1N9YA

Streptavidin mutant s27a at 1.5a resolution
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
121
structure length
118
Chain Sequence
b'GITGTWYNQLGATFIVTAGADGALTGTYESNAESRYVLTGRYDSAPATDGSGTALGWTVAWKNNYRNAHSATTWSGQYVGGAEARINTQWLLTSGTTEANAWKSTLVGHDTFTKVKPS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Streptavidin
publication title Structural studies of hydrogen bonds in the high-affinity streptavidin-biotin complex: mutations of amino acids interacting with the ureido oxygen of biotin.
pubmed doi rcsb
source organism Streptomyces avidinii
molecule tags Biotin-binding protein
total genus 27
structure length 118
sequence length 121
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2002-11-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01382 Avidin Avidin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.128.30 Mainly Beta Beta Barrel Lipocalin Avidin-like 1n9yA00
1VWBB 2IZCB 3EW2A 2G5LA 1MEPA 4Z2PA 4Y5DA 1SWCA 1KFFA 1SWGA 3RDUA 2OFBA 2RTLA 1N7YA 4CPEA 1RSUB 2RTGB 1MOYA 4BX6B 4YVBA 1VWDB 2IZHB 2RTNB 4BX7B 1N4JA 1STRB 1N9YA 4IRWA 1NC9A 2RTIB 1VWPB 3MM0A 3RDMA 4Z6JA 4CPIA 2RTEB 3WZNA 4BX7A 4Z27A 1SRGA 1LDOA 2UYWA 3T2WA 1VWJB 4Z2OA 4GGTA 3RY1A 1SWQA 1NQNA 2GH7A 2IZKA 4CPHB 3RDSA 3VHMA 1RAVA 3T6FA 4GJSA 1MK5A 1KL3A 1LCVA 2RTHB 1VWQB 3WYQA 5L3YA 1SWUA 4GJVA 1HY2A 2IZBA 1SWOA 2Y3EA 2CAMA 2RTMA 2IZJA 1VWMB 1SWSA 4EKVA 3RE5A 4DNEA 3EW1A 3RY2A 4BX5B 4GGRA 1VWLB 2QCBA 3WZOA 1SRJA 1STPA 2JGSA 5JD2A 1SLFB 4JNJA 1VYOA 2A5CA 1KL4A 4BX6A 1MM9A 1SWJA 5K68A 1SWNA 1VWOB 1SWKA 2IZLB 5B5GA 4Z28A 4CPFA 5B5FA 1KL5A 3PK2A 2C1QA 1AVEA 3WZPA 2MF6A 2IZFB 3RDXA 1LUQA 2RTQB 1VWNB 2Y32A 1VWHB 1SWBA 1LCWA 2OF9A 3T2XA 3VGWA 5F2BA 3SZHA 1SWRA 5CSEA 2IZDB 2RTFB 1SWLA 1VWIB 4CPHA 2RTDB 1NBXA 4Z2VA 2RTBB 1VWFB 4Y59A 5IRUA 1Y53X 2C4IA 3RDQA 3SZIA 2Y3FA 1SWTA 1SWEA 1VWEB 4GDAA 2RTAA 1VWRB 1SLEB 2F01A 1VWKB 2RTOB 3FDCA 5IRWA 1Y55X 1NQMA 1SWFA 1VWAB 2BC3A 2A5BA 2IZEB 2OFAA 1SLGB 4JHQA 4BX5A 1NDJA 1SWPA 1VWGB 1N9MA 4OKAA 5K67A 3SZJA 3RDOA 1PTSA 1N43A 3VHIA 2FHNX 1SREA 2RTKA 2RTRB 4BCSA 4I60A 4JO6A 3WZQA 4BJ8A 1WBIA 2RTJA 2RTPB 5CHKA 2FHLA 1AVDA 1SRFA 1HXLA 1RSTB 1SWDA 1LELA 1LCZA 4GD9A 1SRHA 3X00A 1RXHA 1LDQA 2OF8A 3VHHA 3RE6A 1VWCB 3MG5A 2UZ2A 1SWHA 4BBOA 2A8GA 1I9HA 3T6LA 5IRAA 1STSB 1SRIA 2RTCB 3WYPA 1HQQA 1HXZA 1RXKA 1DF8A 2WPUA 4U46A 1IJ8A 2AVIA 1SWAA 2C1SA 1Y52X 2IZIA 2IZGB 2ZSCA 1SLDB 2IZAA 1RXJA 4GGZA
chains in the Genus database with same CATH superfamily
2IZCB 1JIWI 2Z4IA 2X56A 4TKBA 4KH8A 1W5RA 4NV7A 5LJGA 3MVFA 2Q9SA 5AJBA 3FA9A 2X8FA 3WOVA 2RTLA 3LHNA 4CPEA 1RSUB 1MOYA 4QRLA 4GETA 1VWDB 4BX7B 4IAWA 3WJFA 3RSWA 5D47A 1N9YA 3PQUA 1TVQA 4WFUA 2HZQA 4IRWA 1JJUA 1RLBE 2FKJA 2JN3A 4ZHFA 1S2PA 1VWPB 3MM0A 1O8VA 4AZOA 4I3CA 4ZFXA 4FBOA 1CRBA 3NQKA 1OBPA 4KC8A 3FIDA 2XKLA 3ZW1A 2RD7C 4OS3A 1ZNEA 5D45A 3PPTA 3VU1A 1BM5A 3D9WA 4YFRA 3T2WA 1P6PA 3RY1A 2AT5X 2AT6X 4ZHHA 5F6ZA 1OBQA 3LTWA 1Z24A 1KL3A 4GKCA 2RTHB 3STNA 2DM5A 3ZW0A 1ZNKA 4NYRA 3I17A 2F09A 5AJCA 1XCAA 4GU8A 4ZHCA 1EPBA 3GE2A 1ML7A 4AZMA 1GT5A 4TQ2A 1O1VA 1O1UA 1ZNDA 3VG3A 4AZNA 1WUBA 2WWPA 5F1EA 1SY1A 2KD2A 3RE5A 4DNEA 3LV4A 1KT6A 4M6SA 4MVIA 1FELA 5LKFA 4GGRA 3FIQA 1SRJA 1STPA 3TGBA 5JD2A 3O19A 2HNXA 4JNJA 4ML7B 3NBXX 1KL4A 4ORXA 5K68A 5HCCC 2MO5A 4NP1A 5K06A 3BX7A 1SXUA 5HZ9A 3C77X 3KZAA 2OL6O 4KIIA 4DQ3A 4Y0QA 3ZQ3A 2YG2A 2R74A 3WZPA 1KT7A 1LUQA 3RWXA 1ICNA 2I5VO 4O9SA 2OVDA 4TNNA 1LCWA 1JZUA 4D6AA 1YUPA 3TGAA 1I05A 1G5WA 2FS6A 3WXQA 2HZRA 4ORSA 2WSJA 3HPEA 3F8AA 1SWLA 1VWIB 4Z2VA 4ZHGA 2QO6A 5IO6A 2NP1A 4ORYA 1LKEA 3SZIA 1N0SA 3EYCA 4HPAA 4ON1A 4O4UA 1TOUA 2HKDA 1K3BA 4RUNA 1E02A 1S7DA 1LIDA 1VWEB 2RTAA 5BVQA 4ZGFA 4YGGA 5IRWA 2F73A 3IFBA 1E06A 3CBSA 4INNA 2MM3A 4ALOA 2IZEB 1BJ7A 3TF6A 1QQSA 1SLGB 3D97A 4IB8A 3IA8A 4ARHA 1I06A 1QABE 2DJGA 4BQUA 1EQDA 2L5PA 3D4RA 4BX5A 4HPBA 4OELA 2LA7A 1VWGB 3ZZVA 1DF3A 1DC9A 1LIBA 4XMDA 4I3BA 4NLIA 3HWDA 1N43A 4TKJA 3Q34A 2FHNX 2RTRB 1LICA 3EBKA 3NQ9A 1EPAA 1CJ5A 1VYFA 1PMPA 2GC9A 3D96A 1JYDA 2RTJA 3G7XA 4XMGA 3U03A 4AW8A 3KQ0A 1S44A 1IW2A 2FHLA 4NV8A 5D48A 1SRFA 2FT9A 3ZW1B 3APVA 1QFTA 3P6CA 1LCZA 1UYNX 4QAEA 5F7GA 1RXHA 3B2LA 5FQ6E 1LDQA 4YCHA 4C5PA 5C0NA 3MG5A 2Q4NA 2UZ2A 4BBOA 4DCBA 1A18A 3BY0A 1Y9TA 3ZW0B 1BSOA 1SRIA 2BT9A 4YKMA 1HBPA 1HQQA 1R0UA 1DF8A 1LF7A 1FJ1E 3P6FA 4OS0A 3JS1A 4RUUA 4LKPA 4U46A 2LBVA 1B0OA 2A2UA 3WJBA 1A57A 1AVGI 2X34A 1CBSA 1UREA 2ZSCA 5H9AA 1SLDB 2RQ0A 3PP6A 3JSQA 4ORUA 1ACDA 3SAOA 4LZVA 4HWMA 1RXJA 2OVSA 4ES7A 3EW2A 3B2JA 4MVLA 1T8VA 3FYFA 5EPQA 3CKGA 5BVSA 4Y5DA 5EEEA 5FQ7E 3UEWA 1KFFA 3OD9A 5KIDA 1AELA 4MIRA 1N7YA 2NNDA 4XMEA 1BBPA 4NLJA 1N4JA 3WVMA 1STRB 2ALLX 4ZR2A 2OFRX 2OL8O 1KQWA 2WEXA 3KFHA 1NC9A 2RTIB 4U8UM 2FWVA 4ZH9A 2WEWA 5LJDA 1CBIA 4ODDA 4BVMA 5EDCA 5LKEA 1VYGA 4CDFA 4CPIA 5L8NA 2CZTA 3FENA 1EIIA 4NNTA 3WZNA 2R56A 1DFVA 3F9DA 4Z2OA 1T68X 3P02A 3B2HA 4GGTA 1NQNA 2IZKA 1YWBA 4XMCA 1Y0GA 3WJDA 3VHMA 5DPQA 5HZ8A 1LCVA 4U8UN 4YFPA 1JMZA 2LKKA 3CQRA 4GJVA 1HY2A 4WHIA 3SOTA 1ERBA 1JQPA 2Y3EA 1AQBA 2CAMA 3C78X 3P6HA 5B10O 2KTDA 2N93A 2X55A 2BSZA 3D95A 4O3WA 3RY2A 4BX5B 4KCAA 4NNSA 2OY8A 2OVAA 2GTLM 2BHVA 4QYNA 4A1YA 1MVGA 1VYOA 2JU8A 1EW3A 3HTYA 4R0BA 4BX6A 3BRNA 1SWNA 1VWOB 2NNQA 1YWAA 2X45A 1PM1X 2IZLB 3U9PC 5B5GA 1E5PA 2C1QA 1AVEA 1SXYA 2OVEA 1ERXA 4Y0SA 3FEKA 3EMMA 3JQOA 2MF6A 2GTLN 2K23A 2Z4HA 2K62A 3FEPA 4PSQA 4U8UO 2OFMX 3AEHA 4BGFA 1YP6A 5LJHA 4CK4A 3VGWA 2AT3X 1DV9A 2A0AA 3VG4A 4GH7A 2BS6A 3HWFA 2RTFB 4YMYA 1MUPA 2RTDB 1NBXA 2FTBA 2RTBB 5B27A 5B11O 3RDQA 2Y3FA 4YDAA 5H8TA 2NNEA 1GKAA 1SWEA 1ZNGA 3O2YA 1CBQA 3VPJE 1VWRB 3FDCA 3OE3A 2PY1A 1VWAB 4AZPA 1B56A 3S5VA 3KVNA 4IB7A 2OL7A 1E2TA 3HK1A 3HOEA 4JHQA 4MVKA 1HMRA 2JOZA 1U18A 5HCEC 4ORWA 1SWPA 3WBGA 3PH6A 2Q2MA 4CDDA 5B29A 3RDOA 2CBRA 2QO5A 3AKNA 3P24A 2RTKA 3VHIA 1EUOA 4BCSA 2MWHA 3CBCA 1TXLA 4I95A 4M7MA 4IMOA 4I60A 4ZJ0A 2RTPB 1BLRA 4GZVA 3PQSA 5LJBA 2X8TA 1A3YA 2BS5A 1ZNHA 3FMZA 1RSTB 3X00A 1GX8A 3FA7A 1SRHA 1BRPA 2LBAA 4ZGUA 2QMIA 3Q6LA 3VHHA 2X4MA 1VWCB 2ASNX 2G8CO 2W2AA 3WJGA 5HZ5A 4U9CA 2CM9A 1UYOX 2MJIA 3QQ2A 4I6SA 2RTCB 4XMFA 3WYPA 4EQAC 3TZSA 3I0AA 1D3SA 5D4AA 2HYSA 4MISA 1OSPO 4YFQA 1IJ8A 2W2BA 1MX8A 3WJCA 5LJKA 3NX2A 2FR2A 2IZGB 2X32A 2G79A 2IZAA 2QCBA 3BU1A 3CQNA 3VE2A 5HCDC 1NP1A 4GGZA 1VWBB 5CHKA 1KZXA 2FKGA 2G5LA 4KT5A 3E3CA 1X71A 4Z2PA 4N7CA 1SWCA 5IO7A 1SWGA 2EU7X 3PEDA 4MEEA 4YVBA 2RTGB 4BX6B 1EI5A 2XSTA 4UU3A 4QGVA 1T0VA 1EIOA 4FBRA 2QOSC 2R73A 1JYJA 4OMXA 3N91A 2LFOA 5HA1A 4JGLA 2W2FA 4EXZA 3RKGA 1I4UA 5HAEA 3NX1A 3RDMA 5BVTA 4Z6JA 2RTEB 1UZ2X 1W6FA 2RCQA 4ORRA 4BX7A 4Z27A 1SRGA 5AQ6A 4B55A 4EFGA 1VWJB 1LIFA 2ANSA 4ALBA 5KHPA 2Q2PA 2GH7A 2X46A 3UEUA 3RDSA 1X8PA 1RAVA 3WJEA 3T6FA 1BWYA 1JV4A 2VDFA 4CDCA 1GKAB 1VWQB 1G74A 1X8NA 1SWUA 2L68A 3WYQA 5L8OA 4UU2A 1XKIA 1VPRA 2IZBA 3STKA 1IFCA 2AKQA 4EEJA 1IIUA 1TOWA 3L4RA 3ZI8A 1VWMB 1SWSA 2OY7A 3UEVA 1IKJA 4EKVA 3HWGA 3KFGA 2RA6A 1KOIA 3WZOA 1E00A 2JGSA 1FDQA 2AF5A 3HOLA 4YBPA 3PH5A 2AT8X 4TLJA 4A1HA 1MM9A 1SWJA 3APWA 3FR2A 4CDEA 1SWKA 2FLJA 5HTEA 4D6BA 4O3XB 3BX8A 4CPFA 1KT5A 4GNYA 4OS8A 3PK2A 4AYHA 2FS7A 3P6GA 4Y0PA 5D8JA 2L67A 1ADLA 4IBAA 5FFHA 2IZFB 2POAA 1OEEA 2RTQB 3VG5A 1VWNB 2Y32A 1VWHB 1SMPI 3DSZA 3NADA 3S60A 2VFCA 4AZQA 3FR5A 4O3YA 4OMWA 2YMSA 3SZHA 3NPOA 2IZDB 4CPHA 2DJFA 2ZAIA 4I9SA 1U17A 4QQ1A 1VWFB 3P6DA 4Y59A 5IRUA 3UEXA 2I5ZO 2L9CA 4IAXA 2MHDA 2F01A 1VWKB 4YBUA 2ZAGA 2O62A 4QNIA 2BC3A 4A60A 1LFOA 1PBOA 2OFAA 5KICA 1PEEA 2Q39A 3VG2A 3ELZA 1GXAA 1EXSA 1QY2A 3NP1A 1I04A 1HN2A 4MVEA 1SA8A 3VE1A 1HMSA 4OKAA 1N9MA 3O22A 1H91A 2RN4A 4TKHA 5EZ2A 5K67A 1SXWA 5FAZA 1SREA 3U0DA 4NYQA 1LIEA 1MX7A 3F6ZB 5CYBA 5EEDA 2QM9A 1OEJA 1WBIA 4N7DA 3T1DA 3HWEA 4I9RA 4L3RA 4ZCBA 2HMBA 4O3ZA 1AVDA 1QFVA 2CBSA 3APXA 2E4JA 3PECA 2OF8A 4YKOA 4YGHA 1BSYA 3FA6A 2M4LA 2OY1O 4NW4A 1SWHA 3AKMA 1QY1A 3ZW2A 2A8GA 1I9HA 2CZUA 3FLLA 2HLVA 3B2IA 4FGIB 5H9KA 4OEMA 3ZUOA 1HBQA 4CV7A 5F58A 1Y9LA 1HXZA 1RXKA 2WPUA 1IFBA 3NR3A 1KQXA 2WUTA 2VFBA 3FW4A 4LKTA 5HZ6A 1DZKA 3EC5A 1X8QA 2LB6A 2PI3O 5AEOA 1W4TA 2GTLO 2X8SA 3EM0A 5IO5A 5HZQA 1GX3A 1IKEA 1MEPA 4XMHA 2FR3A 4WBKA 1YWDA 3RDUA 2OFBA 5HTDA 1JMXA 4YH0A 4IB9A 4GDZA 4FBVA 2IZHB 2RTNB 1YWCA 3MX7A 4KC7A 4GUZA 2AMMX 3NQ3A 1NP4A 1HQPA 3RBYA 1U0XA 2FRSA 4ZH6A 1G7NA 1A2DA 1GT3A 1DZMA 2AT0X 1G85A 3P6EA 1KT4A 1X89A 3S26A 2AL0X 4O49A 2WQAE 1SY0A 5FENA 2G78A 1LDOA 3KFFA 2UYWA 3CR6A 5L8IA 1B4MA 1SWQA 1OBUA 4CPHB 1OEKA 1L6MA 1JBHA 4IB6A 4GJSA 1KT3A 4LZUA 1MK5A 5JR8A 4DQ4A 5CE4A 5LJCA 1GX9A 1SY3A 5L3YA 4QZTA 4K19A 3CWKA 1HMTA 1SWOA 2WR6A 2OZQA 3C76X 2RTMA 2IZJA 2KW1A 3FELA 1DZJA 4U3QA 3VG7A 1SY2A 2A3FX 3EW1A 3FW5A 4ID2A 1BRQA 1ALBA 1GT1A 3ZWEA 1VWLB 1MDCA 1X8OA 1EALA 3BDRA 2JU3A 2KTSA 2OYBO 1SLFB 4QZUA 2A5CA 4QYPA 3ZUIA 1KXOA 2IFBA 4IMNA 2JW1A 2OY5O 4A8ZA 3TGCA 5DG4A 5B5FA 4Z28A 2WQ9A 1SXXA 1KL5A 4EDEA 4HPCA 2G7BA 1FEMA 1NGLA 2ACPX 3MBTA 2GTFX 2JMBA 4FQBB 4O4SA 4HPDA 1LNMA 1AB0A 3BSZE 1CBRA 2RCTA 3RDXA 2KT4B 3STMX 1OPAA 5IXGA 1SWBA 2OF9A 3T2XA 4GRJA 5BYPA 5LJEA 1FE3A 4PJ2A 5F2BA 3S5XA 3DTQA 3CMPA 4LQZA 1SWRA 4GK9A 5CSEA 3H3IA 3SLTA 4BOEA 1Y53X 2C4IA 3UAQA 2A13A 3BLGA 4YCEA 2P8GA 2A2GA 1SWTA 3OJYC 4Y0RA 1RBPA 4GDAA 3CKFA 1SLEB 1X8UA 2RTOB 3APUA 3AUMO 3K3LA 1FTPA 3V8UA 1Y55X 1NQMA 1QG5A 1SWFA 2GJ5A 3QKGA 2A5BA 4IABA 4AZRA 1QY0A 3PDFA 2AH7X 4GNWA 4I3DA 5HBSA 1GGLA 1TW4A 1JJJA 3FA8A 1PBYA 3ELXA 1NDJA 3SLJA 1BSQA 2ACOA 3KFIA 4ZHDA 1I78A 4QGXA 3SZJA 1PTSA 1YIVA 4HFOA 1OPBA 4JO6A 3WZQA 4BJ8A 1DZPA 4YDBA 1GM6A 1LPJA 3EBWA 3OBLA 1ZNLA 4TJZA 2FGSA 4O4XA 5H9NA 1SWDA 1HXLA 1QWDA 1B8EA 1LELA 4GD9A 4L1NA 5B2AO 3FR4A 5EDBA 1D2UA 2QOMA 3RE6A 1K24A 4CSBA 4O4OA 1YP7A 3RZYA 3SLOA 3BU9A 5IRAA 1STSB 2BLGA 4YGZA 5H9LA 1FENA 3T6LA 2JU7A 3VG6A 3GAQA 2CM4A 1ZRYA 5HA0A 4COTA 5B3MO 4GE1A 4WFVA 1KZWA 1ICMA 2AVIA 1SWAA 2C1SA 3BS2A 5FQ8E 5HWZA 1Y52X 2QO4A 2IZIA 3B2KA 1BEBA 4QGWA 5F6BA 1JJXA 1KGLA 1GT4A
chains in the Genus database with same CATH topology
1VWBB 2IZCB 3EW2A 2G5LA 1MEPA 4Z2PA 4Y5DA 1SWCA 1KFFA 1SWGA 3RDUA 2OFBA 2RTLA 1N7YA 4CPEA 1RSUB 2RTGB 1MOYA 4BX6B 4YVBA 1VWDB 2IZHB 2RTNB 4BX7B 1N4JA 1STRB 1N9YA 4IRWA 1NC9A 2RTIB 1VWPB 3MM0A 3RDMA 4Z6JA 4CPIA 2RTEB 3WZNA 4BX7A 4Z27A 1SRGA 1LDOA 2UYWA 3T2WA 1VWJB 4Z2OA 4GGTA 3RY1A 1SWQA 1NQNA 2GH7A 2IZKA 4CPHB 3RDSA 3VHMA 1RAVA 3T6FA 4GJSA 1MK5A 1KL3A 1LCVA 2RTHB 1VWQB 3WYQA 5L3YA 1SWUA 4GJVA 1HY2A 2IZBA 1SWOA 2Y3EA 2CAMA 2RTMA 2IZJA 1VWMB 1SWSA 4EKVA 3RE5A 4DNEA 3EW1A 3RY2A 4BX5B 4GGRA 1VWLB 2QCBA 3WZOA 1SRJA 1STPA 2JGSA 5JD2A 1SLFB 4JNJA 1VYOA 2A5CA 1KL4A 4BX6A 1MM9A 1SWJA 5K68A 1SWNA 1VWOB 1SWKA 2IZLB 5B5GA 4Z28A 4CPFA 5B5FA 1KL5A 3PK2A 2C1QA 1AVEA 3WZPA 2MF6A 2IZFB 3RDXA 1LUQA 2RTQB 1VWNB 2Y32A 1VWHB 1SWBA 1LCWA 2OF9A 3T2XA 3VGWA 5F2BA 3SZHA 1SWRA 5CSEA 2IZDB 2RTFB 1SWLA 1VWIB 4CPHA 2RTDB 1NBXA 4Z2VA 2RTBB 1VWFB 4Y59A 5IRUA 1Y53X 2C4IA 3RDQA 3SZIA 2Y3FA 1SWTA 1SWEA 1VWEB 4GDAA 2RTAA 1VWRB 1SLEB 2F01A 1VWKB 2RTOB 3FDCA 5IRWA 1Y55X 1NQMA 1SWFA 1VWAB 2BC3A 2A5BA 2IZEB 2OFAA 1SLGB 4JHQA 4BX5A 1NDJA 1SWPA 1VWGB 1N9MA 4OKAA 5K67A 3SZJA 3RDOA 1PTSA 1N43A 3VHIA 2FHNX 1SREA 2RTKA 2RTRB 4BCSA 4I60A 4JO6A 3WZQA 4BJ8A 1WBIA 2RTJA 2RTPB 5CHKA 2FHLA 1AVDA 1SRFA 1HXLA 1RSTB 1SWDA 1LELA 1LCZA 4GD9A 1SRHA 3X00A 1RXHA 1LDQA 2OF8A 3VHHA 3RE6A 1VWCB 3MG5A 2UZ2A 1SWHA 4BBOA 2A8GA 1I9HA 3T6LA 5IRAA 1STSB 1SRIA 2RTCB 3WYPA 1HQQA 1HXZA 1RXKA 1DF8A 2WPUA 4U46A 1IJ8A 2AVIA 1SWAA 2C1SA 1Y52X 2IZIA 2IZGB 2ZSCA 1SLDB 2IZAA 1RXJA 4GGZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1VWB B;  2IZC B;  3EW2 A;  2G5L A;  1MEP A;  4Z2P A;  4Y5D A;  1SWC A;  1KFF A;  1SWG A;  3RDU A;  2OFB A;  2RTL A;  1N7Y A;  4CPE A;  1RSU B;  2RTG B;  1MOY A;  4BX6 B;  4YVB A;  1VWD B;  2IZH B;  2RTN B;  4BX7 B;  1N4J A;  1STR B;  1N9Y A;  4IRW A;  1NC9 A;  2RTI B;  1VWP B;  3MM0 A;  3RDM A;  4Z6J A;  4CPI A;  2RTE B;  3WZN A;  4BX7 A;  4Z27 A;  1SRG A;  1LDO A;  2UYW A;  3T2W A;  1VWJ B;  4Z2O A;  4GGT A;  3RY1 A;  1SWQ A;  1NQN A;  2GH7 A;  2IZK A;  4CPH B;  3RDS A;  3VHM A;  1RAV A;  3T6F A;  4GJS A;  1MK5 A;  1KL3 A;  1LCV A;  2RTH B;  1VWQ B;  3WYQ A;  5L3Y A;  1SWU A;  4GJV A;  1HY2 A;  2IZB A;  1SWO A;  2Y3E A;  2CAM A;  2RTM A;  2IZJ A;  1VWM B;  1SWS A;  4EKV A;  3RE5 A;  4DNE A;  3EW1 A;  3RY2 A;  4BX5 B;  4GGR A;  1VWL B;  2QCB A;  3WZO A;  1SRJ A;  1STP A;  2JGS A;  5JD2 A;  1SLF B;  4JNJ A;  1VYO A;  2A5C A;  1KL4 A;  4BX6 A;  1MM9 A;  1SWJ A;  5K68 A;  1SWN A;  1VWO B;  1SWK A;  2IZL B;  5B5G A;  4Z28 A;  4CPF A;  5B5F A;  1KL5 A;  3PK2 A;  2C1Q A;  1AVE A;  3WZP A;  2MF6 A;  2IZF B;  3RDX A;  1LUQ A;  2RTQ B;  1VWN B;  2Y32 A;  1VWH B;  1SWB A;  1LCW A;  2OF9 A;  3T2X A;  3VGW A;  5F2B A;  3SZH A;  1SWR A;  5CSE A;  2IZD B;  2RTF B;  1SWL A;  1VWI B;  4CPH A;  2RTD B;  1NBX A;  4Z2V A;  2RTB B;  1VWF B;  4Y59 A;  5IRU A;  1Y53 X;  2C4I A;  3RDQ A;  3SZI A;  2Y3F A;  1SWT A;  1SWE A;  1VWE B;  4GDA A;  2RTA A;  1VWR B;  1SLE B;  2F01 A;  1VWK B;  2RTO B;  3FDC A;  5IRW A;  1Y55 X;  1NQM A;  1SWF A;  1VWA B;  2BC3 A;  2A5B A;  2IZE B;  2OFA A;  1SLG B;  4JHQ A;  4BX5 A;  1NDJ A;  1SWP A;  1VWG B;  1N9M A;  4OKA A;  5K67 A;  3SZJ A;  3RDO A;  1PTS A;  1N43 A;  3VHI A;  2FHN X;  1SRE A;  2RTK A;  2RTR B;  4BCS A;  4I60 A;  4JO6 A;  3WZQ A;  4BJ8 A;  1WBI A;  2RTJ A;  2RTP B;  5CHK A;  2FHL A;  1AVD A;  1SRF A;  1HXL A;  1RST B;  1SWD A;  1LEL A;  1LCZ A;  4GD9 A;  1SRH A;  3X00 A;  1RXH A;  1LDQ A;  2OF8 A;  3VHH A;  3RE6 A;  1VWC B;  3MG5 A;  2UZ2 A;  1SWH A;  4BBO A;  2A8G A;  1I9H A;  3T6L A;  5IRA A;  1STS B;  1SRI A;  2RTC B;  3WYP A;  1HQQ A;  1HXZ A;  1RXK A;  1DF8 A;  2WPU A;  4U46 A;  1IJ8 A;  2AVI A;  1SWA A;  2C1S A;  1Y52 X;  2IZI A;  2IZG B;  2ZSC A;  1SLD B;  2IZA A;  1RXJ A;  4GGZ A; 
#chains in the Genus database with same CATH topology
 2IZC B;  1JIW I;  2Z4I A;  2X56 A;  4TKB A;  4KH8 A;  1W5R A;  4NV7 A;  5LJG A;  3MVF A;  2Q9S A;  5AJB A;  3FA9 A;  2X8F A;  3WOV A;  2RTL A;  3LHN A;  4CPE A;  1RSU B;  1MOY A;  4QRL A;  4GET A;  1VWD B;  4BX7 B;  4IAW A;  3WJF A;  3RSW A;  5D47 A;  1N9Y A;  3PQU A;  1TVQ A;  4WFU A;  2HZQ A;  4IRW A;  1JJU A;  1RLB E;  2FKJ A;  2JN3 A;  4ZHF A;  1S2P A;  1VWP B;  3MM0 A;  1O8V A;  4AZO A;  4I3C A;  4ZFX A;  4FBO A;  1CRB A;  3NQK A;  1OBP A;  4KC8 A;  3FID A;  2XKL A;  3ZW1 A;  2RD7 C;  4OS3 A;  1ZNE A;  5D45 A;  3PPT A;  3VU1 A;  1BM5 A;  3D9W A;  4YFR A;  3T2W A;  1P6P A;  3RY1 A;  2AT5 X;  2AT6 X;  4ZHH A;  5F6Z A;  1OBQ A;  3LTW A;  1Z24 A;  1KL3 A;  4GKC A;  2RTH B;  3STN A;  2DM5 A;  3ZW0 A;  1ZNK A;  4NYR A;  3I17 A;  2F09 A;  5AJC A;  1XCA A;  4GU8 A;  4ZHC A;  1EPB A;  3GE2 A;  1ML7 A;  4AZM A;  1GT5 A;  4TQ2 A;  1O1V A;  1O1U A;  1ZND A;  3VG3 A;  4AZN A;  1WUB A;  2WWP A;  5F1E A;  1SY1 A;  2KD2 A;  3RE5 A;  4DNE A;  3LV4 A;  1KT6 A;  4M6S A;  4MVI A;  1FEL A;  5LKF A;  4GGR A;  3FIQ A;  1SRJ A;  1STP A;  3TGB A;  5JD2 A;  3O19 A;  2HNX A;  4JNJ A;  4ML7 B;  3NBX X;  1KL4 A;  4ORX A;  5K68 A;  5HCC C;  2MO5 A;  4NP1 A;  5K06 A;  3BX7 A;  1SXU A;  5HZ9 A;  3C77 X;  3KZA A;  2OL6 O;  4KII A;  4DQ3 A;  4Y0Q A;  3ZQ3 A;  2YG2 A;  2R74 A;  3WZP A;  1KT7 A;  1LUQ A;  3RWX A;  1ICN A;  2I5V O;  4O9S A;  2OVD A;  4TNN A;  1LCW A;  1JZU A;  4D6A A;  1YUP A;  3TGA A;  1I05 A;  1G5W A;  2FS6 A;  3WXQ A;  2HZR A;  4ORS A;  2WSJ A;  3HPE A;  3F8A A;  1SWL A;  1VWI B;  4Z2V A;  4ZHG A;  2QO6 A;  5IO6 A;  2NP1 A;  4ORY A;  1LKE A;  3SZI A;  1N0S A;  3EYC A;  4HPA A;  4ON1 A;  4O4U A;  1TOU A;  2HKD A;  1K3B A;  4RUN A;  1E02 A;  1S7D A;  1LID A;  1VWE B;  2RTA A;  5BVQ A;  4ZGF A;  4YGG A;  5IRW A;  2F73 A;  3IFB A;  1E06 A;  3CBS A;  4INN A;  2MM3 A;  4ALO A;  2IZE B;  1BJ7 A;  3TF6 A;  1QQS A;  1SLG B;  3D97 A;  4IB8 A;  3IA8 A;  4ARH A;  1I06 A;  1QAB E;  2DJG A;  4BQU A;  1EQD A;  2L5P A;  3D4R A;  4BX5 A;  4HPB A;  4OEL A;  2LA7 A;  1VWG B;  3ZZV A;  1DF3 A;  1DC9 A;  1LIB A;  4XMD A;  4I3B A;  4NLI A;  3HWD A;  1N43 A;  4TKJ A;  3Q34 A;  2FHN X;  2RTR B;  1LIC A;  3EBK A;  3NQ9 A;  1EPA A;  1CJ5 A;  1VYF A;  1PMP A;  2GC9 A;  3D96 A;  1JYD A;  2RTJ A;  3G7X A;  4XMG A;  3U03 A;  4AW8 A;  3KQ0 A;  1S44 A;  1IW2 A;  2FHL A;  4NV8 A;  5D48 A;  1SRF A;  2FT9 A;  3ZW1 B;  3APV A;  1QFT A;  3P6C A;  1LCZ A;  1UYN X;  4QAE A;  5F7G A;  1RXH A;  3B2L A;  5FQ6 E;  1LDQ A;  4YCH A;  4C5P A;  5C0N A;  3MG5 A;  2Q4N A;  2UZ2 A;  4BBO A;  4DCB A;  1A18 A;  3BY0 A;  1Y9T A;  3ZW0 B;  1BSO A;  1SRI A;  2BT9 A;  4YKM A;  1HBP A;  1HQQ A;  1R0U A;  1DF8 A;  1LF7 A;  1FJ1 E;  3P6F A;  4OS0 A;  3JS1 A;  4RUU A;  4LKP A;  4U46 A;  2LBV A;  1B0O A;  2A2U A;  3WJB A;  1A57 A;  1AVG I;  2X34 A;  1CBS A;  1URE A;  2ZSC A;  5H9A A;  1SLD B;  2RQ0 A;  3PP6 A;  3JSQ A;  4ORU A;  1ACD A;  3SAO A;  4LZV A;  4HWM A;  1RXJ A;  2OVS A;  4ES7 A;  3EW2 A;  3B2J A;  4MVL A;  1T8V A;  3FYF A;  5EPQ A;  3CKG A;  5BVS A;  4Y5D A;  5EEE A;  5FQ7 E;  3UEW A;  1KFF A;  3OD9 A;  5KID A;  1AEL A;  4MIR A;  1N7Y A;  2NND A;  4XME A;  1BBP A;  4NLJ A;  1N4J A;  3WVM A;  1STR B;  2ALL X;  4ZR2 A;  2OFR X;  2OL8 O;  1KQW A;  2WEX A;  3KFH A;  1NC9 A;  2RTI B;  4U8U M;  2FWV A;  4ZH9 A;  2WEW A;  5LJD A;  1CBI A;  4ODD A;  4BVM A;  5EDC A;  5LKE A;  1VYG A;  4CDF A;  4CPI A;  5L8N A;  2CZT A;  3FEN A;  1EII A;  4NNT A;  3WZN A;  2R56 A;  1DFV A;  3F9D A;  4Z2O A;  1T68 X;  3P02 A;  3B2H A;  4GGT A;  1NQN A;  2IZK A;  1YWB A;  4XMC A;  1Y0G A;  3WJD A;  3VHM A;  5DPQ A;  5HZ8 A;  1LCV A;  4U8U N;  4YFP A;  1JMZ A;  2LKK A;  3CQR A;  4GJV A;  1HY2 A;  4WHI A;  3SOT A;  1ERB A;  1JQP A;  2Y3E A;  1AQB A;  2CAM A;  3C78 X;  3P6H A;  5B10 O;  2KTD A;  2N93 A;  2X55 A;  2BSZ A;  3D95 A;  4O3W A;  3RY2 A;  4BX5 B;  4KCA A;  4NNS A;  2OY8 A;  2OVA A;  2GTL M;  2BHV A;  4QYN A;  4A1Y A;  1MVG A;  1VYO A;  2JU8 A;  1EW3 A;  3HTY A;  4R0B A;  4BX6 A;  3BRN A;  1SWN A;  1VWO B;  2NNQ A;  1YWA A;  2X45 A;  1PM1 X;  2IZL B;  3U9P C;  5B5G A;  1E5P A;  2C1Q A;  1AVE A;  1SXY A;  2OVE A;  1ERX A;  4Y0S A;  3FEK A;  3EMM A;  3JQO A;  2MF6 A;  2GTL N;  2K23 A;  2Z4H A;  2K62 A;  3FEP A;  4PSQ A;  4U8U O;  2OFM X;  3AEH A;  4BGF A;  1YP6 A;  5LJH A;  4CK4 A;  3VGW A;  2AT3 X;  1DV9 A;  2A0A A;  3VG4 A;  4GH7 A;  2BS6 A;  3HWF A;  2RTF B;  4YMY A;  1MUP A;  2RTD B;  1NBX A;  2FTB A;  2RTB B;  5B27 A;  5B11 O;  3RDQ A;  2Y3F A;  4YDA A;  5H8T A;  2NNE A;  1GKA A;  1SWE A;  1ZNG A;  3O2Y A;  1CBQ A;  3VPJ E;  1VWR B;  3FDC A;  3OE3 A;  2PY1 A;  1VWA B;  4AZP A;  1B56 A;  3S5V A;  3KVN A;  4IB7 A;  2OL7 A;  1E2T A;  3HK1 A;  3HOE A;  4JHQ A;  4MVK A;  1HMR A;  2JOZ A;  1U18 A;  5HCE C;  4ORW A;  1SWP A;  3WBG A;  3PH6 A;  2Q2M A;  4CDD A;  5B29 A;  3RDO A;  2CBR A;  2QO5 A;  3AKN A;  3P24 A;  2RTK A;  3VHI A;  1EUO A;  4BCS A;  2MWH A;  3CBC A;  1TXL A;  4I95 A;  4M7M A;  4IMO A;  4I60 A;  4ZJ0 A;  2RTP B;  1BLR A;  4GZV A;  3PQS A;  5LJB A;  2X8T A;  1A3Y A;  2BS5 A;  1ZNH A;  3FMZ A;  1RST B;  3X00 A;  1GX8 A;  3FA7 A;  1SRH A;  1BRP A;  2LBA A;  4ZGU A;  2QMI A;  3Q6L A;  3VHH A;  2X4M A;  1VWC B;  2ASN X;  2G8C O;  2W2A A;  3WJG A;  5HZ5 A;  4U9C A;  2CM9 A;  1UYO X;  2MJI A;  3QQ2 A;  4I6S A;  2RTC B;  4XMF A;  3WYP A;  4EQA C;  3TZS A;  3I0A A;  1D3S A;  5D4A A;  2HYS A;  4MIS A;  1OSP O;  4YFQ A;  1IJ8 A;  2W2B A;  1MX8 A;  3WJC A;  5LJK A;  3NX2 A;  2FR2 A;  2IZG B;  2X32 A;  2G79 A;  2IZA A;  2QCB A;  3BU1 A;  3CQN A;  3VE2 A;  5HCD C;  1NP1 A;  4GGZ A;  1VWB B;  5CHK A;  1KZX A;  2FKG A;  2G5L A;  4KT5 A;  3E3C A;  1X71 A;  4Z2P A;  4N7C A;  1SWC A;  5IO7 A;  1SWG A;  2EU7 X;  3PED A;  4MEE A;  4YVB A;  2RTG B;  4BX6 B;  1EI5 A;  2XST A;  4UU3 A;  4QGV A;  1T0V A;  1EIO A;  4FBR A;  2QOS C;  2R73 A;  1JYJ A;  4OMX A;  3N91 A;  2LFO A;  5HA1 A;  4JGL A;  2W2F A;  4EXZ A;  3RKG A;  1I4U A;  5HAE A;  3NX1 A;  3RDM A;  5BVT A;  4Z6J A;  2RTE B;  1UZ2 X;  1W6F A;  2RCQ A;  4ORR A;  4BX7 A;  4Z27 A;  1SRG A;  5AQ6 A;  4B55 A;  4EFG A;  1VWJ B;  1LIF A;  2ANS A;  4ALB A;  5KHP A;  2Q2P A;  2GH7 A;  2X46 A;  3UEU A;  3RDS A;  1X8P A;  1RAV A;  3WJE A;  3T6F A;  1BWY A;  1JV4 A;  2VDF A;  4CDC A;  1GKA B;  1VWQ B;  1G74 A;  1X8N A;  1SWU A;  2L68 A;  3WYQ A;  5L8O A;  4UU2 A;  1XKI A;  1VPR A;  2IZB A;  3STK A;  1IFC A;  2AKQ A;  4EEJ A;  1IIU A;  1TOW A;  3L4R A;  3ZI8 A;  1VWM B;  1SWS A;  2OY7 A;  3UEV A;  1IKJ A;  4EKV A;  3HWG A;  3KFG A;  2RA6 A;  1KOI A;  3WZO A;  1E00 A;  2JGS A;  1FDQ A;  2AF5 A;  3HOL A;  4YBP A;  3PH5 A;  2AT8 X;  4TLJ A;  4A1H A;  1MM9 A;  1SWJ A;  3APW A;  3FR2 A;  4CDE A;  1SWK A;  2FLJ A;  5HTE A;  4D6B A;  4O3X B;  3BX8 A;  4CPF A;  1KT5 A;  4GNY A;  4OS8 A;  3PK2 A;  4AYH A;  2FS7 A;  3P6G A;  4Y0P A;  5D8J A;  2L67 A;  1ADL A;  4IBA A;  5FFH A;  2IZF B;  2POA A;  1OEE A;  2RTQ B;  3VG5 A;  1VWN B;  2Y32 A;  1VWH B;  1SMP I;  3DSZ A;  3NAD A;  3S60 A;  2VFC A;  4AZQ A;  3FR5 A;  4O3Y A;  4OMW A;  2YMS A;  3SZH A;  3NPO A;  2IZD B;  4CPH A;  2DJF A;  2ZAI A;  4I9S A;  1U17 A;  4QQ1 A;  1VWF B;  3P6D A;  4Y59 A;  5IRU A;  3UEX A;  2I5Z O;  2L9C A;  4IAX A;  2MHD A;  2F01 A;  1VWK B;  4YBU A;  2ZAG A;  2O62 A;  4QNI A;  2BC3 A;  4A60 A;  1LFO A;  1PBO A;  2OFA A;  5KIC A;  1PEE A;  2Q39 A;  3VG2 A;  3ELZ A;  1GXA A;  1EXS A;  1QY2 A;  3NP1 A;  1I04 A;  1HN2 A;  4MVE A;  1SA8 A;  3VE1 A;  1HMS A;  4OKA A;  1N9M A;  3O22 A;  1H91 A;  2RN4 A;  4TKH A;  5EZ2 A;  5K67 A;  1SXW A;  5FAZ A;  1SRE A;  3U0D A;  4NYQ A;  1LIE A;  1MX7 A;  3F6Z B;  5CYB A;  5EED A;  2QM9 A;  1OEJ A;  1WBI A;  4N7D A;  3T1D A;  3HWE A;  4I9R A;  4L3R A;  4ZCB A;  2HMB A;  4O3Z A;  1AVD A;  1QFV A;  2CBS A;  3APX A;  2E4J A;  3PEC A;  2OF8 A;  4YKO A;  4YGH A;  1BSY A;  3FA6 A;  2M4L A;  2OY1 O;  4NW4 A;  1SWH A;  3AKM A;  1QY1 A;  3ZW2 A;  2A8G A;  1I9H A;  2CZU A;  3FLL A;  2HLV A;  3B2I A;  4FGI B;  5H9K A;  4OEM A;  3ZUO A;  1HBQ A;  4CV7 A;  5F58 A;  1Y9L A;  1HXZ A;  1RXK A;  2WPU A;  1IFB A;  3NR3 A;  1KQX A;  2WUT A;  2VFB A;  3FW4 A;  4LKT A;  5HZ6 A;  1DZK A;  3EC5 A;  1X8Q A;  2LB6 A;  2PI3 O;  5AEO A;  1W4T A;  2GTL O;  2X8S A;  3EM0 A;  5IO5 A;  5HZQ A;  1GX3 A;  1IKE A;  1MEP A;  4XMH A;  2FR3 A;  4WBK A;  1YWD A;  3RDU A;  2OFB A;  5HTD A;  1JMX A;  4YH0 A;  4IB9 A;  4GDZ A;  4FBV A;  2IZH B;  2RTN B;  1YWC A;  3MX7 A;  4KC7 A;  4GUZ A;  2AMM X;  3NQ3 A;  1NP4 A;  1HQP A;  3RBY A;  1U0X A;  2FRS A;  4ZH6 A;  1G7N A;  1A2D A;  1GT3 A;  1DZM A;  2AT0 X;  1G85 A;  3P6E A;  1KT4 A;  1X89 A;  3S26 A;  2AL0 X;  4O49 A;  2WQA E;  1SY0 A;  5FEN A;  2G78 A;  1LDO A;  3KFF A;  2UYW A;  3CR6 A;  5L8I A;  1B4M A;  1SWQ A;  1OBU A;  4CPH B;  1OEK A;  1L6M A;  1JBH A;  4IB6 A;  4GJS A;  1KT3 A;  4LZU A;  1MK5 A;  5JR8 A;  4DQ4 A;  5CE4 A;  5LJC A;  1GX9 A;  1SY3 A;  5L3Y A;  4QZT A;  4K19 A;  3CWK A;  1HMT A;  1SWO A;  2WR6 A;  2OZQ A;  3C76 X;  2RTM A;  2IZJ A;  2KW1 A;  3FEL A;  1DZJ A;  4U3Q A;  3VG7 A;  1SY2 A;  2A3F X;  3EW1 A;  3FW5 A;  4ID2 A;  1BRQ A;  1ALB A;  1GT1 A;  3ZWE A;  1VWL B;  1MDC A;  1X8O A;  1EAL A;  3BDR A;  2JU3 A;  2KTS A;  2OYB O;  1SLF B;  4QZU A;  2A5C A;  4QYP A;  3ZUI A;  1KXO A;  2IFB A;  4IMN A;  2JW1 A;  2OY5 O;  4A8Z A;  3TGC A;  5DG4 A;  5B5F A;  4Z28 A;  2WQ9 A;  1SXX A;  1KL5 A;  4EDE A;  4HPC A;  2G7B A;  1FEM A;  1NGL A;  2ACP X;  3MBT A;  2GTF X;  2JMB A;  4FQB B;  4O4S A;  4HPD A;  1LNM A;  1AB0 A;  3BSZ E;  1CBR A;  2RCT A;  3RDX A;  2KT4 B;  3STM X;  1OPA A;  5IXG A;  1SWB A;  2OF9 A;  3T2X A;  4GRJ A;  5BYP A;  5LJE A;  1FE3 A;  4PJ2 A;  5F2B A;  3S5X A;  3DTQ A;  3CMP A;  4LQZ A;  1SWR A;  4GK9 A;  5CSE A;  3H3I A;  3SLT A;  4BOE A;  1Y53 X;  2C4I A;  3UAQ A;  2A13 A;  3BLG A;  4YCE A;  2P8G A;  2A2G A;  1SWT A;  3OJY C;  4Y0R A;  1RBP A;  4GDA A;  3CKF A;  1SLE B;  1X8U A;  2RTO B;  3APU A;  3AUM O;  3K3L A;  1FTP A;  3V8U A;  1Y55 X;  1NQM A;  1QG5 A;  1SWF A;  2GJ5 A;  3QKG A;  2A5B A;  4IAB A;  4AZR A;  1QY0 A;  3PDF A;  2AH7 X;  4GNW A;  4I3D A;  5HBS A;  1GGL A;  1TW4 A;  1JJJ A;  3FA8 A;  1PBY A;  3ELX A;  1NDJ A;  3SLJ A;  1BSQ A;  2ACO A;  3KFI A;  4ZHD A;  1I78 A;  4QGX A;  3SZJ A;  1PTS A;  1YIV A;  4HFO A;  1OPB A;  4JO6 A;  3WZQ A;  4BJ8 A;  1DZP A;  4YDB A;  1GM6 A;  1LPJ A;  3EBW A;  3OBL A;  1ZNL A;  4TJZ A;  2FGS A;  4O4X A;  5H9N A;  1SWD A;  1HXL A;  1QWD A;  1B8E A;  1LEL A;  4GD9 A;  4L1N A;  5B2A O;  3FR4 A;  5EDB A;  1D2U A;  2QOM A;  3RE6 A;  1K24 A;  4CSB A;  4O4O A;  1YP7 A;  3RZY A;  3SLO A;  3BU9 A;  5IRA A;  1STS B;  2BLG A;  4YGZ A;  5H9L A;  1FEN A;  3T6L A;  2JU7 A;  3VG6 A;  3GAQ A;  2CM4 A;  1ZRY A;  5HA0 A;  4COT A;  5B3M O;  4GE1 A;  4WFV A;  1KZW A;  1ICM A;  2AVI A;  1SWA A;  2C1S A;  3BS2 A;  5FQ8 E;  5HWZ A;  1Y52 X;  2QO4 A;  2IZI A;  3B2K A;  1BEB A;  4QGW A;  5F6B A;  1JJX A;  1KGL A;  1GT4 A; 
#chains in the Genus database with same CATH homology
 1VWB B;  2IZC B;  3EW2 A;  2G5L A;  1MEP A;  4Z2P A;  4Y5D A;  1SWC A;  1KFF A;  1SWG A;  3RDU A;  2OFB A;  2RTL A;  1N7Y A;  4CPE A;  1RSU B;  2RTG B;  1MOY A;  4BX6 B;  4YVB A;  1VWD B;  2IZH B;  2RTN B;  4BX7 B;  1N4J A;  1STR B;  1N9Y A;  4IRW A;  1NC9 A;  2RTI B;  1VWP B;  3MM0 A;  3RDM A;  4Z6J A;  4CPI A;  2RTE B;  3WZN A;  4BX7 A;  4Z27 A;  1SRG A;  1LDO A;  2UYW A;  3T2W A;  1VWJ B;  4Z2O A;  4GGT A;  3RY1 A;  1SWQ A;  1NQN A;  2GH7 A;  2IZK A;  4CPH B;  3RDS A;  3VHM A;  1RAV A;  3T6F A;  4GJS A;  1MK5 A;  1KL3 A;  1LCV A;  2RTH B;  1VWQ B;  3WYQ A;  5L3Y A;  1SWU A;  4GJV A;  1HY2 A;  2IZB A;  1SWO A;  2Y3E A;  2CAM A;  2RTM A;  2IZJ A;  1VWM B;  1SWS A;  4EKV A;  3RE5 A;  4DNE A;  3EW1 A;  3RY2 A;  4BX5 B;  4GGR A;  1VWL B;  2QCB A;  3WZO A;  1SRJ A;  1STP A;  2JGS A;  5JD2 A;  1SLF B;  4JNJ A;  1VYO A;  2A5C A;  1KL4 A;  4BX6 A;  1MM9 A;  1SWJ A;  5K68 A;  1SWN A;  1VWO B;  1SWK A;  2IZL B;  5B5G A;  4Z28 A;  4CPF A;  5B5F A;  1KL5 A;  3PK2 A;  2C1Q A;  1AVE A;  3WZP A;  2MF6 A;  2IZF B;  3RDX A;  1LUQ A;  2RTQ B;  1VWN B;  2Y32 A;  1VWH B;  1SWB A;  1LCW A;  2OF9 A;  3T2X A;  3VGW A;  5F2B A;  3SZH A;  1SWR A;  5CSE A;  2IZD B;  2RTF B;  1SWL A;  1VWI B;  4CPH A;  2RTD B;  1NBX A;  4Z2V A;  2RTB B;  1VWF B;  4Y59 A;  5IRU A;  1Y53 X;  2C4I A;  3RDQ A;  3SZI A;  2Y3F A;  1SWT A;  1SWE A;  1VWE B;  4GDA A;  2RTA A;  1VWR B;  1SLE B;  2F01 A;  1VWK B;  2RTO B;  3FDC A;  5IRW A;  1Y55 X;  1NQM A;  1SWF A;  1VWA B;  2BC3 A;  2A5B A;  2IZE B;  2OFA A;  1SLG B;  4JHQ A;  4BX5 A;  1NDJ A;  1SWP A;  1VWG B;  1N9M A;  4OKA A;  5K67 A;  3SZJ A;  3RDO A;  1PTS A;  1N43 A;  3VHI A;  2FHN X;  1SRE A;  2RTK A;  2RTR B;  4BCS A;  4I60 A;  4JO6 A;  3WZQ A;  4BJ8 A;  1WBI A;  2RTJ A;  2RTP B;  5CHK A;  2FHL A;  1AVD A;  1SRF A;  1HXL A;  1RST B;  1SWD A;  1LEL A;  1LCZ A;  4GD9 A;  1SRH A;  3X00 A;  1RXH A;  1LDQ A;  2OF8 A;  3VHH A;  3RE6 A;  1VWC B;  3MG5 A;  2UZ2 A;  1SWH A;  4BBO A;  2A8G A;  1I9H A;  3T6L A;  5IRA A;  1STS B;  1SRI A;  2RTC B;  3WYP A;  1HQQ A;  1HXZ A;  1RXK A;  1DF8 A;  2WPU A;  4U46 A;  1IJ8 A;  2AVI A;  1SWA A;  2C1S A;  1Y52 X;  2IZI A;  2IZG B;  2ZSC A;  1SLD B;  2IZA A;  1RXJ A;  4GGZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...