1N9XA

Structure of microgravity-grown oxidized myoglobin mutant yqr (iss8a)
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
154
structure length
154
Chain Sequence
MVLSEGEWQLVLHVWAKVEADVAGHGQDIYIRLFKSHPETLEKFDRFKHLKTEAEMKASEDLKKQGVRVLTALGAILKKKGHHEAELKPLAQSHATKHKIPIKYLEFISEAIIHVLHSRHPGNFGADAQGAMNKALELFRKDIAAKYKELGYQG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Analysis of the effect of microgravity on protein crystal quality: the case of a myoglobin triple mutant.
pubmed doi rcsb
source organism Physeter catodon
molecule tags Oxygen storage/transport
molecule keywords Myoglobin
total genus 64
structure length 154
sequence length 154
ec nomenclature
pdb deposition date 2002-11-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00042 Globin Globin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.490.10 Mainly Alpha Orthogonal Bundle Globin-like Globins 1n9xA00
1XZ5A 1HDBA 1SPGA 1B86A 1A3NA 1YGDA 1THBA 3GKTA 2GLNA 2ZFOB 1BZ1A 2JHOA 1X9FA 5EUIB 1GCVB 1BZZA 2G0RA 1MWBA 1QSHA 1LFYA 2W6XA 3S1JA 3PELA 1Y7CA 2W6VA 2EF2A 1N9FA 4IT8A 3ECXA 1S56A 1OR6A 1YENA 1GVHA 1NS6B 1D8UA 2R4WA 1HGCB 1EBTA 2R4ZA 1NQPB 1Y35A 5C6EB 5HY8A 2QMBA 1GBVB 1GBUA 3ZJPA 1MLKA 2VEBA 1MYJA 4H0BA 1Y7DB 3GQGA 2D5XB 1THBB 1J41A 1SDKA 1A3OB 2OHBA 1CMYB 2ZSTA 4ROMB 1IBEA 3UHNA 1B0BA 1DUKA 2LH5A 1W92A 2ZLWA 2V1IA 1A9WA 1XYEB 5ILEA 1DO1A 4PQ6A 2H35A 3PELB 1L2KA 2MYDA 1LFZA 1MNHA 3OGBA 2ZWJA 3UGYA 1CH2A 3G46A 1O1JA 4HRTB 3UHVA 1WMUA 1DTMA 5EYJA 1YH9B 3DHTA 1Y83B 5SW7A 3KMFA 1G0BB 1NS9A 1C7BB 3UHCA 4DWUA 3HF4B 1BBBB 1PBXA 3OO5A 4UIQA 4MU5A 3VHBA 6HBWA 4FWXA 1NIHA 2HBEB 1YVTA 1Q1FA 1MNIA 1JEBA 2ZSRA 1NWIA 1QSIB 1YEOA 2LH7A 3WCTB 3PI2A 3NL7B 1Y4FA 4VHBA 3ZJIA 1DXVA 1S61A 4KN3A 1GCWB 3WFWA 5HLQA 4XS0B 2ZS0C 2HBCB 3ARLA 3A5AA 3GDJA 2VEEA 1J7SB 2D5ZB 3SZKA 2D2MC 2GL3A 5C6EA 3UH3A 3ODQA 3HHBA 1MNOA 2NX0A 4FH6A 2HBGA 2O5LX 3DHRA 1HDBB 1SPGB 4HRRB 4PQCA 2XKHA 1SDKB 3AG0A 3BJ2B 3HRWB 3GK9A 5EUIA 1YDZA 1HGAA 2NSSA 5JGGA 3MVCA 3NFEA 2G11A 3QJEA 1HDSB 1HBHA 1CP0A 2GRHA 1NAZA 3ZJOA 3MKBB 5EE4C 4F6BA 1Y0TB 3D1KB 3ORDA 1YHRA 3WCUA 1DKEB 2VYZA 3PI9A 1Y85B 3BJ1B 1H97A 3MJUA 3AT5A 1Y4VB 3WHMB 3PT8A 2IN4A 1UIWA 2PGHA 109MA 2EVPA 2ZT0A 2E2YA 4SDHA 1FDHA 3A0GA 2HZ2A 3LB1A 2ZSZA 2ZSOA 1GBUB 1DO4A 2PEGA 1JEBB 1XXTA 4MQIA 1HHOB 1URVA 2Z6NA 2W6YA 1S0HB 4F4OA 1G09A 2GKNA 3QQQA 3NL7A 2R1HA 3O89A 1YCAA 2VHBA 3K8BA 3B75B 3WCTC 3PIAB 1J3YB 3UH7A 3OZUA 1BZRA 2RI4A 1MLLA 5SW7B 1G0BA 2ZS1D 3ECZA 1O1LB 1VWTB 3WTGB 4O2GA 3DR9A 1X46A 2ZFOC 1HGCA 2HBSB 1YVQB 2YRSB 2PEGB 1FHJB 1RVWA 1MNJA 1YZIB 3EDAA 1MWCA 3LR9A 1LFQA 4X0LB 1EW6A 2D2MA 5F0BA 4ROMA 1NPFA 3VRFB 1Y4QA 3TLDA 4B3WA 2QU0B 2GTLC 1T1NA 2R50A 1HBRB 3QM8A 1J7WB 3GQPB 4UURA 1BUWA 2OHAA 1LFVA 1COHA 4UZVA 3GDJB 1HBHB 1AJ9A 1JY7A 3NMMB 1YHEA 111MA 2V1JA 5E83B 2DN1B 2ZLTB 4MQHB 1MBCA 4YU4B 1MTKA 1YOGA 1JP9A 1MLSA 3D1AB 3OZVA 3BJ2A 4XDIA 1Y8WB 1GDLA 1KFRA 1Y5JA 1BINA 1J7SA 1DWRA 2DN2A 1DWSA 2HHEA 3R5IB 2EVKA 1I3DA 2OIFA 4ESAB 3IC2A 4MQJB 3AQ8A 3WR1B 4F6IA 2LH2A 1CIKA 3A5GA 3UHKA 3E5OA 3HXNB 4HHBA 3WCWD 2OLPA 1AJHA 1MLMA 1MCYA 1Y09B 2ZT3A 1RPSA 2R80B 1Y7GA 4JYQA 2D2NB 1DM1A 3QZZA 5ILMA 1O1KA 2AUOA 3KUNA 4M4BB 2HBSA 1LH1A 1NPGA 2W6WA 1MYFA 5AB8A 3QM9A 1MDNA 1S5XA 1YOHA 3UGZA 3PI9B 2XYKA 7HBIA 4OODA 3UHDA 3MYNA 1O1OA 4PQBA 4X0LA 1XZUB 1BZ6A 2G12A 3VREA 3BJ3A 1YEUA 3W4UA 1FN3A 2G14A 1LHSA 2R80A 3UHRA 5HY8B 2DXMB 1HBBA 1XQ5B 1YVTB 4MQIB 3DHRB 1NZ3A 3WCVB 2MGFA 1LH2A 1YHUC 3FS4B 1QXDA 3NG6B 2QMBB 3P5QB 2Z6SA 2YRSA 4NXCA 2Z6TA 1DXUB 3QJCA 1Y5FA 1ABSA 2WTHA 2D2NC 4WCHD 4ODCA 3MBAA 1FDHG 1MYMA 2HZ1A 1YE2B 2MHBA 1UMOA 1LH5A 2DHBB 1Y7ZB 1C40A 1AJ9B 3UHTA 1A0UB 3WHMA 1CBMA 1UIWB 2AUQA 2PGHB 1MYGA 3G53A 3ZHWA 3D17A 3QZXA 2RAOB 1Y4QB 2MB5A 5KDQA 1CH5A 2MGJA 5KERA 2FRFA 3K3UA 1HBRA 1LH6A 1Y8WA 5CHQA 2O58X 3HENA 1Y2ZB 3U3EA 2R4XA 5KKKA 4MQGB 1C7CA 5E83A 1F5OA 1M6MA 1TESA 3IXFA 5CN6A 1VXCA 1Y4FB 4MBAA 4N7PB 1LA6A 4KMVA 2MYBA 2HCOA 3HXNA 1NEJA 3ZOLA 3VREB 1CLSB 1MBSA 1I3EA 1GCWA 2ZFBA 5E29A 2ZS1B 5EYSA 1A01B 3GQRB 2V1GA 2SPNA 2QSSA 1FCSA 2HBFA 5D5RA 2EKTA 3EOKB 1VRFA 1MKOA 1UT0A 2VYYA 2NRLA 5AZQA 1Y45A 1ITHA 1YFFB 3LB4A 2ZLXB 1YGDB 5CMVA 1Y0CB 3AQ6A 4NI1A 2DN3B 1VXHA 2GDMA 3QQRA 1Y46B 1O1IB 2VYWA 2QLSA 2LH6A 3IC0B 1J40B 1K0YA 2W72B 1KR7A 4HSWA 2ZSPA 1V07A 1OFJA 1MTIA 2FAMA 1Z8UB 1IDRA 1Y5JB 2D60B 2MYAA 1O1NA 1O1PA 4O4TA 1HDSA 5CNBA 2M6ZB 1JZKA 1YIHA 2AA1B 1MZ0A 1XYEA 3ZJHA 4ESAA 1RTXA 1CPWA 2MGGA 3EOKA 1Y0AA 2V1EA 3RJNB 2ZS0B 1XZ5B 3HYUA 2D5XA 3GQGB 1J41B 2VLYA 2GNVA 5JDOD 2Z8AA 3D1KA 1YG5A 2D6CA 1Y22B 4ILZA 1V4WA 1MLFA 1Y4RA 3VRFA 1JWNA 108MA 5CN8A 5F2AA 3MOUA 2DXMA 1G08B 1SHRA 5E6EA 3QM6A 1VXEA 1NZ2A 1LFZB 2ZT2A 3GKVA 1COHB 2V1FA 1VXDA 1EMYA 110MA 1NWNA 2HBEA 1LH7A 1CQXA 1X9FB 4MQHA 1FSXB 2ZS0A 1LA6B 3AT6A 2G10A 3UHWA 2NRMA 1MTJA 2MGCA 3M39A 4FC3B 1Y7GB 2FRKX 2B7HB 2XKGA 4ODCB 1O1LA 2W6VB 1O1MA 1HV4B 1A4FA 3WFUA 2G3HA 2MGEA 5CNFA 1LH3A 3QJBB 1NQPA 1Y35B 4G51B 1YVQA 5KERB 4MQJA 1S5XB 2C0KA 5CHRA 3GKVB 1XCHA 1GLIB 3M3BA 1QSIA 3MJPA 1MYHA 3S65A 2HHDA 2WTGA 3WCWB 104MA 1SI4A 1JZMA 3UHBA 3HHBB 3LB2A 1OUUB 3WCUB 1BZ1B 5KDQB 3QJCB 2Z85A 2VLXA 3S48C 5CN4A 4H07A 1O1MB 4WJGA 5HAVA 2BW9M 1UFPA 1DXDA 1G9VB 2SPMA 3UHQA 2BWHA 2LHBA 1HACB 3WCUD 1RTEA 2BMMA 5CN7A 1KD2B 1NXFA 2DHBA 3HYUB 1Y83A 1Y8IA 3MKBA 2HZ3A 4H2LB 3BCQA 4ROLA 3D4XB 1Y0WA 1FSLA 1FN3B 1URYA 3LHBA 2MYCA 1Y85A 2SPLA 1MKOB 3G4QA 3UHSA 1V75A 1EWAA 2D60A 4F69A 1MBAA 2ZLVA 3QMAA 4HSXA 4NI1B 4N8TA 3NMLA 4NI0B 4NXAA 3ODQB 3HEOA 1DXVB 3IC0A 1J7YB 2H8FA 1MBNA 1IRCA 4TWVA 1UFJA 4L7YA 1YIEA 4BJAA 1X9FC 2MGIA 3KUOA 2MGDA 1CIOA 1GJNA 1C7DA 4F6DA 3R0GA 1HJTA 1MLOA 3UHXA 2BK9A 4DC8A 1Y4GB 1LFVB 4NS2A 3WCPB 3CIUB 1K1KB 1YFFA 2W72C 1Y7DA 1OUTB 1NEJB 3ZH0A 1G0AA 2KSCA 5HU6A 4AVEA 4FWYA 3EDBA 1DO3A 4MPMA 1Y8HA 5MBNA 3CY5B 3AT6B 1A01A 3GQRA 4JACA 1NZ4A 106MA 2ZT1A 3PT7A 3PT8B 4DC7A 1XZ2A 1A00B 1MLJA 3W4UB 2QFKA 4MXLA 4F68A 1J3ZB 4C0NA 1HACA 1JL6A 1QXEB 1JY7B 1UC3A 1LUEA 1LFLB 3PI8B 1C7BA 1CLSA 4KMWA 3LQDB 1ECDA 3ASEA 3K8BB 4DWTA 2QSPB 1FAWA 3D7OB 5EETA 1CH7A 1J3YA 4MQKB 2ZS1A 3M38A 1HCOA 1R1YB 3M3AA 1JP8A 107MA 2D2NA 3NFEB 1XZ2B 1V75B 1UVXA 1Y7ZA 1JF4A 3ZJQA 3WTGA 3GYSB 1RQ3B 1J3FA 2ZLXA 3O7NA 1XZVA 3UH6A 4MQCB 1OBMA 2H8FB 4YU4A 4MBNA 5EQMA 1BVDA 1IWHA 1HRMA 2VLZA 1A3OA 1HGBA 1LFQB 1IBEB 1YEUB 2D2MB 1V4UB 2QSPA 1MLHA 2M6ZA 1V9QA 3OVUC 3GLNA 3ZJJA 1XY0B 5ILPA 3HC9A 5B85A 4IROB 1HSYA 1A0ZA 2FALA 5EU2A 2GKMA 2HHDB 1A3NB 1V5HA 1YHEB 5CN9A 3WCVD 1VREA 1M9PB 1DXUA 1XZ7B 2MBWA 1YDZB 4YU3B 1RPSB 2DC3A 4G51A 2QU0A 3ARJA 1IOPA 1T1NB 1V4XA 2GTLA 4F6FA 1RQ4A 2H8DB 5HBIA 2SPOA 3WCWA 1MOHA 3VRGA 1DXTB 4O4ZA 1PMBA 1Y45B 1CQ2A 1FSXA 1RVWB 4MAXA 4FH7A 1YGFA 1GZXA 1HLBA 102MA 3BOMB 1LFLA 1U7SA 4GZGA 1CMYA 2MGKA 4TWUA 2V1HA 3AQ9A 1A4FB 1HV4A 1S5YA 1X9FD 1YIHB 1HCOB 1F65A 2H35B 1MLQA 1KD2A 3VAUA 1BZ0A 112MA 1IRDA 5HLXA 4M4AB 5ILRA 3GYSA 1OUTA 3WCVA 3E4NA 4F6GA 2GNWA 1HLMA 3P5QA 4O35A 5HU6B 4NI0A 1CBLA 1Y0AB 2HHBA 1CG8A 1ECOA 1CH4A 4N7NB 4ZVAA 1BIJB 3BOMA 2O5QX 1NS9B 1QI8B 1MBIA 1Y0DA 5JOMA 3HF4A 1SDLA 1RQAA 1CH9A 3E55A 2G0ZA 2MGBA 1VHBA 1YHUD 2RAOA 1HDAB 2OH9A 3DUTA 2ZFBB 3E5IA 5JGGB 4U8UC 2ZSYA 5E6EB 3RJ6A 1QPWA 1S6AA 4C44A 1VXFA 1MWDA 2R4YA 1BZPA 3TM3A 3A5BA 3WCUC 1YIEB 3UHUA 1HBSA 1XZVB 1G0AB 1HBIA 1BABA 3A59B 4QAUA 3D17B 2ZSSA 2ZFOA 3UBVA 1LJWB 2EB8A 3BJ1A 1MOAA 1CG5B 1NZ5A 2IG3A 1HABB 2GTLB 1X3KA 3CIUA 1O1PB 1BBBA 1PBXB 3G4VA 4HBIA 5E29B 2HBDA 5EV5A 4HRTA 5JDOF 101MA 2DN1A 4N7PA 3PI3A 3UH5A 1WLAA 2VRYA 1GLIA 3MJPB 2Z6NB 1VXBA 1MLUA 1QSHB 2DN3A 2AV0A 1ABWB 3HEPA 1Y46A 1Y22A 3LQDA 2O5SX 1UX8A 1XY0A 2RI4B 2ZLWB 1YEVB 3G52A 2HBFB 1SHRB 3SDHA 1LTWA 4M4AA 4O1TA 1A0UA 4B4YA 2ZFOD 3NG6A 1UVYA 1Y0TA 1MBOA 3GOUB 1Y5KA 2ZS0D 4PNJA 1WMUB 1F5PA 3K9ZA 3PI4A 2B7HA 3BA2A 1V4XB 3BCQB 1HGBB 4ROLB 1Y7CB 1VXAA 2EKUA 1MNKA 2MGLA 2H8DA 4WJG1 1HDAA 3DUTB 3ECLA 3QM7A 1DO7A 2AA1A 3OO5B 1YEVA 1YHUA 1MLGA 1HGAB 1VXGA 2AUPA 4MQCA 1GBVA 3EU1B 1J7YA 1J52A 3QJDA 3LB3A 2HCOB 1CH1A 1IT3A 2ZLTA 1DWTA 2G0VA 1G08A 2ZSNA 1MOCA 3QJEB 2MGMA 2ZS1C 1H1XA 3ZJRA 1DUOA 1O1IA 3IC2B 2OH8A 1YHRB 4TYXA 1HBAA 1YEQA 1BIJA 2GRZA 4YU3A 4KJTA 1JW8A 1WVPA 3A9MA 5HLUA 1SI4B 1ABWA 3UHZA 1Y8KB 1MOBA 1DLWA 3D4XA 1YENB 1UX9A 5MBAA 2BKMA 2MHBB 1J3ZA 1BJEA 1BUWB 1YGFB 3KMFC 1EBCA 1A0ZB 1BVCA 3S66B 1QXEA 1U7RA 2AV3A 1ECAA 2BLJM 2NSRA 3PI8A 3A2GA 3FH9B 1YCBA 1OUUA 1MGNA 2HHBB 1S5YB 2QLSB 1CG8B 5JDOE 3G4UA 4L7YB 3G4YA 1YZIA 3UHIA 3BJ3B 5M3SA 2DN2B 4MXKA 2ZLUA 3UHEA 1ABYB 2WY4A 4G1BA 1LFTA 1Y2ZA 4G1VA 1RQ3A 4NK1A 1YE0B 1MODA 1MLRA 5D1VA 1MBDA 1XQ5A 1YMAA 3S66A 1HHOA 1F63A 2ZLVB 2O5MX 1QI8A 4ZVBA 1N9HA 1HBGA 3ZOMA 2XKIA 1O16A 5CNCA 1GCVA 4FWZA 3PIAA 1M6CA 2ZSQA 1CG5A 2G0XA 5CNEA 2D2ND 1J7WA 3GQPA 1XXTB 3ZJLA 2ZSXA 2QRWA 3UI0A 1CO8A 1YE2A 3ONZA 4U8UB 1C7DB 1YEOB 1G9VA 1HBSB 3RGKA 5EE4D 1M9PA 2G0SA 1FHJA 3UHYA 1S69A 1J40A 1K0YB 2W72A 4N7NA 1C40B 4N7OA 1GDIA 1Y8IB 1Y4VA 3OJ1A 4H2LA 3WCTA 1Y31A 6HBIA 1RQAB 2O5BX 4U8UD 2D5ZA 5JDOC 1BZZB 1Y0WB 1A9WE 1AZIA 3SZKB 5CNDA 2BLIA 1N9XA 1HBBB 3PT7B 2HBCA 3H57A 3QJDB 3S65B 1GZXB 1B86B 3UHHA 3FH9A 1O1JB 3ED9A 2LH3A 1A6GA 1MYZA 1BABB 3A59A 1YG5B 1Y5KB 1A6NA 1YH9A 3DHTB 4AVDA 3OZWA 3D1AA 4L2MA 3QM5A 1O1OB 3PI1A 1JF3A 2EB9A 1TU9A 1LHTA 1Y8KA 1Y4BB 2O5OX 1VWTA 3SDNA 1RSEA 1GDKA 1NS6A 3V2ZA 4MQKA 2BNLA 3WCVC 3GOUA 1SWMA 2V1KA 3OO4B 2FRIX 1K1KA 2GRFA 5C6YA 5EOHA 2ZT4A 3WI8A 1DTIA 1XZ4B 1GDJA 1Y8HB 2VM0A 1AJGA 1DKEA 1NGKA 1Y5FB 1R1XA 3UHGA 2O5TX 1LFYB 4XS0A 2D2MD 1A00A 3WCPA 1CH3A 1Y4PB 1OJ6A 3ONZB 4U8UA 2MGHA 1C7CB 4F4OB 6HBWB 1YE0A 3WFXA 3WFTA 2FRJX 3OO4A 1YEQB 1ECNA 1OR4A 4HRRA 3WCTD 1XZ4A 1DLYA 2R1HB 1V4UA 1LJWA 2HHEB 5CNGA 2HBDB 3IA3B 1MYTA 4OF9A 3G4WA 4LPIA 1HBAB 1CP5A 1Y4GA 4NK2A 1QXDB 3MN0A 4HHBB 1XZUA 2MGAA 1DXTA 3H58A 1JZLA 1CO9A 3TM9A 3CY5A 1Y01B 1YOIA 3AT5B 3MJUB 1IWHB 1Y0DB 1SDLB 3G4RA 2MYEA 5IKSA 1A6KA 4NZIA 1O1KB 3A0GB 4MQGA 3FS4A 3WCWC 4M4BA 1A6MA 4N8TB 3ZJSA 1NIHB 2QSSB 1QPWB 3UBCA 1S0HA 3OK5A 1SPEA 5AZRA 2BLHA 3NMMA 1Y0CA 1ASHA 1N9IA 3ARKA 3HRWA 2CMMA 2ZLUB 3ZJNA 1ABYA 1JL7A 1YMBA 1Y4RB 3B75A 1XZ7A 1FAWB 3D7OA 1YHUB 1JDOA 1R1YA 4IROA 3ZJMA 1DXCA 1Y4PA 3LR7A 5B84A 1RQ4B 1IRDB 1BZ0B 1Y4BA 3R5IA 103MA 105MA 3EU1A 3WR1A 1JP6A 3V2VA 4FC3A 2AURA 2W31A 4N7OB 1Y09A 2QFNA 1G09B 5CN5A 3MYMA 1MLNA 2LH1A 1OFKA 1JPBA 1O1NB 2GTLD 1Y31B 1V4WB 1FLPA 1LFTB 1MYIA 3AQ7A 3QJBA 1R1XB 3VRGB 3AQ5A 1YMCA 1HABA 1IT2A 3S1IA 4F6JA
chains in the Genus database with same CATH superfamily
1XZ5A 1HDBA 1SPGA 5B13A 1B86A 1A3NA 1YGDA 1THBA 3GKTA 2GLNA 2ZFOB 1BZ1A 2JHOA 1X9FA 5EUIB 1GCVB 1BZZA 2G0RA 1MWBA 1QSHA 1LFYA 2W6XA 3S1JA 3PELA 1Y7CA 2W6VA 2EF2A 1N9FA 4IT8A 3ECXA 1S56A 1OR6A 1YENA 1GVHA 1NS6B 1D8UA 2R4WA 1HGCB 1EBTA 2R4ZA 1NQPB 1Y35A 5C6EB 5HY8A 2QMBA 1GBVB 1GBUA 3ZJPA 3KVSA 1MLKA 2VEBA 1A87A 1MYJA 4H0BA 1Y7DB 3GQGA 2D5XB 1THBB 1J41A 1SDKA 1A3OB 2OHBA 1CMYB 2ZSTA 2C7LB 1IBEA 4ROMB 3UHNA 1B0BA 1DUKA 2LH5A 1W92A 2ZLWA 2V1IA 1A9WA 1XYEB 5ILEA 1DO1A 4PQ6A 2H35A 3PELB 1L2KA 2MYDA 1LFZA 1MNHA 3OGBA 2ZWJA 1NY9A 5AQDM 3UGYA 1CH2A 3G46A 1O1JA 4HRTB 3NUHB 3UHVA 1WMUA 1DTMA 5EYJA 1YH9B 3DHTA 1Y83B 5SW7A 3KMFA 1G0BB 1NS9A 1C7BB 3UHCA 4DWUA 3HF4B 1BBBB 1PBXA 3OO5A 4UIQA 4MU5A 3VHBA 6HBWA 4FWXA 1NIHA 2HBEB 4ERVA 1YVTA 1Q1FA 1MNIA 1JEBA 2ZSRA 2UUMB 1NWIA 1QSIB 1YEOA 2LH7A 3WCTB 3PI2A 3NL7B 1Y4FA 4A8YA 4VHBA 3ZJIA 1DXVA 3BRPA 1S61A 4KN3A 1GCWB 3WFWA 2VJRB 5HLQA 4YJJB 2DKAA 4XS0B 2ZS0C 2HBCB 3ARLA 3A5AA 3GDJA 2VEEA 4LMSB 1J7SB 2D5ZB 3SZKA 2D2MC 2GL3A 5C6EA 3UH3A 3ODQA 3HHBA 1MNOA 2NX0A 4FH6A 2HBGA 2O5LX 3DHRA 1HDBB 1SPGB 4HRRB 4PQCA 2XKHA 1SDKB 3AG0A 3BJ2B 3HRWB 3GK9A 5EUIA 2I88A 1YDZA 1HGAA 4YJJA 2NSSA 5JGGA 3MVCA 3NFEA 2G11A 3QJEA 1HDSB 1HBHA 1CP0A 2GRHA 1NAZA 3ZJOA 3MKBB 5EE4C 4F6BA 1Y0TB 3D1KB 3ORDA 1YHRA 3WCUA 1DKEB 2VYZA 3PI9A 1Y85B 3BJ1B 1H97A 3MJUA 3AT5A 1Y4VB 3WHMB 3PT8A 2IN4A 1UIWA 2PGHA 4XXIA 109MA 2EVPA 2ZT0A 2E2YA 2YSKA 1GH0B 1I7YA 4SDHA 1FDHA 3A0GA 2HZ2A 3LB1A 2ZSZA 2ZSOA 1GBUB 4LM6B 1DO4A 2PEGA 1JEBB 1XXTA 4MQIA 1HHOB 1URVA 2Z6NA 2W6YA 2C7KA 1S0HB 4F4OA 1G09A 2GKNA 3QQQA 3NL7A 2R1HA 3O89A 1YCAA 2VHBA 3K8BA 3B75B 3WCTC 3PIAB 1J3YB 3UH7A 3OZUA 1BZRA 4A8MP 2RI4A 1MLLA 5SW7B 1G0BA 2ZS1D 3ECZA 1O1LB 2WCRA 1VWTB 2X49A 3WTGB 4O2GA 3DR9A 1X46A 3DBJA 2ZFOC 1HGCA 3O18A 2HBSB 1YVQB 2YRSB 2PEGB 1FHJB 1RVWA 1MNJA 1YZIB 3EDAA 1MWCA 3LR9A 1LFQA 4X0LB 1EW6A 2D2MA 5F0BA 2C7LA 4ROMA 1NPFA 3VRFB 1Y4QA 3TLDA 4B3WA 2QU0B 2JL9A 2GTLC 1PHNA 1T1NA 2R50A 1HBRB 3QM8A 1J7WB 3GQPB 4UURA 1BUWA 2OHAA 1LFVA 1COHA 4UZVA 3GDJB 1HBHB 1AJ9A 1JY7A 3O2CB 3NMMB 1YHEA 111MA 2V1JA 5E83B 2DN1B 2ZLTB 4MQHB 1UVLA 1CIIA 1MBCA 4YU4B 1MTKA 1YOGA 1JP9A 1MLSA 3D1AB 1UVIA 3OZVA 3BJ2A 4XDIA 1Y8WB 1UVKA 1GDLA 1KFRA 1Y5JA 1BINA 1J7SA 1DWRA 2DN2A 1DWSA 2HHEA 3R5IB 2EVKA 1I3DA 2OIFA 4ESAB 3IC2A 4MQJB 3AQ8A 3WR1B 4F6IA 2LH2A 1CIKA 3GIOA 3A5GA 3UHKA 3E5OA 3HXNB 4ZIZA 4HHBA 3WCWD 2OLPA 1AJHA 3LQ9A 1MLMA 1MCYA 1Y09B 2ZT3A 1RPSA 2R80B 1Y7GA 4JYQA 2D2NB 1DM1A 1WACA 4GY3B 1JBOA 3QZZA 5ILMA 1O1KA 2AUOA 3KUNA 4M4BB 2HBSA 3O18B 1LH1A 1NPGA 2W6WA 1MYFA 5AB8A 3QM9A 1MDNA 1S5XA 1YOHA 3UGZA 3PI9B 2XYKA 7HBIA 4OODA 3UHDA 3MYNA 1O1OA 4PQBA 4X0LA 1XZUB 1BZ6A 2G12A 3VREA 3BJ3A 1YEUA 3W4UA 1FN3A 2G14A 1LHSA 2R80A 3UHRA 5HY8B 2DXMB 1HBBA 1XQ5B 1YVTB 4MQIB 3DHRB 1NZ3A 1KTPA 3WCVB 2MGFA 1LH2A 1YHUC 3FS4B 1QXDA 3NG6B 2QMBB 3P5QB 2V8AA 2Z6SA 2YRSA 4NXCA 2Z6TA 1DXUB 3QJCA 1Y5FA 1HI8A 1ABSA 2WTHA 2UUNB 2VJRA 2D2NC 4WCHD 4ODCA 4BS9A 3MBAA 1FDHG 1MYMA 2HZ1A 1YE2B 2MHBA 1UMOA 1LH5A 2DHBB 1Y7ZB 1C40A 1AJ9B 3UHTA 1A0UB 1HI0P 3WHMA 1CBMA 1UIWB 2AUQA 2PGHB 1MYGA 3G53A 2UUND 3ZHWA 3D17A 3QZXA 2RAOB 1Y4QB 2MB5A 5KDQA 1CH5A 2MGJA 4RMPB 2UUNA 1UVNA 5KERA 2FRFA 4F0TA 3K3UA 1HBRA 1LH6A 1Y8WA 5CHQA 4N6SB 2O58X 3HENA 1Y2ZB 3U3EA 2VMLA 2R4XA 5KKKA 4MQGB 1C7CA 5E83A 1F5OA 1M6MA 1TESA 3IXFA 5CN6A 1VXCA 1Y4FB 4MBAA 4N7PB 1LA6A 4KMVA 2MYBA 4L1EB 2HCOA 3HXNA 1NEJA 3ZOLA 4Z8KB 3VREB 1CLSB 1CPCA 5FVBM 1MBSA 4AE1A 3DBJB 1I3EA 1GCWA 2ZFBA 5E29A 2ZS1B 5EYSA 1A01B 3GQRB 2V1GA 2SPNA 2QSSA 1FCSA 2HBFA 5D5RA 2EKTA 3EOKB 1VRFA 1MKOA 1UT0A 2VYYA 2NRLA 5AZQA 1Y45A 1ITHA 1YFFB 3LB4A 2ZLXB 1YGDB 5CMVA 1Y0CB 3AQ6A 4NI1A 2DN3B 1VXHA 2GDMA 3QQRA 1Y46B 1O1IB 2VYWA 2QLSA 2LH6A 3IC0B 1J40B 1K0YA 2W72B 1KR7A 4HSWA 2ZSPA 1V07A 1OFJA 1MTIA 2FAMA 1Z8UB 1IDRA 1Y5JB 2D60B 2MYAA 1O1NA 1O1PA 4O4TA 1HDSA 5CNBA 2M6ZB 1JZKA 1YIHA 2AA1B 1DDTA 1MZ0A 1XYEA 3ZJHA 4ESAA 1RTXA 1CPWA 2MGGA 3EOKA 1Y0AA 2V1EA 3RJNB 2ZS0B 1XZ5B 3HYUA 4Q70A 2D5XA 3GQGB 1J41B 2VLYA 2GNVA 5JDOD 2Z8AA 3D1KA 1YG5A 2D6CA 1Y22B 4ILZA 1V4WA 1MLFA 1Y4RA 3VRFA 1JWNA 108MA 5CN8A 5F2AA 3MOUA 2DXMA 1G08B 1SHRA 5E6EA 3QM6A 1VXEA 1NZ2A 1LFZB 2ZT2A 3GKVA 1COHB 2V1FA 1VXDA 1EMYA 110MA 1NWNA 5B13G 2HBEA 1LH7A 1CQXA 1X9FB 4MQHA 1FSXB 2ZS0A 1LA6B 3AT6A 2G10A 3UHWA 2NRMA 1MTJA 2MGCA 3M39A 1EYXA 4FC3B 1Y7GB 2FRKX 2B7HB 2XKGA 4ODCB 1O1LA 2W6VB 1O1MA 1HV4B 1A4FA 3WFUA 2G3HA 2MGEA 5CNFA 1LH3A 3QJBB 1NQPA 1Y35B 4G51B 1YVQA 5KERB 4MQJA 1S5XB 2C0KA 3GKVB 5CHRA 1XCHA 1GLIB 3M3BA 1QSIA 3MJPA 1MYHA 3S65A 2HHDA 2WTGA 3WCWB 104MA 1SI4A 1JZMA 3UHBA 3HHBB 3LB2A 1OUUB 3WCUB 1BZ1B 4ERTA 5KDQB 3QJCB 2Z85A 2VLXA 3S48C 5CN4A 4H07A 1O1MB 4WJGA 3V57B 5HAVA 2BW9M 1HHTP 1UFPA 1DXDA 1G9VB 2SPMA 3UHQA 1ON7A 2BWHA 2LHBA 1HACB 3WCUD 1RTEA 2BMMA 5CN7A 1KD2B 1NXFA 2DHBA 2VJTB 3HYUB 1Y83A 1Y8IA 2UULH 3MKBA 2HZ3A 4H2LB 3BCQA 4ROLA 4A8SA 3D4XB 1Y0WA 1FSLA 3BRPB 4BJUA 1FN3B 1URYA 3LHBA 2MYCA 1Y85A 2SPLA 1MKOB 3G4QA 3UHSA 1V75A 1EWAA 2D60A 4F69A 1MBAA 2ZLVA 3QMAA 4HSXA 4GXEA 4NI1B 1KN1A 4N8TA 3NMLA 4NI0B 4NXAA 3ODQB 3HEOA 1DXVB 3IC0A 1J7YB 2H8FA 1MBNA 1IRCA 4TWVA 1UFJA 1F99A 4L7YA 1YIEA 4BJAA 1X9FC 2MGIA 3KUOA 2MGDA 1CIOA 1GJNA 1C7DA 4F6DA 3R0GA 1HJTA 1MLOA 3UHXA 4H0MB 2BK9A 4DC8A 1Y4GB 1LFVB 4NS2A 3WCPB 3CIUB 1K1KB 4HH1A 1YFFA 2W72C 1Y7DA 1OUTB 1HA7B 1NEJB 3ZH0A 1G0AA 2KSCA 5HU6A 4AVEA 4FWYA 3EDBA 1DO3A 4MPMA 1Y8HA 5MBNA 3CY5B 3AT6B 1A01A 3GQRA 4JACA 1NZ4A 106MA 1XF6C 2ZT1A 3PT7A 3PT8B 4F0TB 4DC7A 1XZ2A 1A00B 1MLJA 3W4UB 2QFKA 4MXLA 4F68A 4B02A 1I7YB 1J3ZB 4C0NA 1HACA 1COLA 1JL6A 1XG0C 4A8WA 1QXEB 1JY7B 1UC3A 1LUEA 1LFLB 1UVMA 3PI8B 1C7BA 1B33A 1CLSA 4KMWA 2BV8B 3LQDB 1ECDA 1GH0A 3ASEA 3K8BB 4DWTA 2QSPB 1FAWA 3D7OB 5EETA 1CH7A 1J3YA 4MQKB 2ZS1A 3M38A 1HCOA 1R1YB 3M3AA 1JP8A 107MA 2D2NA 3NFEB 1XZ2B 1V75B 1UVXA 1Y7ZA 1JF4A 3ZJQA 3WTGA 3GYSB 1RQ3B 1J3FA 2ZLXA 4ESUA 3O7NA 1XZVA 3UH6A 4MQCB 1OBMA 2H8FB 4YU4A 4MBNA 3L0FA 5EQMA 1BVDA 1IWHA 1HRMA 2VLZA 1A3OA 1HGBA 1LFQB 2UULC 1IBEB 1YEUB 2D2MB 1V4UB 2QSPA 1MLHA 2M6ZA 1V9QA 3OVUC 3GLNA 3ZJJA 4RMPA 1XY0B 5ILPA 3HC9A 5B85A 4IROB 1HSYA 1A0ZA 2FALA 1KTPB 5EU2A 2GKMA 2C7KB 2HHDB 2VMLB 1A3NB 1V5HA 1YHEB 5CN9A 3WCVD 1VREA 1M9PB 2VJHA 1DXUA 1XZ7B 2MBWA 1YDZB 4A8OA 4YU3B 1RPSB 2DC3A 1F99B 4G51A 2QU0A 1ALLA 4ETTA 3ARJA 1IOPA 1T1NB 1V4XA 2GTLA 4F6FA 1RQ4A 1B8DB 2H8DB 5HBIA 1TOXA 2SPOA 3WCWA 1MOHA 3VRGA 1DXTB 4O4ZA 2DKCA 1PMBA 1Y45B 1CQ2A 1FSXA 1RVWB 4MAXA 4FH7A 1YGFA 4ETVA 1GZXA 1HLBA 102MA 3BOMB 1LFLA 1U7SA 4GZGA 1CMYA 2MGKA 4TWUA 2V1HA 3AQ9A 1A4FB 1HV4A 1S5YA 1X9FD 1YIHB 1HCOB 4TMAB 1F65A 2H35B 1MLQA 1KD2A 3VAUA 1BZ0A 112MA 1IRDA 5HLXA 4M4AB 5ILRA 3GYSA 1OUTA 3WCVA 3E4NA 4F6GA 2GNWA 1HLMA 3P5QA 4O35A 5HU6B 4NI0A 1CBLA 1Y0AB 2HHBA 1CG8A 1ECOA 1CH4A 4N7NB 4ZVAA 1BIJB 2JLFA 3BOMA 2O5QX 1NS9B 1QI8B 1MBIA 1Y0DA 2J96A 5JOMA 3HF4A 1SDLA 1JBOB 1RQAA 1CH9A 3E55A 2G0ZA 2MGBA 1VHBA 1YHUD 2RAOA 1HDAB 2OH9A 3DUTA 2ZFBB 3GUQA 1SGKA 3E5IA 5JGGB 4U8UC 2ZSYA 5E6EB 3RJ6A 1QPWA 1S6AA 4C44A 1VXFA 1MWDA 2R4YA 1BZPA 3TM3A 3A5BA 1HA7A 3WCUC 1YIEB 3UHUA 1HBSA 1XZVB 1G0AB 1HBIA 1BABA 3A59B 2VJHB 4QAUA 3D17B 2ZSSA 2ZFOA 3UBVA 1LJWB 2EB8A 3BJ1A 1MOAA 1CG5B 1NZ5A 2IG3A 1HABB 2GTLB 4Z8KA 4PO5B 1X3KA 3CIUA 1O1PB 1BBBA 1PBXB 4A8KA 3G4VA 4HBIA 5E29B 2HBDA 5EV5A 4HRTA 5JDOF 101MA 2DN1A 4N7PA 3PI3A 3UH5A 1WLAA 2VRYA 1GLIA 3MJPB 2Z6NB 1VXBA 1MLUA 1QSHB 2DN3A 2AV0A 1ABWB 3HEPA 1Y46A 1Y22A 1CPCB 2BV8A 3LQDA 2O5SX 1UX8A 1XY0A 2RI4B 2ZLWB 1YEVB 3G52A 2HBFB 4A8FA 1SHRB 3SDHA 1LTWA 4M4AA 4O1TA 1A0UA 4B4YA 1RH1A 2ZFOD 3NG6A 1UVYA 1Y0TA 1MBOA 3GOUB 2V8AB 1Y5KA 2ZS0D 2VJTA 4PNJA 1WMUB 1F5PA 3K9ZA 3PI4A 1MDTA 2B7HA 3BA2A 1V4XB 3BCQB 1HGBB 4ROLB 1Y7CB 1VXAA 2EKUA 1MNKA 2MGLA 2H8DA 4WJG1 1HDAA 3DUTB 3ECLA 3QM7A 1DO7A 2AA1A 3OO5B 1YEVA 1YHUA 1KN1B 1MLGA 1HGAB 1VXGA 2AUPA 4MQCA 5AQDA 1GBVA 3EU1B 1J7YA 1J52A 3QJDA 4Q70B 3LB3A 2HCOB 1CH1A 1IT3A 2ZLTA 4LMXB 1DWTA 3PMCA 2G0VA 1G08A 2ZSNA 1MOCA 1LIAA 3QJEB 2MGMA 2ZS1C 1H1XA 3ZJRA 1DUOA 1O1IA 3IC2B 2OH8A 1YHRB 4TYXA 1HBAA 1YEQA 1BIJA 2GRZA 4YU3A 4KJTA 4ETUA 2JLGA 1JW8A 1WVPA 3A9MA 5HLUA 1SI4B 1ABWA 3UHZA 1Y8KB 1MOBA 1DLWA 2DKDA 3D4XA 1YENB 1UX9A 5MBAA 2BKMA 2MHBB 1J3ZA 1BJEA 1BUWB 1YGFB 3KMFC 4PO5A 1EBCA 1A0ZB 1BVCA 3S66B 1QXEA 1U7RA 2AV3A 1ECAA 2BLJM 2NSRA 3PI8A 3A2GA 3FH9B 1YCBA 1OUUA 1MGNA 2HHBB 1S5YB 2QLSB 1CG8B 5JDOE 3G4UA 3RQRA 4L7YB 3G4YA 1YZIA 3ZTAA 3UHIA 1B33B 1HHSA 3BJ3B 5M3SA 2DN2B 4MXKA 2ZLUA 3UHEA 1ABYB 2WY4A 4G1BA 1LFTA 1Y2ZA 4G1VA 1RQ3A 4NK1A 1YE0B 1MODA 1MLRA 5D1VA 4H0MA 1MBDA 1XQ5A 1YMAA 3S66A 1HHOA 3L0FB 1F63A 2ZLVB 2C7JA 2O5MX 1QI8A 4ZVBA 4ZIZB 1N9HA 1HBGA 3ZOMA 2XKIA 1O16A 5CNCA 1XDTT 1GCVA 4FWZA 3PIAA 1M6CA 5FVBA 2ZSQA 1CG5A 2G0XA 5CNEA 2D2ND 1J7WA 3GQPA 1XXTB 3ZJLA 2ZSXA 2QRWA 3UI0A 1CO8A 1YE2A 3ONZA 4U8UB 1C7DB 1YEOB 1G9VA 1HBSB 3RGKA 5EE4D 1M9PA 2G0SA 1FHJA 1F0LA 3UHYA 1S69A 1J40A 1K0YB 2UUMA 2W72A 4N7NA 1C40B 4N7OA 1GDIA 1Y8IB 1Y4VA 3OJ1A 4HH0A 4H2LA 3WCTA 1Y31A 6HBIA 1RQAB 2O5BX 4U8UD 2D5ZA 5JDOC 1BZZB 1Y0WB 1A9WE 1AZIA 3SZKB 5CNDA 2BLIA 1ON7B 1N9XA 1HBBB 3PT7B 2HBCA 1B8DA 3H57A 3QJDB 3S65B 1GZXB 1B86B 4GXEB 3UHHA 3V58A 3FH9A 1O1JB 3ED9A 3VNCA 2LH3A 1A6GA 1MYZA 1BABB 3A59A 1YG5B 3KVSB 1Y5KB 1A6NA 4L1EA 1YH9A 3DHTB 4AVDA 3OZWA 3D1AA 4L2MA 3QM5A 1O1OB 4A8QA 3PI1A 1JF3A 2EB9A 1TU9A 1LHTA 1Y8KA 1Y4BB 2O5OX 1VWTA 3SDNA 3V57A 1RSEA 1GDKA 1NS6A 3O2CA 3V2ZA 4MQKA 2BNLA 3MWNA 3WCVC 3GOUA 1SWMA 2V1KA 3OO4B 2FRIX 1K1KA 2GRFA 5C6YA 5EOHA 3V58B 4XXKA 2ZT4A 4AE0A 3WI8A 1DTIA 1XZ4B 1GDJA 1Y8HB 2VM0A 1AJGA 1DKEA 1NGKA 1Y5FB 1R1XA 1ALLB 3UHGA 2O5TX 1LFYB 4XS0A 2D2MD 1A00A 3WCPA 1CH3A 1Y4PB 1OJ6A 3ONZB 4U8UA 2MGHA 1C7CB 4F4OB 6HBWB 1YE0A 3WFXA 3WFTA 2FRJX 3OO4A 2UULB 1YEQB 1ECNA 1OR4A 4HRRA 3WCTD 4GY3A 1XZ4A 1DLYA 2R1HB 1V4UA 1LJWA 2HHEB 5CNGA 2HBDB 3IA3B 1MYTA 4OF9A 4F0UB 3G4WA 4LPIA 1HBAB 1CP5A 1Y4GA 1QGWC 2C7JB 4NK2A 2UULD 1QXDB 3MN0A 4HHBB 1XZUA 2MGAA 1DXTA 3H58A 2UULA 1JZLA 1CO9A 3TM9A 3CY5A 1Y01B 1YOIA 3AT5B 3MJUB 1IWHB 1Y0DB 1SDLB 1PHNB 3G4RA 2MYEA 5IKSA 1A6KA 2WCQA 4NZIA 1O1KB 3A0GB 4MQGA 3FS4A 3WCWC 4M4BA 1A6MA 4N8TB 3ZJSA 1UVJA 1NIHB 2QSSB 1QPWB 3UBCA 1S0HA 3OK5A 1SPEA 5AZRA 2BLHA 3NMMA 3FEWX 1Y0CA 1ASHA 1N9IA 3ARKA 3HRWA 2CMMA 2ZLUB 3ZJNA 1ABYA 1JL7A 1YMBA 1Y4RB 3B75A 1XZ7A 1FAWB 3D7OA 1YHUB 1JDOA 1R1YA 4IROA 3ZJMA 1DXCA 1Y4PA 3LR7A 5B84A 1RQ4B 1IRDB 1BZ0B 1Y4BA 3PMDA 4N6SA 3R5IA 103MA 105MA 3EU1A 3WR1A 1JP6A 3V2VA 2X4AA 1EYXB 4FC3A 2UUMX 2AURA 2W31A 4N7OB 1Y09A 2QFNA 1G09B 5CN5A 3MYMA 1MLNA 2LH1A 1OFKA 1JPBA 1LIAB 1O1NB 2GTLD 1Y31B 1V4WB 1FLPA 1LFTB 1MYIA 3AQ7A 3QJBA 1HI1A 1R1XB 3VRGB 3AQ5A 4F0UA 1YMCA 1HABA 1IT2A 3S1IA 4F6JA
chains in the Genus database with same CATH topology
1XZ5A 1HDBA 1SPGA 1B86A 1A3NA 1YGDA 1THBA 3GKTA 2GLNA 2ZFOB 1BZ1A 2JHOA 1X9FA 5EUIB 1GCVB 1BZZA 2G0RA 1MWBA 1QSHA 1LFYA 2W6XA 3S1JA 3PELA 1Y7CA 2W6VA 2EF2A 1N9FA 4IT8A 3ECXA 1S56A 1OR6A 1YENA 1GVHA 1NS6B 1D8UA 2R4WA 1HGCB 1EBTA 2R4ZA 1NQPB 1Y35A 5C6EB 5HY8A 2QMBA 1GBVB 1GBUA 3ZJPA 1MLKA 2VEBA 1MYJA 4H0BA 1Y7DB 3GQGA 2D5XB 1THBB 1J41A 1SDKA 1A3OB 2OHBA 1CMYB 2ZSTA 4ROMB 1IBEA 3UHNA 1B0BA 1DUKA 2LH5A 1W92A 2ZLWA 2V1IA 1A9WA 1XYEB 5ILEA 1DO1A 4PQ6A 2H35A 3PELB 1L2KA 2MYDA 1LFZA 1MNHA 3OGBA 2ZWJA 3UGYA 1CH2A 3G46A 1O1JA 4HRTB 3UHVA 1WMUA 1DTMA 5EYJA 1YH9B 3DHTA 1Y83B 5SW7A 3KMFA 1G0BB 1NS9A 1C7BB 3UHCA 4DWUA 3HF4B 1BBBB 1PBXA 3OO5A 4UIQA 4MU5A 3VHBA 6HBWA 4FWXA 1NIHA 2HBEB 1YVTA 1Q1FA 1MNIA 1JEBA 2ZSRA 1NWIA 1QSIB 1YEOA 2LH7A 3WCTB 3PI2A 3NL7B 1Y4FA 4VHBA 3ZJIA 1DXVA 1S61A 4KN3A 1GCWB 3WFWA 5HLQA 4XS0B 2ZS0C 2HBCB 3ARLA 3A5AA 3GDJA 2VEEA 1J7SB 2D5ZB 3SZKA 2D2MC 2GL3A 5C6EA 3UH3A 3ODQA 3HHBA 1MNOA 2NX0A 4FH6A 2HBGA 2O5LX 3DHRA 1HDBB 1SPGB 4HRRB 4PQCA 2XKHA 1SDKB 3AG0A 3BJ2B 3HRWB 3GK9A 5EUIA 1YDZA 1HGAA 2NSSA 5JGGA 3MVCA 3NFEA 2G11A 3QJEA 1HDSB 1HBHA 1CP0A 2GRHA 1NAZA 3ZJOA 3MKBB 5EE4C 4F6BA 1Y0TB 3D1KB 3ORDA 1YHRA 3WCUA 1DKEB 2VYZA 3PI9A 1Y85B 3BJ1B 1H97A 3MJUA 3AT5A 1Y4VB 3WHMB 3PT8A 2IN4A 1UIWA 2PGHA 109MA 2EVPA 2ZT0A 2E2YA 4SDHA 1FDHA 3A0GA 2HZ2A 3LB1A 2ZSZA 2ZSOA 1GBUB 1DO4A 2PEGA 1JEBB 1XXTA 4MQIA 1HHOB 1URVA 2Z6NA 2W6YA 1S0HB 4F4OA 1G09A 2GKNA 3QQQA 3NL7A 2R1HA 3O89A 1YCAA 2VHBA 3K8BA 3B75B 3WCTC 3PIAB 1J3YB 3UH7A 3OZUA 1BZRA 2RI4A 1MLLA 5SW7B 1G0BA 2ZS1D 3ECZA 1O1LB 1VWTB 3WTGB 4O2GA 3DR9A 1X46A 2ZFOC 1HGCA 2HBSB 1YVQB 2YRSB 2PEGB 1FHJB 1RVWA 1MNJA 1YZIB 3EDAA 1MWCA 3LR9A 1LFQA 4X0LB 1EW6A 2D2MA 5F0BA 4ROMA 1NPFA 3VRFB 1Y4QA 3TLDA 4B3WA 2QU0B 2GTLC 1T1NA 2R50A 1HBRB 3QM8A 1J7WB 3GQPB 4UURA 1BUWA 2OHAA 1LFVA 1COHA 4UZVA 3GDJB 1HBHB 1AJ9A 1JY7A 3NMMB 1YHEA 111MA 2V1JA 5E83B 2DN1B 2ZLTB 4MQHB 1MBCA 4YU4B 1MTKA 1YOGA 1JP9A 1MLSA 3D1AB 3OZVA 3BJ2A 4XDIA 1Y8WB 1GDLA 1KFRA 1Y5JA 1BINA 1J7SA 1DWRA 2DN2A 1DWSA 2HHEA 3R5IB 2EVKA 1I3DA 2OIFA 4ESAB 3IC2A 4MQJB 3AQ8A 3WR1B 4F6IA 2LH2A 1CIKA 3A5GA 3UHKA 3E5OA 3HXNB 4HHBA 3WCWD 2OLPA 1AJHA 1MLMA 1MCYA 1Y09B 2ZT3A 1RPSA 2R80B 1Y7GA 4JYQA 2D2NB 1DM1A 3QZZA 5ILMA 1O1KA 2AUOA 3KUNA 4M4BB 2HBSA 1LH1A 1NPGA 2W6WA 1MYFA 5AB8A 3QM9A 1MDNA 1S5XA 1YOHA 3UGZA 3PI9B 2XYKA 7HBIA 4OODA 3UHDA 3MYNA 1O1OA 4PQBA 4X0LA 1XZUB 1BZ6A 2G12A 3VREA 3BJ3A 1YEUA 3W4UA 1FN3A 2G14A 1LHSA 2R80A 3UHRA 5HY8B 2DXMB 1HBBA 1XQ5B 1YVTB 4MQIB 3DHRB 1NZ3A 3WCVB 2MGFA 1LH2A 1YHUC 3FS4B 1QXDA 3NG6B 2QMBB 3P5QB 2Z6SA 2YRSA 4NXCA 2Z6TA 1DXUB 3QJCA 1Y5FA 1ABSA 2WTHA 2D2NC 4WCHD 4ODCA 3MBAA 1FDHG 1MYMA 2HZ1A 1YE2B 2MHBA 1UMOA 1LH5A 2DHBB 1Y7ZB 1C40A 1AJ9B 3UHTA 1A0UB 3WHMA 1CBMA 1UIWB 2AUQA 2PGHB 1MYGA 3G53A 3ZHWA 3D17A 3QZXA 2RAOB 1Y4QB 2MB5A 5KDQA 1CH5A 2MGJA 5KERA 2FRFA 3K3UA 1HBRA 1LH6A 1Y8WA 5CHQA 2O58X 3HENA 1Y2ZB 3U3EA 2R4XA 5KKKA 4MQGB 1C7CA 5E83A 1F5OA 1M6MA 1TESA 3IXFA 5CN6A 1VXCA 1Y4FB 4MBAA 4N7PB 1LA6A 4KMVA 2MYBA 2HCOA 3HXNA 1NEJA 3ZOLA 3VREB 1CLSB 1MBSA 1I3EA 1GCWA 2ZFBA 5E29A 2ZS1B 5EYSA 1A01B 3GQRB 2V1GA 2SPNA 2QSSA 1FCSA 2HBFA 5D5RA 2EKTA 3EOKB 1VRFA 1MKOA 1UT0A 2VYYA 2NRLA 5AZQA 1Y45A 1ITHA 1YFFB 3LB4A 2ZLXB 1YGDB 5CMVA 1Y0CB 3AQ6A 4NI1A 2DN3B 1VXHA 2GDMA 3QQRA 1Y46B 1O1IB 2VYWA 2QLSA 2LH6A 3IC0B 1J40B 1K0YA 2W72B 1KR7A 4HSWA 2ZSPA 1V07A 1OFJA 1MTIA 2FAMA 1Z8UB 1IDRA 1Y5JB 2D60B 2MYAA 1O1NA 1O1PA 4O4TA 1HDSA 5CNBA 2M6ZB 1JZKA 1YIHA 2AA1B 1MZ0A 1XYEA 3ZJHA 4ESAA 1RTXA 1CPWA 2MGGA 3EOKA 1Y0AA 2V1EA 3RJNB 2ZS0B 1XZ5B 3HYUA 2D5XA 3GQGB 1J41B 2VLYA 2GNVA 5JDOD 2Z8AA 3D1KA 1YG5A 2D6CA 1Y22B 4ILZA 1V4WA 1MLFA 1Y4RA 3VRFA 1JWNA 108MA 5CN8A 5F2AA 3MOUA 2DXMA 1G08B 1SHRA 5E6EA 3QM6A 1VXEA 1NZ2A 1LFZB 2ZT2A 3GKVA 1COHB 2V1FA 1VXDA 1EMYA 110MA 1NWNA 2HBEA 1LH7A 1CQXA 1X9FB 4MQHA 1FSXB 2ZS0A 1LA6B 3AT6A 2G10A 3UHWA 2NRMA 1MTJA 2MGCA 3M39A 4FC3B 1Y7GB 2FRKX 2B7HB 2XKGA 4ODCB 1O1LA 2W6VB 1O1MA 1HV4B 1A4FA 3WFUA 2G3HA 2MGEA 5CNFA 1LH3A 3QJBB 1NQPA 1Y35B 4G51B 1YVQA 5KERB 4MQJA 1S5XB 2C0KA 5CHRA 3GKVB 1XCHA 1GLIB 3M3BA 1QSIA 3MJPA 1MYHA 3S65A 2HHDA 2WTGA 3WCWB 104MA 1SI4A 1JZMA 3UHBA 3HHBB 3LB2A 1OUUB 3WCUB 1BZ1B 5KDQB 3QJCB 2Z85A 2VLXA 3S48C 5CN4A 4H07A 1O1MB 4WJGA 5HAVA 2BW9M 1UFPA 1DXDA 1G9VB 2SPMA 3UHQA 2BWHA 2LHBA 1HACB 3WCUD 1RTEA 2BMMA 5CN7A 1KD2B 1NXFA 2DHBA 3HYUB 1Y83A 1Y8IA 3MKBA 2HZ3A 4H2LB 3BCQA 4ROLA 3D4XB 1Y0WA 1FSLA 1FN3B 1URYA 3LHBA 2MYCA 1Y85A 2SPLA 1MKOB 3G4QA 3UHSA 1V75A 1EWAA 2D60A 4F69A 1MBAA 2ZLVA 3QMAA 4HSXA 4NI1B 4N8TA 3NMLA 4NI0B 4NXAA 3ODQB 3HEOA 1DXVB 3IC0A 1J7YB 2H8FA 1MBNA 1IRCA 4TWVA 1UFJA 4L7YA 1YIEA 4BJAA 1X9FC 2MGIA 3KUOA 2MGDA 1CIOA 1GJNA 1C7DA 4F6DA 3R0GA 1HJTA 1MLOA 3UHXA 2BK9A 4DC8A 1Y4GB 1LFVB 4NS2A 3WCPB 3CIUB 1K1KB 1YFFA 2W72C 1Y7DA 1OUTB 1NEJB 3ZH0A 1G0AA 2KSCA 5HU6A 4AVEA 4FWYA 3EDBA 1DO3A 4MPMA 1Y8HA 5MBNA 3CY5B 3AT6B 1A01A 3GQRA 4JACA 1NZ4A 106MA 2ZT1A 3PT7A 3PT8B 4DC7A 1XZ2A 1A00B 1MLJA 3W4UB 2QFKA 4MXLA 4F68A 1J3ZB 4C0NA 1HACA 1JL6A 1QXEB 1JY7B 1UC3A 1LUEA 1LFLB 3PI8B 1C7BA 1CLSA 4KMWA 3LQDB 1ECDA 3ASEA 3K8BB 4DWTA 2QSPB 1FAWA 3D7OB 5EETA 1CH7A 1J3YA 4MQKB 2ZS1A 3M38A 1HCOA 1R1YB 3M3AA 1JP8A 107MA 2D2NA 3NFEB 1XZ2B 1V75B 1UVXA 1Y7ZA 1JF4A 3ZJQA 3WTGA 3GYSB 1RQ3B 1J3FA 2ZLXA 3O7NA 1XZVA 3UH6A 4MQCB 1OBMA 2H8FB 4YU4A 4MBNA 5EQMA 1BVDA 1IWHA 1HRMA 2VLZA 1A3OA 1HGBA 1LFQB 1IBEB 1YEUB 2D2MB 1V4UB 2QSPA 1MLHA 2M6ZA 1V9QA 3OVUC 3GLNA 3ZJJA 1XY0B 5ILPA 3HC9A 5B85A 4IROB 1HSYA 1A0ZA 2FALA 5EU2A 2GKMA 2HHDB 1A3NB 1V5HA 1YHEB 5CN9A 3WCVD 1VREA 1M9PB 1DXUA 1XZ7B 2MBWA 1YDZB 4YU3B 1RPSB 2DC3A 4G51A 2QU0A 3ARJA 1IOPA 1T1NB 1V4XA 2GTLA 4F6FA 1RQ4A 2H8DB 5HBIA 2SPOA 3WCWA 1MOHA 3VRGA 1DXTB 4O4ZA 1PMBA 1Y45B 1CQ2A 1FSXA 1RVWB 4MAXA 4FH7A 1YGFA 1GZXA 1HLBA 102MA 3BOMB 1LFLA 1U7SA 4GZGA 1CMYA 2MGKA 4TWUA 2V1HA 3AQ9A 1A4FB 1HV4A 1S5YA 1X9FD 1YIHB 1HCOB 1F65A 2H35B 1MLQA 1KD2A 3VAUA 1BZ0A 112MA 1IRDA 5HLXA 4M4AB 5ILRA 3GYSA 1OUTA 3WCVA 3E4NA 4F6GA 2GNWA 1HLMA 3P5QA 4O35A 5HU6B 4NI0A 1CBLA 1Y0AB 2HHBA 1CG8A 1ECOA 1CH4A 4N7NB 4ZVAA 1BIJB 3BOMA 2O5QX 1NS9B 1QI8B 1MBIA 1Y0DA 5JOMA 3HF4A 1SDLA 1RQAA 1CH9A 3E55A 2G0ZA 2MGBA 1VHBA 1YHUD 2RAOA 1HDAB 2OH9A 3DUTA 2ZFBB 3E5IA 5JGGB 4U8UC 2ZSYA 5E6EB 3RJ6A 1QPWA 1S6AA 4C44A 1VXFA 1MWDA 2R4YA 1BZPA 3TM3A 3A5BA 3WCUC 1YIEB 3UHUA 1HBSA 1XZVB 1G0AB 1HBIA 1BABA 3A59B 4QAUA 3D17B 2ZSSA 2ZFOA 3UBVA 1LJWB 2EB8A 3BJ1A 1MOAA 1CG5B 1NZ5A 2IG3A 1HABB 2GTLB 1X3KA 3CIUA 1O1PB 1BBBA 1PBXB 3G4VA 4HBIA 5E29B 2HBDA 5EV5A 4HRTA 5JDOF 101MA 2DN1A 4N7PA 3PI3A 3UH5A 1WLAA 2VRYA 1GLIA 3MJPB 2Z6NB 1VXBA 1MLUA 1QSHB 2DN3A 2AV0A 1ABWB 3HEPA 1Y46A 1Y22A 3LQDA 2O5SX 1UX8A 1XY0A 2RI4B 2ZLWB 1YEVB 3G52A 2HBFB 1SHRB 3SDHA 1LTWA 4M4AA 4O1TA 1A0UA 4B4YA 2ZFOD 3NG6A 1UVYA 1Y0TA 1MBOA 3GOUB 1Y5KA 2ZS0D 4PNJA 1WMUB 1F5PA 3K9ZA 3PI4A 2B7HA 3BA2A 1V4XB 3BCQB 1HGBB 4ROLB 1Y7CB 1VXAA 2EKUA 1MNKA 2MGLA 2H8DA 4WJG1 1HDAA 3DUTB 3ECLA 3QM7A 1DO7A 2AA1A 3OO5B 1YEVA 1YHUA 1MLGA 1HGAB 1VXGA 2AUPA 4MQCA 1GBVA 3EU1B 1J7YA 1J52A 3QJDA 3LB3A 2HCOB 1CH1A 1IT3A 2ZLTA 1DWTA 2G0VA 1G08A 2ZSNA 1MOCA 3QJEB 2MGMA 2ZS1C 1H1XA 3ZJRA 1DUOA 1O1IA 3IC2B 2OH8A 1YHRB 4TYXA 1HBAA 1YEQA 1BIJA 2GRZA 4YU3A 4KJTA 1JW8A 1WVPA 3A9MA 5HLUA 1SI4B 1ABWA 3UHZA 1Y8KB 1MOBA 1DLWA 3D4XA 1YENB 1UX9A 5MBAA 2BKMA 2MHBB 1J3ZA 1BJEA 1BUWB 1YGFB 3KMFC 1EBCA 1A0ZB 1BVCA 3S66B 1QXEA 1U7RA 2AV3A 1ECAA 2BLJM 2NSRA 3PI8A 3A2GA 3FH9B 1YCBA 1OUUA 1MGNA 2HHBB 1S5YB 2QLSB 1CG8B 5JDOE 3G4UA 4L7YB 3G4YA 1YZIA 3UHIA 3BJ3B 5M3SA 2DN2B 4MXKA 2ZLUA 3UHEA 1ABYB 2WY4A 4G1BA 1LFTA 1Y2ZA 4G1VA 1RQ3A 4NK1A 1YE0B 1MODA 1MLRA 5D1VA 1MBDA 1XQ5A 1YMAA 3S66A 1HHOA 1F63A 2ZLVB 2O5MX 1QI8A 4ZVBA 1N9HA 1HBGA 3ZOMA 2XKIA 1O16A 5CNCA 1GCVA 4FWZA 3PIAA 1M6CA 2ZSQA 1CG5A 2G0XA 5CNEA 2D2ND 1J7WA 3GQPA 1XXTB 3ZJLA 2ZSXA 2QRWA 3UI0A 1CO8A 1YE2A 3ONZA 4U8UB 1C7DB 1YEOB 1G9VA 1HBSB 3RGKA 5EE4D 1M9PA 2G0SA 1FHJA 3UHYA 1S69A 1J40A 1K0YB 2W72A 4N7NA 1C40B 4N7OA 1GDIA 1Y8IB 1Y4VA 3OJ1A 4H2LA 3WCTA 1Y31A 6HBIA 1RQAB 2O5BX 4U8UD 2D5ZA 5JDOC 1BZZB 1Y0WB 1A9WE 1AZIA 3SZKB 5CNDA 2BLIA 1N9XA 1HBBB 3PT7B 2HBCA 3H57A 3QJDB 3S65B 1GZXB 1B86B 3UHHA 3FH9A 1O1JB 3ED9A 2LH3A 1A6GA 1MYZA 1BABB 3A59A 1YG5B 1Y5KB 1A6NA 1YH9A 3DHTB 4AVDA 3OZWA 3D1AA 4L2MA 3QM5A 1O1OB 3PI1A 1JF3A 2EB9A 1TU9A 1LHTA 1Y8KA 1Y4BB 2O5OX 1VWTA 3SDNA 1RSEA 1GDKA 1NS6A 3V2ZA 4MQKA 2BNLA 3WCVC 3GOUA 1SWMA 2V1KA 3OO4B 2FRIX 1K1KA 2GRFA 5C6YA 5EOHA 2ZT4A 3WI8A 1DTIA 1XZ4B 1GDJA 1Y8HB 2VM0A 1AJGA 1DKEA 1NGKA 1Y5FB 1R1XA 3UHGA 2O5TX 1LFYB 4XS0A 2D2MD 1A00A 3WCPA 1CH3A 1Y4PB 1OJ6A 3ONZB 4U8UA 2MGHA 1C7CB 4F4OB 6HBWB 1YE0A 3WFXA 3WFTA 2FRJX 3OO4A 1YEQB 1ECNA 1OR4A 4HRRA 3WCTD 1XZ4A 1DLYA 2R1HB 1V4UA 1LJWA 2HHEB 5CNGA 2HBDB 3IA3B 1MYTA 4OF9A 3G4WA 4LPIA 1HBAB 1CP5A 1Y4GA 4NK2A 1QXDB 3MN0A 4HHBB 1XZUA 2MGAA 1DXTA 3H58A 1JZLA 1CO9A 3TM9A 3CY5A 1Y01B 1YOIA 3AT5B 3MJUB 1IWHB 1Y0DB 1SDLB 3G4RA 2MYEA 5IKSA 1A6KA 4NZIA 1O1KB 3A0GB 4MQGA 3FS4A 3WCWC 4M4BA 1A6MA 4N8TB 3ZJSA 1NIHB 2QSSB 1QPWB 3UBCA 1S0HA 3OK5A 1SPEA 5AZRA 2BLHA 3NMMA 1Y0CA 1ASHA 1N9IA 3ARKA 3HRWA 2CMMA 2ZLUB 3ZJNA 1ABYA 1JL7A 1YMBA 1Y4RB 3B75A 1XZ7A 1FAWB 3D7OA 1YHUB 1JDOA 1R1YA 4IROA 3ZJMA 1DXCA 1Y4PA 3LR7A 5B84A 1RQ4B 1IRDB 1BZ0B 1Y4BA 3R5IA 103MA 105MA 3EU1A 3WR1A 1JP6A 3V2VA 4FC3A 2AURA 2W31A 4N7OB 1Y09A 2QFNA 1G09B 5CN5A 3MYMA 1MLNA 2LH1A 1OFKA 1JPBA 1O1NB 2GTLD 1Y31B 1V4WB 1FLPA 1LFTB 1MYIA 3AQ7A 3QJBA 1R1XB 3VRGB 3AQ5A 1YMCA 1HABA 1IT2A 3S1IA 4F6JA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1XZ5 A;  1HDB A;  1SPG A;  1B86 A;  1A3N A;  1YGD A;  1THB A;  3GKT A;  2GLN A;  2ZFO B;  1BZ1 A;  2JHO A;  1X9F A;  5EUI B;  1GCV B;  1BZZ A;  2G0R A;  1MWB A;  1QSH A;  1LFY A;  2W6X A;  3S1J A;  3PEL A;  1Y7C A;  2W6V A;  2EF2 A;  1N9F A;  4IT8 A;  3ECX A;  1S56 A;  1OR6 A;  1YEN A;  1GVH A;  1NS6 B;  1D8U A;  2R4W A;  1HGC B;  1EBT A;  2R4Z A;  1NQP B;  1Y35 A;  5C6E B;  5HY8 A;  2QMB A;  1GBV B;  1GBU A;  3ZJP A;  1MLK A;  2VEB A;  1MYJ A;  4H0B A;  1Y7D B;  3GQG A;  2D5X B;  1THB B;  1J41 A;  1SDK A;  1A3O B;  2OHB A;  1CMY B;  2ZST A;  4ROM B;  1IBE A;  3UHN A;  1B0B A;  1DUK A;  2LH5 A;  1W92 A;  2ZLW A;  2V1I A;  1A9W A;  1XYE B;  5ILE A;  1DO1 A;  4PQ6 A;  2H35 A;  3PEL B;  1L2K A;  2MYD A;  1LFZ A;  1MNH A;  3OGB A;  2ZWJ A;  3UGY A;  1CH2 A;  3G46 A;  1O1J A;  4HRT B;  3UHV A;  1WMU A;  1DTM A;  5EYJ A;  1YH9 B;  3DHT A;  1Y83 B;  5SW7 A;  3KMF A;  1G0B B;  1NS9 A;  1C7B B;  3UHC A;  4DWU A;  3HF4 B;  1BBB B;  1PBX A;  3OO5 A;  4UIQ A;  4MU5 A;  3VHB A;  6HBW A;  4FWX A;  1NIH A;  2HBE B;  1YVT A;  1Q1F A;  1MNI A;  1JEB A;  2ZSR A;  1NWI A;  1QSI B;  1YEO A;  2LH7 A;  3WCT B;  3PI2 A;  3NL7 B;  1Y4F A;  4VHB A;  3ZJI A;  1DXV A;  1S61 A;  4KN3 A;  1GCW B;  3WFW A;  5HLQ A;  4XS0 B;  2ZS0 C;  2HBC B;  3ARL A;  3A5A A;  3GDJ A;  2VEE A;  1J7S B;  2D5Z B;  3SZK A;  2D2M C;  2GL3 A;  5C6E A;  3UH3 A;  3ODQ A;  3HHB A;  1MNO A;  2NX0 A;  4FH6 A;  2HBG A;  2O5L X;  3DHR A;  1HDB B;  1SPG B;  4HRR B;  4PQC A;  2XKH A;  1SDK B;  3AG0 A;  3BJ2 B;  3HRW B;  3GK9 A;  5EUI A;  1YDZ A;  1HGA A;  2NSS A;  5JGG A;  3MVC A;  3NFE A;  2G11 A;  3QJE A;  1HDS B;  1HBH A;  1CP0 A;  2GRH A;  1NAZ A;  3ZJO A;  3MKB B;  5EE4 C;  4F6B A;  1Y0T B;  3D1K B;  3ORD A;  1YHR A;  3WCU A;  1DKE B;  2VYZ A;  3PI9 A;  1Y85 B;  3BJ1 B;  1H97 A;  3MJU A;  3AT5 A;  1Y4V B;  3WHM B;  3PT8 A;  2IN4 A;  1UIW A;  2PGH A;  109M A;  2EVP A;  2ZT0 A;  2E2Y A;  4SDH A;  1FDH A;  3A0G A;  2HZ2 A;  3LB1 A;  2ZSZ A;  2ZSO A;  1GBU B;  1DO4 A;  2PEG A;  1JEB B;  1XXT A;  4MQI A;  1HHO B;  1URV A;  2Z6N A;  2W6Y A;  1S0H B;  4F4O A;  1G09 A;  2GKN A;  3QQQ A;  3NL7 A;  2R1H A;  3O89 A;  1YCA A;  2VHB A;  3K8B A;  3B75 B;  3WCT C;  3PIA B;  1J3Y B;  3UH7 A;  3OZU A;  1BZR A;  2RI4 A;  1MLL A;  5SW7 B;  1G0B A;  2ZS1 D;  3ECZ A;  1O1L B;  1VWT B;  3WTG B;  4O2G A;  3DR9 A;  1X46 A;  2ZFO C;  1HGC A;  2HBS B;  1YVQ B;  2YRS B;  2PEG B;  1FHJ B;  1RVW A;  1MNJ A;  1YZI B;  3EDA A;  1MWC A;  3LR9 A;  1LFQ A;  4X0L B;  1EW6 A;  2D2M A;  5F0B A;  4ROM A;  1NPF A;  3VRF B;  1Y4Q A;  3TLD A;  4B3W A;  2QU0 B;  2GTL C;  1T1N A;  2R50 A;  1HBR B;  3QM8 A;  1J7W B;  3GQP B;  4UUR A;  1BUW A;  2OHA A;  1LFV A;  1COH A;  4UZV A;  3GDJ B;  1HBH B;  1AJ9 A;  1JY7 A;  3NMM B;  1YHE A;  111M A;  2V1J A;  5E83 B;  2DN1 B;  2ZLT B;  4MQH B;  1MBC A;  4YU4 B;  1MTK A;  1YOG A;  1JP9 A;  1MLS A;  3D1A B;  3OZV A;  3BJ2 A;  4XDI A;  1Y8W B;  1GDL A;  1KFR A;  1Y5J A;  1BIN A;  1J7S A;  1DWR A;  2DN2 A;  1DWS A;  2HHE A;  3R5I B;  2EVK A;  1I3D A;  2OIF A;  4ESA B;  3IC2 A;  4MQJ B;  3AQ8 A;  3WR1 B;  4F6I A;  2LH2 A;  1CIK A;  3A5G A;  3UHK A;  3E5O A;  3HXN B;  4HHB A;  3WCW D;  2OLP A;  1AJH A;  1MLM A;  1MCY A;  1Y09 B;  2ZT3 A;  1RPS A;  2R80 B;  1Y7G A;  4JYQ A;  2D2N B;  1DM1 A;  3QZZ A;  5ILM A;  1O1K A;  2AUO A;  3KUN A;  4M4B B;  2HBS A;  1LH1 A;  1NPG A;  2W6W A;  1MYF A;  5AB8 A;  3QM9 A;  1MDN A;  1S5X A;  1YOH A;  3UGZ A;  3PI9 B;  2XYK A;  7HBI A;  4OOD A;  3UHD A;  3MYN A;  1O1O A;  4PQB A;  4X0L A;  1XZU B;  1BZ6 A;  2G12 A;  3VRE A;  3BJ3 A;  1YEU A;  3W4U A;  1FN3 A;  2G14 A;  1LHS A;  2R80 A;  3UHR A;  5HY8 B;  2DXM B;  1HBB A;  1XQ5 B;  1YVT B;  4MQI B;  3DHR B;  1NZ3 A;  3WCV B;  2MGF A;  1LH2 A;  1YHU C;  3FS4 B;  1QXD A;  3NG6 B;  2QMB B;  3P5Q B;  2Z6S A;  2YRS A;  4NXC A;  2Z6T A;  1DXU B;  3QJC A;  1Y5F A;  1ABS A;  2WTH A;  2D2N C;  4WCH D;  4ODC A;  3MBA A;  1FDH G;  1MYM A;  2HZ1 A;  1YE2 B;  2MHB A;  1UMO A;  1LH5 A;  2DHB B;  1Y7Z B;  1C40 A;  1AJ9 B;  3UHT A;  1A0U B;  3WHM A;  1CBM A;  1UIW B;  2AUQ A;  2PGH B;  1MYG A;  3G53 A;  3ZHW A;  3D17 A;  3QZX A;  2RAO B;  1Y4Q B;  2MB5 A;  5KDQ A;  1CH5 A;  2MGJ A;  5KER A;  2FRF A;  3K3U A;  1HBR A;  1LH6 A;  1Y8W A;  5CHQ A;  2O58 X;  3HEN A;  1Y2Z B;  3U3E A;  2R4X A;  5KKK A;  4MQG B;  1C7C A;  5E83 A;  1F5O A;  1M6M A;  1TES A;  3IXF A;  5CN6 A;  1VXC A;  1Y4F B;  4MBA A;  4N7P B;  1LA6 A;  4KMV A;  2MYB A;  2HCO A;  3HXN A;  1NEJ A;  3ZOL A;  3VRE B;  1CLS B;  1MBS A;  1I3E A;  1GCW A;  2ZFB A;  5E29 A;  2ZS1 B;  5EYS A;  1A01 B;  3GQR B;  2V1G A;  2SPN A;  2QSS A;  1FCS A;  2HBF A;  5D5R A;  2EKT A;  3EOK B;  1VRF A;  1MKO A;  1UT0 A;  2VYY A;  2NRL A;  5AZQ A;  1Y45 A;  1ITH A;  1YFF B;  3LB4 A;  2ZLX B;  1YGD B;  5CMV A;  1Y0C B;  3AQ6 A;  4NI1 A;  2DN3 B;  1VXH A;  2GDM A;  3QQR A;  1Y46 B;  1O1I B;  2VYW A;  2QLS A;  2LH6 A;  3IC0 B;  1J40 B;  1K0Y A;  2W72 B;  1KR7 A;  4HSW A;  2ZSP A;  1V07 A;  1OFJ A;  1MTI A;  2FAM A;  1Z8U B;  1IDR A;  1Y5J B;  2D60 B;  2MYA A;  1O1N A;  1O1P A;  4O4T A;  1HDS A;  5CNB A;  2M6Z B;  1JZK A;  1YIH A;  2AA1 B;  1MZ0 A;  1XYE A;  3ZJH A;  4ESA A;  1RTX A;  1CPW A;  2MGG A;  3EOK A;  1Y0A A;  2V1E A;  3RJN B;  2ZS0 B;  1XZ5 B;  3HYU A;  2D5X A;  3GQG B;  1J41 B;  2VLY A;  2GNV A;  5JDO D;  2Z8A A;  3D1K A;  1YG5 A;  2D6C A;  1Y22 B;  4ILZ A;  1V4W A;  1MLF A;  1Y4R A;  3VRF A;  1JWN A;  108M A;  5CN8 A;  5F2A A;  3MOU A;  2DXM A;  1G08 B;  1SHR A;  5E6E A;  3QM6 A;  1VXE A;  1NZ2 A;  1LFZ B;  2ZT2 A;  3GKV A;  1COH B;  2V1F A;  1VXD A;  1EMY A;  110M A;  1NWN A;  2HBE A;  1LH7 A;  1CQX A;  1X9F B;  4MQH A;  1FSX B;  2ZS0 A;  1LA6 B;  3AT6 A;  2G10 A;  3UHW A;  2NRM A;  1MTJ A;  2MGC A;  3M39 A;  4FC3 B;  1Y7G B;  2FRK X;  2B7H B;  2XKG A;  4ODC B;  1O1L A;  2W6V B;  1O1M A;  1HV4 B;  1A4F A;  3WFU A;  2G3H A;  2MGE A;  5CNF A;  1LH3 A;  3QJB B;  1NQP A;  1Y35 B;  4G51 B;  1YVQ A;  5KER B;  4MQJ A;  1S5X B;  2C0K A;  5CHR A;  3GKV B;  1XCH A;  1GLI B;  3M3B A;  1QSI A;  3MJP A;  1MYH A;  3S65 A;  2HHD A;  2WTG A;  3WCW B;  104M A;  1SI4 A;  1JZM A;  3UHB A;  3HHB B;  3LB2 A;  1OUU B;  3WCU B;  1BZ1 B;  5KDQ B;  3QJC B;  2Z85 A;  2VLX A;  3S48 C;  5CN4 A;  4H07 A;  1O1M B;  4WJG A;  5HAV A;  2BW9 M;  1UFP A;  1DXD A;  1G9V B;  2SPM A;  3UHQ A;  2BWH A;  2LHB A;  1HAC B;  3WCU D;  1RTE A;  2BMM A;  5CN7 A;  1KD2 B;  1NXF A;  2DHB A;  3HYU B;  1Y83 A;  1Y8I A;  3MKB A;  2HZ3 A;  4H2L B;  3BCQ A;  4ROL A;  3D4X B;  1Y0W A;  1FSL A;  1FN3 B;  1URY A;  3LHB A;  2MYC A;  1Y85 A;  2SPL A;  1MKO B;  3G4Q A;  3UHS A;  1V75 A;  1EWA A;  2D60 A;  4F69 A;  1MBA A;  2ZLV A;  3QMA A;  4HSX A;  4NI1 B;  4N8T A;  3NML A;  4NI0 B;  4NXA A;  3ODQ B;  3HEO A;  1DXV B;  3IC0 A;  1J7Y B;  2H8F A;  1MBN A;  1IRC A;  4TWV A;  1UFJ A;  4L7Y A;  1YIE A;  4BJA A;  1X9F C;  2MGI A;  3KUO A;  2MGD A;  1CIO A;  1GJN A;  1C7D A;  4F6D A;  3R0G A;  1HJT A;  1MLO A;  3UHX A;  2BK9 A;  4DC8 A;  1Y4G B;  1LFV B;  4NS2 A;  3WCP B;  3CIU B;  1K1K B;  1YFF A;  2W72 C;  1Y7D A;  1OUT B;  1NEJ B;  3ZH0 A;  1G0A A;  2KSC A;  5HU6 A;  4AVE A;  4FWY A;  3EDB A;  1DO3 A;  4MPM A;  1Y8H A;  5MBN A;  3CY5 B;  3AT6 B;  1A01 A;  3GQR A;  4JAC A;  1NZ4 A;  106M A;  2ZT1 A;  3PT7 A;  3PT8 B;  4DC7 A;  1XZ2 A;  1A00 B;  1MLJ A;  3W4U B;  2QFK A;  4MXL A;  4F68 A;  1J3Z B;  4C0N A;  1HAC A;  1JL6 A;  1QXE B;  1JY7 B;  1UC3 A;  1LUE A;  1LFL B;  3PI8 B;  1C7B A;  1CLS A;  4KMW A;  3LQD B;  1ECD A;  3ASE A;  3K8B B;  4DWT A;  2QSP B;  1FAW A;  3D7O B;  5EET A;  1CH7 A;  1J3Y A;  4MQK B;  2ZS1 A;  3M38 A;  1HCO A;  1R1Y B;  3M3A A;  1JP8 A;  107M A;  2D2N A;  3NFE B;  1XZ2 B;  1V75 B;  1UVX A;  1Y7Z A;  1JF4 A;  3ZJQ A;  3WTG A;  3GYS B;  1RQ3 B;  1J3F A;  2ZLX A;  3O7N A;  1XZV A;  3UH6 A;  4MQC B;  1OBM A;  2H8F B;  4YU4 A;  4MBN A;  5EQM A;  1BVD A;  1IWH A;  1HRM A;  2VLZ A;  1A3O A;  1HGB A;  1LFQ B;  1IBE B;  1YEU B;  2D2M B;  1V4U B;  2QSP A;  1MLH A;  2M6Z A;  1V9Q A;  3OVU C;  3GLN A;  3ZJJ A;  1XY0 B;  5ILP A;  3HC9 A;  5B85 A;  4IRO B;  1HSY A;  1A0Z A;  2FAL A;  5EU2 A;  2GKM A;  2HHD B;  1A3N B;  1V5H A;  1YHE B;  5CN9 A;  3WCV D;  1VRE A;  1M9P B;  1DXU A;  1XZ7 B;  2MBW A;  1YDZ B;  4YU3 B;  1RPS B;  2DC3 A;  4G51 A;  2QU0 A;  3ARJ A;  1IOP A;  1T1N B;  1V4X A;  2GTL A;  4F6F A;  1RQ4 A;  2H8D B;  5HBI A;  2SPO A;  3WCW A;  1MOH A;  3VRG A;  1DXT B;  4O4Z A;  1PMB A;  1Y45 B;  1CQ2 A;  1FSX A;  1RVW B;  4MAX A;  4FH7 A;  1YGF A;  1GZX A;  1HLB A;  102M A;  3BOM B;  1LFL A;  1U7S A;  4GZG A;  1CMY A;  2MGK A;  4TWU A;  2V1H A;  3AQ9 A;  1A4F B;  1HV4 A;  1S5Y A;  1X9F D;  1YIH B;  1HCO B;  1F65 A;  2H35 B;  1MLQ A;  1KD2 A;  3VAU A;  1BZ0 A;  112M A;  1IRD A;  5HLX A;  4M4A B;  5ILR A;  3GYS A;  1OUT A;  3WCV A;  3E4N A;  4F6G A;  2GNW A;  1HLM A;  3P5Q A;  4O35 A;  5HU6 B;  4NI0 A;  1CBL A;  1Y0A B;  2HHB A;  1CG8 A;  1ECO A;  1CH4 A;  4N7N B;  4ZVA A;  1BIJ B;  3BOM A;  2O5Q X;  1NS9 B;  1QI8 B;  1MBI A;  1Y0D A;  5JOM A;  3HF4 A;  1SDL A;  1RQA A;  1CH9 A;  3E55 A;  2G0Z A;  2MGB A;  1VHB A;  1YHU D;  2RAO A;  1HDA B;  2OH9 A;  3DUT A;  2ZFB B;  3E5I A;  5JGG B;  4U8U C;  2ZSY A;  5E6E B;  3RJ6 A;  1QPW A;  1S6A A;  4C44 A;  1VXF A;  1MWD A;  2R4Y A;  1BZP A;  3TM3 A;  3A5B A;  3WCU C;  1YIE B;  3UHU A;  1HBS A;  1XZV B;  1G0A B;  1HBI A;  1BAB A;  3A59 B;  4QAU A;  3D17 B;  2ZSS A;  2ZFO A;  3UBV A;  1LJW B;  2EB8 A;  3BJ1 A;  1MOA A;  1CG5 B;  1NZ5 A;  2IG3 A;  1HAB B;  2GTL B;  1X3K A;  3CIU A;  1O1P B;  1BBB A;  1PBX B;  3G4V A;  4HBI A;  5E29 B;  2HBD A;  5EV5 A;  4HRT A;  5JDO F;  101M A;  2DN1 A;  4N7P A;  3PI3 A;  3UH5 A;  1WLA A;  2VRY A;  1GLI A;  3MJP B;  2Z6N B;  1VXB A;  1MLU A;  1QSH B;  2DN3 A;  2AV0 A;  1ABW B;  3HEP A;  1Y46 A;  1Y22 A;  3LQD A;  2O5S X;  1UX8 A;  1XY0 A;  2RI4 B;  2ZLW B;  1YEV B;  3G52 A;  2HBF B;  1SHR B;  3SDH A;  1LTW A;  4M4A A;  4O1T A;  1A0U A;  4B4Y A;  2ZFO D;  3NG6 A;  1UVY A;  1Y0T A;  1MBO A;  3GOU B;  1Y5K A;  2ZS0 D;  4PNJ A;  1WMU B;  1F5P A;  3K9Z A;  3PI4 A;  2B7H A;  3BA2 A;  1V4X B;  3BCQ B;  1HGB B;  4ROL B;  1Y7C B;  1VXA A;  2EKU A;  1MNK A;  2MGL A;  2H8D A;  4WJG 1;  1HDA A;  3DUT B;  3ECL A;  3QM7 A;  1DO7 A;  2AA1 A;  3OO5 B;  1YEV A;  1YHU A;  1MLG A;  1HGA B;  1VXG A;  2AUP A;  4MQC A;  1GBV A;  3EU1 B;  1J7Y A;  1J52 A;  3QJD A;  3LB3 A;  2HCO B;  1CH1 A;  1IT3 A;  2ZLT A;  1DWT A;  2G0V A;  1G08 A;  2ZSN A;  1MOC A;  3QJE B;  2MGM A;  2ZS1 C;  1H1X A;  3ZJR A;  1DUO A;  1O1I A;  3IC2 B;  2OH8 A;  1YHR B;  4TYX A;  1HBA A;  1YEQ A;  1BIJ A;  2GRZ A;  4YU3 A;  4KJT A;  1JW8 A;  1WVP A;  3A9M A;  5HLU A;  1SI4 B;  1ABW A;  3UHZ A;  1Y8K B;  1MOB A;  1DLW A;  3D4X A;  1YEN B;  1UX9 A;  5MBA A;  2BKM A;  2MHB B;  1J3Z A;  1BJE A;  1BUW B;  1YGF B;  3KMF C;  1EBC A;  1A0Z B;  1BVC A;  3S66 B;  1QXE A;  1U7R A;  2AV3 A;  1ECA A;  2BLJ M;  2NSR A;  3PI8 A;  3A2G A;  3FH9 B;  1YCB A;  1OUU A;  1MGN A;  2HHB B;  1S5Y B;  2QLS B;  1CG8 B;  5JDO E;  3G4U A;  4L7Y B;  3G4Y A;  1YZI A;  3UHI A;  3BJ3 B;  5M3S A;  2DN2 B;  4MXK A;  2ZLU A;  3UHE A;  1ABY B;  2WY4 A;  4G1B A;  1LFT A;  1Y2Z A;  4G1V A;  1RQ3 A;  4NK1 A;  1YE0 B;  1MOD A;  1MLR A;  5D1V A;  1MBD A;  1XQ5 A;  1YMA A;  3S66 A;  1HHO A;  1F63 A;  2ZLV B;  2O5M X;  1QI8 A;  4ZVB A;  1N9H A;  1HBG A;  3ZOM A;  2XKI A;  1O16 A;  5CNC A;  1GCV A;  4FWZ A;  3PIA A;  1M6C A;  2ZSQ A;  1CG5 A;  2G0X A;  5CNE A;  2D2N D;  1J7W A;  3GQP A;  1XXT B;  3ZJL A;  2ZSX A;  2QRW A;  3UI0 A;  1CO8 A;  1YE2 A;  3ONZ A;  4U8U B;  1C7D B;  1YEO B;  1G9V A;  1HBS B;  3RGK A;  5EE4 D;  1M9P A;  2G0S A;  1FHJ A;  3UHY A;  1S69 A;  1J40 A;  1K0Y B;  2W72 A;  4N7N A;  1C40 B;  4N7O A;  1GDI A;  1Y8I B;  1Y4V A;  3OJ1 A;  4H2L A;  3WCT A;  1Y31 A;  6HBI A;  1RQA B;  2O5B X;  4U8U D;  2D5Z A;  5JDO C;  1BZZ B;  1Y0W B;  1A9W E;  1AZI A;  3SZK B;  5CND A;  2BLI A;  1N9X A;  1HBB B;  3PT7 B;  2HBC A;  3H57 A;  3QJD B;  3S65 B;  1GZX B;  1B86 B;  3UHH A;  3FH9 A;  1O1J B;  3ED9 A;  2LH3 A;  1A6G A;  1MYZ A;  1BAB B;  3A59 A;  1YG5 B;  1Y5K B;  1A6N A;  1YH9 A;  3DHT B;  4AVD A;  3OZW A;  3D1A A;  4L2M A;  3QM5 A;  1O1O B;  3PI1 A;  1JF3 A;  2EB9 A;  1TU9 A;  1LHT A;  1Y8K A;  1Y4B B;  2O5O X;  1VWT A;  3SDN A;  1RSE A;  1GDK A;  1NS6 A;  3V2Z A;  4MQK A;  2BNL A;  3WCV C;  3GOU A;  1SWM A;  2V1K A;  3OO4 B;  2FRI X;  1K1K A;  2GRF A;  5C6Y A;  5EOH A;  2ZT4 A;  3WI8 A;  1DTI A;  1XZ4 B;  1GDJ A;  1Y8H B;  2VM0 A;  1AJG A;  1DKE A;  1NGK A;  1Y5F B;  1R1X A;  3UHG A;  2O5T X;  1LFY B;  4XS0 A;  2D2M D;  1A00 A;  3WCP A;  1CH3 A;  1Y4P B;  1OJ6 A;  3ONZ B;  4U8U A;  2MGH A;  1C7C B;  4F4O B;  6HBW B;  1YE0 A;  3WFX A;  3WFT A;  2FRJ X;  3OO4 A;  1YEQ B;  1ECN A;  1OR4 A;  4HRR A;  3WCT D;  1XZ4 A;  1DLY A;  2R1H B;  1V4U A;  1LJW A;  2HHE B;  5CNG A;  2HBD B;  3IA3 B;  1MYT A;  4OF9 A;  3G4W A;  4LPI A;  1HBA B;  1CP5 A;  1Y4G A;  4NK2 A;  1QXD B;  3MN0 A;  4HHB B;  1XZU A;  2MGA A;  1DXT A;  3H58 A;  1JZL A;  1CO9 A;  3TM9 A;  3CY5 A;  1Y01 B;  1YOI A;  3AT5 B;  3MJU B;  1IWH B;  1Y0D B;  1SDL B;  3G4R A;  2MYE A;  5IKS A;  1A6K A;  4NZI A;  1O1K B;  3A0G B;  4MQG A;  3FS4 A;  3WCW C;  4M4B A;  1A6M A;  4N8T B;  3ZJS A;  1NIH B;  2QSS B;  1QPW B;  3UBC A;  1S0H A;  3OK5 A;  1SPE A;  5AZR A;  2BLH A;  3NMM A;  1Y0C A;  1ASH A;  1N9I A;  3ARK A;  3HRW A;  2CMM A;  2ZLU B;  3ZJN A;  1ABY A;  1JL7 A;  1YMB A;  1Y4R B;  3B75 A;  1XZ7 A;  1FAW B;  3D7O A;  1YHU B;  1JDO A;  1R1Y A;  4IRO A;  3ZJM A;  1DXC A;  1Y4P A;  3LR7 A;  5B84 A;  1RQ4 B;  1IRD B;  1BZ0 B;  1Y4B A;  3R5I A;  103M A;  105M A;  3EU1 A;  3WR1 A;  1JP6 A;  3V2V A;  4FC3 A;  2AUR A;  2W31 A;  4N7O B;  1Y09 A;  2QFN A;  1G09 B;  5CN5 A;  3MYM A;  1MLN A;  2LH1 A;  1OFK A;  1JPB A;  1O1N B;  2GTL D;  1Y31 B;  1V4W B;  1FLP A;  1LFT B;  1MYI A;  3AQ7 A;  3QJB A;  1R1X B;  3VRG B;  3AQ5 A;  1YMC A;  1HAB A;  1IT2 A;  3S1I A;  4F6J A; 
#chains in the Genus database with same CATH topology
 1XZ5 A;  1HDB A;  1SPG A;  5B13 A;  1B86 A;  1A3N A;  1YGD A;  1THB A;  3GKT A;  2GLN A;  2ZFO B;  1BZ1 A;  2JHO A;  1X9F A;  5EUI B;  1GCV B;  1BZZ A;  2G0R A;  1MWB A;  1QSH A;  1LFY A;  2W6X A;  3S1J A;  3PEL A;  1Y7C A;  2W6V A;  2EF2 A;  1N9F A;  4IT8 A;  3ECX A;  1S56 A;  1OR6 A;  1YEN A;  1GVH A;  1NS6 B;  1D8U A;  2R4W A;  1HGC B;  1EBT A;  2R4Z A;  1NQP B;  1Y35 A;  5C6E B;  5HY8 A;  2QMB A;  1GBV B;  1GBU A;  3ZJP A;  3KVS A;  1MLK A;  2VEB A;  1A87 A;  1MYJ A;  4H0B A;  1Y7D B;  3GQG A;  2D5X B;  1THB B;  1J41 A;  1SDK A;  1A3O B;  2OHB A;  1CMY B;  2ZST A;  2C7L B;  1IBE A;  4ROM B;  3UHN A;  1B0B A;  1DUK A;  2LH5 A;  1W92 A;  2ZLW A;  2V1I A;  1A9W A;  1XYE B;  5ILE A;  1DO1 A;  4PQ6 A;  2H35 A;  3PEL B;  1L2K A;  2MYD A;  1LFZ A;  1MNH A;  3OGB A;  2ZWJ A;  1NY9 A;  5AQD M;  3UGY A;  1CH2 A;  3G46 A;  1O1J A;  4HRT B;  3NUH B;  3UHV A;  1WMU A;  1DTM A;  5EYJ A;  1YH9 B;  3DHT A;  1Y83 B;  5SW7 A;  3KMF A;  1G0B B;  1NS9 A;  1C7B B;  3UHC A;  4DWU A;  3HF4 B;  1BBB B;  1PBX A;  3OO5 A;  4UIQ A;  4MU5 A;  3VHB A;  6HBW A;  4FWX A;  1NIH A;  2HBE B;  4ERV A;  1YVT A;  1Q1F A;  1MNI A;  1JEB A;  2ZSR A;  2UUM B;  1NWI A;  1QSI B;  1YEO A;  2LH7 A;  3WCT B;  3PI2 A;  3NL7 B;  1Y4F A;  4A8Y A;  4VHB A;  3ZJI A;  1DXV A;  3BRP A;  1S61 A;  4KN3 A;  1GCW B;  3WFW A;  2VJR B;  5HLQ A;  4YJJ B;  2DKA A;  4XS0 B;  2ZS0 C;  2HBC B;  3ARL A;  3A5A A;  3GDJ A;  2VEE A;  4LMS B;  1J7S B;  2D5Z B;  3SZK A;  2D2M C;  2GL3 A;  5C6E A;  3UH3 A;  3ODQ A;  3HHB A;  1MNO A;  2NX0 A;  4FH6 A;  2HBG A;  2O5L X;  3DHR A;  1HDB B;  1SPG B;  4HRR B;  4PQC A;  2XKH A;  1SDK B;  3AG0 A;  3BJ2 B;  3HRW B;  3GK9 A;  5EUI A;  2I88 A;  1YDZ A;  1HGA A;  4YJJ A;  2NSS A;  5JGG A;  3MVC A;  3NFE A;  2G11 A;  3QJE A;  1HDS B;  1HBH A;  1CP0 A;  2GRH A;  1NAZ A;  3ZJO A;  3MKB B;  5EE4 C;  4F6B A;  1Y0T B;  3D1K B;  3ORD A;  1YHR A;  3WCU A;  1DKE B;  2VYZ A;  3PI9 A;  1Y85 B;  3BJ1 B;  1H97 A;  3MJU A;  3AT5 A;  1Y4V B;  3WHM B;  3PT8 A;  2IN4 A;  1UIW A;  2PGH A;  4XXI A;  109M A;  2EVP A;  2ZT0 A;  2E2Y A;  2YSK A;  1GH0 B;  1I7Y A;  4SDH A;  1FDH A;  3A0G A;  2HZ2 A;  3LB1 A;  2ZSZ A;  2ZSO A;  1GBU B;  4LM6 B;  1DO4 A;  2PEG A;  1JEB B;  1XXT A;  4MQI A;  1HHO B;  1URV A;  2Z6N A;  2W6Y A;  2C7K A;  1S0H B;  4F4O A;  1G09 A;  2GKN A;  3QQQ A;  3NL7 A;  2R1H A;  3O89 A;  1YCA A;  2VHB A;  3K8B A;  3B75 B;  3WCT C;  3PIA B;  1J3Y B;  3UH7 A;  3OZU A;  1BZR A;  4A8M P;  2RI4 A;  1MLL A;  5SW7 B;  1G0B A;  2ZS1 D;  3ECZ A;  1O1L B;  2WCR A;  1VWT B;  2X49 A;  3WTG B;  4O2G A;  3DR9 A;  1X46 A;  3DBJ A;  2ZFO C;  1HGC A;  3O18 A;  2HBS B;  1YVQ B;  2YRS B;  2PEG B;  1FHJ B;  1RVW A;  1MNJ A;  1YZI B;  3EDA A;  1MWC A;  3LR9 A;  1LFQ A;  4X0L B;  1EW6 A;  2D2M A;  5F0B A;  2C7L A;  4ROM A;  1NPF A;  3VRF B;  1Y4Q A;  3TLD A;  4B3W A;  2QU0 B;  2JL9 A;  2GTL C;  1PHN A;  1T1N A;  2R50 A;  1HBR B;  3QM8 A;  1J7W B;  3GQP B;  4UUR A;  1BUW A;  2OHA A;  1LFV A;  1COH A;  4UZV A;  3GDJ B;  1HBH B;  1AJ9 A;  1JY7 A;  3O2C B;  3NMM B;  1YHE A;  111M A;  2V1J A;  5E83 B;  2DN1 B;  2ZLT B;  4MQH B;  1UVL A;  1CII A;  1MBC A;  4YU4 B;  1MTK A;  1YOG A;  1JP9 A;  1MLS A;  3D1A B;  1UVI A;  3OZV A;  3BJ2 A;  4XDI A;  1Y8W B;  1UVK A;  1GDL A;  1KFR A;  1Y5J A;  1BIN A;  1J7S A;  1DWR A;  2DN2 A;  1DWS A;  2HHE A;  3R5I B;  2EVK A;  1I3D A;  2OIF A;  4ESA B;  3IC2 A;  4MQJ B;  3AQ8 A;  3WR1 B;  4F6I A;  2LH2 A;  1CIK A;  3GIO A;  3A5G A;  3UHK A;  3E5O A;  3HXN B;  4ZIZ A;  4HHB A;  3WCW D;  2OLP A;  1AJH A;  3LQ9 A;  1MLM A;  1MCY A;  1Y09 B;  2ZT3 A;  1RPS A;  2R80 B;  1Y7G A;  4JYQ A;  2D2N B;  1DM1 A;  1WAC A;  4GY3 B;  1JBO A;  3QZZ A;  5ILM A;  1O1K A;  2AUO A;  3KUN A;  4M4B B;  2HBS A;  3O18 B;  1LH1 A;  1NPG A;  2W6W A;  1MYF A;  5AB8 A;  3QM9 A;  1MDN A;  1S5X A;  1YOH A;  3UGZ A;  3PI9 B;  2XYK A;  7HBI A;  4OOD A;  3UHD A;  3MYN A;  1O1O A;  4PQB A;  4X0L A;  1XZU B;  1BZ6 A;  2G12 A;  3VRE A;  3BJ3 A;  1YEU A;  3W4U A;  1FN3 A;  2G14 A;  1LHS A;  2R80 A;  3UHR A;  5HY8 B;  2DXM B;  1HBB A;  1XQ5 B;  1YVT B;  4MQI B;  3DHR B;  1NZ3 A;  1KTP A;  3WCV B;  2MGF A;  1LH2 A;  1YHU C;  3FS4 B;  1QXD A;  3NG6 B;  2QMB B;  3P5Q B;  2V8A A;  2Z6S A;  2YRS A;  4NXC A;  2Z6T A;  1DXU B;  3QJC A;  1Y5F A;  1HI8 A;  1ABS A;  2WTH A;  2UUN B;  2VJR A;  2D2N C;  4WCH D;  4ODC A;  4BS9 A;  3MBA A;  1FDH G;  1MYM A;  2HZ1 A;  1YE2 B;  2MHB A;  1UMO A;  1LH5 A;  2DHB B;  1Y7Z B;  1C40 A;  1AJ9 B;  3UHT A;  1A0U B;  1HI0 P;  3WHM A;  1CBM A;  1UIW B;  2AUQ A;  2PGH B;  1MYG A;  3G53 A;  2UUN D;  3ZHW A;  3D17 A;  3QZX A;  2RAO B;  1Y4Q B;  2MB5 A;  5KDQ A;  1CH5 A;  2MGJ A;  4RMP B;  2UUN A;  1UVN A;  5KER A;  2FRF A;  4F0T A;  3K3U A;  1HBR A;  1LH6 A;  1Y8W A;  5CHQ A;  4N6S B;  2O58 X;  3HEN A;  1Y2Z B;  3U3E A;  2VML A;  2R4X A;  5KKK A;  4MQG B;  1C7C A;  5E83 A;  1F5O A;  1M6M A;  1TES A;  3IXF A;  5CN6 A;  1VXC A;  1Y4F B;  4MBA A;  4N7P B;  1LA6 A;  4KMV A;  2MYB A;  4L1E B;  2HCO A;  3HXN A;  1NEJ A;  3ZOL A;  4Z8K B;  3VRE B;  1CLS B;  1CPC A;  5FVB M;  1MBS A;  4AE1 A;  3DBJ B;  1I3E A;  1GCW A;  2ZFB A;  5E29 A;  2ZS1 B;  5EYS A;  1A01 B;  3GQR B;  2V1G A;  2SPN A;  2QSS A;  1FCS A;  2HBF A;  5D5R A;  2EKT A;  3EOK B;  1VRF A;  1MKO A;  1UT0 A;  2VYY A;  2NRL A;  5AZQ A;  1Y45 A;  1ITH A;  1YFF B;  3LB4 A;  2ZLX B;  1YGD B;  5CMV A;  1Y0C B;  3AQ6 A;  4NI1 A;  2DN3 B;  1VXH A;  2GDM A;  3QQR A;  1Y46 B;  1O1I B;  2VYW A;  2QLS A;  2LH6 A;  3IC0 B;  1J40 B;  1K0Y A;  2W72 B;  1KR7 A;  4HSW A;  2ZSP A;  1V07 A;  1OFJ A;  1MTI A;  2FAM A;  1Z8U B;  1IDR A;  1Y5J B;  2D60 B;  2MYA A;  1O1N A;  1O1P A;  4O4T A;  1HDS A;  5CNB A;  2M6Z B;  1JZK A;  1YIH A;  2AA1 B;  1DDT A;  1MZ0 A;  1XYE A;  3ZJH A;  4ESA A;  1RTX A;  1CPW A;  2MGG A;  3EOK A;  1Y0A A;  2V1E A;  3RJN B;  2ZS0 B;  1XZ5 B;  3HYU A;  4Q70 A;  2D5X A;  3GQG B;  1J41 B;  2VLY A;  2GNV A;  5JDO D;  2Z8A A;  3D1K A;  1YG5 A;  2D6C A;  1Y22 B;  4ILZ A;  1V4W A;  1MLF A;  1Y4R A;  3VRF A;  1JWN A;  108M A;  5CN8 A;  5F2A A;  3MOU A;  2DXM A;  1G08 B;  1SHR A;  5E6E A;  3QM6 A;  1VXE A;  1NZ2 A;  1LFZ B;  2ZT2 A;  3GKV A;  1COH B;  2V1F A;  1VXD A;  1EMY A;  110M A;  1NWN A;  5B13 G;  2HBE A;  1LH7 A;  1CQX A;  1X9F B;  4MQH A;  1FSX B;  2ZS0 A;  1LA6 B;  3AT6 A;  2G10 A;  3UHW A;  2NRM A;  1MTJ A;  2MGC A;  3M39 A;  1EYX A;  4FC3 B;  1Y7G B;  2FRK X;  2B7H B;  2XKG A;  4ODC B;  1O1L A;  2W6V B;  1O1M A;  1HV4 B;  1A4F A;  3WFU A;  2G3H A;  2MGE A;  5CNF A;  1LH3 A;  3QJB B;  1NQP A;  1Y35 B;  4G51 B;  1YVQ A;  5KER B;  4MQJ A;  1S5X B;  2C0K A;  3GKV B;  5CHR A;  1XCH A;  1GLI B;  3M3B A;  1QSI A;  3MJP A;  1MYH A;  3S65 A;  2HHD A;  2WTG A;  3WCW B;  104M A;  1SI4 A;  1JZM A;  3UHB A;  3HHB B;  3LB2 A;  1OUU B;  3WCU B;  1BZ1 B;  4ERT A;  5KDQ B;  3QJC B;  2Z85 A;  2VLX A;  3S48 C;  5CN4 A;  4H07 A;  1O1M B;  4WJG A;  3V57 B;  5HAV A;  2BW9 M;  1HHT P;  1UFP A;  1DXD A;  1G9V B;  2SPM A;  3UHQ A;  1ON7 A;  2BWH A;  2LHB A;  1HAC B;  3WCU D;  1RTE A;  2BMM A;  5CN7 A;  1KD2 B;  1NXF A;  2DHB A;  2VJT B;  3HYU B;  1Y83 A;  1Y8I A;  2UUL H;  3MKB A;  2HZ3 A;  4H2L B;  3BCQ A;  4ROL A;  4A8S A;  3D4X B;  1Y0W A;  1FSL A;  3BRP B;  4BJU A;  1FN3 B;  1URY A;  3LHB A;  2MYC A;  1Y85 A;  2SPL A;  1MKO B;  3G4Q A;  3UHS A;  1V75 A;  1EWA A;  2D60 A;  4F69 A;  1MBA A;  2ZLV A;  3QMA A;  4HSX A;  4GXE A;  4NI1 B;  1KN1 A;  4N8T A;  3NML A;  4NI0 B;  4NXA A;  3ODQ B;  3HEO A;  1DXV B;  3IC0 A;  1J7Y B;  2H8F A;  1MBN A;  1IRC A;  4TWV A;  1UFJ A;  1F99 A;  4L7Y A;  1YIE A;  4BJA A;  1X9F C;  2MGI A;  3KUO A;  2MGD A;  1CIO A;  1GJN A;  1C7D A;  4F6D A;  3R0G A;  1HJT A;  1MLO A;  3UHX A;  4H0M B;  2BK9 A;  4DC8 A;  1Y4G B;  1LFV B;  4NS2 A;  3WCP B;  3CIU B;  1K1K B;  4HH1 A;  1YFF A;  2W72 C;  1Y7D A;  1OUT B;  1HA7 B;  1NEJ B;  3ZH0 A;  1G0A A;  2KSC A;  5HU6 A;  4AVE A;  4FWY A;  3EDB A;  1DO3 A;  4MPM A;  1Y8H A;  5MBN A;  3CY5 B;  3AT6 B;  1A01 A;  3GQR A;  4JAC A;  1NZ4 A;  106M A;  1XF6 C;  2ZT1 A;  3PT7 A;  3PT8 B;  4F0T B;  4DC7 A;  1XZ2 A;  1A00 B;  1MLJ A;  3W4U B;  2QFK A;  4MXL A;  4F68 A;  4B02 A;  1I7Y B;  1J3Z B;  4C0N A;  1HAC A;  1COL A;  1JL6 A;  1XG0 C;  4A8W A;  1QXE B;  1JY7 B;  1UC3 A;  1LUE A;  1LFL B;  1UVM A;  3PI8 B;  1C7B A;  1B33 A;  1CLS A;  4KMW A;  2BV8 B;  3LQD B;  1ECD A;  1GH0 A;  3ASE A;  3K8B B;  4DWT A;  2QSP B;  1FAW A;  3D7O B;  5EET A;  1CH7 A;  1J3Y A;  4MQK B;  2ZS1 A;  3M38 A;  1HCO A;  1R1Y B;  3M3A A;  1JP8 A;  107M A;  2D2N A;  3NFE B;  1XZ2 B;  1V75 B;  1UVX A;  1Y7Z A;  1JF4 A;  3ZJQ A;  3WTG A;  3GYS B;  1RQ3 B;  1J3F A;  2ZLX A;  4ESU A;  3O7N A;  1XZV A;  3UH6 A;  4MQC B;  1OBM A;  2H8F B;  4YU4 A;  4MBN A;  3L0F A;  5EQM A;  1BVD A;  1IWH A;  1HRM A;  2VLZ A;  1A3O A;  1HGB A;  1LFQ B;  2UUL C;  1IBE B;  1YEU B;  2D2M B;  1V4U B;  2QSP A;  1MLH A;  2M6Z A;  1V9Q A;  3OVU C;  3GLN A;  3ZJJ A;  4RMP A;  1XY0 B;  5ILP A;  3HC9 A;  5B85 A;  4IRO B;  1HSY A;  1A0Z A;  2FAL A;  1KTP B;  5EU2 A;  2GKM A;  2C7K B;  2HHD B;  2VML B;  1A3N B;  1V5H A;  1YHE B;  5CN9 A;  3WCV D;  1VRE A;  1M9P B;  2VJH A;  1DXU A;  1XZ7 B;  2MBW A;  1YDZ B;  4A8O A;  4YU3 B;  1RPS B;  2DC3 A;  1F99 B;  4G51 A;  2QU0 A;  1ALL A;  4ETT A;  3ARJ A;  1IOP A;  1T1N B;  1V4X A;  2GTL A;  4F6F A;  1RQ4 A;  1B8D B;  2H8D B;  5HBI A;  1TOX A;  2SPO A;  3WCW A;  1MOH A;  3VRG A;  1DXT B;  4O4Z A;  2DKC A;  1PMB A;  1Y45 B;  1CQ2 A;  1FSX A;  1RVW B;  4MAX A;  4FH7 A;  1YGF A;  4ETV A;  1GZX A;  1HLB A;  102M A;  3BOM B;  1LFL A;  1U7S A;  4GZG A;  1CMY A;  2MGK A;  4TWU A;  2V1H A;  3AQ9 A;  1A4F B;  1HV4 A;  1S5Y A;  1X9F D;  1YIH B;  1HCO B;  4TMA B;  1F65 A;  2H35 B;  1MLQ A;  1KD2 A;  3VAU A;  1BZ0 A;  112M A;  1IRD A;  5HLX A;  4M4A B;  5ILR A;  3GYS A;  1OUT A;  3WCV A;  3E4N A;  4F6G A;  2GNW A;  1HLM A;  3P5Q A;  4O35 A;  5HU6 B;  4NI0 A;  1CBL A;  1Y0A B;  2HHB A;  1CG8 A;  1ECO A;  1CH4 A;  4N7N B;  4ZVA A;  1BIJ B;  2JLF A;  3BOM A;  2O5Q X;  1NS9 B;  1QI8 B;  1MBI A;  1Y0D A;  2J96 A;  5JOM A;  3HF4 A;  1SDL A;  1JBO B;  1RQA A;  1CH9 A;  3E55 A;  2G0Z A;  2MGB A;  1VHB A;  1YHU D;  2RAO A;  1HDA B;  2OH9 A;  3DUT A;  2ZFB B;  3GUQ A;  1SGK A;  3E5I A;  5JGG B;  4U8U C;  2ZSY A;  5E6E B;  3RJ6 A;  1QPW A;  1S6A A;  4C44 A;  1VXF A;  1MWD A;  2R4Y A;  1BZP A;  3TM3 A;  3A5B A;  1HA7 A;  3WCU C;  1YIE B;  3UHU A;  1HBS A;  1XZV B;  1G0A B;  1HBI A;  1BAB A;  3A59 B;  2VJH B;  4QAU A;  3D17 B;  2ZSS A;  2ZFO A;  3UBV A;  1LJW B;  2EB8 A;  3BJ1 A;  1MOA A;  1CG5 B;  1NZ5 A;  2IG3 A;  1HAB B;  2GTL B;  4Z8K A;  4PO5 B;  1X3K A;  3CIU A;  1O1P B;  1BBB A;  1PBX B;  4A8K A;  3G4V A;  4HBI A;  5E29 B;  2HBD A;  5EV5 A;  4HRT A;  5JDO F;  101M A;  2DN1 A;  4N7P A;  3PI3 A;  3UH5 A;  1WLA A;  2VRY A;  1GLI A;  3MJP B;  2Z6N B;  1VXB A;  1MLU A;  1QSH B;  2DN3 A;  2AV0 A;  1ABW B;  3HEP A;  1Y46 A;  1Y22 A;  1CPC B;  2BV8 A;  3LQD A;  2O5S X;  1UX8 A;  1XY0 A;  2RI4 B;  2ZLW B;  1YEV B;  3G52 A;  2HBF B;  4A8F A;  1SHR B;  3SDH A;  1LTW A;  4M4A A;  4O1T A;  1A0U A;  4B4Y A;  1RH1 A;  2ZFO D;  3NG6 A;  1UVY A;  1Y0T A;  1MBO A;  3GOU B;  2V8A B;  1Y5K A;  2ZS0 D;  2VJT A;  4PNJ A;  1WMU B;  1F5P A;  3K9Z A;  3PI4 A;  1MDT A;  2B7H A;  3BA2 A;  1V4X B;  3BCQ B;  1HGB B;  4ROL B;  1Y7C B;  1VXA A;  2EKU A;  1MNK A;  2MGL A;  2H8D A;  4WJG 1;  1HDA A;  3DUT B;  3ECL A;  3QM7 A;  1DO7 A;  2AA1 A;  3OO5 B;  1YEV A;  1YHU A;  1KN1 B;  1MLG A;  1HGA B;  1VXG A;  2AUP A;  4MQC A;  5AQD A;  1GBV A;  3EU1 B;  1J7Y A;  1J52 A;  3QJD A;  4Q70 B;  3LB3 A;  2HCO B;  1CH1 A;  1IT3 A;  2ZLT A;  4LMX B;  1DWT A;  3PMC A;  2G0V A;  1G08 A;  2ZSN A;  1MOC A;  1LIA A;  3QJE B;  2MGM A;  2ZS1 C;  1H1X A;  3ZJR A;  1DUO A;  1O1I A;  3IC2 B;  2OH8 A;  1YHR B;  4TYX A;  1HBA A;  1YEQ A;  1BIJ A;  2GRZ A;  4YU3 A;  4KJT A;  4ETU A;  2JLG A;  1JW8 A;  1WVP A;  3A9M A;  5HLU A;  1SI4 B;  1ABW A;  3UHZ A;  1Y8K B;  1MOB A;  1DLW A;  2DKD A;  3D4X A;  1YEN B;  1UX9 A;  5MBA A;  2BKM A;  2MHB B;  1J3Z A;  1BJE A;  1BUW B;  1YGF B;  3KMF C;  4PO5 A;  1EBC A;  1A0Z B;  1BVC A;  3S66 B;  1QXE A;  1U7R A;  2AV3 A;  1ECA A;  2BLJ M;  2NSR A;  3PI8 A;  3A2G A;  3FH9 B;  1YCB A;  1OUU A;  1MGN A;  2HHB B;  1S5Y B;  2QLS B;  1CG8 B;  5JDO E;  3G4U A;  3RQR A;  4L7Y B;  3G4Y A;  1YZI A;  3ZTA A;  3UHI A;  1B33 B;  1HHS A;  3BJ3 B;  5M3S A;  2DN2 B;  4MXK A;  2ZLU A;  3UHE A;  1ABY B;  2WY4 A;  4G1B A;  1LFT A;  1Y2Z A;  4G1V A;  1RQ3 A;  4NK1 A;  1YE0 B;  1MOD A;  1MLR A;  5D1V A;  4H0M A;  1MBD A;  1XQ5 A;  1YMA A;  3S66 A;  1HHO A;  3L0F B;  1F63 A;  2ZLV B;  2C7J A;  2O5M X;  1QI8 A;  4ZVB A;  4ZIZ B;  1N9H A;  1HBG A;  3ZOM A;  2XKI A;  1O16 A;  5CNC A;  1XDT T;  1GCV A;  4FWZ A;  3PIA A;  1M6C A;  5FVB A;  2ZSQ A;  1CG5 A;  2G0X A;  5CNE A;  2D2N D;  1J7W A;  3GQP A;  1XXT B;  3ZJL A;  2ZSX A;  2QRW A;  3UI0 A;  1CO8 A;  1YE2 A;  3ONZ A;  4U8U B;  1C7D B;  1YEO B;  1G9V A;  1HBS B;  3RGK A;  5EE4 D;  1M9P A;  2G0S A;  1FHJ A;  1F0L A;  3UHY A;  1S69 A;  1J40 A;  1K0Y B;  2UUM A;  2W72 A;  4N7N A;  1C40 B;  4N7O A;  1GDI A;  1Y8I B;  1Y4V A;  3OJ1 A;  4HH0 A;  4H2L A;  3WCT A;  1Y31 A;  6HBI A;  1RQA B;  2O5B X;  4U8U D;  2D5Z A;  5JDO C;  1BZZ B;  1Y0W B;  1A9W E;  1AZI A;  3SZK B;  5CND A;  2BLI A;  1ON7 B;  1N9X A;  1HBB B;  3PT7 B;  2HBC A;  1B8D A;  3H57 A;  3QJD B;  3S65 B;  1GZX B;  1B86 B;  4GXE B;  3UHH A;  3V58 A;  3FH9 A;  1O1J B;  3ED9 A;  3VNC A;  2LH3 A;  1A6G A;  1MYZ A;  1BAB B;  3A59 A;  1YG5 B;  3KVS B;  1Y5K B;  1A6N A;  4L1E A;  1YH9 A;  3DHT B;  4AVD A;  3OZW A;  3D1A A;  4L2M A;  3QM5 A;  1O1O B;  4A8Q A;  3PI1 A;  1JF3 A;  2EB9 A;  1TU9 A;  1LHT A;  1Y8K A;  1Y4B B;  2O5O X;  1VWT A;  3SDN A;  3V57 A;  1RSE A;  1GDK A;  1NS6 A;  3O2C A;  3V2Z A;  4MQK A;  2BNL A;  3MWN A;  3WCV C;  3GOU A;  1SWM A;  2V1K A;  3OO4 B;  2FRI X;  1K1K A;  2GRF A;  5C6Y A;  5EOH A;  3V58 B;  4XXK A;  2ZT4 A;  4AE0 A;  3WI8 A;  1DTI A;  1XZ4 B;  1GDJ A;  1Y8H B;  2VM0 A;  1AJG A;  1DKE A;  1NGK A;  1Y5F B;  1R1X A;  1ALL B;  3UHG A;  2O5T X;  1LFY B;  4XS0 A;  2D2M D;  1A00 A;  3WCP A;  1CH3 A;  1Y4P B;  1OJ6 A;  3ONZ B;  4U8U A;  2MGH A;  1C7C B;  4F4O B;  6HBW B;  1YE0 A;  3WFX A;  3WFT A;  2FRJ X;  3OO4 A;  2UUL B;  1YEQ B;  1ECN A;  1OR4 A;  4HRR A;  3WCT D;  4GY3 A;  1XZ4 A;  1DLY A;  2R1H B;  1V4U A;  1LJW A;  2HHE B;  5CNG A;  2HBD B;  3IA3 B;  1MYT A;  4OF9 A;  4F0U B;  3G4W A;  4LPI A;  1HBA B;  1CP5 A;  1Y4G A;  1QGW C;  2C7J B;  4NK2 A;  2UUL D;  1QXD B;  3MN0 A;  4HHB B;  1XZU A;  2MGA A;  1DXT A;  3H58 A;  2UUL A;  1JZL A;  1CO9 A;  3TM9 A;  3CY5 A;  1Y01 B;  1YOI A;  3AT5 B;  3MJU B;  1IWH B;  1Y0D B;  1SDL B;  1PHN B;  3G4R A;  2MYE A;  5IKS A;  1A6K A;  2WCQ A;  4NZI A;  1O1K B;  3A0G B;  4MQG A;  3FS4 A;  3WCW C;  4M4B A;  1A6M A;  4N8T B;  3ZJS A;  1UVJ A;  1NIH B;  2QSS B;  1QPW B;  3UBC A;  1S0H A;  3OK5 A;  1SPE A;  5AZR A;  2BLH A;  3NMM A;  3FEW X;  1Y0C A;  1ASH A;  1N9I A;  3ARK A;  3HRW A;  2CMM A;  2ZLU B;  3ZJN A;  1ABY A;  1JL7 A;  1YMB A;  1Y4R B;  3B75 A;  1XZ7 A;  1FAW B;  3D7O A;  1YHU B;  1JDO A;  1R1Y A;  4IRO A;  3ZJM A;  1DXC A;  1Y4P A;  3LR7 A;  5B84 A;  1RQ4 B;  1IRD B;  1BZ0 B;  1Y4B A;  3PMD A;  4N6S A;  3R5I A;  103M A;  105M A;  3EU1 A;  3WR1 A;  1JP6 A;  3V2V A;  2X4A A;  1EYX B;  4FC3 A;  2UUM X;  2AUR A;  2W31 A;  4N7O B;  1Y09 A;  2QFN A;  1G09 B;  5CN5 A;  3MYM A;  1MLN A;  2LH1 A;  1OFK A;  1JPB A;  1LIA B;  1O1N B;  2GTL D;  1Y31 B;  1V4W B;  1FLP A;  1LFT B;  1MYI A;  3AQ7 A;  3QJB A;  1HI1 A;  1R1X B;  3VRG B;  3AQ5 A;  4F0U A;  1YMC A;  1HAB A;  1IT2 A;  3S1I A;  4F6J A; 
#chains in the Genus database with same CATH homology
 1XZ5 A;  1HDB A;  1SPG A;  1B86 A;  1A3N A;  1YGD A;  1THB A;  3GKT A;  2GLN A;  2ZFO B;  1BZ1 A;  2JHO A;  1X9F A;  5EUI B;  1GCV B;  1BZZ A;  2G0R A;  1MWB A;  1QSH A;  1LFY A;  2W6X A;  3S1J A;  3PEL A;  1Y7C A;  2W6V A;  2EF2 A;  1N9F A;  4IT8 A;  3ECX A;  1S56 A;  1OR6 A;  1YEN A;  1GVH A;  1NS6 B;  1D8U A;  2R4W A;  1HGC B;  1EBT A;  2R4Z A;  1NQP B;  1Y35 A;  5C6E B;  5HY8 A;  2QMB A;  1GBV B;  1GBU A;  3ZJP A;  1MLK A;  2VEB A;  1MYJ A;  4H0B A;  1Y7D B;  3GQG A;  2D5X B;  1THB B;  1J41 A;  1SDK A;  1A3O B;  2OHB A;  1CMY B;  2ZST A;  4ROM B;  1IBE A;  3UHN A;  1B0B A;  1DUK A;  2LH5 A;  1W92 A;  2ZLW A;  2V1I A;  1A9W A;  1XYE B;  5ILE A;  1DO1 A;  4PQ6 A;  2H35 A;  3PEL B;  1L2K A;  2MYD A;  1LFZ A;  1MNH A;  3OGB A;  2ZWJ A;  3UGY A;  1CH2 A;  3G46 A;  1O1J A;  4HRT B;  3UHV A;  1WMU A;  1DTM A;  5EYJ A;  1YH9 B;  3DHT A;  1Y83 B;  5SW7 A;  3KMF A;  1G0B B;  1NS9 A;  1C7B B;  3UHC A;  4DWU A;  3HF4 B;  1BBB B;  1PBX A;  3OO5 A;  4UIQ A;  4MU5 A;  3VHB A;  6HBW A;  4FWX A;  1NIH A;  2HBE B;  1YVT A;  1Q1F A;  1MNI A;  1JEB A;  2ZSR A;  1NWI A;  1QSI B;  1YEO A;  2LH7 A;  3WCT B;  3PI2 A;  3NL7 B;  1Y4F A;  4VHB A;  3ZJI A;  1DXV A;  1S61 A;  4KN3 A;  1GCW B;  3WFW A;  5HLQ A;  4XS0 B;  2ZS0 C;  2HBC B;  3ARL A;  3A5A A;  3GDJ A;  2VEE A;  1J7S B;  2D5Z B;  3SZK A;  2D2M C;  2GL3 A;  5C6E A;  3UH3 A;  3ODQ A;  3HHB A;  1MNO A;  2NX0 A;  4FH6 A;  2HBG A;  2O5L X;  3DHR A;  1HDB B;  1SPG B;  4HRR B;  4PQC A;  2XKH A;  1SDK B;  3AG0 A;  3BJ2 B;  3HRW B;  3GK9 A;  5EUI A;  1YDZ A;  1HGA A;  2NSS A;  5JGG A;  3MVC A;  3NFE A;  2G11 A;  3QJE A;  1HDS B;  1HBH A;  1CP0 A;  2GRH A;  1NAZ A;  3ZJO A;  3MKB B;  5EE4 C;  4F6B A;  1Y0T B;  3D1K B;  3ORD A;  1YHR A;  3WCU A;  1DKE B;  2VYZ A;  3PI9 A;  1Y85 B;  3BJ1 B;  1H97 A;  3MJU A;  3AT5 A;  1Y4V B;  3WHM B;  3PT8 A;  2IN4 A;  1UIW A;  2PGH A;  109M A;  2EVP A;  2ZT0 A;  2E2Y A;  4SDH A;  1FDH A;  3A0G A;  2HZ2 A;  3LB1 A;  2ZSZ A;  2ZSO A;  1GBU B;  1DO4 A;  2PEG A;  1JEB B;  1XXT A;  4MQI A;  1HHO B;  1URV A;  2Z6N A;  2W6Y A;  1S0H B;  4F4O A;  1G09 A;  2GKN A;  3QQQ A;  3NL7 A;  2R1H A;  3O89 A;  1YCA A;  2VHB A;  3K8B A;  3B75 B;  3WCT C;  3PIA B;  1J3Y B;  3UH7 A;  3OZU A;  1BZR A;  2RI4 A;  1MLL A;  5SW7 B;  1G0B A;  2ZS1 D;  3ECZ A;  1O1L B;  1VWT B;  3WTG B;  4O2G A;  3DR9 A;  1X46 A;  2ZFO C;  1HGC A;  2HBS B;  1YVQ B;  2YRS B;  2PEG B;  1FHJ B;  1RVW A;  1MNJ A;  1YZI B;  3EDA A;  1MWC A;  3LR9 A;  1LFQ A;  4X0L B;  1EW6 A;  2D2M A;  5F0B A;  4ROM A;  1NPF A;  3VRF B;  1Y4Q A;  3TLD A;  4B3W A;  2QU0 B;  2GTL C;  1T1N A;  2R50 A;  1HBR B;  3QM8 A;  1J7W B;  3GQP B;  4UUR A;  1BUW A;  2OHA A;  1LFV A;  1COH A;  4UZV A;  3GDJ B;  1HBH B;  1AJ9 A;  1JY7 A;  3NMM B;  1YHE A;  111M A;  2V1J A;  5E83 B;  2DN1 B;  2ZLT B;  4MQH B;  1MBC A;  4YU4 B;  1MTK A;  1YOG A;  1JP9 A;  1MLS A;  3D1A B;  3OZV A;  3BJ2 A;  4XDI A;  1Y8W B;  1GDL A;  1KFR A;  1Y5J A;  1BIN A;  1J7S A;  1DWR A;  2DN2 A;  1DWS A;  2HHE A;  3R5I B;  2EVK A;  1I3D A;  2OIF A;  4ESA B;  3IC2 A;  4MQJ B;  3AQ8 A;  3WR1 B;  4F6I A;  2LH2 A;  1CIK A;  3A5G A;  3UHK A;  3E5O A;  3HXN B;  4HHB A;  3WCW D;  2OLP A;  1AJH A;  1MLM A;  1MCY A;  1Y09 B;  2ZT3 A;  1RPS A;  2R80 B;  1Y7G A;  4JYQ A;  2D2N B;  1DM1 A;  3QZZ A;  5ILM A;  1O1K A;  2AUO A;  3KUN A;  4M4B B;  2HBS A;  1LH1 A;  1NPG A;  2W6W A;  1MYF A;  5AB8 A;  3QM9 A;  1MDN A;  1S5X A;  1YOH A;  3UGZ A;  3PI9 B;  2XYK A;  7HBI A;  4OOD A;  3UHD A;  3MYN A;  1O1O A;  4PQB A;  4X0L A;  1XZU B;  1BZ6 A;  2G12 A;  3VRE A;  3BJ3 A;  1YEU A;  3W4U A;  1FN3 A;  2G14 A;  1LHS A;  2R80 A;  3UHR A;  5HY8 B;  2DXM B;  1HBB A;  1XQ5 B;  1YVT B;  4MQI B;  3DHR B;  1NZ3 A;  3WCV B;  2MGF A;  1LH2 A;  1YHU C;  3FS4 B;  1QXD A;  3NG6 B;  2QMB B;  3P5Q B;  2Z6S A;  2YRS A;  4NXC A;  2Z6T A;  1DXU B;  3QJC A;  1Y5F A;  1ABS A;  2WTH A;  2D2N C;  4WCH D;  4ODC A;  3MBA A;  1FDH G;  1MYM A;  2HZ1 A;  1YE2 B;  2MHB A;  1UMO A;  1LH5 A;  2DHB B;  1Y7Z B;  1C40 A;  1AJ9 B;  3UHT A;  1A0U B;  3WHM A;  1CBM A;  1UIW B;  2AUQ A;  2PGH B;  1MYG A;  3G53 A;  3ZHW A;  3D17 A;  3QZX A;  2RAO B;  1Y4Q B;  2MB5 A;  5KDQ A;  1CH5 A;  2MGJ A;  5KER A;  2FRF A;  3K3U A;  1HBR A;  1LH6 A;  1Y8W A;  5CHQ A;  2O58 X;  3HEN A;  1Y2Z B;  3U3E A;  2R4X A;  5KKK A;  4MQG B;  1C7C A;  5E83 A;  1F5O A;  1M6M A;  1TES A;  3IXF A;  5CN6 A;  1VXC A;  1Y4F B;  4MBA A;  4N7P B;  1LA6 A;  4KMV A;  2MYB A;  2HCO A;  3HXN A;  1NEJ A;  3ZOL A;  3VRE B;  1CLS B;  1MBS A;  1I3E A;  1GCW A;  2ZFB A;  5E29 A;  2ZS1 B;  5EYS A;  1A01 B;  3GQR B;  2V1G A;  2SPN A;  2QSS A;  1FCS A;  2HBF A;  5D5R A;  2EKT A;  3EOK B;  1VRF A;  1MKO A;  1UT0 A;  2VYY A;  2NRL A;  5AZQ A;  1Y45 A;  1ITH A;  1YFF B;  3LB4 A;  2ZLX B;  1YGD B;  5CMV A;  1Y0C B;  3AQ6 A;  4NI1 A;  2DN3 B;  1VXH A;  2GDM A;  3QQR A;  1Y46 B;  1O1I B;  2VYW A;  2QLS A;  2LH6 A;  3IC0 B;  1J40 B;  1K0Y A;  2W72 B;  1KR7 A;  4HSW A;  2ZSP A;  1V07 A;  1OFJ A;  1MTI A;  2FAM A;  1Z8U B;  1IDR A;  1Y5J B;  2D60 B;  2MYA A;  1O1N A;  1O1P A;  4O4T A;  1HDS A;  5CNB A;  2M6Z B;  1JZK A;  1YIH A;  2AA1 B;  1MZ0 A;  1XYE A;  3ZJH A;  4ESA A;  1RTX A;  1CPW A;  2MGG A;  3EOK A;  1Y0A A;  2V1E A;  3RJN B;  2ZS0 B;  1XZ5 B;  3HYU A;  2D5X A;  3GQG B;  1J41 B;  2VLY A;  2GNV A;  5JDO D;  2Z8A A;  3D1K A;  1YG5 A;  2D6C A;  1Y22 B;  4ILZ A;  1V4W A;  1MLF A;  1Y4R A;  3VRF A;  1JWN A;  108M A;  5CN8 A;  5F2A A;  3MOU A;  2DXM A;  1G08 B;  1SHR A;  5E6E A;  3QM6 A;  1VXE A;  1NZ2 A;  1LFZ B;  2ZT2 A;  3GKV A;  1COH B;  2V1F A;  1VXD A;  1EMY A;  110M A;  1NWN A;  2HBE A;  1LH7 A;  1CQX A;  1X9F B;  4MQH A;  1FSX B;  2ZS0 A;  1LA6 B;  3AT6 A;  2G10 A;  3UHW A;  2NRM A;  1MTJ A;  2MGC A;  3M39 A;  4FC3 B;  1Y7G B;  2FRK X;  2B7H B;  2XKG A;  4ODC B;  1O1L A;  2W6V B;  1O1M A;  1HV4 B;  1A4F A;  3WFU A;  2G3H A;  2MGE A;  5CNF A;  1LH3 A;  3QJB B;  1NQP A;  1Y35 B;  4G51 B;  1YVQ A;  5KER B;  4MQJ A;  1S5X B;  2C0K A;  5CHR A;  3GKV B;  1XCH A;  1GLI B;  3M3B A;  1QSI A;  3MJP A;  1MYH A;  3S65 A;  2HHD A;  2WTG A;  3WCW B;  104M A;  1SI4 A;  1JZM A;  3UHB A;  3HHB B;  3LB2 A;  1OUU B;  3WCU B;  1BZ1 B;  5KDQ B;  3QJC B;  2Z85 A;  2VLX A;  3S48 C;  5CN4 A;  4H07 A;  1O1M B;  4WJG A;  5HAV A;  2BW9 M;  1UFP A;  1DXD A;  1G9V B;  2SPM A;  3UHQ A;  2BWH A;  2LHB A;  1HAC B;  3WCU D;  1RTE A;  2BMM A;  5CN7 A;  1KD2 B;  1NXF A;  2DHB A;  3HYU B;  1Y83 A;  1Y8I A;  3MKB A;  2HZ3 A;  4H2L B;  3BCQ A;  4ROL A;  3D4X B;  1Y0W A;  1FSL A;  1FN3 B;  1URY A;  3LHB A;  2MYC A;  1Y85 A;  2SPL A;  1MKO B;  3G4Q A;  3UHS A;  1V75 A;  1EWA A;  2D60 A;  4F69 A;  1MBA A;  2ZLV A;  3QMA A;  4HSX A;  4NI1 B;  4N8T A;  3NML A;  4NI0 B;  4NXA A;  3ODQ B;  3HEO A;  1DXV B;  3IC0 A;  1J7Y B;  2H8F A;  1MBN A;  1IRC A;  4TWV A;  1UFJ A;  4L7Y A;  1YIE A;  4BJA A;  1X9F C;  2MGI A;  3KUO A;  2MGD A;  1CIO A;  1GJN A;  1C7D A;  4F6D A;  3R0G A;  1HJT A;  1MLO A;  3UHX A;  2BK9 A;  4DC8 A;  1Y4G B;  1LFV B;  4NS2 A;  3WCP B;  3CIU B;  1K1K B;  1YFF A;  2W72 C;  1Y7D A;  1OUT B;  1NEJ B;  3ZH0 A;  1G0A A;  2KSC A;  5HU6 A;  4AVE A;  4FWY A;  3EDB A;  1DO3 A;  4MPM A;  1Y8H A;  5MBN A;  3CY5 B;  3AT6 B;  1A01 A;  3GQR A;  4JAC A;  1NZ4 A;  106M A;  2ZT1 A;  3PT7 A;  3PT8 B;  4DC7 A;  1XZ2 A;  1A00 B;  1MLJ A;  3W4U B;  2QFK A;  4MXL A;  4F68 A;  1J3Z B;  4C0N A;  1HAC A;  1JL6 A;  1QXE B;  1JY7 B;  1UC3 A;  1LUE A;  1LFL B;  3PI8 B;  1C7B A;  1CLS A;  4KMW A;  3LQD B;  1ECD A;  3ASE A;  3K8B B;  4DWT A;  2QSP B;  1FAW A;  3D7O B;  5EET A;  1CH7 A;  1J3Y A;  4MQK B;  2ZS1 A;  3M38 A;  1HCO A;  1R1Y B;  3M3A A;  1JP8 A;  107M A;  2D2N A;  3NFE B;  1XZ2 B;  1V75 B;  1UVX A;  1Y7Z A;  1JF4 A;  3ZJQ A;  3WTG A;  3GYS B;  1RQ3 B;  1J3F A;  2ZLX A;  3O7N A;  1XZV A;  3UH6 A;  4MQC B;  1OBM A;  2H8F B;  4YU4 A;  4MBN A;  5EQM A;  1BVD A;  1IWH A;  1HRM A;  2VLZ A;  1A3O A;  1HGB A;  1LFQ B;  1IBE B;  1YEU B;  2D2M B;  1V4U B;  2QSP A;  1MLH A;  2M6Z A;  1V9Q A;  3OVU C;  3GLN A;  3ZJJ A;  1XY0 B;  5ILP A;  3HC9 A;  5B85 A;  4IRO B;  1HSY A;  1A0Z A;  2FAL A;  5EU2 A;  2GKM A;  2HHD B;  1A3N B;  1V5H A;  1YHE B;  5CN9 A;  3WCV D;  1VRE A;  1M9P B;  1DXU A;  1XZ7 B;  2MBW A;  1YDZ B;  4YU3 B;  1RPS B;  2DC3 A;  4G51 A;  2QU0 A;  3ARJ A;  1IOP A;  1T1N B;  1V4X A;  2GTL A;  4F6F A;  1RQ4 A;  2H8D B;  5HBI A;  2SPO A;  3WCW A;  1MOH A;  3VRG A;  1DXT B;  4O4Z A;  1PMB A;  1Y45 B;  1CQ2 A;  1FSX A;  1RVW B;  4MAX A;  4FH7 A;  1YGF A;  1GZX A;  1HLB A;  102M A;  3BOM B;  1LFL A;  1U7S A;  4GZG A;  1CMY A;  2MGK A;  4TWU A;  2V1H A;  3AQ9 A;  1A4F B;  1HV4 A;  1S5Y A;  1X9F D;  1YIH B;  1HCO B;  1F65 A;  2H35 B;  1MLQ A;  1KD2 A;  3VAU A;  1BZ0 A;  112M A;  1IRD A;  5HLX A;  4M4A B;  5ILR A;  3GYS A;  1OUT A;  3WCV A;  3E4N A;  4F6G A;  2GNW A;  1HLM A;  3P5Q A;  4O35 A;  5HU6 B;  4NI0 A;  1CBL A;  1Y0A B;  2HHB A;  1CG8 A;  1ECO A;  1CH4 A;  4N7N B;  4ZVA A;  1BIJ B;  3BOM A;  2O5Q X;  1NS9 B;  1QI8 B;  1MBI A;  1Y0D A;  5JOM A;  3HF4 A;  1SDL A;  1RQA A;  1CH9 A;  3E55 A;  2G0Z A;  2MGB A;  1VHB A;  1YHU D;  2RAO A;  1HDA B;  2OH9 A;  3DUT A;  2ZFB B;  3E5I A;  5JGG B;  4U8U C;  2ZSY A;  5E6E B;  3RJ6 A;  1QPW A;  1S6A A;  4C44 A;  1VXF A;  1MWD A;  2R4Y A;  1BZP A;  3TM3 A;  3A5B A;  3WCU C;  1YIE B;  3UHU A;  1HBS A;  1XZV B;  1G0A B;  1HBI A;  1BAB A;  3A59 B;  4QAU A;  3D17 B;  2ZSS A;  2ZFO A;  3UBV A;  1LJW B;  2EB8 A;  3BJ1 A;  1MOA A;  1CG5 B;  1NZ5 A;  2IG3 A;  1HAB B;  2GTL B;  1X3K A;  3CIU A;  1O1P B;  1BBB A;  1PBX B;  3G4V A;  4HBI A;  5E29 B;  2HBD A;  5EV5 A;  4HRT A;  5JDO F;  101M A;  2DN1 A;  4N7P A;  3PI3 A;  3UH5 A;  1WLA A;  2VRY A;  1GLI A;  3MJP B;  2Z6N B;  1VXB A;  1MLU A;  1QSH B;  2DN3 A;  2AV0 A;  1ABW B;  3HEP A;  1Y46 A;  1Y22 A;  3LQD A;  2O5S X;  1UX8 A;  1XY0 A;  2RI4 B;  2ZLW B;  1YEV B;  3G52 A;  2HBF B;  1SHR B;  3SDH A;  1LTW A;  4M4A A;  4O1T A;  1A0U A;  4B4Y A;  2ZFO D;  3NG6 A;  1UVY A;  1Y0T A;  1MBO A;  3GOU B;  1Y5K A;  2ZS0 D;  4PNJ A;  1WMU B;  1F5P A;  3K9Z A;  3PI4 A;  2B7H A;  3BA2 A;  1V4X B;  3BCQ B;  1HGB B;  4ROL B;  1Y7C B;  1VXA A;  2EKU A;  1MNK A;  2MGL A;  2H8D A;  4WJG 1;  1HDA A;  3DUT B;  3ECL A;  3QM7 A;  1DO7 A;  2AA1 A;  3OO5 B;  1YEV A;  1YHU A;  1MLG A;  1HGA B;  1VXG A;  2AUP A;  4MQC A;  1GBV A;  3EU1 B;  1J7Y A;  1J52 A;  3QJD A;  3LB3 A;  2HCO B;  1CH1 A;  1IT3 A;  2ZLT A;  1DWT A;  2G0V A;  1G08 A;  2ZSN A;  1MOC A;  3QJE B;  2MGM A;  2ZS1 C;  1H1X A;  3ZJR A;  1DUO A;  1O1I A;  3IC2 B;  2OH8 A;  1YHR B;  4TYX A;  1HBA A;  1YEQ A;  1BIJ A;  2GRZ A;  4YU3 A;  4KJT A;  1JW8 A;  1WVP A;  3A9M A;  5HLU A;  1SI4 B;  1ABW A;  3UHZ A;  1Y8K B;  1MOB A;  1DLW A;  3D4X A;  1YEN B;  1UX9 A;  5MBA A;  2BKM A;  2MHB B;  1J3Z A;  1BJE A;  1BUW B;  1YGF B;  3KMF C;  1EBC A;  1A0Z B;  1BVC A;  3S66 B;  1QXE A;  1U7R A;  2AV3 A;  1ECA A;  2BLJ M;  2NSR A;  3PI8 A;  3A2G A;  3FH9 B;  1YCB A;  1OUU A;  1MGN A;  2HHB B;  1S5Y B;  2QLS B;  1CG8 B;  5JDO E;  3G4U A;  4L7Y B;  3G4Y A;  1YZI A;  3UHI A;  3BJ3 B;  5M3S A;  2DN2 B;  4MXK A;  2ZLU A;  3UHE A;  1ABY B;  2WY4 A;  4G1B A;  1LFT A;  1Y2Z A;  4G1V A;  1RQ3 A;  4NK1 A;  1YE0 B;  1MOD A;  1MLR A;  5D1V A;  1MBD A;  1XQ5 A;  1YMA A;  3S66 A;  1HHO A;  1F63 A;  2ZLV B;  2O5M X;  1QI8 A;  4ZVB A;  1N9H A;  1HBG A;  3ZOM A;  2XKI A;  1O16 A;  5CNC A;  1GCV A;  4FWZ A;  3PIA A;  1M6C A;  2ZSQ A;  1CG5 A;  2G0X A;  5CNE A;  2D2N D;  1J7W A;  3GQP A;  1XXT B;  3ZJL A;  2ZSX A;  2QRW A;  3UI0 A;  1CO8 A;  1YE2 A;  3ONZ A;  4U8U B;  1C7D B;  1YEO B;  1G9V A;  1HBS B;  3RGK A;  5EE4 D;  1M9P A;  2G0S A;  1FHJ A;  3UHY A;  1S69 A;  1J40 A;  1K0Y B;  2W72 A;  4N7N A;  1C40 B;  4N7O A;  1GDI A;  1Y8I B;  1Y4V A;  3OJ1 A;  4H2L A;  3WCT A;  1Y31 A;  6HBI A;  1RQA B;  2O5B X;  4U8U D;  2D5Z A;  5JDO C;  1BZZ B;  1Y0W B;  1A9W E;  1AZI A;  3SZK B;  5CND A;  2BLI A;  1N9X A;  1HBB B;  3PT7 B;  2HBC A;  3H57 A;  3QJD B;  3S65 B;  1GZX B;  1B86 B;  3UHH A;  3FH9 A;  1O1J B;  3ED9 A;  2LH3 A;  1A6G A;  1MYZ A;  1BAB B;  3A59 A;  1YG5 B;  1Y5K B;  1A6N A;  1YH9 A;  3DHT B;  4AVD A;  3OZW A;  3D1A A;  4L2M A;  3QM5 A;  1O1O B;  3PI1 A;  1JF3 A;  2EB9 A;  1TU9 A;  1LHT A;  1Y8K A;  1Y4B B;  2O5O X;  1VWT A;  3SDN A;  1RSE A;  1GDK A;  1NS6 A;  3V2Z A;  4MQK A;  2BNL A;  3WCV C;  3GOU A;  1SWM A;  2V1K A;  3OO4 B;  2FRI X;  1K1K A;  2GRF A;  5C6Y A;  5EOH A;  2ZT4 A;  3WI8 A;  1DTI A;  1XZ4 B;  1GDJ A;  1Y8H B;  2VM0 A;  1AJG A;  1DKE A;  1NGK A;  1Y5F B;  1R1X A;  3UHG A;  2O5T X;  1LFY B;  4XS0 A;  2D2M D;  1A00 A;  3WCP A;  1CH3 A;  1Y4P B;  1OJ6 A;  3ONZ B;  4U8U A;  2MGH A;  1C7C B;  4F4O B;  6HBW B;  1YE0 A;  3WFX A;  3WFT A;  2FRJ X;  3OO4 A;  1YEQ B;  1ECN A;  1OR4 A;  4HRR A;  3WCT D;  1XZ4 A;  1DLY A;  2R1H B;  1V4U A;  1LJW A;  2HHE B;  5CNG A;  2HBD B;  3IA3 B;  1MYT A;  4OF9 A;  3G4W A;  4LPI A;  1HBA B;  1CP5 A;  1Y4G A;  4NK2 A;  1QXD B;  3MN0 A;  4HHB B;  1XZU A;  2MGA A;  1DXT A;  3H58 A;  1JZL A;  1CO9 A;  3TM9 A;  3CY5 A;  1Y01 B;  1YOI A;  3AT5 B;  3MJU B;  1IWH B;  1Y0D B;  1SDL B;  3G4R A;  2MYE A;  5IKS A;  1A6K A;  4NZI A;  1O1K B;  3A0G B;  4MQG A;  3FS4 A;  3WCW C;  4M4B A;  1A6M A;  4N8T B;  3ZJS A;  1NIH B;  2QSS B;  1QPW B;  3UBC A;  1S0H A;  3OK5 A;  1SPE A;  5AZR A;  2BLH A;  3NMM A;  1Y0C A;  1ASH A;  1N9I A;  3ARK A;  3HRW A;  2CMM A;  2ZLU B;  3ZJN A;  1ABY A;  1JL7 A;  1YMB A;  1Y4R B;  3B75 A;  1XZ7 A;  1FAW B;  3D7O A;  1YHU B;  1JDO A;  1R1Y A;  4IRO A;  3ZJM A;  1DXC A;  1Y4P A;  3LR7 A;  5B84 A;  1RQ4 B;  1IRD B;  1BZ0 B;  1Y4B A;  3R5I A;  103M A;  105M A;  3EU1 A;  3WR1 A;  1JP6 A;  3V2V A;  4FC3 A;  2AUR A;  2W31 A;  4N7O B;  1Y09 A;  2QFN A;  1G09 B;  5CN5 A;  3MYM A;  1MLN A;  2LH1 A;  1OFK A;  1JPB A;  1O1N B;  2GTL D;  1Y31 B;  1V4W B;  1FLP A;  1LFT B;  1MYI A;  3AQ7 A;  3QJB A;  1R1X B;  3VRG B;  3AQ5 A;  1YMC A;  1HAB A;  1IT2 A;  3S1I A;  4F6J A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...