2DMWA 3H9WA 3PBSA 2KLIA 2W3GA 3F1OA 3KSGA 3MR0A 4L9GA 4NEED 4UQIS 3UB6A 2XROA 4ARZB 2PHYA 4E04A 4ETZA 3UMDA 3B33A 3HJKA 4II7A 3CUEA 3OLOA 4G3KA 2O0YA 2VZWA 3LIAA 1LSWA 3LR3A 3CUEC 4I38A 3LR5A 4MCWA 3OC2A 2GNXA 1F98A 3DBAA 4CLCE 4IUKA 4JGOA 4KQOA 5DKLA 3RTYA 2QJ7A 3UB7A 4EU0A 2JN7A 2VEAA 3VE4A 1OTIA 2HF6A 2V1AA 4OOLA 3H82B 2Z6CA 2EWVA 4HIAA 5KIZA 4H6JA 1NWZA 3O5YA 4G3VA 2H28A 3TRCA 4G3WA 2B18A 3LR4A 5HDCA 1TS8A 5G4ZA 3VOLA 1UWNX 5MC7A 3PBOA 3EQUA 1LSVA 5DKKA 2EWWA 3GDIA 2O9CA 5IS1A 3LIBA 5IU1A 2QYBA 2K7SA 2JKRI 2K2NA 4IJGA 1N9LA 3HJIA 4CLCB 4L9EA 4NXEA 2GX5A 3EQVA 5J4EA 3F1PA 4EQ1A 2V0WA 3PBTA 5IT5A 3R4KA 4NXBA 4EW7A 4R6LA 3KSFA 2PDRA 2A24A 2PR6A 1ZTUA 1KOUA 3D3OA 1DP8A 1LL8A 3GECA 1TS7A 4M4XA 3S7OA 4B93A 2VGLS 2VLGA 2VV7A 3H7WA 1N9OA 2O9BA 1DP6A 4Q0JA 4B9OA 3TW8A 4ETXA 1TS0A 5DF9A 4F3LB 4HI4A 4YOFA 3A0VA 3PHYA 1XJ2A 4BBUA 4EEPA 5TBMB 2XRNA 3OCNA 2W3DA 4MMNA 3A0SA 3TJZC 1VHMA 3OCLA 4BBVA 2D02A 2L0WA 2QHKA 4HP4A 3T4TA 3BY9A 4L0LA 3LICA 2P08A 1UGUA 3T4JA 3EOIA 4MDZA 4KQDA 3PXPA 3T4QA 4DN0A 1OJGA 3LIEA 1H3QA 2A2LA 5HSQA 4NXGA 3UMEA 1X0OA 2O99A 2J3TD 5HD3A 2OWJA 5AVFA 2MJ6A 2NUPC 1DRMA 2W3FA 5HDSA 1OTBA 3B47A 1MC0A 3SW1A 4GS9A 3LUQA 3KSIA 2M1CA 4WL9A 2FZ0A 3U2AA 3K3DA 3T4SA 2W1TA 5HZHA 3JVUA 2XA7M 2HJEA 1NLYA 4GW9A 5I5LA 3B42A 1IFQA 1T1BA 3LFVA 3S7NA 4FSFA 2JKTM 4DJ3A 5C5KA 1F9IA 4OOMA 4BWIA 4CLCD 3E4QA 4JGRA 2IA2A 3NJAA 1S66L 1TF1A 5CX7A 4MN6A 3CAXA 4WF0A 4Y5FA 1YAXA 3ZYTA 2K31A 3PBQA 3R7WA 4JGPA 1LSXA 4XT2A 4UEYA 4EESA 4YNRA 1ZHHB 3EGXC 2VA0A 3BQAA 1OPXA 3T4KA 3LI8A 4HY8A 2HGVA 2FH5A 5A8BA 3RH8B 1XJ3A 3LIFA 3P01A 1STZA 2ZMVA 5G4YA 1OJ5A 3F1NB 1V9ZA 4O0PA 2QJ5A 4AFIA 3NOTC 3BW6A 4NXFA 3E4PA 2KX6A 2W3EA 5F69A 3UB8A 2I9VA 3ZQ5A 2QWSA 4EUVA 3S7QA 2BASA 3VV4A 4DMZA 4ARZA 3IS2B 3LR0A 1TS6A 3MJQA 3NOPC 1W63M 3RFBA 2ZOHA 2LB9A 4LRYC 1WA9A 4O8GA 4ZRRA 1OT6A 3C8CA 5K5BA 3PBRA 3UE3A 3MXQA 3EGDC 1T1CA 4GHIB 1H8MA 3EWKA 2JHEA 3NOUC 4MN7A 2HJ9C 1XJ6A 3CITA 3S7PA 3H82A 3LYXA 1T19A 1T1AA 2VGLM 2HV1A 1XJ4A 2J3TC 3ICYA 1GSXA 4LPZA 1P97A 3IBRA 2VV8A 2M7UA 1DP9A 3C38A 4HH2A 1N9NA 3V67A 5HPIA 4R70A 5DJUA 3F1OB 5HD5A 2ZMFA 3BQ8A 2W27A 5HDDA 2L4RA 2LB5A 1S4SA 1F5MA 2V0UA 5LBRA 4EETB 2M7VA 1S1ZA 2JKRM 4CLCA 3KSHA 2D01A 4HJ6A 4HNBA 3EEHA 4GCZA 2P7JA 4CLCC 4P6ZM 1EW0A 4IUHA 2OAQ1 2Y79A 3MFXA 2B02A 4GJ4A 1S4RA 4BJPA 2YKHA 4I5SA 4PHTA 3UE6A 2WKPA 2PD8A 4Y3IA 5DJTA 4H6JB 2GJ3A 3NHQA 4KUOA 2O9AA 3BWLA 3KYZA 4HHDA 4O01A 4PKYA 4IHQA 5AVEA 3C2WA 1UWPX 1OTAA 2KOIA 1MKMA 2G7UA 2PD7A 3TE8A 1GSVA 3A0RA 2ZOIA 2W0NA 5DFXA 5HWWA 4WUJA 4LRXC 4UQIM 3C30A 1NLZA 2PT7A 1YKDA 2PR5A 2W3HA 4WLAA 2YKFA 3JVVA 3KX0X 4F3LA 2INWA 3FPWA 1OTDA 3PYPA 4WEKA 4WN5A 5TBMA 3CWFA 3K3CA 3D72A 3E98A 2OWHA 1Y28A 1MZUA 3ULFA 1D7EA 3FG8A 2KDKA 3W2ZA 3MQOA 5AJGA 4RQ9A 3F1PB 2Y8HA 3MF0A 3IBJA 3MQ0A 3OOVA 2VJWA 3EEAA 2EA9A 4EEUA 4Q0HA 2A24B 1OTEA 2OAP1 2R78A 3FC7A 4HJ4A 1W63Q 2CMNA 2PYPA 2NUTC 2Z6DA 3E0YA 3H7WB 4WEJA 1OT9A 4HOIA 5F5YA 1BYWA 3MQQA 4EXOA 3PBNA 4Q0IA 2VKSA 1D06A 4Z1WA 4I3AA 4DJ2A 4R38A 2J80A 5KSHA 1IOUA 3E4OA 3OBFA 4BMWA 1YSPA 1G6OA 4Y2FA 4MN5A 4KUKA 3LI9A 5L8MA 2W1RA 5EFWA 1JNUA 4ME4A 3T4OA 2V1BA 1S67L 5FL3A 4L9FA 3FPVA 3PR6A 4JGQA 1P0ZA 2P04A 3MMHA 4BBTA 4R3AA 4LRZE 4HJ3A 3BY8A 4I39A 1LT0A 4GS9B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2L1M A;  4HP9 A;  3UB9 A;  1G28 A;  4HQA A;  4K08 A;  3F1N A;  5F6A A;  3VE3 A;  2VV6 A;  5HWT A;  3LID A;  1S1Y A;  4I3J A;  1GSW A;  1T18 A;  1XFQ A;  1ODV A;  3P7N A;  5J3W A;  3IS2 A;  4PKY G;  4XT2 B;  1VB6 A;  2QKP A;  2PYR A;  1XFN A;  5HWV A;  4EER A;  2WKQ A;  3CLO A;  4I3I A;  2ZBB A;  5F68 A;  4GHI A;  4HH3 A;  2WKR A;  4LLO B;  1V9Y A;  2V9A A;  5J7E A;  2OOL A;  4YWZ A;  3G6O A;  3T50 A;  3H9W A;  3F1O A;  3MR0 A;  4L9G A;  3UB6 A;  2PHY A;  4E04 A;  3UMD A;  3B33 A;  3HJK A;  3OLO A;  3LIA A;  1LSW A;  4I38 A;  1F98 A;  4JGO A;  5DKL A;  3RTY A;  2QJ7 A;  3UB7 A;  2JN7 A;  2VEA A;  3VE4 A;  1OTI A;  2V1A A;  3H82 B;  2Z6C A;  4HIA A;  5KIZ A;  4H6J A;  1NWZ A;  2H28 A;  5HDC A;  1TS8 A;  5G4Z A;  3VOL A;  1UWN X;  1LSV A;  5DKK A;  3GDI A;  5IS1 A;  3LIB A;  5IU1 A;  2K7S A;  1N9L A;  3HJI A;  4L9E A;  4NXE A;  5J4E A;  3F1P A;  4EQ1 A;  2V0W A;  4NXB A;  4EW7 A;  4R6L A;  2PDR A;  2A24 A;  2PR6 A;  1KOU A;  1DP8 A;  1LL8 A;  3GEC A;  1TS7 A;  4M4X A;  2VLG A;  2VV7 A;  3H7W A;  1N9O A;  1DP6 A;  4B9O A;  1TS0 A;  4F3L B;  4HI4 A;  3A0V A;  3PHY A;  1XJ2 A;  4BBU A;  4EEP A;  5TBM B;  3A0S A;  4BBV A;  2D02 A;  2L0W A;  2QHK A;  4HP4 A;  3BY9 A;  3LIC A;  1UGU A;  4KQD A;  1OJG A;  3LIE A;  5HSQ A;  4NXG A;  3UME A;  1X0O A;  5HD3 A;  2OWJ A;  5AVF A;  1DRM A;  5HDS A;  1OTB A;  3SW1 A;  4GS9 A;  3LUQ A;  2M1C A;  4WL9 A;  3K3D A;  5HZH A;  4GW9 A;  5I5L A;  1T1B A;  4DJ3 A;  1F9I A;  3E4Q A;  4JGR A;  3NJA A;  1S66 L;  4MN6 A;  3CAX A;  4WF0 A;  4JGP A;  1LSX A;  4XT2 A;  4EES A;  3LI8 A;  4HY8 A;  5A8B A;  3RH8 B;  1XJ3 A;  3LIF A;  5G4Y A;  1OJ5 A;  3F1N B;  1V9Z A;  2QJ5 A;  3NOT C;  4NXF A;  3E4P A;  2KX6 A;  5F69 A;  3UB8 A;  2I9V A;  3ZQ5 A;  2QWS A;  2BAS A;  3IS2 B;  1TS6 A;  3MJQ A;  3NOP C;  2ZOH A;  4LRY C;  1WA9 A;  1OT6 A;  3C8C A;  3MXQ A;  1T1C A;  4GHI B;  3EWK A;  2JHE A;  3NOU C;  1XJ6 A;  3H82 A;  3LYX A;  1T19 A;  1T1A A;  2HV1 A;  1XJ4 A;  3ICY A;  1GSX A;  4LPZ A;  1P97 A;  3IBR A;  2VV8 A;  1DP9 A;  4HH2 A;  1N9N A;  4R70 A;  5DJU A;  3F1O B;  5HD5 A;  2W27 A;  5HDD A;  2L4R A;  1S4S A;  2V0U A;  4EET B;  1S1Z A;  2D01 A;  4HJ6 A;  4HNB A;  4GCZ A;  3EEH A;  2P7J A;  1EW0 A;  3MFX A;  2B02 A;  1S4R A;  2YKH A;  4I5S A;  3UE6 A;  2WKP A;  2PD8 A;  5DJT A;  4H6J B;  2GJ3 A;  3NHQ A;  4KUO A;  3BWL A;  4HHD A;  4PKY A;  5AVE A;  3C2W A;  1UWP X;  1OTA A;  2PD7 A;  1GSV A;  3A0R A;  2ZOI A;  2W0N A;  5HWW A;  4WUJ A;  4LRX C;  2PR5 A;  4WLA A;  2YKF A;  3KX0 X;  4F3L A;  2INW A;  1OTD A;  3PYP A;  4WN5 A;  5TBM A;  3CWF A;  3K3C A;  3D72 A;  2OWH A;  1Y28 A;  1MZU A;  3ULF A;  1D7E A;  3FG8 A;  2KDK A;  3MQO A;  4RQ9 A;  3F1P B;  2EA9 A;  4EEU A;  2A24 B;  1OTE A;  2R78 A;  3FC7 A;  4HJ4 A;  2PYP A;  2CMN A;  2Z6D A;  3H7W B;  1OT9 A;  4HOI A;  5F5Y A;  1BYW A;  3MQQ A;  4EXO A;  1D06 A;  4I3A A;  4DJ2 A;  4R38 A;  2J80 A;  3E4O A;  4MN5 A;  4KUK A;  3LI9 A;  5EFW A;  1JNU A;  2V1B A;  1S67 L;  4L9F A;  4JGQ A;  1P0Z A;  4BBT A;  4R3A A;  4LRZ E;  4HJ3 A;  3BY8 A;  4I39 A;  1LT0 A;  4GS9 B; 
#chains in the Genus database with same CATH topology
 3UB9 A;  1FCO A;  4HQA A;  4K08 A;  1ACF A;  3BFC A;  1YSQ A;  1XKZ A;  4RA7 A;  3VE3 A;  2R9X A;  2VV6 A;  5FI6 A;  3ZDJ A;  1NZO A;  3WS0 A;  2H0Y A;  1RP5 A;  1SKO B;  2BLS A;  4NKP A;  4GZB A;  4NET A;  5TFQ A;  1XFQ A;  3VFF A;  3P7N A;  5J3W A;  3L7H A;  4KQQ A;  1FOF A;  3O86 A;  2QKP A;  1W7F A;  3WS2 A;  2PYR A;  2EXA A;  1U60 A;  4EER A;  1PWD A;  4I3I A;  1K4F A;  4WEL A;  3LY3 A;  2HDR A;  4HH3 A;  4OP5 A;  1VM1 A;  1NRJ A;  4X53 A;  2XSS A;  3HLF A;  3LEQ A;  2V9A A;  4HEF A;  4R0Q A;  2XA7 S;  4EV4 A;  2OOL A;  5HPF A;  3T50 A;  3H9W A;  3IX8 A;  2KLI A;  2ZMA A;  5FEG A;  3T1Q B;  2ZM0 A;  5FAQ A;  4E04 A;  1DJB A;  1JTD A;  4X1M A;  1K0K A;  2O0Y A;  3LIA A;  1LSW A;  3S1Y A;  1IKG A;  4I38 A;  1DJC A;  2Y2I A;  5DKL A;  4EU0 A;  2JN7 A;  3HUN A;  1E25 A;  4Y15 A;  1J9M A;  1NWZ A;  3TRC A;  4MLL A;  1NYM A;  2XK1 A;  5G4Z A;  4U0X A;  1UWN X;  4OQG A;  5MC7 A;  3MZF A;  2WYX A;  2R9W A;  3LIB A;  3C4O A;  5EOE A;  3PAG A;  2K7S A;  3AGF A;  2JKR I;  1L3L A;  1ONG A;  2OLV A;  3ITA A;  3LGO A;  4N92 A;  4NXE A;  4Y0O A;  5DF8 A;  4UA6 A;  3NDE A;  3EQV A;  5G18 A;  2ZQ9 A;  3R4K A;  2XFS A;  3KSF A;  2PDR A;  4QHC A;  1ZTU A;  5AQ9 A;  4S2L A;  2WUQ A;  1LL8 A;  4JF5 A;  1TS7 A;  3UE0 A;  3S7O A;  1SZV A;  2VV7 A;  4ID4 A;  1N9O A;  2WAD A;  4B9O A;  4Q0J A;  2H5S A;  4FD8 A;  3TW8 A;  4FH4 A;  2J8Y A;  5FQM A;  4YOF A;  1XJ2 A;  2DCF A;  1VHM A;  4BBV A;  2RCX A;  2L0W A;  5CHU A;  1O07 A;  3N8S A;  3BY9 A;  1ERQ A;  3MSH A;  4GKU A;  4L0L A;  2V8F A;  1UGU A;  4WYY A;  2WGV A;  3T4Q A;  3UDX A;  3IF6 A;  5EM0 A;  2A2L A;  4NXG A;  3NUL A;  5E2H A;  3G35 A;  3VFH A;  4GNU A;  3O3V A;  3ZG5 A;  4LCL A;  1MPL A;  1L0G A;  2FZ0 A;  3G34 A;  5AQ7 A;  1NLY A;  4GW9 A;  2EX2 A;  3B42 A;  1NZU A;  4DJ3 A;  2Y2Q A;  1YMX A;  4PM8 A;  3GTC A;  4FUW A;  2JE5 A;  3D9Y A;  1W5D A;  1SKO A;  4X25 A;  1TF1 A;  3UPN A;  3V5M A;  4Y5F A;  4JGP A;  4UA9 A;  1XA7 A;  3UE1 A;  4YNR A;  1ZHH B;  1OPX A;  1ZG6 A;  3LI8 A;  4HY8 A;  1XJ3 A;  3LIF A;  2OV5 A;  3E2L A;  3P01 A;  2ZMV A;  4DDY A;  4Q8I A;  1YLP A;  4WZ5 A;  1HVB A;  5L10 A;  4PMA A;  2QJ5 A;  5IHV A;  3Q81 A;  3E4P A;  2W3E A;  4Y0T A;  2WZZ A;  5F69 A;  2V1Z A;  3BFG A;  3S7Q A;  5F1G A;  1G6A A;  3LR0 A;  2WKI A;  4KZ7 A;  3IHB A;  3MJQ A;  2P9V B;  3GRJ A;  1I2S A;  1HLU P;  1OT6 A;  2ZQ7 A;  3QP8 A;  3VOZ A;  3PBR A;  3QP1 A;  3UE3 A;  4HBT A;  1T1C A;  3EWK A;  2EX9 A;  1K56 D;  2HJ9 C;  4IBR A;  3LYX A;  2VGL M;  4JXW A;  2HV1 A;  1GSX A;  2V20 A;  5EEC A;  1J3W A;  2VV8 A;  3HUM A;  4UA7 A;  3UN7 A;  3CPT B;  3HLB A;  5CHM A;  5KSC A;  1NXY A;  2ZQD A;  2L4R A;  1K54 A;  2LB5 A;  1S4S A;  3GQZ A;  5HX9 A;  1S1Z A;  4CLC C;  1PI5 A;  1YLJ A;  1EW0 A;  2Y79 A;  3MFX A;  1YM1 A;  3GVB A;  4GJ4 A;  4BJP A;  2YKH A;  4CJN A;  3C4P A;  4IHQ A;  4C3Q A;  4B88 A;  4EUZ A;  2PD7 A;  1GSV A;  3A0R A;  2ZD8 A;  2ZOI A;  1XA1 A;  5DFX A;  3C30 A;  5EVL A;  2PR5 A;  4WLA A;  2YKF A;  4U3T A;  4WEK A;  3FZC A;  3CWF A;  4RX2 A;  4Y13 A;  1Y28 A;  1FSY A;  1MZU A;  5EUA A;  5EVI D;  1VEU A;  2A49 A;  4LEN A;  3SZT A;  3DTM A;  3F1P B;  2VJW A;  4EEU A;  5J8X A;  1D1J A;  2JCH A;  2A24 B;  3UO9 A;  1K57 C;  3FC7 A;  1ES4 A;  1KVL A;  4HJ4 A;  1NY0 A;  2CMN A;  3H7W B;  3E0Y A;  1YLZ A;  1BLP A;  5F5Y A;  4FH2 A;  1MBL A;  4EXO A;  5D3O A;  4MBH A;  3QP6 A;  4QWO A;  4R38 A;  4E3I A;  3BLS A;  4OPQ A;  3IT9 A;  1G6O A;  3NCK A;  4KUK A;  4B4Z A;  1S67 L;  3ZHH A;  2V2F F;  4MBF A;  3PR6 A;  1CF0 A;  2P04 A;  4WMC D;  4P85 A;  4E3L A;  2W1T B;  4X1L A;  4YIN A;  1SCW A;  1H8Y A;  2JKT I;  5HWT A;  3QP4 A;  2GZA A;  3FV7 A;  5EOO A;  4ZDX A;  1MWS A;  2X71 A;  2WK0 A;  4I3J A;  2J3W A;  1T18 A;  2HP9 A;  1ODV A;  4E6W A;  1I2W A;  4OQH A;  1JVJ A;  1IYO A;  2Z2M B;  3TG9 A;  3ZGA B;  2QZ6 A;  2Z2L B;  4QPR A;  4EBN A;  2WKQ A;  3MZE A;  3CLO A;  5DF7 A;  3FKV A;  4LV1 A;  5L09 A;  1JWZ A;  1P9W A;  2HZ5 A;  3C7V A;  3P98 A;  3C7U A;  2XD5 A;  5DFY A;  1O7E A;  4YWZ A;  3G6O A;  4FOF A;  2DMW A;  3ZG7 B;  5FEF A;  3HUO A;  3CPT A;  4C75 A;  2Y2N A;  4L9G A;  2W3G A;  4NEE D;  3KSG A;  4ESP A;  4UQI S;  3UB6 A;  2XRO A;  4ARZ B;  2PHY A;  3T1R A;  4GDN A;  1PYY A;  3CUE A;  3OLO A;  4II7 A;  4KZ8 A;  4C6Y A;  5E2E A;  3LR3 A;  1K57 A;  1PI4 A;  3LR5 A;  4MCW A;  1PW1 A;  1F98 A;  4IUK A;  1ESU A;  4O7D A;  4KZ4 A;  1KGG A;  3IQA A;  2WGI A;  3CG5 A;  3O87 A;  4HIA A;  5KIZ A;  1L0F A;  4G3V A;  2H28 A;  4G3W A;  2B18 A;  5HDC A;  4DKI A;  4IVI A;  3NY4 A;  3VOL A;  1K38 A;  4KEN B;  5DKK A;  4LGW A;  5I94 A;  4S2P A;  4S2O A;  3SS4 A;  1LI0 A;  2K2N A;  4DE2 A;  1N9L A;  4IED A;  4L9E A;  4OQ0 A;  2XEP A;  1HZO A;  2OLU A;  3NDG A;  4OON A;  4Y7P A;  3F1P A;  5FAT A;  3V39 A;  4BQM A;  4R6L A;  2A24 A;  5A92 A;  5EVI B;  1HTZ A;  3D3O A;  1K6S A;  3GEC A;  3BEB A;  4M4X A;  2VLG A;  3H7W A;  2BG1 A;  1PIO A;  5CGX A;  2O9B A;  4OPY A;  1W8Y A;  3TOI A;  1TDG A;  1MWU A;  4ETX A;  2G2U A;  1DJA A;  4HI4 A;  3B3X A;  3A0V A;  4Z9Q A;  1ONH A;  4E3K A;  5CTN A;  3A0S A;  3TJZ C;  1E3U D;  4GB7 A;  2D02 A;  2QHK A;  3BFE A;  1G68 A;  4M3K A;  4HP4 A;  4KZ5 A;  3HL9 A;  5GHX A;  3WRT A;  3LIC A;  3IX4 A;  2HP6 A;  3OPP A;  3T4J A;  3EOI A;  4MDZ A;  4KQD A;  3N7W A;  3LIE A;  4E3J A;  4S2N A;  3NC8 A;  1X0O A;  5M18 A;  1LI9 A;  3IF6 C;  2W3F A;  2Y55 A;  1Y54 A;  1OTB A;  2WZX A;  3O88 A;  1MC0 A;  3N8L A;  5FQI A;  1K6R A;  4N9K A;  1AXB A;  5HZH A;  1XP4 A;  2W1T A;  1LL9 A;  3JVU A;  2XA7 M;  2HJE A;  5I5L A;  1IFQ A;  3LFV A;  3VOY A;  4FSF A;  5C5K A;  4N1X A;  1F9I A;  4CLC D;  4JGR A;  3PAE A;  4PPR A;  1S66 L;  3I7J A;  2PAV P;  2XDM A;  5CX7 A;  4DF6 A;  3BFD A;  5CHJ A;  3CAX A;  2UWX A;  3ZYT A;  1BT5 A;  2A3U A;  3NIA A;  1MY8 A;  1KDS A;  3M2K A;  5A8B A;  3RH8 B;  4DXB A;  1LHY A;  3F1N B;  1KE3 A;  4O0P A;  4WZ5 C;  3CJM A;  4KZ6 A;  1SDN A;  3NOT C;  4OPR A;  4OKP A;  1K56 A;  2J7V A;  5DTK A;  3RXX A;  4DE0 A;  2GDN A;  4LV2 A;  4ARZ A;  3IS2 B;  3LO7 A;  4PM9 A;  2LB9 A;  4ZRR A;  2V8C A;  3VP1 A;  1ES3 A;  3C8C A;  4DE1 A;  4PM5 A;  5K5B A;  1C3B A;  3SS3 A;  4GN2 A;  1H8M A;  5CED A;  2JHE A;  4MN7 A;  1MXO A;  3BRM A;  5DTS A;  3VP4 A;  4U0T A;  3ICY A;  3Q7Z A;  1SKF A;  2DRW A;  3IBR A;  3WS5 A;  1PW8 A;  4HH2 A;  3V67 A;  5HPI A;  2X02 A;  3ZG0 A;  3BQ8 A;  2W27 A;  5GHZ A;  5HDD A;  4LCM A;  1FQG A;  1K54 C;  2M7V A;  3T12 B;  2IWC A;  3MKF A;  1M6K A;  4P6Z M;  2OAQ 1;  1BSG A;  2Y59 A;  3L9K A;  2E8I A;  4PHT A;  2WKP A;  4YFM A;  4H6J B;  2GJ3 A;  5EVI A;  3BWL A;  3KYZ A;  4HHD A;  4O01 A;  4RVA A;  1OTA A;  4IVK A;  1MKM A;  2G2W A;  4WUJ A;  4LRX C;  4JF6 A;  5F82 A;  2HPB A;  1QME A;  2PT7 A;  1YKD A;  3A3J A;  3KX0 X;  2INW A;  4WZ4 A;  3FPW A;  3K3C A;  1D7E A;  4ZTK A;  1YLW A;  4PM7 A;  4RQ9 A;  4RYE A;  3M2J A;  1VET B;  2Y8H A;  3IBJ A;  3OOV A;  4KZB A;  3G30 A;  4FCF A;  1NYY A;  3VP2 A;  5AQA A;  2OAP 1;  4NK3 A;  2Q0O A;  1IYQ A;  4WEJ A;  1OT9 A;  2HDU A;  3IX3 A;  3MQQ A;  3G2Z A;  3PBN A;  2VKS A;  1D06 A;  1QMF A;  3Q07 A;  3W4Q A;  4Z1W A;  3UPP A;  4DJ2 A;  3OPH A;  1IOU A;  3D4F A;  3OBF A;  1YSP A;  3QP2 A;  4DE3 A;  4Y2F A;  1YLY A;  4MN5 A;  3G2Y A;  1ZG4 A;  5L8M A;  2W1R A;  5HAQ A;  1RGZ A;  4EBP A;  3ZCZ A;  4BBT A;  1YT4 A;  4HJ3 A;  1MWT A;  3A3F A;  3DTI A;  3VMA A;  1LT0 A;  4GS9 B;  4HP9 A;  1GHI A;  4KQR A;  4KG6 A;  1BUE A;  4JLF A;  3F1N A;  2RL3 A;  3KYQ A;  2Q9N A;  3A3E A;  4QD4 A;  2HDQ A;  1S1Y A;  1P9R A;  1KDW A;  5L2F A;  3GMW A;  4WM9 A;  1Z6F A;  4GLQ A;  1GSW A;  2ZQ8 A;  2XGN A;  2Y2H A;  1K55 A;  2B95 A;  3IS2 A;  4PKY G;  3IXH A;  3CHW P;  4H8R A;  3V50 A;  3BJN A;  4S2M A;  4UHU A;  5HWV A;  2VGK A;  1CQA A;  1TD5 A;  2ZBB A;  4PAU A;  3MXR A;  1WE4 A;  2WKR A;  4P0M A;  3CI6 A;  3HBR A;  1AWI A;  1ERM A;  5J7E A;  3DTE A;  1L0D A;  4MEZ A;  3G32 A;  5FSR A;  3PBS A;  5CRF A;  1G5U A;  3MR0 A;  1SHV A;  4R3J A;  4E3O A;  3MKE A;  3UMD A;  2WAE A;  3HJK A;  3DWZ A;  3CUE C;  3OC2 A;  3DBA A;  4CLC E;  4KQO A;  3ZG9 B;  3RTY A;  2QJ7 A;  3UB7 A;  2V1A A;  3IWO A;  5CGW A;  2Z6C A;  1FR6 A;  3BYD A;  4H6J A;  3O5Y A;  4R4S A;  3LY4 A;  1NJ4 A;  4S2J A;  3PBO A;  1LSV A;  3SOI A;  2EWW A;  3GDI A;  3LEZ A;  3A3I A;  2O9C A;  5IU1 A;  4N1H A;  3WS1 A;  5F83 A;  1K4E A;  2QYB A;  2PRF A;  4IJG A;  1PWG A;  5E2G A;  5M19 A;  4DXC A;  2I72 A;  3RXW A;  2GX5 A;  1ERO A;  4EQ1 A;  2VGJ A;  5IT5 A;  1E3U A;  1Z09 A;  4NXB A;  4EW7 A;  2OSU A;  2PR6 A;  1LLB A;  1DP8 A;  3BM6 A;  1YLT A;  3DWK A;  4P87 A;  1H5X A;  4GDB A;  3U4L P;  1DP6 A;  3UDI A;  3ISG A;  2B5R A;  1TS0 A;  5FA7 A;  3PHY A;  4EEP A;  5TBM B;  2XRN A;  2W3D A;  3OCL A;  3UNW A;  3T4T A;  2P9V A;  2ZJ9 A;  3MZD A;  3W4P A;  2P08 A;  1IYP A;  1JWV A;  3PXP A;  4DN0 A;  3NBL A;  1FCN A;  4GD6 A;  1H3Q A;  4QY6 A;  3OPL A;  3UME A;  2O99 A;  2QMI A;  2OWJ A;  2MJ6 A;  4S2N C;  1S0W A;  2NUP C;  5EM1 A;  4XUX A;  5HDS A;  3ZVT A;  5FQ9 A;  4S2K A;  2JC7 A;  3B47 A;  5FDS A;  3SW1 A;  4GS9 A;  3GR2 A;  3K3D A;  3T4S A;  3N8R A;  1L2S A;  3S7N A;  2ZM8 A;  2Y4A A;  5GLC A;  3SH7 A;  3QHY A;  4BWI A;  2IA2 A;  3GSG A;  5EVE A;  1YAX A;  3C5A A;  3A3D A;  1RGY A;  4UEY A;  4JKT A;  4EES A;  3HVF A;  4R23 A;  5A93 A;  1TEM A;  5HAI A;  3DTK A;  3FWL A;  5G4Y A;  1OJ5 A;  1V9Z A;  3RJU A;  3UPO A;  2ZQA A;  3DAV A;  3IXB A;  2H10 A;  3BW6 A;  3FKW A;  3UB8 A;  4PM6 A;  3ZQ5 A;  3Q7V B;  4ZAM A;  1I5Q A;  2BAS A;  5DTT A;  3ZFZ A;  5GL9 A;  3TSG A;  1TS6 A;  1A0K A;  1W63 M;  3BEC A;  3ITB A;  2C6W B;  4O8G A;  2ZC6 B;  5EE8 A;  5GLD A;  1DY6 A;  2WGW B;  3EGD C;  1IYS A;  2ZLY A;  4GHI B;  1CEG A;  3NOU C;  3N4I A;  4GD8 A;  5GHY A;  1XJ6 A;  4K0X A;  3CIT A;  1KVM A;  4JXV A;  2J3T C;  3AGE A;  4LPZ A;  3Q82 A;  4JBF A;  1P97 A;  2M7U A;  4R70 A;  4P6B A;  4RX3 A;  3F1O B;  3OZH A;  4EQI A;  3HLG A;  5A90 A;  4EBL A;  5LBR A;  2V0U A;  1ZC2 A;  3M6B A;  1XGI A;  2JKR M;  4HJ6 A;  3EEH A;  4IUH A;  5FAS A;  5CER A;  2B02 A;  1S4R A;  2ZC3 B;  2C5W B;  4Y3I A;  5DJT A;  5JYO A;  3NHQ A;  4KUO A;  5FQJ A;  2O9A A;  3ZNY A;  3ZVW A;  1CJF A;  5EVI C;  5GLB A;  1UWP X;  3OPR A;  3MS6 A;  3VSL A;  3WWX A;  2W3H A;  3JVV A;  1CI9 A;  3DW0 A;  1GHP A;  4X68 A;  5HAR A;  3PYP A;  5TBM A;  3E98 A;  5CEC A;  1M40 A;  1MKI A;  3FG8 A;  3MQO A;  1WYC A;  5AJG A;  2EX6 A;  2EX8 A;  3MF0 A;  3MQ0 A;  2XH9 A;  3EEA A;  5L07 A;  3NEC A;  1ZKJ A;  3CMZ A;  3NI9 A;  4EWF A;  2XR0 A;  2R78 A;  1BZA A;  3CZD A;  2Z6D A;  4X6T A;  4ZJ2 A;  3S22 A;  1VQQ A;  1BYW A;  2J9O A;  3GV9 A;  2X01 A;  5HW3 A;  3QNC A;  4R4R A;  1N9B A;  4QJG A;  1ALQ A;  5FI2 A;  4BMW A;  4K0W A;  4BLM A;  4DDS A;  1W8Q A;  5FQK A;  2PBY A;  4ME4 A;  1BUL A;  3T4O A;  4ZBE A;  2V1B A;  2Y2K A;  5FL3 A;  4L9F A;  3FPV A;  4LV3 A;  2XF3 A;  4JGQ A;  1FIL A;  1EI5 A;  2ZM2 A;  5FAO A;  4JPM A;  2J9P A;  4E6X A;  2ZL1 B;  3BY8 A;  3HLW A;  4I39 A;  5BOH A;  1ES5 A;  1GHM A;  2L1M A;  1EWZ A;  4KG2 A;  3S4X A;  1G28 A;  1CK3 A;  4XXR A;  4LV0 A;  4WBG A;  4KZ3 A;  3UY6 A;  2QPN A;  5F6A A;  3V3R A;  3T4L A;  4X69 A;  3LID A;  4X55 A;  1GCE A;  3FYZ A;  3E2K A;  4D2O A;  3G4P A;  3Q7V A;  2JKG A;  2WKE A;  5HL6 A;  5TR7 A;  3KO6 A;  1PWC A;  2VX8 A;  4QB8 A;  3R7W B;  1K55 C;  4HES A;  4XT2 B;  1VB6 A;  1VEU B;  4BEN A;  2WAF A;  4CQH A;  1XFN A;  1BLS A;  3PTE A;  2WGW A;  2PU4 A;  2Y2M A;  2VK3 A;  5F68 A;  4GHI A;  4P6Z S;  3WS4 A;  3HCY A;  4B4X A;  1PNE A;  1PZO A;  1FIK A;  2UV0 E;  3K2N A;  1V9Y A;  2P74 A;  4LLO B;  5TJJ A;  2Y2O A;  3HRE A;  4FTX A;  4OLD A;  4BD1 A;  1GA9 A;  2WKH A;  3W8K A;  2H0T A;  1GA0 A;  1H0M A;  1FSW A;  4OPZ A;  1RCJ A;  1S6R A;  4JXG A;  4BL2 A;  1IEL A;  3F1O A;  1YQS A;  4ETZ A;  3B33 A;  2XQZ A;  4ZJ3 A;  1XPB A;  4G3K A;  1ES2 A;  2VZW A;  1IKI A;  2GNX A;  4CPK A;  4JGO A;  3MFD A;  2IWB A;  2VEA A;  3VE4 A;  2Y2G A;  5A91 A;  2Y2P A;  2Y2L A;  1OTI A;  2HF6 A;  3HLE A;  3HLD A;  4OOL A;  4Y17 A;  3H82 B;  4S2I A;  2EFU A;  2EWV A;  3ZNT A;  1CI8 A;  1KGF A;  1YPR A;  4WMC A;  3LCE A;  4E3N A;  2ACG A;  4X56 A;  3LR4 A;  1CEF A;  1TS8 A;  1TDL A;  1LL5 A;  3EQU A;  3P09 A;  1FR1 A;  1KGE A;  5IS1 A;  2EXB A;  3HJI A;  4CLC B;  5HAP A;  4BD0 A;  4OQI A;  5FDH A;  5HL1 A;  4OVD A;  1N4O A;  3VP0 A;  1MWR A;  5J4E A;  2V0W A;  3PBT A;  4OOY A;  1JWP A;  1YMS A;  2ZQC A;  2XFT A;  1KOU A;  3M6H A;  4R3B A;  5CXW A;  2Y91 A;  5FQQ A;  5GLA A;  2DNS A;  4B93 A;  2VGL S;  1BLH A;  5U47 A;  2ZC5 B;  5DF9 A;  4F3L B;  4K91 A;  3SS5 A;  4BBU A;  2PU2 A;  3OCN A;  4MMN A;  3VSK A;  2HP5 A;  5F1F A;  4MNR A;  4HBU A;  2EFX A;  3QNB A;  4KG5 A;  2Y2J A;  1OJG A;  3T1X A;  5HSQ A;  5HD3 A;  2J3T D;  4N9L A;  5AVF A;  3VP3 A;  4D60 A;  2PBD P;  1NRF A;  1DRM A;  3BLM A;  5HFO A;  2ZL1 A;  3LUQ A;  2FFY A;  3KSI A;  2M1C A;  4WL9 A;  5EPH A;  3U2A A;  5JYP A;  4UAA A;  1XXM A;  2E8J A;  3IHA A;  1T1B A;  2JKT M;  5DVA A;  1W79 A;  4OOM A;  4XUZ A;  3E4Q A;  1ESI A;  2ZC7 A;  3IF5 A;  3JYI A;  3V3S A;  3NJA A;  5EV0 A;  1Y4O A;  4MN6 A;  1PZP A;  1KE0 A;  4WF0 A;  2JBF A;  1TVF A;  2K31 A;  3PBQ A;  3R7W A;  1LSX A;  3IH9 A;  4XT2 A;  5AQB A;  3IXG A;  3EGX C;  2BTF P;  2VA0 A;  3BQA A;  4KZA A;  4LFU A;  3KYE A;  4OP8 A;  3T4K A;  2HGV A;  2FH5 A;  1PFL A;  1STZ A;  5M1A A;  4JF4 A;  1BLC A;  4AFI A;  4NXF A;  4F94 A;  2KX6 A;  3UDF A;  5E43 A;  4KZ9 A;  1BTL A;  2I9V A;  3WRZ A;  2QWS A;  4EUV A;  2JKF A;  3VV4 A;  3UB5 P;  4DMZ A;  4QU3 A;  5KMW A;  3MXS A;  1VET A;  3NOP C;  3RFB A;  2ZOH A;  3QP5 A;  4LRY C;  1WA9 A;  4E3M A;  3HLC A;  4IBX A;  5CGS A;  3MXQ A;  1F2K A;  1H8Z A;  3SH9 A;  3IWQ A;  4BL3 A;  3S7P A;  3H82 A;  1Q2P A;  1T19 A;  1T1A A;  4Y0U A;  3IH8 A;  1XJ4 A;  4OLG A;  3BFF A;  1DP9 A;  3C38 A;  1N9N A;  5DJU A;  5FAP A;  3SH8 A;  5HD5 A;  2ZMF A;  1IEM A;  2HDS A;  1F5M A;  3G31 A;  4EET B;  3W4O A;  3JPU A;  4CLC A;  1L0E A;  3KSH A;  2D01 A;  4HNB A;  4GCZ A;  2P7J A;  3IXD A;  2FFF B;  4I5S A;  3UE6 A;  2PD8 A;  4PKY A;  5AVE A;  3C2W A;  2AVX A;  1WYB A;  5TGF A;  2KOI A;  2G7U A;  3TE8 A;  4MBK A;  2Q9M A;  2W0N A;  5HWW A;  1Q2Q A;  4UQI M;  1NLZ A;  4F3L A;  1OTD A;  4WN5 A;  3D72 A;  1HD8 A;  2OWH A;  3ULF A;  2KDK A;  3W2Z A;  5CTM A;  3AGD A;  2XLN A;  5E2F A;  2IWD A;  1XX2 A;  1SDE A;  2EA9 A;  3Q1F A;  4DRT A;  1FCM A;  4Q0H A;  1OME A;  3MBZ A;  4JXS A;  1KE4 A;  1OTE A;  1JTG A;  2ZC4 B;  4A5R A;  1E4D A;  1W63 Q;  2PYP A;  2NUT C;  4QY5 A;  5CEB A;  4R1G A;  4HOI A;  3N6I A;  3ZG8 B;  1PRQ A;  5KZH A;  2XD1 A;  4Q0I A;  4OH0 A;  4I3A A;  3T1S A;  5FI7 A;  2J80 A;  5KSH A;  4ZJ1 A;  3E4O A;  3LI9 A;  5EFW A;  3IF6 B;  1JNU A;  1XGJ A;  2CC1 A;  1P0Z A;  3MMH A;  1K25 A;  4R3A A;  4LRZ E;  4GOG A;  3IWI A;  4NG2 A; 
#chains in the Genus database with same CATH homology
 2L1M A;  4HP9 A;  3UB9 A;  1G28 A;  2W1T B;  4HQA A;  4K08 A;  3F1N A;  1YSQ A;  5F6A A;  2JKT I;  3KYQ A;  3T4L A;  3VE3 A;  2VV6 A;  5HWT A;  3LID A;  2GZA A;  1S1Y A;  1P9R A;  4GLQ A;  4I3J A;  2J3W A;  1GSW A;  4NKP A;  1T18 A;  1XFQ A;  1ODV A;  5HL6 A;  3P7N A;  3KO6 A;  5J3W A;  2VX8 A;  3IS2 A;  4PKY G;  3R7W B;  3BJN A;  4XT2 B;  1VB6 A;  2QKP A;  2PYR A;  4CQH A;  1XFN A;  4QPR A;  5HWV A;  4EER A;  2WKQ A;  3CLO A;  4I3I A;  1TD5 A;  4WEL A;  2ZBB A;  4PAU A;  5F68 A;  4GHI A;  4P6Z S;  4HH3 A;  2WKR A;  3HCY A;  3CI6 A;  1NRJ A;  2XSS A;  1P9W A;  3K2N A;  1V9Y A;  4LLO B;  2V9A A;  5TJJ A;  5J7E A;  5DFY A;  2XA7 S;  2OOL A;  4YWZ A;  5HPF A;  3G6O A;  4FOF A;  3T50 A;  2DMW A;  3H9W A;  3PBS A;  2KLI A;  2W3G A;  3F1O A;  3KSG A;  3MR0 A;  4L9G A;  4NEE D;  4UQI S;  3UB6 A;  2XRO A;  4ARZ B;  2PHY A;  4E04 A;  4ETZ A;  3UMD A;  3B33 A;  3HJK A;  4II7 A;  3CUE A;  3OLO A;  4G3K A;  2O0Y A;  2VZW A;  3LIA A;  1LSW A;  3LR3 A;  3CUE C;  4I38 A;  3LR5 A;  4MCW A;  3OC2 A;  2GNX A;  1F98 A;  3DBA A;  4CLC E;  4IUK A;  4JGO A;  4KQO A;  5DKL A;  3RTY A;  2QJ7 A;  3UB7 A;  4EU0 A;  2JN7 A;  2VEA A;  3VE4 A;  1OTI A;  2HF6 A;  2V1A A;  4OOL A;  3H82 B;  2Z6C A;  2EWV A;  4HIA A;  5KIZ A;  4H6J A;  1NWZ A;  3O5Y A;  4G3V A;  2H28 A;  3TRC A;  4G3W A;  2B18 A;  3LR4 A;  5HDC A;  1TS8 A;  5G4Z A;  3VOL A;  1UWN X;  5MC7 A;  3PBO A;  3EQU A;  1LSV A;  5DKK A;  2EWW A;  3GDI A;  2O9C A;  5IS1 A;  3LIB A;  5IU1 A;  2QYB A;  2K7S A;  2JKR I;  2K2N A;  4IJG A;  1N9L A;  3HJI A;  4CLC B;  4L9E A;  4NXE A;  2GX5 A;  3EQV A;  5J4E A;  3F1P A;  4EQ1 A;  2V0W A;  3PBT A;  5IT5 A;  3R4K A;  4NXB A;  4EW7 A;  4R6L A;  3KSF A;  2PDR A;  2A24 A;  2PR6 A;  1ZTU A;  1KOU A;  3D3O A;  1DP8 A;  1LL8 A;  3GEC A;  1TS7 A;  4M4X A;  3S7O A;  4B93 A;  2VGL S;  2VLG A;  2VV7 A;  3H7W A;  1N9O A;  2O9B A;  1DP6 A;  4Q0J A;  4B9O A;  3TW8 A;  4ETX A;  1TS0 A;  5DF9 A;  4F3L B;  4HI4 A;  4YOF A;  3A0V A;  3PHY A;  1XJ2 A;  4BBU A;  4EEP A;  5TBM B;  2XRN A;  3OCN A;  2W3D A;  4MMN A;  3A0S A;  3TJZ C;  1VHM A;  3OCL A;  4BBV A;  2D02 A;  2L0W A;  2QHK A;  4HP4 A;  3T4T A;  3BY9 A;  4L0L A;  3LIC A;  2P08 A;  1UGU A;  3T4J A;  3EOI A;  4MDZ A;  4KQD A;  3PXP A;  3T4Q A;  4DN0 A;  1OJG A;  3LIE A;  1H3Q A;  2A2L A;  5HSQ A;  4NXG A;  3UME A;  1X0O A;  2O99 A;  2J3T D;  5HD3 A;  2OWJ A;  5AVF A;  2MJ6 A;  2NUP C;  1DRM A;  2W3F A;  5HDS A;  1OTB A;  3B47 A;  1MC0 A;  3SW1 A;  4GS9 A;  3LUQ A;  3KSI A;  2M1C A;  4WL9 A;  2FZ0 A;  3U2A A;  3K3D A;  3T4S A;  2W1T A;  5HZH A;  3JVU A;  2XA7 M;  2HJE A;  1NLY A;  4GW9 A;  5I5L A;  3B42 A;  1IFQ A;  1T1B A;  3LFV A;  3S7N A;  4FSF A;  2JKT M;  4DJ3 A;  5C5K A;  1F9I A;  4OOM A;  4BWI A;  4CLC D;  3E4Q A;  4JGR A;  2IA2 A;  3NJA A;  1S66 L;  1TF1 A;  5CX7 A;  4MN6 A;  3CAX A;  4WF0 A;  4Y5F A;  1YAX A;  3ZYT A;  2K31 A;  3PBQ A;  3R7W A;  4JGP A;  1LSX A;  4XT2 A;  4UEY A;  4EES A;  4YNR A;  1ZHH B;  3EGX C;  2VA0 A;  3BQA A;  1OPX A;  3T4K A;  3LI8 A;  4HY8 A;  2HGV A;  2FH5 A;  5A8B A;  3RH8 B;  1XJ3 A;  3LIF A;  3P01 A;  1STZ A;  2ZMV A;  5G4Y A;  1OJ5 A;  3F1N B;  1V9Z A;  4O0P A;  2QJ5 A;  4AFI A;  3NOT C;  3BW6 A;  4NXF A;  3E4P A;  2KX6 A;  2W3E A;  5F69 A;  3UB8 A;  2I9V A;  3ZQ5 A;  2QWS A;  4EUV A;  3S7Q A;  2BAS A;  3VV4 A;  4DMZ A;  4ARZ A;  3IS2 B;  3LR0 A;  1TS6 A;  3MJQ A;  3NOP C;  1W63 M;  3RFB A;  2ZOH A;  2LB9 A;  4LRY C;  1WA9 A;  4O8G A;  4ZRR A;  1OT6 A;  3C8C A;  5K5B A;  3PBR A;  3UE3 A;  3MXQ A;  3EGD C;  1T1C A;  4GHI B;  1H8M A;  3EWK A;  2JHE A;  3NOU C;  4MN7 A;  2HJ9 C;  1XJ6 A;  3CIT A;  3S7P A;  3H82 A;  3LYX A;  1T19 A;  1T1A A;  2VGL M;  2HV1 A;  1XJ4 A;  2J3T C;  3ICY A;  1GSX A;  4LPZ A;  1P97 A;  3IBR A;  2VV8 A;  2M7U A;  1DP9 A;  3C38 A;  4HH2 A;  1N9N A;  3V67 A;  5HPI A;  4R70 A;  5DJU A;  3F1O B;  5HD5 A;  2ZMF A;  3BQ8 A;  2W27 A;  5HDD A;  2L4R A;  2LB5 A;  1S4S A;  1F5M A;  2V0U A;  5LBR A;  4EET B;  2M7V A;  1S1Z A;  2JKR M;  4CLC A;  3KSH A;  2D01 A;  4HJ6 A;  4HNB A;  3EEH A;  4GCZ A;  2P7J A;  4CLC C;  4P6Z M;  1EW0 A;  4IUH A;  2OAQ 1;  2Y79 A;  3MFX A;  2B02 A;  4GJ4 A;  1S4R A;  4BJP A;  2YKH A;  4I5S A;  4PHT A;  3UE6 A;  2WKP A;  2PD8 A;  4Y3I A;  5DJT A;  4H6J B;  2GJ3 A;  3NHQ A;  4KUO A;  2O9A A;  3BWL A;  3KYZ A;  4HHD A;  4O01 A;  4PKY A;  4IHQ A;  5AVE A;  3C2W A;  1UWP X;  1OTA A;  2KOI A;  1MKM A;  2G7U A;  2PD7 A;  3TE8 A;  1GSV A;  3A0R A;  2ZOI A;  2W0N A;  5DFX A;  5HWW A;  4WUJ A;  4LRX C;  4UQI M;  3C30 A;  1NLZ A;  2PT7 A;  1YKD A;  2PR5 A;  2W3H A;  4WLA A;  2YKF A;  3JVV A;  3KX0 X;  4F3L A;  2INW A;  3FPW A;  1OTD A;  3PYP A;  4WEK A;  4WN5 A;  5TBM A;  3CWF A;  3K3C A;  3D72 A;  3E98 A;  2OWH A;  1Y28 A;  1MZU A;  3ULF A;  1D7E A;  3FG8 A;  2KDK A;  3W2Z A;  3MQO A;  5AJG A;  4RQ9 A;  3F1P B;  2Y8H A;  3MF0 A;  3IBJ A;  3MQ0 A;  3OOV A;  2VJW A;  3EEA A;  2EA9 A;  4EEU A;  4Q0H A;  2A24 B;  1OTE A;  2OAP 1;  2R78 A;  3FC7 A;  4HJ4 A;  1W63 Q;  2CMN A;  2PYP A;  2NUT C;  2Z6D A;  3E0Y A;  3H7W B;  4WEJ A;  1OT9 A;  4HOI A;  5F5Y A;  1BYW A;  3MQQ A;  4EXO A;  3PBN A;  4Q0I A;  2VKS A;  1D06 A;  4Z1W A;  4I3A A;  4DJ2 A;  4R38 A;  2J80 A;  5KSH A;  1IOU A;  3E4O A;  3OBF A;  4BMW A;  1YSP A;  1G6O A;  4Y2F A;  4MN5 A;  4KUK A;  3LI9 A;  5L8M A;  2W1R A;  5EFW A;  1JNU A;  4ME4 A;  3T4O A;  2V1B A;  1S67 L;  5FL3 A;  4L9F A;  3FPV A;  3PR6 A;  4JGQ A;  1P0Z A;  2P04 A;  3MMH A;  4BBT A;  4R3A A;  4LRZ E;  4HJ3 A;  3BY8 A;  4I39 A;  1LT0 A;  4GS9 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...